5JSLA

The l16f mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jslA00
1E86A 2YL3A 4U9DA 2XLDA 1YZCA 3M4BA 4U9EA 1NBBA 1MQVA 4D4NA 2YL0A 1CGOA 4NC3A 1S05A 4EIYA 2YLIA 1CPRA 4N4WA 4ER9A 3M15A 2XLMA 4IB4A 2XLWA 2YL1A 1E85A 256BA 2J9BA 3C63A 2J8WA 1YZAA 2YLDA 3ZTMA 5JT4A 4CJGA 3ZTZA 3ZWIA 4WGYA 1YYXA 3QVZA 1LM3B 1M6TA 1CPQA 5JSLA 2XM0A 3DE8A 3TOLA 2YL7A 3TOMA 4CDAA 3FOPA 5JVEA 4JEAA 4CIPA 3DE9A 2XM4A 5B3IA 3QW1A 1GQAA 2QLAA 3QW0A 3NMJA 5JRAA 2XLEA 1A7VA 4IARA 5AGFA 2XLOA 1E84A 4CDVA 1BBHA 1E83A 1APCA 5JP7A 3HNLA 1JAFA 5JLIA 2BC5A 4N6HA 3L1MA 3QVYA 3HNJA 1QPUA 2XL8A 3ZQVA 2XLHA 1YYJA 2YLGA 3M79A 4D4XA 3FOOA 2YKZA 3HNIA 4JEBA 3U8PA 3IQ5A 2XLVA 4CX9A 3VRCA 4L6RA 4WGZA 4IAQA 4ULVA 4JKVA 4CJOA 3C62A 3HNKA 2XL6A 3IQ6A 3NMKA 5JS5A 1RCPA 3M4CA 4JE9A 5JUAA 2CCYA 3ZQYA 1EKYA 3NMIA 1CGNA 1QQ3A 4CDYA
chains in the Genus database with same CATH superfamily
4CBEA 4GEHA 4U9DA 1WWPA 2J9UA 2WZLA 4E0IA 1YZCA 3DM9B 4D4NA 4CS8C 4LLEA 4CS9C 1QKRA 1T01A 2YLIA 1CPRA 3DJUB 4XTKA 3KH2A 1RXQA 4KNWA 1AUEA 2G3KA 1A0BA 1Q0DA 5BUOA 2A6EF 4MVUA 3G50A 4HFFB 2XS1A 2FGYA 5E3AA 3DAFA 4C3BA 4IB4A 1JRAA 4XEFA 3T9OA 1LI5A 5CIVA 1D1CA 1S7ZA 4MW3A 3EFOA 1E85A 1RKEA 1ZHTA 4NTBA 2J9BA 2R7QA 1BDJB 1HE9A 1ZW3A 2WB7A 4PFPA 2WZGA 3IEEA 5HV9A 1YZAA 2YZSA 3ABKC 3ZTMA 4DRIB 3F47A 4FAPB 1MMNA 2XL4A 2HS5A 4LDRA 4WGYA 3O55A 4G7ZF 2QUPA 2A0UA 1WN0A 1T9KA 5L3VA 3AGTA 2R7SA 3K1IC 1LPEA 1M6TA 3EZIA 3LJBA 3O39A 4K7BA 2J0WA 3O10A 1VLTA 2WZFA 5JSLA 2DYSC 3GEHA 3HLZA 4JC7A 2ICWG 3ASOC 5DS6A 3T4RA 2YL7A 4JTCB 1JOGA 1NG1A 3TOMA 4EBJA 5A6JA 4KI2A 4G7OF 2LFDA 2Y3BA 1RKCA 2P6VA 1FFTC 4MS2A 2XXAA 3ZVRA 4EKWA 1OCCC 2JD3A 3EG9B 4O6YA 2R7RA 2PNOA 3ZG1A 3CSKA 1FMVA 2Q7RA 5A6BD 3FXHA 2B0HA 1DOVA 2R7TA 2CNWD 2Q00A 4IARA 4U5HA 1VLSA 1C17M 1ZU5A 2L9JA 2XSEA 4PACA 1OCRC 1Q0KA 2VCAA 3LS0A 2NUPB 4YT5A 2W45A 2KJGA 2PX0A 5JP7A 1K40A 2M64A 3BRJA 1M2OA 1JAFA 1L7CA 2BC5A 3I5QA 3GEEA 3W8HA 3RH3A 4KBLA 4DVYP 3V5XA 4KNVA 2VASA 3GANA 3SXZA 3FVYA 1LE4A 1RKEB 4OIQF 3S28A 2R02A 2ETSA 3U3FA 1ORYA 5AC5A 3FAPB 4P9FA 4OIRF 2CYDA 3ASNC 3DZAA 4E17A 1GGQA 2C04A 2A68F 3EPVA 2W4MA 2IOQA 2IXPA 4XPXA 3T6GB 1G4US 2KYHA 4NCQA 1YA7O 2PFDA 4JEBA 3HKKA 4DRHB 4E18A 3DAGA 1LS4A 3SP1A 4A2NB 3B9QA 4NTFA 2IXOA 2D5RB 2ZXOA 3N2ZB 2OQMA 1LIHA 4DRJB 2G3VA 1C02A 5E2QA 4GYTA 1SF8A 4HFKB 5GPGB 4MVMA 4UDVA 3H65A 2FFHA 1ZW2A 4WGZA 3RQGA 4JTAB 4J32B 5A69A 2CDQA 1IW7F 1OKKD 1W2WA 3PMRA 2DI3A 3HNKA 3N0TA 2Y39A 4JCZA 4CSAC 4AE4B 3IQ6A 1T6QA 4U5FE 1JMWA 3E9VA 4IRUA 1NU7D 2GA0A 4LLCA 3RVYA 1GM5A 3S90A 4JZAA 5D91A 2J7PD 1BR1A 1YVIA 1G8XA 4AL1A 3EGXA 1YAUO 1OR2A 3NKEA 4E0HA 2CCYA 1Z63A 1K04A 3KPHA 3U2LA 3I4UA 4R32A 4AK9A 4YL0A 5K0IA 1EKYA 4YN0B 2QTVA 1CGNA 4BJ6A 3LNMB 1HMDA 3K7DA 3FDQA 2YL3A 4C7OB 2LCHA 3B0PA 1MQVA 4K1OA 3EGDA 3DWWA 4NC3A 1S05A 3UMIA 4N4WA 2ZXWC 1QSPA 4XQ1A 2CW0F 3DMDA 1JPJA 3SYNA 3LAYA 1IZMA 2GAQA 2XLMA 2KSFA 3Q6MA 3UMHA 1T6UA 4OIPF 5L0JA 2YL1A 2KQ9A 5L0FA 1Q0FA 4ZLDA 3SXMA 3DM5A 4U5CE 1XZPA 3C8GD 3C63A 2H7OA 2J8WA 3AG1C 2E87A 4Z9HA 2IXNA 3UGOA 2YLDA 1OCZC 2P7VA 5JT4A 4OINF 2X51A 5FZTA 3ZWIA 4DOZA 1VMAA 4H54A 4JW1A 4FESA 1TWHA 3OEOA 3RVZA 2LIGA 1LM3B 2DYRC 2CGEA 2J9WA 4I1OB 4JJFA 1UG7A 4X0RA 1OQCA 1ZU4A 5AC4A 4G0HA 1OW8A 2Y3DA 3CQZA 1VK5A 3DE8A 3WAQA 2TMVP 3L34A 4CDAA 3ITFA 3NYMA 3EGXB 1MMAA 2NUTB 3DKAA 3A9CA 5L0HA 2EPOA 4Q7CA 3FHDA 5TJ5E 1NU9C 1V55C 4YWQA 1TFKB 2EIJC 1TKNA 2HV7A 2KGOA 3DE9A 1YJGA 4BJ5A 1U6HA 1PD1A 5B3IA 4U5GA 4EUKB 3QW1A 4DBQA 1GS9A 3KKBA 4XPWA 3SZRA 5F5HA 2Q9CA 4G7HF 1RJ9B 2Q3TA 3L0IA 4PK4A 4BJ1A 3TK0A 3C7JA 3RKOF 3U9JA 1M2VA 2I15A 2EPLX 3K33A 5DS4A 3RIPA 1E83A 1APCA 1MMDA 2R03A 4BEMJ 5L0CA 5L3QA 3KYIA 3RW0A 4N6HA 1YARO 4JVSA 5CI8A 3UMKA 2NSFA 2YWAA 3SNHA 2HMZA 1QVXA 3HNJA 2ZXPA 1FAPB 2XL8A 4PJLA 3ZQVA 2OG2A 3IQTA 3PDMP 1AVOB 2YRFA 2YLGA 3M79A 1V74B 3MX3A 2ZPAA 4CS8A 3CZ6A 2EILC 4CS9A 5L0GA 2YKZA 1D1BA 5KYUA 3V5ZA 1OCOC 3IQ5A 5EHHA 1KTMA 1HE1A 2HKVA 5CI9A 3G4ZA 1M57C 2YEVA 2XLVA 3KMIA 4MTGA 3RF3A 4CX9A 3JZ0A 5COFA 2L6FA 4YK5A 1VB5A 3VRCA 2HSBA 3F46A 2EINC 1VYKA 2HUJA 4LDKA 3US6A 4ULVA 1WTYA 3AQCA 1Z5ZA 4RDAA 4CJOA 3EFOB 2XL6A 4ULWA 3S29A 5KYXA 3E70C 4IWBA 4MVQA 1KU2A 3NMKA 1WASA 5KYYA 2BE5F 3K1IA 5JS5A 4RD9A 4I3MA 3M4CA 4JE9A 2LK4A 3DXJF 5JUAA 3MLGA 3TD7A 4W8KA 4K0DA 4AL0A 2KC3A 1EI7A 3ZQYA 5KYWA 1DOWA 2H7BA 3JRTA 2WVNA 5L0DA 1YDIA 2QNLA 3GEIA 3WHNA 2J0XA 4CDYA 5KYNA 1E86A 3POVA 2IXMA 2P61A 2R7XA 3O6XA 3B71A 1G4WR 1TWGA 2XLDA 4U9EA 1NBBA 2XXAB 3W2VA 2AU5A 1ZYRF 3GM3A 4MTFA 4EIYA 3M1CB 1L3PA 3K6BA 3M15A 4MVRA 3AG2C 3OWTA 3DD7A 2NSGA 4C3EA 4Q4ZF 1R4TA 1FNTc 4BG0A 1AEPA 1TR2A 4J7YA 4EBKA 4YJWA 3UR3C 2XLWA 4C3DA 3IPMO 2R7WA 3MFNA 3SEOA 2VB6A 3DJNB 4XWJA 5FCLA 256BA 3LNRA 4Q5SF 4ZLCA 5A6BA 1XZQA 2AWCA 1B68A 1J8YF 4RBNA 5DS5A 1D0ZA 3S27A 2CNWA 5DQTA 2VCCA 1H7IA 3B0VC 3BEHA 2Y69C 1YYXA 4MVZA 1SZIA 2VC9A 3QVZA 2MWQA 5KYXB 4XEKA 4AX2A 4M63A 5T1DB 5EK0A 1NFNA 4WABA 4YT4A 3TOLA 2NG1A 3T6JA 4NQFA 3ABLC 4O79A 1E2XA 3JYHA 5BQIA 5DLJA 3FOPA 2F22A 1MNDA 2WL8A 3EH1A 4PFOA 4ANJA 3EQLF 4YT2A 2L7AA 5JVEA 5KYWB 3JCUQ 4JEAA 3RFYA 3NRHA 3TULA 1T5OA 2Y3GA 3AG3C 4PJMA 1Y6DA 2YHSA 1GQAA 2QLAA 3NMJA 5JRAA 2HMQA 1Z23A 2AVKA 2LSEA 4CSAA 3B0UX 5COMA 3WG7C 2IYLD 2OOCA 3QMKA 2YVKA 5AGFA 1XWJA 5COGA 1E84A 5F5FA 4CDVA 3V7OA 1BBHA 1ZZPA 2MYSA 1TWAA 1RMVA 4JURI 4I44A 3MYFA 4BJTA 3KYJA 5JLIA 2OEXA 1V4AA 1OW6A 2PP4A 1O5HA 3UGPA 3QVYA 1OKKA 2OEVA 5A6AA 1YA9A 1U89A 3NYJA 4J30B 3TJ6A 3ZC4A 1CGME 1QPUA 1R5ID 4CS7A 2Q9BA 1A7DA 3JRMO 3VF0A 1H9GA 2XLHA 3EJNA 4NTAA 1Z3IX 3G4XA 4LACB 4MTOA 2J46A 3AGUA 3FOOA 1MMGA 2J7PA 3HNIA 4MNDA 4WJ0A 2KK1A 3VYWA 1JR8A 1M56C 1ZVZA 2JPUA 1A7EA 3GM1A 1NFOA 2BL2A 3U8PA 4O6NA 2RSEB 3EG9A 2KNHA 2J9VA 4PR9A 4U5EE 1VOMA 2O9XA 3EGDB 4BPMA 3GM2A 2B0JA 4CIHA 4QI2A 4DJ9A 4OD4A 1LVKA 3B29A 3HTKC 3SXKA 3GORA 5B3SC 4N6CA 2GWWA 2EPKX 2ZD9A 3Q7GA 1SMYF 3K66A 2NUPA 3C62A 3NDBB 3K1HA 4Z9IA 2HSQA 1I4ZA 3LLIA 1HY5A 1G5ZA 1TWCA 1WATA 2PBEA 1NLXA 2I8BA 2ASRA 1RCPA 2V3CC 5L0IA 4P6IC 1A41A 1LS1A 3C8GA 4E7SA 1QLEC 3FMSA 2A1DD 3EHNA 4J7TA 1C03A 2H7VC 3IHUA 4MVOA 4DXWA 4H4KC 4KC9A 2L6HA 3JSZA 3TJ5A 1QQ3A 1ST6A 3Q6NA 3C8ZA 3LUTB 4JIOA 5F28E 1H9TA 2R05A 3LEVA 1Y4CA 1ZHYA 4EWCA 5EGYA 3R2PA 4GQHA 3X2QC 2Q9AA 2W4BA 3M4BA 1K05A 4W8PA 2YL0A 1CGOA 3CEXA 2UUHA 3R7CA 4ER9A 1V54C 2EPNA 3U3BA 5DQZA 1Q0GA 1U0BB 4IGGA 2HJ3A 1SR2A 2A0BA 2HZ8A 2W9YA 2QE9A 1Z7Qc 2OJED 2R7VA 2DGJA 3GWNA 1ORJA 2YQYA 3W8IA 1KNYA 4QDLA 4Z9JA 3N24A 4FWVA 3SXYA 1D0YA 1HMOA 4LDQA 3GWLA 1OXBA 2DB4A 3ABMC 3S9OA 1BR4A 1T6IA 4AE4A 3J06A 3LS1A 1H6GA 3U9MA 4YL1A 3ZDLA 1M2VB 3ZSUA 4U5BE 3QTHA 5E3CA 1OXKA 1O87A 1TFOB 1HW1A 3NKDA 1FMWA 4LERA 2OJQA 4CJGA 1FR0A 4P9TA 3ZTZA 2R7UA 1ZHWA 4BEJA 1ZHXA 2L6GA 4O6MA 4XEVA 2UUIA 2V26A 3FAJA 1QZXA 3V5YA 4XLNF 1PD0A 4ONSA 1CPQA 3WODF 2OU6A 5DVWA 3H2VA 3I5PA 4OD5A 3CAXA 2XM0A 4PJJA 3L8IA 3JT1A 4U5DE 5D92A 3A11A 3RQFA 4C7OA 1VTMP 2LFFA 4XPYA 1EA8A 2LD6A 3DI5A 4HEAJ 2LP4A 3C8GB 5BQGA 4IAOA 4BJ6C 2IBFA 2OCCC 3AOUA 1O3UA 1FFHA 4IJJA 5B1BC 4B6IA 4O7GA 1I5NA 5IY5C 5KYUB 4CIPA 3HJCA 4FX5A 2XM4A 5A6KA 3U0CA 2AP3A 3MBGA 2EIKC 3JYYA 2KW3C 3NYLA 2RD9A 3C18A 2L81A 3QW0A 4EHPA 5T3TA 5HSWA 1BR2A 2XLEA 1ORSC 2X0CA 3NG1A 1A7VA 2Q4FA 2M4EA 2XLOA 3JTLO 2OKUA 1MNEA 1OR3A 3H2UA 3RYLA 4DBRA 2HFIA 3LLKA 2EIMC 1Z6AA 2C03A 1Q0MA 1OW7A 2HJMA 3EH2A 2LQGA 3ECSA 3HNLA 4OIOF 4I1MA 3QZCA 4F4BA 2FAPB 1TQGA 4A4AA 5KYYB 3X1OA 2VCBA 4XLPF 1EQ1A 3W2WA 3L1MA 1NZEA 3ATPA 3ZIBA 4YL3A 3S84A 2GDCA 3LEOA 1WGWA 4QI0A 2XS8A 1VYIA 2P1AA 2EPMX 3IQCA 1JPNA 3U5SA 3KL4A 3L8JA 1HW2A 2D4UA 1YYJA 3AJMA 1D0XA 2IM8A 3VM6A 4D4XA 3GODA 2ZXRA 4E7ZA 2NUTA 3TQOA 3T6BA 3MYIA 4JTDB 2A6HF 1N1CA 1LKXA 2H8AA 1YLMA 3U8VA 4N06A 1BZ4A 1PCXA 2Z15A 4HE8D 4NY3A 2WVQA 4PJNA 5E33A 2HV6A 2PX3A 1RJ9A 4JCHA 1I4YA 1D1AA 1NSGB 4L6RA 3RQEA 3U2MA 4BJ5C 3PCVA 4IAQA 2QY9A 2R25A 3JSEO 1UFBA 4JJGA 4JKVA 2G62A 3EHMA 2NPUA 3UNGC 2VH3A 4MVSA 3PHF2 5BQHA 3OA1A 3W4YA 1WOLA 2AWYA 2XRHA 4G78A 1PV3A 2GFHA 1FTSA 2MHRA 4JRZA 2PF4E 3AG4C 4EBBA 1J8MF 5B1AC 1F1MA 1LE2A 2Y3HA 2R9RB 2WVOA 3S0XA 1LI7A 5T3WA 3LESA 4MQ9F 1SYQA 1ZHZA 3AQBA 2A69F 2P0NA 3EZHA 4YT8A 2J45A 2JX0A 3Q7LA 4MW8A 3VAYA 4DVZA 3NMIA 2R7OA
chains in the Genus database with same CATH topology
1E86A 2YL3A 4U9DA 2XLDA 1YZCA 3M4BA 4U9EA 1NBBA 1MQVA 4D4NA 2YL0A 1CGOA 4NC3A 1S05A 4EIYA 2YLIA 1CPRA 4N4WA 4ER9A 3M15A 2XLMA 4IB4A 2XLWA 2YL1A 1E85A 256BA 2J9BA 3C63A 2J8WA 1YZAA 2YLDA 3ZTMA 5JT4A 4CJGA 3ZTZA 3ZWIA 4WGYA 1YYXA 3QVZA 1LM3B 1M6TA 1CPQA 5JSLA 2XM0A 3DE8A 3TOLA 2YL7A 3TOMA 4CDAA 3FOPA 5JVEA 4JEAA 4CIPA 3DE9A 2XM4A 5B3IA 3QW1A 1GQAA 2QLAA 3QW0A 3NMJA 5JRAA 2XLEA 1A7VA 4IARA 5AGFA 2XLOA 1E84A 4CDVA 1BBHA 1E83A 1APCA 5JP7A 3HNLA 1JAFA 5JLIA 2BC5A 4N6HA 3L1MA 3QVYA 3HNJA 1QPUA 2XL8A 3ZQVA 2XLHA 1YYJA 2YLGA 3M79A 4D4XA 3FOOA 2YKZA 3HNIA 4JEBA 3U8PA 3IQ5A 2XLVA 4CX9A 3VRCA 4L6RA 4WGZA 4IAQA 4ULVA 4JKVA 4CJOA 3C62A 3HNKA 2XL6A 3IQ6A 3NMKA 5JS5A 1RCPA 3M4CA 4JE9A 5JUAA 2CCYA 3ZQYA 1EKYA 3NMIA 1CGNA 1QQ3A 4CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E86 A;  2YL3 A;  4U9D A;  2XLD A;  1YZC A;  3M4B A;  4U9E A;  1NBB A;  1MQV A;  4D4N A;  2YL0 A;  1CGO A;  4NC3 A;  1S05 A;  4EIY A;  2YLI A;  1CPR A;  4N4W A;  4ER9 A;  3M15 A;  2XLM A;  4IB4 A;  2XLW A;  2YL1 A;  1E85 A;  256B A;  2J9B A;  3C63 A;  2J8W A;  1YZA A;  2YLD A;  3ZTM A;  5JT4 A;  4CJG A;  3ZTZ A;  3ZWI A;  4WGY A;  1YYX A;  3QVZ A;  1LM3 B;  1M6T A;  1CPQ A;  5JSL A;  2XM0 A;  3DE8 A;  3TOL A;  2YL7 A;  3TOM A;  4CDA A;  3FOP A;  5JVE A;  4JEA A;  4CIP A;  3DE9 A;  2XM4 A;  5B3I A;  3QW1 A;  1GQA A;  2QLA A;  3QW0 A;  3NMJ A;  5JRA A;  2XLE A;  1A7V A;  4IAR A;  5AGF A;  2XLO A;  1E84 A;  4CDV A;  1BBH A;  1E83 A;  1APC A;  5JP7 A;  3HNL A;  1JAF A;  5JLI A;  2BC5 A;  4N6H A;  3L1M A;  3QVY A;  3HNJ A;  1QPU A;  2XL8 A;  3ZQV A;  2XLH A;  1YYJ A;  2YLG A;  3M79 A;  4D4X A;  3FOO A;  2YKZ A;  3HNI A;  4JEB A;  3U8P A;  3IQ5 A;  2XLV A;  4CX9 A;  3VRC A;  4L6R A;  4WGZ A;  4IAQ A;  4ULV A;  4JKV A;  4CJO A;  3C62 A;  3HNK A;  2XL6 A;  3IQ6 A;  3NMK A;  5JS5 A;  1RCP A;  3M4C A;  4JE9 A;  5JUA A;  2CCY A;  3ZQY A;  1EKY A;  3NMI A;  1CGN A;  1QQ3 A;  4CDY A; 
#chains in the Genus database with same CATH topology
 4CBE A;  4GEH A;  4U9D A;  1WWP A;  2J9U A;  2WZL A;  4E0I A;  1YZC A;  3DM9 B;  4D4N A;  4CS8 C;  4LLE A;  4CS9 C;  1QKR A;  1T01 A;  2YLI A;  1CPR A;  3DJU B;  4XTK A;  3KH2 A;  1RXQ A;  4KNW A;  1AUE A;  2G3K A;  1A0B A;  1Q0D A;  5BUO A;  2A6E F;  4MVU A;  3G50 A;  4HFF B;  2XS1 A;  2FGY A;  5E3A A;  3DAF A;  4C3B A;  4IB4 A;  1JRA A;  4XEF A;  3T9O A;  1LI5 A;  5CIV A;  1D1C A;  1S7Z A;  4MW3 A;  3EFO A;  1E85 A;  1RKE A;  1ZHT A;  4NTB A;  2J9B A;  2R7Q A;  1BDJ B;  1HE9 A;  1ZW3 A;  2WB7 A;  4PFP A;  2WZG A;  3IEE A;  5HV9 A;  1YZA A;  2YZS A;  3ABK C;  3ZTM A;  4DRI B;  3F47 A;  4FAP B;  1MMN A;  2XL4 A;  2HS5 A;  4LDR A;  4WGY A;  3O55 A;  4G7Z F;  2QUP A;  2A0U A;  1WN0 A;  1T9K A;  5L3V A;  3AGT A;  2R7S A;  3K1I C;  1LPE A;  1M6T A;  3EZI A;  3LJB A;  3O39 A;  4K7B A;  2J0W A;  3O10 A;  1VLT A;  2WZF A;  5JSL A;  2DYS C;  3GEH A;  3HLZ A;  4JC7 A;  2ICW G;  3ASO C;  5DS6 A;  3T4R A;  2YL7 A;  4JTC B;  1JOG A;  1NG1 A;  3TOM A;  4EBJ A;  5A6J A;  4KI2 A;  4G7O F;  2LFD A;  2Y3B A;  1RKC A;  2P6V A;  1FFT C;  4MS2 A;  2XXA A;  3ZVR A;  4EKW A;  1OCC C;  2JD3 A;  3EG9 B;  4O6Y A;  2R7R A;  2PNO A;  3ZG1 A;  3CSK A;  1FMV A;  2Q7R A;  5A6B D;  3FXH A;  2B0H A;  1DOV A;  2R7T A;  2CNW D;  2Q00 A;  4IAR A;  4U5H A;  1VLS A;  1C17 M;  1ZU5 A;  2L9J A;  2XSE A;  4PAC A;  1OCR C;  1Q0K A;  2VCA A;  3LS0 A;  2NUP B;  4YT5 A;  2W45 A;  2KJG A;  2PX0 A;  5JP7 A;  1K40 A;  2M64 A;  3BRJ A;  1M2O A;  1JAF A;  1L7C A;  2BC5 A;  3I5Q A;  3GEE A;  3W8H A;  3RH3 A;  4KBL A;  4DVY P;  3V5X A;  4KNV A;  2VAS A;  3GAN A;  3SXZ A;  3FVY A;  1LE4 A;  1RKE B;  4OIQ F;  3S28 A;  2R02 A;  2ETS A;  3U3F A;  1ORY A;  5AC5 A;  3FAP B;  4P9F A;  4OIR F;  2CYD A;  3ASN C;  3DZA A;  4E17 A;  1GGQ A;  2C04 A;  2A68 F;  3EPV A;  2W4M A;  2IOQ A;  2IXP A;  4XPX A;  3T6G B;  1G4U S;  2KYH A;  4NCQ A;  1YA7 O;  2PFD A;  4JEB A;  3HKK A;  4DRH B;  4E18 A;  3DAG A;  1LS4 A;  3SP1 A;  4A2N B;  3B9Q A;  4NTF A;  2IXO A;  2D5R B;  2ZXO A;  3N2Z B;  2OQM A;  1LIH A;  4DRJ B;  2G3V A;  1C02 A;  5E2Q A;  4GYT A;  1SF8 A;  4HFK B;  5GPG B;  4MVM A;  4UDV A;  3H65 A;  2FFH A;  1ZW2 A;  4WGZ A;  3RQG A;  4JTA B;  4J32 B;  5A69 A;  2CDQ A;  1IW7 F;  1OKK D;  1W2W A;  3PMR A;  2DI3 A;  3HNK A;  3N0T A;  2Y39 A;  4JCZ A;  4CSA C;  4AE4 B;  3IQ6 A;  1T6Q A;  4U5F E;  1JMW A;  3E9V A;  4IRU A;  1NU7 D;  2GA0 A;  4LLC A;  3RVY A;  1GM5 A;  3S90 A;  4JZA A;  5D91 A;  2J7P D;  1BR1 A;  1YVI A;  1G8X A;  4AL1 A;  3EGX A;  1YAU O;  1OR2 A;  3NKE A;  4E0H A;  2CCY A;  1Z63 A;  1K04 A;  3KPH A;  3U2L A;  3I4U A;  4R32 A;  4AK9 A;  4YL0 A;  5K0I A;  1EKY A;  4YN0 B;  2QTV A;  1CGN A;  4BJ6 A;  3LNM B;  1HMD A;  3K7D A;  3FDQ A;  2YL3 A;  4C7O B;  2LCH A;  3B0P A;  1MQV A;  4K1O A;  3EGD A;  3DWW A;  4NC3 A;  1S05 A;  3UMI A;  4N4W A;  2ZXW C;  1QSP A;  4XQ1 A;  2CW0 F;  3DMD A;  1JPJ A;  3SYN A;  3LAY A;  1IZM A;  2GAQ A;  2XLM A;  2KSF A;  3Q6M A;  3UMH A;  1T6U A;  4OIP F;  5L0J A;  2YL1 A;  2KQ9 A;  5L0F A;  1Q0F A;  4ZLD A;  3SXM A;  3DM5 A;  4U5C E;  1XZP A;  3C8G D;  3C63 A;  2H7O A;  2J8W A;  3AG1 C;  2E87 A;  4Z9H A;  2IXN A;  3UGO A;  2YLD A;  1OCZ C;  2P7V A;  5JT4 A;  4OIN F;  2X51 A;  5FZT A;  3ZWI A;  4DOZ A;  1VMA A;  4H54 A;  4JW1 A;  4FES A;  1TWH A;  3OEO A;  3RVZ A;  2LIG A;  1LM3 B;  2DYR C;  2CGE A;  2J9W A;  4I1O B;  4JJF A;  1UG7 A;  4X0R A;  1OQC A;  1ZU4 A;  5AC4 A;  4G0H A;  1OW8 A;  2Y3D A;  3CQZ A;  1VK5 A;  3DE8 A;  3WAQ A;  2TMV P;  3L34 A;  4CDA A;  3ITF A;  3NYM A;  3EGX B;  1MMA A;  2NUT B;  3DKA A;  3A9C A;  5L0H A;  2EPO A;  4Q7C A;  3FHD A;  5TJ5 E;  1NU9 C;  1V55 C;  4YWQ A;  1TFK B;  2EIJ C;  1TKN A;  2HV7 A;  2KGO A;  3DE9 A;  1YJG A;  4BJ5 A;  1U6H A;  1PD1 A;  5B3I A;  4U5G A;  4EUK B;  3QW1 A;  4DBQ A;  1GS9 A;  3KKB A;  4XPW A;  3SZR A;  5F5H A;  2Q9C A;  4G7H F;  1RJ9 B;  2Q3T A;  3L0I A;  4PK4 A;  4BJ1 A;  3TK0 A;  3C7J A;  3RKO F;  3U9J A;  1M2V A;  2I15 A;  2EPL X;  3K33 A;  5DS4 A;  3RIP A;  1E83 A;  1APC A;  1MMD A;  2R03 A;  4BEM J;  5L0C A;  5L3Q A;  3KYI A;  3RW0 A;  4N6H A;  1YAR O;  4JVS A;  5CI8 A;  3UMK A;  2NSF A;  2YWA A;  3SNH A;  2HMZ A;  1QVX A;  3HNJ A;  2ZXP A;  1FAP B;  2XL8 A;  4PJL A;  3ZQV A;  2OG2 A;  3IQT A;  3PDM P;  1AVO B;  2YRF A;  2YLG A;  3M79 A;  1V74 B;  3MX3 A;  2ZPA A;  4CS8 A;  3CZ6 A;  2EIL C;  4CS9 A;  5L0G A;  2YKZ A;  1D1B A;  5KYU A;  3V5Z A;  1OCO C;  3IQ5 A;  5EHH A;  1KTM A;  1HE1 A;  2HKV A;  5CI9 A;  3G4Z A;  1M57 C;  2YEV A;  2XLV A;  3KMI A;  4MTG A;  3RF3 A;  4CX9 A;  3JZ0 A;  5COF A;  2L6F A;  4YK5 A;  1VB5 A;  3VRC A;  2HSB A;  3F46 A;  2EIN C;  1VYK A;  2HUJ A;  4LDK A;  3US6 A;  4ULV A;  1WTY A;  3AQC A;  1Z5Z A;  4RDA A;  4CJO A;  3EFO B;  2XL6 A;  4ULW A;  3S29 A;  5KYX A;  3E70 C;  4IWB A;  4MVQ A;  1KU2 A;  3NMK A;  1WAS A;  5KYY A;  2BE5 F;  3K1I A;  5JS5 A;  4RD9 A;  4I3M A;  3M4C A;  4JE9 A;  2LK4 A;  3DXJ F;  5JUA A;  3MLG A;  3TD7 A;  4W8K A;  4K0D A;  4AL0 A;  2KC3 A;  1EI7 A;  3ZQY A;  5KYW A;  1DOW A;  2H7B A;  3JRT A;  2WVN A;  5L0D A;  1YDI A;  2QNL A;  3GEI A;  3WHN A;  2J0X A;  4CDY A;  5KYN A;  1E86 A;  3POV A;  2IXM A;  2P61 A;  2R7X A;  3O6X A;  3B71 A;  1G4W R;  1TWG A;  2XLD A;  4U9E A;  1NBB A;  2XXA B;  3W2V A;  2AU5 A;  1ZYR F;  3GM3 A;  4MTF A;  4EIY A;  3M1C B;  1L3P A;  3K6B A;  3M15 A;  4MVR A;  3AG2 C;  3OWT A;  3DD7 A;  2NSG A;  4C3E A;  4Q4Z F;  1R4T A;  1FNT c;  4BG0 A;  1AEP A;  1TR2 A;  4J7Y A;  4EBK A;  4YJW A;  3UR3 C;  2XLW A;  4C3D A;  3IPM O;  2R7W A;  3MFN A;  3SEO A;  2VB6 A;  3DJN B;  4XWJ A;  5FCL A;  256B A;  3LNR A;  4Q5S F;  4ZLC A;  5A6B A;  1XZQ A;  2AWC A;  1B68 A;  1J8Y F;  4RBN A;  5DS5 A;  1D0Z A;  3S27 A;  2CNW A;  5DQT A;  2VCC A;  1H7I A;  3B0V C;  3BEH A;  2Y69 C;  1YYX A;  4MVZ A;  1SZI A;  2VC9 A;  3QVZ A;  2MWQ A;  5KYX B;  4XEK A;  4AX2 A;  4M63 A;  5T1D B;  5EK0 A;  1NFN A;  4WAB A;  4YT4 A;  3TOL A;  2NG1 A;  3T6J A;  4NQF A;  3ABL C;  4O79 A;  1E2X A;  3JYH A;  5BQI A;  5DLJ A;  3FOP A;  2F22 A;  1MND A;  2WL8 A;  3EH1 A;  4PFO A;  4ANJ A;  3EQL F;  4YT2 A;  2L7A A;  5JVE A;  5KYW B;  3JCU Q;  4JEA A;  3RFY A;  3NRH A;  3TUL A;  1T5O A;  2Y3G A;  3AG3 C;  4PJM A;  1Y6D A;  2YHS A;  1GQA A;  2QLA A;  3NMJ A;  5JRA A;  2HMQ A;  1Z23 A;  2AVK A;  2LSE A;  4CSA A;  3B0U X;  5COM A;  3WG7 C;  2IYL D;  2OOC A;  3QMK A;  2YVK A;  5AGF A;  1XWJ A;  5COG A;  1E84 A;  5F5F A;  4CDV A;  3V7O A;  1BBH A;  1ZZP A;  2MYS A;  1TWA A;  1RMV A;  4JUR I;  4I44 A;  3MYF A;  4BJT A;  3KYJ A;  5JLI A;  2OEX A;  1V4A A;  1OW6 A;  2PP4 A;  1O5H A;  3UGP A;  3QVY A;  1OKK A;  2OEV A;  5A6A A;  1YA9 A;  1U89 A;  3NYJ A;  4J30 B;  3TJ6 A;  3ZC4 A;  1CGM E;  1QPU A;  1R5I D;  4CS7 A;  2Q9B A;  1A7D A;  3JRM O;  3VF0 A;  1H9G A;  2XLH A;  3EJN A;  4NTA A;  1Z3I X;  3G4X A;  4LAC B;  4MTO A;  2J46 A;  3AGU A;  3FOO A;  1MMG A;  2J7P A;  3HNI A;  4MND A;  4WJ0 A;  2KK1 A;  3VYW A;  1JR8 A;  1M56 C;  1ZVZ A;  2JPU A;  1A7E A;  3GM1 A;  1NFO A;  2BL2 A;  3U8P A;  4O6N A;  2RSE B;  3EG9 A;  2KNH A;  2J9V A;  4PR9 A;  4U5E E;  1VOM A;  2O9X A;  3EGD B;  4BPM A;  3GM2 A;  2B0J A;  4CIH A;  4QI2 A;  4DJ9 A;  4OD4 A;  1LVK A;  3B29 A;  3HTK C;  3SXK A;  3GOR A;  5B3S C;  4N6C A;  2GWW A;  2EPK X;  2ZD9 A;  3Q7G A;  1SMY F;  3K66 A;  2NUP A;  3C62 A;  3NDB B;  3K1H A;  4Z9I A;  2HSQ A;  1I4Z A;  3LLI A;  1HY5 A;  1G5Z A;  1TWC A;  1WAT A;  2PBE A;  1NLX A;  2I8B A;  2ASR A;  1RCP A;  2V3C C;  5L0I A;  4P6I C;  1A41 A;  1LS1 A;  3C8G A;  4E7S A;  1QLE C;  3FMS A;  2A1D D;  3EHN A;  4J7T A;  1C03 A;  2H7V C;  3IHU A;  4MVO A;  4DXW A;  4H4K C;  4KC9 A;  2L6H A;  3JSZ A;  3TJ5 A;  1QQ3 A;  1ST6 A;  3Q6N A;  3C8Z A;  3LUT B;  4JIO A;  5F28 E;  1H9T A;  2R05 A;  3LEV A;  1Y4C A;  1ZHY A;  4EWC A;  5EGY A;  3R2P A;  4GQH A;  3X2Q C;  2Q9A A;  2W4B A;  3M4B A;  1K05 A;  4W8P A;  2YL0 A;  1CGO A;  3CEX A;  2UUH A;  3R7C A;  4ER9 A;  1V54 C;  2EPN A;  3U3B A;  5DQZ A;  1Q0G A;  1U0B B;  4IGG A;  2HJ3 A;  1SR2 A;  2A0B A;  2HZ8 A;  2W9Y A;  2QE9 A;  1Z7Q c;  2OJE D;  2R7V A;  2DGJ A;  3GWN A;  1ORJ A;  2YQY A;  3W8I A;  1KNY A;  4QDL A;  4Z9J A;  3N24 A;  4FWV A;  3SXY A;  1D0Y A;  1HMO A;  4LDQ A;  3GWL A;  1OXB A;  2DB4 A;  3ABM C;  3S9O A;  1BR4 A;  1T6I A;  4AE4 A;  3J06 A;  3LS1 A;  1H6G A;  3U9M A;  4YL1 A;  3ZDL A;  1M2V B;  3ZSU A;  4U5B E;  3QTH A;  5E3C A;  1OXK A;  1O87 A;  1TFO B;  1HW1 A;  3NKD A;  1FMW A;  4LER A;  2OJQ A;  4CJG A;  1FR0 A;  4P9T A;  3ZTZ A;  2R7U A;  1ZHW A;  4BEJ A;  1ZHX A;  2L6G A;  4O6M A;  4XEV A;  2UUI A;  2V26 A;  3FAJ A;  1QZX A;  3V5Y A;  4XLN F;  1PD0 A;  4ONS A;  1CPQ A;  3WOD F;  2OU6 A;  5DVW A;  3H2V A;  3I5P A;  4OD5 A;  3CAX A;  2XM0 A;  4PJJ A;  3L8I A;  3JT1 A;  4U5D E;  5D92 A;  3A11 A;  3RQF A;  4C7O A;  1VTM P;  2LFF A;  4XPY A;  1EA8 A;  2LD6 A;  3DI5 A;  4HEA J;  2LP4 A;  3C8G B;  5BQG A;  4IAO A;  4BJ6 C;  2IBF A;  2OCC C;  3AOU A;  1O3U A;  1FFH A;  4IJJ A;  5B1B C;  4B6I A;  4O7G A;  1I5N A;  5IY5 C;  5KYU B;  4CIP A;  3HJC A;  4FX5 A;  2XM4 A;  5A6K A;  3U0C A;  2AP3 A;  3MBG A;  2EIK C;  3JYY A;  2KW3 C;  3NYL A;  2RD9 A;  3C18 A;  2L81 A;  3QW0 A;  4EHP A;  5T3T A;  5HSW A;  1BR2 A;  2XLE A;  1ORS C;  2X0C A;  3NG1 A;  1A7V A;  2Q4F A;  2M4E A;  2XLO A;  3JTL O;  2OKU A;  1MNE A;  1OR3 A;  3H2U A;  3RYL A;  4DBR A;  2HFI A;  3LLK A;  2EIM C;  1Z6A A;  2C03 A;  1Q0M A;  1OW7 A;  2HJM A;  3EH2 A;  2LQG A;  3ECS A;  3HNL A;  4OIO F;  4I1M A;  3QZC A;  4F4B A;  2FAP B;  1TQG A;  4A4A A;  5KYY B;  3X1O A;  2VCB A;  4XLP F;  1EQ1 A;  3W2W A;  3L1M A;  1NZE A;  3ATP A;  3ZIB A;  4YL3 A;  3S84 A;  2GDC A;  3LEO A;  1WGW A;  4QI0 A;  2XS8 A;  1VYI A;  2P1A A;  2EPM X;  3IQC A;  1JPN A;  3U5S A;  3KL4 A;  3L8J A;  1HW2 A;  2D4U A;  1YYJ A;  3AJM A;  1D0X A;  2IM8 A;  3VM6 A;  4D4X A;  3GOD A;  2ZXR A;  4E7Z A;  2NUT A;  3TQO A;  3T6B A;  3MYI A;  4JTD B;  2A6H F;  1N1C A;  1LKX A;  2H8A A;  1YLM A;  3U8V A;  4N06 A;  1BZ4 A;  1PCX A;  2Z15 A;  4HE8 D;  4NY3 A;  2WVQ A;  4PJN A;  5E33 A;  2HV6 A;  2PX3 A;  1RJ9 A;  4JCH A;  1I4Y A;  1D1A A;  1NSG B;  4L6R A;  3RQE A;  3U2M A;  4BJ5 C;  3PCV A;  4IAQ A;  2QY9 A;  2R25 A;  3JSE O;  1UFB A;  4JJG A;  4JKV A;  2G62 A;  3EHM A;  2NPU A;  3UNG C;  2VH3 A;  4MVS A;  3PHF 2;  5BQH A;  3OA1 A;  3W4Y A;  1WOL A;  2AWY A;  2XRH A;  4G78 A;  1PV3 A;  2GFH A;  1FTS A;  2MHR A;  4JRZ A;  2PF4 E;  3AG4 C;  4EBB A;  1J8M F;  5B1A C;  1F1M A;  1LE2 A;  2Y3H A;  2R9R B;  2WVO A;  3S0X A;  1LI7 A;  5T3W A;  3LES A;  4MQ9 F;  1SYQ A;  1ZHZ A;  3AQB A;  2A69 F;  2P0N A;  3EZH A;  4YT8 A;  2J45 A;  2JX0 A;  3Q7L A;  4MW8 A;  3VAY A;  4DVZ A;  3NMI A;  2R7O A; 
#chains in the Genus database with same CATH homology
 1E86 A;  2YL3 A;  4U9D A;  2XLD A;  1YZC A;  3M4B A;  4U9E A;  1NBB A;  1MQV A;  4D4N A;  2YL0 A;  1CGO A;  4NC3 A;  1S05 A;  4EIY A;  2YLI A;  1CPR A;  4N4W A;  4ER9 A;  3M15 A;  2XLM A;  4IB4 A;  2XLW A;  2YL1 A;  1E85 A;  256B A;  2J9B A;  3C63 A;  2J8W A;  1YZA A;  2YLD A;  3ZTM A;  5JT4 A;  4CJG A;  3ZTZ A;  3ZWI A;  4WGY A;  1YYX A;  3QVZ A;  1LM3 B;  1M6T A;  1CPQ A;  5JSL A;  2XM0 A;  3DE8 A;  3TOL A;  2YL7 A;  3TOM A;  4CDA A;  3FOP A;  5JVE A;  4JEA A;  4CIP A;  3DE9 A;  2XM4 A;  5B3I A;  3QW1 A;  1GQA A;  2QLA A;  3QW0 A;  3NMJ A;  5JRA A;  2XLE A;  1A7V A;  4IAR A;  5AGF A;  2XLO A;  1E84 A;  4CDV A;  1BBH A;  1E83 A;  1APC A;  5JP7 A;  3HNL A;  1JAF A;  5JLI A;  2BC5 A;  4N6H A;  3L1M A;  3QVY A;  3HNJ A;  1QPU A;  2XL8 A;  3ZQV A;  2XLH A;  1YYJ A;  2YLG A;  3M79 A;  4D4X A;  3FOO A;  2YKZ A;  3HNI A;  4JEB A;  3U8P A;  3IQ5 A;  2XLV A;  4CX9 A;  3VRC A;  4L6R A;  4WGZ A;  4IAQ A;  4ULV A;  4JKV A;  4CJO A;  3C62 A;  3HNK A;  2XL6 A;  3IQ6 A;  3NMK A;  5JS5 A;  1RCP A;  3M4C A;  4JE9 A;  5JUA A;  2CCY A;  3ZQY A;  1EKY A;  3NMI A;  1CGN A;  1QQ3 A;  4CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...