5JSLA

The l16f mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jslA00
2YL7A 4JE9A 4L6RA 3FOOA 1YYXA 2XL8A 2XLEA 2XLWA 1CPQA 2XLMA 2XLDA 1MQVA 1E85A 4ULVA 4CDYA 3ZWIA 1BBHA 256BA 1A7VA 3C62A 3QW0A 4CIPA 1CPRA 3VRCA 5JT4A 2XLVA 2XM0A 2BC5A 1QPUA 5JRAA 4U9DA 2XM4A 1CGOA 1E83A 1APCA 3NMJA 3ZTMA 4ER9A 1YZAA 1S05A 3M4BA 4EIYA 4CDAA 4N6HA 1LM3B 4CJOA 5B3IA 3HNJA 4IAQA 2YL3A 3QW1A 3U8PA 3M15A 3ZQVA 4D4NA 3QVZA 4U9EA 4D4XA 2XLOA 4CX9A 3QVYA 5JSLA 3DE8A 2YLIA 3DE9A 1YYJA 3TOLA 2YL1A 3ZTZA 3TOMA 1QQ3A 3NMKA 2J9BA 3NMIA 3IQ6A 1M6TA 2YLGA 5JS5A 1GQAA 4JKVA 4NC3A 2YKZA 3L1MA 2YLDA 3C63A 3IQ5A 2QLAA 2XLHA 4IARA 4WGYA 3HNIA 4JEAA 2J8WA 4CJGA 1RCPA 4JEBA 3M79A 1YZCA 3ZQYA 3HNLA 4N4WA 4WGZA 5JLIA 2CCYA 1E86A 1EKYA 3FOPA 3HNKA 5JUAA 1JAFA 1E84A 1NBBA 5JVEA 1CGNA 4IB4A 5AGFA 2XL6A 5JP7A 2YL0A 3M4CA 4CDVA
chains in the Genus database with same CATH superfamily
2HMQA 3RFYA 3AOUA 3FOOA 1EA8A 1R5ID 1TFOB 4Q7CA 4I44A 3MX3A 5E33A 4LDQA 1D1CA 2OOCA 3JCUQ 3U8VA 2XLWA 1C17M 5DS4A 2J9UA 4O6MA 1CGME 5DVWA 3T6BA 2AWYA 5D91A 1VK5A 1RJ9B 5A6JA 1G5ZA 2WVQA 1E85A 1XZQA 1TQGA 1YLMA 2EPKX 4CDYA 3TULA 3FHDA 4IWBA 1A7VA 1NFOA 1WOLA 4KI2A 1Z6AA 3QW0A 1A0BA 1M2OA 3RVZA 1FTSA 3EGDA 2Y3BA 4J32B 2IXPA 5BQHA 3I5PA 5JT4A 2VASA 2DB4A 3RW0A 2XM0A 2PX0A 4YT2A 1QVXA 1XZPA 4R32A 4W8PA 1BZ4A 4HEAJ 2AP3A 3NRHA 4IJJA 2QNLA 1OQCA 1BR2A 5COGA 4XTKA 3CSKA 4Z9HA 3O55A 3SZRA 5L0DA 3POVA 3T4RA 5DLJA 1E83A 2MYSA 3DXJF 3LLKA 4HFFB 1WN0A 3S84A 2J7PA 3BEHA 3ZTMA 1S05A 4PACA 1DOVA 3ASNC 3M4BA 3KL4A 2KC3A 2RSEB 3BRJA 2HMZA 4N6CA 4MS2A 4RD9A 1UG7A 4YT5A 1I4ZA 3X2QC 5BUOA 2FAPB 5B3SC 3CZ6A 3L0IA 1G4WR 2O9XA 1YDIA 4CJOA 4EUKB 1ORYA 1NLXA 1H6GA 4YT8A 5CI8A 4BJ1A 4I1OB 1LE2A 2ZPAA 4WABA 3N24A 1PCXA 1OR2A 3K33A 3GORA 4JRZA 1KTMA 2IXMA 3F46A 4YT4A 3C8GB 1HW1A 3HJCA 1SF8A 4U5FE 4YL1A 4D4NA 1O87A 4E0HA 4JCHA 3X1OA 3DM5A 1LS4A 4E7ZA 2A6EF 2EPOA 3EGXA 2P7VA 2PNOA 3H65A 2LK4A 3U9JA 5DS6A 2XS1A 4UDVA 2VB6A 1J8YF 3F47A 4CX9A 4Z9IA 4C3DA 3DAFA 1FMWA 1I4YA 1D0YA 1YVIA 4B6IA 4CS8C 5AC5A 2J9VA 2R7VA 1FFTC 2H7BA 2YL1A 4U5BE 1J8MF 2WZFA 3TOMA 2LCHA 4DBQA 4KNWA 3O6XA 4MVOA 4KBLA 3MBGA 4U5HA 4XEKA 1V54C 2F22A 2Y39A 3G4XA 3RKOF 3T6JA 3WG7C 3K1IA 2Q9CA 3NMIA 4PJNA 4DRHB 1LS1A 2GA0A 5KYUB 4K0DA 1MMNA 1IW7F 1M6TA 1V4AA 2D5RB 3GEHA 3U0CA 4BG0A 4MTOA 3GM3A 3R7CA 2WVOA 1LPEA 2C04A 4BPMA 1FAPB 1JOGA 4CSAC 2R7SA 2XLHA 3B0PA 1OCCC 4P9FA 3RH3A 5IY5C 1TWHA 2J8WA 4CJGA 3M79A 2XL4A 3LESA 4CS8A 4XPYA 1D0XA 4JTAB 3R2PA 3Q6NA 4RDAA 1HMDA 2QE9A 1NZEA 2M4EA 2WZLA 2CCYA 3FAPB 1Q0DA 4FAPB 3T9OA 2Q7RA 3GANA 1EKYA 1Q0GA 2A0UA 1E2XA 3LLIA 3B9QA 1E84A 2EIJC 2HKVA 1NU7D 5TJ5E 1ZYRF 2HV6A 3E9VA 1KU2A 2HUJA 2LP4A 2WB7A 1S7ZA 2WL8A 3K1HA 3UMIA 2KK1A 2PF4E 2NUTB 3DJUB 1SR2A 3ABMC 3NYMA 1ORJA 1VLTA 3V5XA 5BQGA 4E18A 2QY9A 2XL6A 3KPHA 4CS9C 5JP7A 2YL0A 2IYLD 1D0ZA 2RD9A 2GFHA 2UUHA 3RF3A 4CDVA 5L0CA 4EHPA 2YZSA 4LERA 4JC7A 3C8GA 4ZLCA 5F5HA 5KYXB 2EILC 3A9CA 1OXKA 3PHF2 5GPGB 5B1BC 1NFNA 4C7OB 1CPQA 2BL2A 2CYDA 2IM8A 3DM9B 3NYLA 3FDQA 1RMVA 4EBKA 4KC9A 5E3CA 3ZWIA 3EHNA 4DRJB 3AQCA 3ABKC 4JW1A 3IPMO 1OCRC 3ABLC 1AVOB 5L0HA 3TD7A 4J7YA 4MTGA 2KSFA 3JTLO 3DAGA 2H7VC 5KYUA 2XLVA 3O10A 1MMGA 4AL1A 5D92A 4JZAA 2TMVP 2J7PD 2DGJA 3EPVA 1ZHWA 2G3KA 1ZU5A 4JCZA 1G8XA 1ZZPA 1ZHYA 3LNMB 4DOZA 1APCA 1LKXA 3NMJA 1SYQA 4HE8D 1ZVZA 1PV3A 4F4BA 3HTKC 3JRMO 4ER9A 5AC4A 1HE1A 1NSGB 3MYIA 1TR2A 4EIYA 2DYSC 1E86A 4G7OF 1C03A 3JYYA 1AUEA 3A11A 4CS7A 5F5FA 3K1IC 4LACB 2HJ3A 3FMSA 4AL0A 1LM3B 3LAYA 3H2UA 1OCOC 3OA1A 5T3WA 2AWCA 1T6IA 1VOMA 3TK0A 1OCZC 2A1DD 2HZ8A 2CDQA 2HS5A 3HNJA 2IOQA 3V7OA 4NY3A 4K1OA 2H8AA 2KQ9A 1HY5A 1O3UA 2NPUA 3ZQVA 4DBRA 3UGOA 2YVKA 2E87A 3V5ZA 4W8KA 2VCCA 3GM1A 4J7TA 2NUTA 1DOWA 1YA9A 4CS9A 2A69F 2B0JA 3TJ6A 2NSGA 2XLOA 1F1MA 4YWQA 4KNVA 3GWNA 1LI5A 1ZHXA 3DE8A 3ECSA 2AVKA 4M63A 3MLGA 1IZMA 1RKEB 4MVQA 1UFBA 2Q4FA 4AE4B 2A6HF 3NMKA 1GS9A 1TFKB 3JT1A 2J9BA 5KYXA 3W8IA 4X0RA 4K7BA 3W2WA 4DXWA 3IQ6A 4C7OA 2L7AA 2JD3A 3IQTA 2CNWA 5JS5A 5F28E 1V55C 2YQYA 2HSBA 4I3MA 3EH1A 4MVSA 3L1MA 2YLDA 3LJBA 1T6UA 5DQTA 3C63A 3IQ5A 2Y69C 3L8JA 1ZHTA 4JURI 4WGYA 1SMYF 5KYNA 4JEAA 2NG1A 3AGTA 2Q3TA 4Q4ZF 3GWLA 1A7DA 3LS0A 4JIOA 1YZCA 2J46A 1OXBA 3CEXA 3EHMA 4PFOA 4AK9A 1FMVA 2Y3GA 5FZTA 4OINF 2VCAA 5BQIA 5KYWB 4EWCA 1A7EA 3U3FA 1JR8A 5JUAA 5EGYA 3TQOA 1Q0KA 4BJ5A 3IQCA 3JSZA 4JJGA 3Q6MA 5B1AC 2YEVA 3S90A 3SXYA 2JX0A 2L6FA 3S28A 5DQZA 1YARO 1WATA 3DD7A 4Z9JA 1RJ9A 2R25A 4HFKB 3W8HA 5EHHA 3C8GD 4BEJA 2GAQA 3B29A 1R4TA 4MVMA 1QLEC 2YHSA 2ICWG 3T6GB 1TWGA 3KYJA 3UNGC 5E2QA 1QSPA 2YL7A 4L6RA 1OW6A 4PR9A 2X0CA 3G4ZA 2XLEA 4BJTA 4BEMJ 1GGQA 1WTYA 3AGUA 4XWJA 4XPWA 2NSFA 1T6QA 5L3QA 4MVUA 2Q9AA 3DKAA 5DS5A 2HJMA 1N1CA 4XLPF 4BJ6A 5EK0A 1HW2A 4PJLA 1BBHA 1D1BA 1G4US 1RKEA 1W2WA 2Y3DA 3GODA 4J30B 3US6A 4DRIB 5HV9A 2L81A 4AE4A 2V3CC 3KMIA 4YJWA 3B0UX 1CPRA 1JMWA 4ONSA 4OIQF 1Z3IX 1TWAA 2MWQA 2LIGA 2W9YA 3U2LA 2BC5A 2I8BA 1QPUA 3N0TA 5JRAA 2R02A 3JSEO 2XM4A 2VC9A 4FX5A 1CGOA 3QTHA 4XPXA 3EFOB 1JRAA 4E17A 3OWTA 4LDKA 2OU6A 1GM5A 2L6GA 4XEFA 1VYIA 2EPMX 4OIPF 5FCLA 5CI9A 4CDAA 5L0IA 1OR3A 2ZD9A 3G50A 4N6HA 4XLNF 2R03A 3SXKA 2P61A 2Q00A 2A0BA 2Q9BA 2WZGA 3MYFA 5A69A 5KYWA 2QTVA 2OCCC 1Y6DA 3NDBB 3WAQA 4IAQA 3QW1A 4U5DE 3U8PA 1VMAA 4U5EE 4LLCA 3IHUA 4MVRA 3QVZA 2PP4A 2R7QA 2Z15A 4MTFA 1KNYA 2IXOA 2KGOA 1XWJA 2XS8A 4ANJA 1V74B 1HMOA 1Z5ZA 4DJ9A 2EIKC 2HFIA 3QVYA 3CAXA 3WODF 5A6KA 2P6VA 1YA7O 2C03A 1WGWA 2JPUA 2OQMA 1QKRA 1O5HA 3DJNB 3I5QA 4GQHA 3VM6A 2CNWD 3ZTZA 1QQ3A 2PFDA 3U3BA 3U5SA 1OW8A 4BJ5C 1Q0FA 2GDCA 3AG4C 4YL3A 3CQZA 3RQGA 1BR4A 2DYRC 3HLZA 1LE4A 5COMA 2YLGA 1NG1A 3DMDA 5CIVA 2OEVA 1GQAA 4NC3A 3H2VA 3Q7GA 3DZAA 1Z23A 1WASA 2ZXPA 2YKZA 1ORSC 4IAOA 2G3VA 1EQ1A 3ASOC 5COFA 2QLAA 1PD1A 2D4UA 4IARA 1U6HA 1TKNA 2VCBA 4NTFA 4NTBA 4PK4A 1A41A 2VH3A 4QI0A 4RBNA 3HKKA 4YL0A 4OIOF 5HSWA 1RCPA 3EJNA 2XXAB 5T3TA 2R7WA 1MMDA 3HNLA 4U5GA 4N4WA 1WWPA 2L6HA 4WGZA 3TJ5A 2BE5F 3WHNA 4JTCB 1BDJB 3JRTA 1K05A 2ZXRA 4JTDB 4BJ6C 3HNKA 4JJFA 3AJMA 4H54A 1JAFA 2LFFA 3EFOA 3IEEA 4AX2A 3AG3C 3W2VA 1NBBA 4DVZA 3KKBA 2R7TA 5JVEA 5A6BA 2V26A 1Z63A 4NCQA 2W45A 3VAYA 4IB4A 3O39A 3ITFA 4A4AA 5T1DB 4G0HA 3UR3C 3Q7LA 1JPNA 4ZLDA 3QZCA 4DVYP 1VLSA 3PMRA 4MVZA 2HSQA 3M4CA 5K0IA 4QI2A 3U2MA 1FR0A 4H4KC 1AEPA 2H7OA 1RXQA 3ZC4A 1ST6A 3EH2A 5E3AA 4JE9A 3S29A 3B0VC 1YYXA 2GWWA 2XL8A 3SP1A 3SYNA 4MNDA 3UMKA 3M1CB 2LSEA 1PD0A 3AG2C 1OKKA 3RVYA 3SXZA 4EBJA 4YK5A 4OD4A 2OJQA 2PBEA 3DI5A 2OEXA 2XLMA 4G7ZF 1FNTc 2XLDA 1YAUO 3C8ZA 1ZW2A 3JZ0A 2P1AA 3ZVRA 4CIHA 1MQVA 2EPNA 3JYHA 4NTAA 4ULVA 1T9KA 3GEEA 2G62A 3SNHA 3ZSUA 2YRFA 1MNDA 256BA 5KYYB 3C62A 3U9MA 1VB5A 4CIPA 2P0NA 3RQEA 3VRCA 3PDMP 4FESA 4QDLA 2KNHA 1Z7Qc 1MMAA 1K40A 4C3BA 1Y4CA 2FFHA 4N06A 4U9DA 1H9TA 2I15A 5L0JA 4XQ1A 4GYTA 4Q5SF 1I5NA 1M2VB 1YJGA 2ZXWC 3K6BA 3NKDA 1L7CA 1T01A 1MNEA 1YZAA 3L34A 1M56C 4G7HF 3W4YA 3EZIA 3EG9B 4C3EA 2XRHA 2R7XA 1Q0MA 1LVKA 2XXAA 2L9JA 4IGGA 2R9RB 3ZIBA 2AU5A 2J0WA 5B3IA 1TWCA 2W4MA 2NUPB 3L8IA 4EKWA 2EINC 2J0XA 2YL3A 3N2ZB 3M15A 4XEVA 4ULWA 5L0GA 3GEIA 3V5YA 4CBEA 2W4BA 1VTMP 2XSEA 4U9EA 2R7RA 3C18A 4D4XA 4LDRA 4O6NA 3AG1C 2QUPA 4O79A 4PJMA 5JSLA 2YLIA 2HV7A 3C7JA 3DE9A 4NQFA 1YYJA 1VYKA 2J45A 2KYHA 1NU9C 3FVYA 3RIPA 3TOLA 3UMHA 3SXMA 3VYWA 3LNRA 3OEOA 3EGDB 2DI3A 3B71A 3NYJA 4GEHA 1K04A 3FAJA 3E70C 1B68A 2ETSA 2IBFA 3S9OA 2MHRA 3J06A 4A2NB 2M64A 3EQLF 1ZU4A 1QZXA 4JKVA 4MQ9F 2R7UA 4LLEA 1M57C 2LD6A 1U0BB 1ZW3A 2FGYA 3NG1A 4E7SA 3RYLA 2R05A 3QMKA 2R7OA 1HE9A 3ZDLA 1RKCA 2CW0F 3HNIA 5L0FA 5KYYA 1JPJA 3GM2A 3KH2A 1LIHA 3FXHA 3LEVA 4MW3A 4JEBA 1T5OA 2KJGA 1ZHZA 4G78A 1U89A 4JVSA 4P9TA 3ZG1A 3ZQYA 1FFHA 2EIMC 3S27A 5JLIA 4IRUA 4MW8A 2J9WA 2OG2A 3LS1A 4O6YA 5A6BD 2IXNA 1D1AA 1H7IA 3NKEA 2ZXOA 2OKUA 1EI7A 2YWAA 2UUIA 2PX3A 3EZHA 3FOPA 1M2VA 2X51A 4OIRF 3I4UA 4WJ0A 2LQGA 3LEOA 2OJED 3PCVA 2A68F 4FWVA 3SEOA 3UGPA 1CGNA 4P6IC 1L3PA 2CGEA 1BR1A 3EG9A 3LUTB 3EGXB 3KYIA 4I1MA 4YN0B 3DWWA 3RQFA 1SZIA 4OD5A 5AGFA 2EPLX 3S0XA 3AQBA 2Y3HA 5L3VA 2WVNA 4E0IA 5A6AA 1H9GA 1C02A 3K7DA 2B0HA 1LI7A 2KW3C 2LFDA 3MFNA 3K66A 1OKKD 4PJJA 4PFPA 1OW7A 2NUPA 4EBBA 4CSAA 4U5CE 2ASRA 4O7GA 3ATPA 3VF0A
chains in the Genus database with same CATH topology
2YL7A 4JE9A 4L6RA 3FOOA 1YYXA 2XL8A 2XLEA 2XLWA 1CPQA 2XLMA 2XLDA 1MQVA 1E85A 4ULVA 4CDYA 3ZWIA 1BBHA 256BA 1A7VA 3C62A 3QW0A 4CIPA 1CPRA 3VRCA 5JT4A 2XLVA 2XM0A 2BC5A 1QPUA 5JRAA 4U9DA 2XM4A 1CGOA 1E83A 1APCA 3NMJA 3ZTMA 4ER9A 1YZAA 1S05A 3M4BA 4EIYA 4CDAA 4N6HA 1LM3B 4CJOA 5B3IA 3HNJA 4IAQA 2YL3A 3QW1A 3U8PA 3M15A 3ZQVA 4D4NA 3QVZA 4U9EA 4D4XA 2XLOA 4CX9A 3QVYA 5JSLA 3DE8A 2YLIA 3DE9A 1YYJA 3TOLA 2YL1A 3ZTZA 3TOMA 1QQ3A 3NMKA 2J9BA 3NMIA 3IQ6A 1M6TA 2YLGA 5JS5A 1GQAA 4JKVA 4NC3A 2YKZA 3L1MA 2YLDA 3C63A 3IQ5A 2QLAA 2XLHA 4IARA 4WGYA 3HNIA 4JEAA 2J8WA 4CJGA 1RCPA 4JEBA 3M79A 1YZCA 3ZQYA 3HNLA 4N4WA 4WGZA 5JLIA 2CCYA 1E86A 1EKYA 3FOPA 3HNKA 5JUAA 1JAFA 1E84A 1NBBA 5JVEA 1CGNA 4IB4A 5AGFA 2XL6A 5JP7A 2YL0A 3M4CA 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL7 A;  4JE9 A;  4L6R A;  3FOO A;  1YYX A;  2XL8 A;  2XLE A;  2XLW A;  1CPQ A;  2XLM A;  2XLD A;  1MQV A;  1E85 A;  4ULV A;  4CDY A;  3ZWI A;  1BBH A;  256B A;  1A7V A;  3C62 A;  3QW0 A;  4CIP A;  1CPR A;  3VRC A;  5JT4 A;  2XLV A;  2XM0 A;  2BC5 A;  1QPU A;  5JRA A;  4U9D A;  2XM4 A;  1CGO A;  1E83 A;  1APC A;  3NMJ A;  3ZTM A;  4ER9 A;  1YZA A;  1S05 A;  3M4B A;  4EIY A;  4CDA A;  4N6H A;  1LM3 B;  4CJO A;  5B3I A;  3HNJ A;  4IAQ A;  2YL3 A;  3QW1 A;  3U8P A;  3M15 A;  3ZQV A;  4D4N A;  3QVZ A;  4U9E A;  4D4X A;  2XLO A;  4CX9 A;  3QVY A;  5JSL A;  3DE8 A;  2YLI A;  3DE9 A;  1YYJ A;  3TOL A;  2YL1 A;  3ZTZ A;  3TOM A;  1QQ3 A;  3NMK A;  2J9B A;  3NMI A;  3IQ6 A;  1M6T A;  2YLG A;  5JS5 A;  1GQA A;  4JKV A;  4NC3 A;  2YKZ A;  3L1M A;  2YLD A;  3C63 A;  3IQ5 A;  2QLA A;  2XLH A;  4IAR A;  4WGY A;  3HNI A;  4JEA A;  2J8W A;  4CJG A;  1RCP A;  4JEB A;  3M79 A;  1YZC A;  3ZQY A;  3HNL A;  4N4W A;  4WGZ A;  5JLI A;  2CCY A;  1E86 A;  1EKY A;  3FOP A;  3HNK A;  5JUA A;  1JAF A;  1E84 A;  1NBB A;  5JVE A;  1CGN A;  4IB4 A;  5AGF A;  2XL6 A;  5JP7 A;  2YL0 A;  3M4C A;  4CDV A; 
#chains in the Genus database with same CATH topology
 2HMQ A;  3RFY A;  3AOU A;  3FOO A;  1EA8 A;  1R5I D;  1TFO B;  4Q7C A;  4I44 A;  3MX3 A;  5E33 A;  4LDQ A;  1D1C A;  2OOC A;  3JCU Q;  3U8V A;  2XLW A;  1C17 M;  5DS4 A;  2J9U A;  4O6M A;  1CGM E;  5DVW A;  3T6B A;  2AWY A;  5D91 A;  1VK5 A;  1RJ9 B;  5A6J A;  1G5Z A;  2WVQ A;  1E85 A;  1XZQ A;  1TQG A;  1YLM A;  2EPK X;  4CDY A;  3TUL A;  3FHD A;  4IWB A;  1A7V A;  1NFO A;  1WOL A;  4KI2 A;  1Z6A A;  3QW0 A;  1A0B A;  1M2O A;  3RVZ A;  1FTS A;  3EGD A;  2Y3B A;  4J32 B;  2IXP A;  5BQH A;  3I5P A;  5JT4 A;  2VAS A;  2DB4 A;  3RW0 A;  2XM0 A;  2PX0 A;  4YT2 A;  1QVX A;  1XZP A;  4R32 A;  4W8P A;  1BZ4 A;  4HEA J;  2AP3 A;  3NRH A;  4IJJ A;  2QNL A;  1OQC A;  1BR2 A;  5COG A;  4XTK A;  3CSK A;  4Z9H A;  3O55 A;  3SZR A;  5L0D A;  3POV A;  3T4R A;  5DLJ A;  1E83 A;  2MYS A;  3DXJ F;  3LLK A;  4HFF B;  1WN0 A;  3S84 A;  2J7P A;  3BEH A;  3ZTM A;  1S05 A;  4PAC A;  1DOV A;  3ASN C;  3M4B A;  3KL4 A;  2KC3 A;  2RSE B;  3BRJ A;  2HMZ A;  4N6C A;  4MS2 A;  4RD9 A;  1UG7 A;  4YT5 A;  1I4Z A;  3X2Q C;  5BUO A;  2FAP B;  5B3S C;  3CZ6 A;  3L0I A;  1G4W R;  2O9X A;  1YDI A;  4CJO A;  4EUK B;  1ORY A;  1NLX A;  1H6G A;  4YT8 A;  5CI8 A;  4BJ1 A;  4I1O B;  1LE2 A;  2ZPA A;  4WAB A;  3N24 A;  1PCX A;  1OR2 A;  3K33 A;  3GOR A;  4JRZ A;  1KTM A;  2IXM A;  3F46 A;  4YT4 A;  3C8G B;  1HW1 A;  3HJC A;  1SF8 A;  4U5F E;  4YL1 A;  4D4N A;  1O87 A;  4E0H A;  4JCH A;  3X1O A;  3DM5 A;  1LS4 A;  4E7Z A;  2A6E F;  2EPO A;  3EGX A;  2P7V A;  2PNO A;  3H65 A;  2LK4 A;  3U9J A;  5DS6 A;  2XS1 A;  4UDV A;  2VB6 A;  1J8Y F;  3F47 A;  4CX9 A;  4Z9I A;  4C3D A;  3DAF A;  1FMW A;  1I4Y A;  1D0Y A;  1YVI A;  4B6I A;  4CS8 C;  5AC5 A;  2J9V A;  2R7V A;  1FFT C;  2H7B A;  2YL1 A;  4U5B E;  1J8M F;  2WZF A;  3TOM A;  2LCH A;  4DBQ A;  4KNW A;  3O6X A;  4MVO A;  4KBL A;  3MBG A;  4U5H A;  4XEK A;  1V54 C;  2F22 A;  2Y39 A;  3G4X A;  3RKO F;  3T6J A;  3WG7 C;  3K1I A;  2Q9C A;  3NMI A;  4PJN A;  4DRH B;  1LS1 A;  2GA0 A;  5KYU B;  4K0D A;  1MMN A;  1IW7 F;  1M6T A;  1V4A A;  2D5R B;  3GEH A;  3U0C A;  4BG0 A;  4MTO A;  3GM3 A;  3R7C A;  2WVO A;  1LPE A;  2C04 A;  4BPM A;  1FAP B;  1JOG A;  4CSA C;  2R7S A;  2XLH A;  3B0P A;  1OCC C;  4P9F A;  3RH3 A;  5IY5 C;  1TWH A;  2J8W A;  4CJG A;  3M79 A;  2XL4 A;  3LES A;  4CS8 A;  4XPY A;  1D0X A;  4JTA B;  3R2P A;  3Q6N A;  4RDA A;  1HMD A;  2QE9 A;  1NZE A;  2M4E A;  2WZL A;  2CCY A;  3FAP B;  1Q0D A;  4FAP B;  3T9O A;  2Q7R A;  3GAN A;  1EKY A;  1Q0G A;  2A0U A;  1E2X A;  3LLI A;  3B9Q A;  1E84 A;  2EIJ C;  2HKV A;  1NU7 D;  5TJ5 E;  1ZYR F;  2HV6 A;  3E9V A;  1KU2 A;  2HUJ A;  2LP4 A;  2WB7 A;  1S7Z A;  2WL8 A;  3K1H A;  3UMI A;  2KK1 A;  2PF4 E;  2NUT B;  3DJU B;  1SR2 A;  3ABM C;  3NYM A;  1ORJ A;  1VLT A;  3V5X A;  5BQG A;  4E18 A;  2QY9 A;  2XL6 A;  3KPH A;  4CS9 C;  5JP7 A;  2YL0 A;  2IYL D;  1D0Z A;  2RD9 A;  2GFH A;  2UUH A;  3RF3 A;  4CDV A;  5L0C A;  4EHP A;  2YZS A;  4LER A;  4JC7 A;  3C8G A;  4ZLC A;  5F5H A;  5KYX B;  2EIL C;  3A9C A;  1OXK A;  3PHF 2;  5GPG B;  5B1B C;  1NFN A;  4C7O B;  1CPQ A;  2BL2 A;  2CYD A;  2IM8 A;  3DM9 B;  3NYL A;  3FDQ A;  1RMV A;  4EBK A;  4KC9 A;  5E3C A;  3ZWI A;  3EHN A;  4DRJ B;  3AQC A;  3ABK C;  4JW1 A;  3IPM O;  1OCR C;  3ABL C;  1AVO B;  5L0H A;  3TD7 A;  4J7Y A;  4MTG A;  2KSF A;  3JTL O;  3DAG A;  2H7V C;  5KYU A;  2XLV A;  3O10 A;  1MMG A;  4AL1 A;  5D92 A;  4JZA A;  2TMV P;  2J7P D;  2DGJ A;  3EPV A;  1ZHW A;  2G3K A;  1ZU5 A;  4JCZ A;  1G8X A;  1ZZP A;  1ZHY A;  3LNM B;  4DOZ A;  1APC A;  1LKX A;  3NMJ A;  1SYQ A;  4HE8 D;  1ZVZ A;  1PV3 A;  4F4B A;  3HTK C;  3JRM O;  4ER9 A;  5AC4 A;  1HE1 A;  1NSG B;  3MYI A;  1TR2 A;  4EIY A;  2DYS C;  1E86 A;  4G7O F;  1C03 A;  3JYY A;  1AUE A;  3A11 A;  4CS7 A;  5F5F A;  3K1I C;  4LAC B;  2HJ3 A;  3FMS A;  4AL0 A;  1LM3 B;  3LAY A;  3H2U A;  1OCO C;  3OA1 A;  5T3W A;  2AWC A;  1T6I A;  1VOM A;  3TK0 A;  1OCZ C;  2A1D D;  2HZ8 A;  2CDQ A;  2HS5 A;  3HNJ A;  2IOQ A;  3V7O A;  4NY3 A;  4K1O A;  2H8A A;  2KQ9 A;  1HY5 A;  1O3U A;  2NPU A;  3ZQV A;  4DBR A;  3UGO A;  2YVK A;  2E87 A;  3V5Z A;  4W8K A;  2VCC A;  3GM1 A;  4J7T A;  2NUT A;  1DOW A;  1YA9 A;  4CS9 A;  2A69 F;  2B0J A;  3TJ6 A;  2NSG A;  2XLO A;  1F1M A;  4YWQ A;  4KNV A;  3GWN A;  1LI5 A;  1ZHX A;  3DE8 A;  3ECS A;  2AVK A;  4M63 A;  3MLG A;  1IZM A;  1RKE B;  4MVQ A;  1UFB A;  2Q4F A;  4AE4 B;  2A6H F;  3NMK A;  1GS9 A;  1TFK B;  3JT1 A;  2J9B A;  5KYX A;  3W8I A;  4X0R A;  4K7B A;  3W2W A;  4DXW A;  3IQ6 A;  4C7O A;  2L7A A;  2JD3 A;  3IQT A;  2CNW A;  5JS5 A;  5F28 E;  1V55 C;  2YQY A;  2HSB A;  4I3M A;  3EH1 A;  4MVS A;  3L1M A;  2YLD A;  3LJB A;  1T6U A;  5DQT A;  3C63 A;  3IQ5 A;  2Y69 C;  3L8J A;  1ZHT A;  4JUR I;  4WGY A;  1SMY F;  5KYN A;  4JEA A;  2NG1 A;  3AGT A;  2Q3T A;  4Q4Z F;  3GWL A;  1A7D A;  3LS0 A;  4JIO A;  1YZC A;  2J46 A;  1OXB A;  3CEX A;  3EHM A;  4PFO A;  4AK9 A;  1FMV A;  2Y3G A;  5FZT A;  4OIN F;  2VCA A;  5BQI A;  5KYW B;  4EWC A;  1A7E A;  3U3F A;  1JR8 A;  5JUA A;  5EGY A;  3TQO A;  1Q0K A;  4BJ5 A;  3IQC A;  3JSZ A;  4JJG A;  3Q6M A;  5B1A C;  2YEV A;  3S90 A;  3SXY A;  2JX0 A;  2L6F A;  3S28 A;  5DQZ A;  1YAR O;  1WAT A;  3DD7 A;  4Z9J A;  1RJ9 A;  2R25 A;  4HFK B;  3W8H A;  5EHH A;  3C8G D;  4BEJ A;  2GAQ A;  3B29 A;  1R4T A;  4MVM A;  1QLE C;  2YHS A;  2ICW G;  3T6G B;  1TWG A;  3KYJ A;  3UNG C;  5E2Q A;  1QSP A;  2YL7 A;  4L6R A;  1OW6 A;  4PR9 A;  2X0C A;  3G4Z A;  2XLE A;  4BJT A;  4BEM J;  1GGQ A;  1WTY A;  3AGU A;  4XWJ A;  4XPW A;  2NSF A;  1T6Q A;  5L3Q A;  4MVU A;  2Q9A A;  3DKA A;  5DS5 A;  2HJM A;  1N1C A;  4XLP F;  4BJ6 A;  5EK0 A;  1HW2 A;  4PJL A;  1BBH A;  1D1B A;  1G4U S;  1RKE A;  1W2W A;  2Y3D A;  3GOD A;  4J30 B;  3US6 A;  4DRI B;  5HV9 A;  2L81 A;  4AE4 A;  2V3C C;  3KMI A;  4YJW A;  3B0U X;  1CPR A;  1JMW A;  4ONS A;  4OIQ F;  1Z3I X;  1TWA A;  2MWQ A;  2LIG A;  2W9Y A;  3U2L A;  2BC5 A;  2I8B A;  1QPU A;  3N0T A;  5JRA A;  2R02 A;  3JSE O;  2XM4 A;  2VC9 A;  4FX5 A;  1CGO A;  3QTH A;  4XPX A;  3EFO B;  1JRA A;  4E17 A;  3OWT A;  4LDK A;  2OU6 A;  1GM5 A;  2L6G A;  4XEF A;  1VYI A;  2EPM X;  4OIP F;  5FCL A;  5CI9 A;  4CDA A;  5L0I A;  1OR3 A;  2ZD9 A;  3G50 A;  4N6H A;  4XLN F;  2R03 A;  3SXK A;  2P61 A;  2Q00 A;  2A0B A;  2Q9B A;  2WZG A;  3MYF A;  5A69 A;  5KYW A;  2QTV A;  2OCC C;  1Y6D A;  3NDB B;  3WAQ A;  4IAQ A;  3QW1 A;  4U5D E;  3U8P A;  1VMA A;  4U5E E;  4LLC A;  3IHU A;  4MVR A;  3QVZ A;  2PP4 A;  2R7Q A;  2Z15 A;  4MTF A;  1KNY A;  2IXO A;  2KGO A;  1XWJ A;  2XS8 A;  4ANJ A;  1V74 B;  1HMO A;  1Z5Z A;  4DJ9 A;  2EIK C;  2HFI A;  3QVY A;  3CAX A;  3WOD F;  5A6K A;  2P6V A;  1YA7 O;  2C03 A;  1WGW A;  2JPU A;  2OQM A;  1QKR A;  1O5H A;  3DJN B;  3I5Q A;  4GQH A;  3VM6 A;  2CNW D;  3ZTZ A;  1QQ3 A;  2PFD A;  3U3B A;  3U5S A;  1OW8 A;  4BJ5 C;  1Q0F A;  2GDC A;  3AG4 C;  4YL3 A;  3CQZ A;  3RQG A;  1BR4 A;  2DYR C;  3HLZ A;  1LE4 A;  5COM A;  2YLG A;  1NG1 A;  3DMD A;  5CIV A;  2OEV A;  1GQA A;  4NC3 A;  3H2V A;  3Q7G A;  3DZA A;  1Z23 A;  1WAS A;  2ZXP A;  2YKZ A;  1ORS C;  4IAO A;  2G3V A;  1EQ1 A;  3ASO C;  5COF A;  2QLA A;  1PD1 A;  2D4U A;  4IAR A;  1U6H A;  1TKN A;  2VCB A;  4NTF A;  4NTB A;  4PK4 A;  1A41 A;  2VH3 A;  4QI0 A;  4RBN A;  3HKK A;  4YL0 A;  4OIO F;  5HSW A;  1RCP A;  3EJN A;  2XXA B;  5T3T A;  2R7W A;  1MMD A;  3HNL A;  4U5G A;  4N4W A;  1WWP A;  2L6H A;  4WGZ A;  3TJ5 A;  2BE5 F;  3WHN A;  4JTC B;  1BDJ B;  3JRT A;  1K05 A;  2ZXR A;  4JTD B;  4BJ6 C;  3HNK A;  4JJF A;  3AJM A;  4H54 A;  1JAF A;  2LFF A;  3EFO A;  3IEE A;  4AX2 A;  3AG3 C;  3W2V A;  1NBB A;  4DVZ A;  3KKB A;  2R7T A;  5JVE A;  5A6B A;  2V26 A;  1Z63 A;  4NCQ A;  2W45 A;  3VAY A;  4IB4 A;  3O39 A;  3ITF A;  4A4A A;  5T1D B;  4G0H A;  3UR3 C;  3Q7L A;  1JPN A;  4ZLD A;  3QZC A;  4DVY P;  1VLS A;  3PMR A;  4MVZ A;  2HSQ A;  3M4C A;  5K0I A;  4QI2 A;  3U2M A;  1FR0 A;  4H4K C;  1AEP A;  2H7O A;  1RXQ A;  3ZC4 A;  1ST6 A;  3EH2 A;  5E3A A;  4JE9 A;  3S29 A;  3B0V C;  1YYX A;  2GWW A;  2XL8 A;  3SP1 A;  3SYN A;  4MND A;  3UMK A;  3M1C B;  2LSE A;  1PD0 A;  3AG2 C;  1OKK A;  3RVY A;  3SXZ A;  4EBJ A;  4YK5 A;  4OD4 A;  2OJQ A;  2PBE A;  3DI5 A;  2OEX A;  2XLM A;  4G7Z F;  1FNT c;  2XLD A;  1YAU O;  3C8Z A;  1ZW2 A;  3JZ0 A;  2P1A A;  3ZVR A;  4CIH A;  1MQV A;  2EPN A;  3JYH A;  4NTA A;  4ULV A;  1T9K A;  3GEE A;  2G62 A;  3SNH A;  3ZSU A;  2YRF A;  1MND A;  256B A;  5KYY B;  3C62 A;  3U9M A;  1VB5 A;  4CIP A;  2P0N A;  3RQE A;  3VRC A;  3PDM P;  4FES A;  4QDL A;  2KNH A;  1Z7Q c;  1MMA A;  1K40 A;  4C3B A;  1Y4C A;  2FFH A;  4N06 A;  4U9D A;  1H9T A;  2I15 A;  5L0J A;  4XQ1 A;  4GYT A;  4Q5S F;  1I5N A;  1M2V B;  1YJG A;  2ZXW C;  3K6B A;  3NKD A;  1L7C A;  1T01 A;  1MNE A;  1YZA A;  3L34 A;  1M56 C;  4G7H F;  3W4Y A;  3EZI A;  3EG9 B;  4C3E A;  2XRH A;  2R7X A;  1Q0M A;  1LVK A;  2XXA A;  2L9J A;  4IGG A;  2R9R B;  3ZIB A;  2AU5 A;  2J0W A;  5B3I A;  1TWC A;  2W4M A;  2NUP B;  3L8I A;  4EKW A;  2EIN C;  2J0X A;  2YL3 A;  3N2Z B;  3M15 A;  4XEV A;  4ULW A;  5L0G A;  3GEI A;  3V5Y A;  4CBE A;  2W4B A;  1VTM P;  2XSE A;  4U9E A;  2R7R A;  3C18 A;  4D4X A;  4LDR A;  4O6N A;  3AG1 C;  2QUP A;  4O79 A;  4PJM A;  5JSL A;  2YLI A;  2HV7 A;  3C7J A;  3DE9 A;  4NQF A;  1YYJ A;  1VYK A;  2J45 A;  2KYH A;  1NU9 C;  3FVY A;  3RIP A;  3TOL A;  3UMH A;  3SXM A;  3VYW A;  3LNR A;  3OEO A;  3EGD B;  2DI3 A;  3B71 A;  3NYJ A;  4GEH A;  1K04 A;  3FAJ A;  3E70 C;  1B68 A;  2ETS A;  2IBF A;  3S9O A;  2MHR A;  3J06 A;  4A2N B;  2M64 A;  3EQL F;  1ZU4 A;  1QZX A;  4JKV A;  4MQ9 F;  2R7U A;  4LLE A;  1M57 C;  2LD6 A;  1U0B B;  1ZW3 A;  2FGY A;  3NG1 A;  4E7S A;  3RYL A;  2R05 A;  3QMK A;  2R7O A;  1HE9 A;  3ZDL A;  1RKC A;  2CW0 F;  3HNI A;  5L0F A;  5KYY A;  1JPJ A;  3GM2 A;  3KH2 A;  1LIH A;  3FXH A;  3LEV A;  4MW3 A;  4JEB A;  1T5O A;  2KJG A;  1ZHZ A;  4G78 A;  1U89 A;  4JVS A;  4P9T A;  3ZG1 A;  3ZQY A;  1FFH A;  2EIM C;  3S27 A;  5JLI A;  4IRU A;  4MW8 A;  2J9W A;  2OG2 A;  3LS1 A;  4O6Y A;  5A6B D;  2IXN A;  1D1A A;  1H7I A;  3NKE A;  2ZXO A;  2OKU A;  1EI7 A;  2YWA A;  2UUI A;  2PX3 A;  3EZH A;  3FOP A;  1M2V A;  2X51 A;  4OIR F;  3I4U A;  4WJ0 A;  2LQG A;  3LEO A;  2OJE D;  3PCV A;  2A68 F;  4FWV A;  3SEO A;  3UGP A;  1CGN A;  4P6I C;  1L3P A;  2CGE A;  1BR1 A;  3EG9 A;  3LUT B;  3EGX B;  3KYI A;  4I1M A;  4YN0 B;  3DWW A;  3RQF A;  1SZI A;  4OD5 A;  5AGF A;  2EPL X;  3S0X A;  3AQB A;  2Y3H A;  5L3V A;  2WVN A;  4E0I A;  5A6A A;  1H9G A;  1C02 A;  3K7D A;  2B0H A;  1LI7 A;  2KW3 C;  2LFD A;  3MFN A;  3K66 A;  1OKK D;  4PJJ A;  4PFP A;  1OW7 A;  2NUP A;  4EBB A;  4CSA A;  4U5C E;  2ASR A;  4O7G A;  3ATP A;  3VF0 A; 
#chains in the Genus database with same CATH homology
 2YL7 A;  4JE9 A;  4L6R A;  3FOO A;  1YYX A;  2XL8 A;  2XLE A;  2XLW A;  1CPQ A;  2XLM A;  2XLD A;  1MQV A;  1E85 A;  4ULV A;  4CDY A;  3ZWI A;  1BBH A;  256B A;  1A7V A;  3C62 A;  3QW0 A;  4CIP A;  1CPR A;  3VRC A;  5JT4 A;  2XLV A;  2XM0 A;  2BC5 A;  1QPU A;  5JRA A;  4U9D A;  2XM4 A;  1CGO A;  1E83 A;  1APC A;  3NMJ A;  3ZTM A;  4ER9 A;  1YZA A;  1S05 A;  3M4B A;  4EIY A;  4CDA A;  4N6H A;  1LM3 B;  4CJO A;  5B3I A;  3HNJ A;  4IAQ A;  2YL3 A;  3QW1 A;  3U8P A;  3M15 A;  3ZQV A;  4D4N A;  3QVZ A;  4U9E A;  4D4X A;  2XLO A;  4CX9 A;  3QVY A;  5JSL A;  3DE8 A;  2YLI A;  3DE9 A;  1YYJ A;  3TOL A;  2YL1 A;  3ZTZ A;  3TOM A;  1QQ3 A;  3NMK A;  2J9B A;  3NMI A;  3IQ6 A;  1M6T A;  2YLG A;  5JS5 A;  1GQA A;  4JKV A;  4NC3 A;  2YKZ A;  3L1M A;  2YLD A;  3C63 A;  3IQ5 A;  2QLA A;  2XLH A;  4IAR A;  4WGY A;  3HNI A;  4JEA A;  2J8W A;  4CJG A;  1RCP A;  4JEB A;  3M79 A;  1YZC A;  3ZQY A;  3HNL A;  4N4W A;  4WGZ A;  5JLI A;  2CCY A;  1E86 A;  1EKY A;  3FOP A;  3HNK A;  5JUA A;  1JAF A;  1E84 A;  1NBB A;  5JVE A;  1CGN A;  4IB4 A;  5AGF A;  2XL6 A;  5JP7 A;  2YL0 A;  3M4C A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...