5JSLA

The l16f mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jslA00
4JEAA 5AGFA 1YYJA 3FOPA 1E83A 4D4XA 3IQ5A 3TOMA 5JS5A 4CX9A 256BA 2XM0A 1E85A 5JUAA 4CIPA 2YL7A 3QW0A 3M4CA 4N4WA 4JE9A 4CJGA 2YLDA 3ZTZA 1A7VA 4L6RA 4ER9A 3L1MA 2CCYA 3C62A 2XLMA 3ZTMA 4EIYA 2YKZA 1QPUA 4IARA 2XLDA 1NBBA 1BBHA 1JAFA 2J9BA 3QVZA 2XLWA 2XLEA 3FOOA 1E84A 1APCA 1CPRA 1YZCA 1QQ3A 2XM4A 3DE8A 4CJOA 4CDYA 1MQVA 2QLAA 3IQ6A 3HNIA 2XLOA 4CDAA 1GQAA 2YL3A 3C63A 3M4BA 1EKYA 2XL6A 4CDVA 5JT4A 3U8PA 3TOLA 4NC3A 2BC5A 4U9DA 1CPQA 3HNLA 5JSLA 3M15A 3HNJA 1CGNA 2YLGA 5JRAA 4WGYA 2YLIA 4JKVA 1CGOA 4WGZA 2J8WA 1RCPA 1E86A 2XLVA 1YYXA 1YZAA 3ZQVA 5JLIA 3VRCA 4IAQA 1M6TA 4D4NA 1S05A 3QVYA 5B3IA 3NMJA 3NMIA 5JP7A 3NMKA 5JVEA 3HNKA 4IB4A 3ZQYA 4N6HA 4JEBA 2YL1A 4ULVA 3DE9A 3QW1A 2YL0A 2XLHA 4U9EA 2XL8A 1LM3B 3M79A 3ZWIA
chains in the Genus database with same CATH superfamily
3NYMA 4JEAA 4BJ6C 1RXQA 3E70C 5CIVA 4JCZA 4D4XA 1HW1A 1SMYF 2EINC 3TOMA 2NUTA 1ORJA 1R5ID 4LACB 3GANA 1H7IA 3NDBB 2C03A 2PP4A 4CIPA 5JUAA 5KYUA 2AWYA 1YA9A 2W9YA 5A6AA 1D1CA 3W8IA 2R7WA 2HUJA 3S84A 1WTYA 4GEHA 4IAOA 3B0PA 4N4WA 1TQGA 3PCVA 2Y39A 2BE5F 3IEEA 3FAJA 4JE9A 4CJGA 3JTLO 3L8JA 2WZLA 1A7VA 2UUHA 1D0YA 3LJBA 1WWPA 2A69F 2EPLX 4CS7A 4LDQA 4XEVA 4ER9A 3S90A 4GQHA 4H54A 3DJUB 1RKEB 4JTCB 2XLMA 5K0IA 1UG7A 2W45A 2IOQA 2R7QA 3JCUQ 3TK0A 4DBQA 3RVZA 1D0ZA 2KJGA 1MMNA 3O10A 2H7BA 2NSFA 3KPHA 2HSBA 4FWVA 2A0UA 2Y3GA 3IQCA 1LI5A 4H4KC 5FCLA 5D91A 2XL4A 4MTGA 1SZIA 3WAQA 4IRUA 5E2QA 2EPMX 2P6VA 4HFFB 1ORSC 1TFKB 1WATA 2AP3A 2HV6A 4XLPF 1J8MF 3JRTA 1OR2A 5A6BD 3EHNA 5KYXB 1QQ3A 1ST6A 2XM4A 3ITFA 1BR1A 5KYYA 3DZAA 1K40A 4E7SA 1SF8A 2Y3BA 5IY5C 2QLAA 1XWJA 3HNIA 2XLOA 1NFOA 1OQCA 3OEOA 4NTFA 3JT1A 4NCQA 1G4US 4ZLDA 2A0BA 2YL3A 3AOUA 3C63A 3EZHA 3UMHA 5AC4A 1BR2A 2Q7RA 2A1DD 3MX3A 2VCBA 3BRJA 4NC3A 2JX0A 3EHMA 1LI7A 4E7ZA 4YT8A 2GFHA 2J0WA 2WL8A 3K66A 1Q0FA 1Q0DA 2ZXPA 3HNLA 2P7VA 3L0IA 4MTOA 1FTSA 4YT2A 1U0BB 2YZSA 1VLTA 1I4YA 4UDVA 3EJNA 2NUPB 1M2VB 1G5ZA 1HW2A 4RD9A 4BJ5C 4YK5A 1A7EA 2J46A 1XZPA 1D0XA 2Q3TA 1Q0MA 1G4WR 1YARO 4U5CE 4WGYA 4YN0B 5FZTA 1ZYRF 1CGOA 2HJ3A 3EFOB 3GEHA 1HE1A 4WGZA 2CYDA 1OKKD 4OINF 2DYSC 3RYLA 5L0DA 1UFBA 2IXMA 4PJLA 2XLVA 5KYWA 2OKUA 3GWLA 2L7AA 2B0JA 1YZAA 5CI9A 1Z7Qc 4IAQA 3VRCA 3HKKA 4MW8A 5A6KA 3AGTA 1NSGB 3NYLA 2XXAA 3GM2A 3RW0A 4JURI 3T4RA 1S05A 3NMJA 2LIGA 3CSKA 4P6IC 5EK0A 3POVA 2WB7A 3WG7C 4E0HA 3QMKA 2OEVA 5A69A 5A6BA 3MYIA 4MVQA 2V3CC 2G3VA 2OQMA 2P0NA 1YVIA 1VOMA 1N1CA 4A2NB 2EIJC 5L3QA 3ASOC 2GDCA 3UGOA 1C03A 5L0IA 1OW7A 3RIPA 2ASRA 1LVKA 1ZU4A 2XXAB 4E17A 2WVOA 2XL8A 1AVOB 2CGEA 2XSEA 4EBJA 4EUKB 1TFOB 2J0XA 4CS8C 5B1BC 3ZWIA 4U5HA 2ZXRA 3BEHA 3N24A 2D4UA 3WHNA 5AGFA 4Q5SF 4J7YA 2OEXA 1E83A 3IQ5A 3K1IA 4DBRA 1WASA 2NPUA 1HMDA 4BG0A 5BUOA 4I3MA 3V7OA 2HJMA 1EQ1A 1AUEA 3Q6NA 2YRFA 3AG2C 2L9JA 3DWWA 3QW0A 5HV9A 4AL0A 3M4CA 2OG2A 1DOVA 1NZEA 3C7JA 1V4AA 4U5BE 5DVWA 3U2MA 5B3SC 1JR8A 3AQBA 1O87A 1WN0A 2W4BA 4MVZA 2RSEB 4O6MA 1ZHWA 3KMIA 3VAYA 3ZTZA 1JOGA 4P9TA 5KYXA 2QNLA 2VASA 3JRMO 4JIOA 5F5FA 3EH2A 4BJ6A 5L0CA 2HS5A 3B9QA 5DQZA 4O6NA 2DYRC 2Q00A 3ZTMA 2MYSA 3AGUA 1VYKA 2Y3HA 5GPGB 4AK9A 2TMVP 2VB6A 4GYTA 3RQGA 2XLDA 1NBBA 4NY3A 1JAFA 1MNEA 2R7RA 1U89A 2YHSA 4YT4A 1T6QA 3L34A 2VCCA 2J9WA 4Z9IA 1RMVA 3V5ZA 2VCAA 2R25A 3L8IA 1HMOA 3LNRA 2ZXWC 4N6CA 2XLWA 2J9VA 2L6HA 1U6HA 2XLEA 4XQ1A 3RKOF 2EILC 4BPMA 2L6GA 2OJED 1SYQA 3U3BA 3DE8A 1KTMA 3EQLF 2NUPA 4DRJB 1FAPB 1JRAA 4FX5A 3ECSA 4LLCA 3K33A 3T6JA 2KSFA 3DI5A 3A11A 1TWGA 3NKDA 4U5EE 2VH3A 2YVKA 1GM5A 3HJCA 1QSPA 1MMDA 2LD6A 3Q6MA 2J45A 3FMSA 2JPUA 1TWCA 4MS2A 2A6HF 3LLIA 1H9TA 4KNVA 1NU9C 3B0UX 2R7OA 4CDVA 4LDKA 5JT4A 2D5RB 3R2PA 1KU2A 1EI7A 2FAPB 1MNDA 1OXBA 3E9VA 1IZMA 3TOLA 4DOZA 4DVYP 1D1AA 4C7OB 5KYNA 4MVSA 4EBBA 4O7GA 5DS6A 4WJ0A 3J06A 5E3CA 3ZVRA 2R03A 2X51A 3VM6A 3S0XA 3RQEA 5L0FA 1W2WA 2MWQA 1NG1A 5BQIA 1R4TA 5COMA 2OU6A 3TQOA 4JKVA 4PJJA 4NTAA 1RCPA 5KYWB 5COFA 4DXWA 1MMGA 3GEEA 4EHPA 1I5NA 3T6GB 1V74B 5JLIA 2FFHA 4YL3A 1PD1A 3ABKC 3LS0A 1XZQA 3NRHA 3C8GB 2PX0A 4A4AA 4D4NA 2AU5A 5CI8A 4YWQA 4U5DE 4AE4B 5JP7A 2L6FA 3V5YA 3LLKA 1YJGA 3EPVA 3I4UA 4HEAJ 5JVEA 4OIPF 4KNWA 2R02A 3LNMB 4PFPA 2PX3A 2A68F 3ZQYA 5B1AC 2R7SA 1L7CA 2ZPAA 4JEBA 4ULVA 3EGDB 3DE9A 3QW1A 4XEKA 2LFDA 5F28E 3ZIBA 1YDIA 2WVNA 3OA1A 4U9EA 3TULA 3MLGA 2KNHA 4EBKA 2PF4E 3Q7LA 5EHHA 4G7OF 4Z9JA 2NUTB 3ABMC 1PCXA 1RJ9B 3KL4A 4DRIB 4MW3A 3TD7A 1ORYA 1YYJA 3FOPA 4DVZA 5EGYA 3JYHA 2I8BA 1JPJA 2LCHA 3EG9B 3U9JA 256BA 2XM0A 3S27A 2O9XA 3A9CA 4YL0A 4IWBA 2YL7A 4N06A 2QUPA 3DMDA 4U5GA 5A6JA 3VYWA 4CBEA 3DKAA 5E33A 1G8XA 5DQTA 5HSWA 1KNYA 4ZLCA 2CNWD 1O5HA 2XRHA 2YLDA 4YJWA 1EA8A 5COGA 2H8AA 5T1DB 3MFNA 4MQ9F 3QTHA 3UR3C 2PBEA 4FESA 4L6RA 4MVRA 4XTKA 2LP4A 4OIOF 2HMZA 1LS4A 4MVMA 3C62A 2H7VC 3N2ZB 2IBFA 1K05A 1OW6A 3MYFA 3LUTB 3B71A 3I5QA 4EIYA 2YKZA 1YAUO 1ZHZA 3HTKC 4FAPB 1QPUA 5BQHA 4IARA 2R7UA 3KYIA 4CSAC 1JMWA 1BBHA 1RKEA 2J9BA 2KQ9A 4CS9A 2QY9A 1Q0GA 1T6IA 2Y3DA 2KYHA 1I4ZA 1FMVA 4CIHA 1M57C 4KI2A 3FOOA 2KGOA 2PNOA 1FR0A 1APCA 3K7DA 4XWJA 1MMAA 3S29A 2BL2A 2Y69C 4IJJA 3FHDA 3S28A 2VC9A 4LLEA 3LS1A 4CJOA 4YL1A 4EWCA 1VTMP 1A7DA 1VMAA 3SXZA 3T6BA 2OOCA 4MNDA 2MHRA 1H9GA 3V5XA 3IPMO 3OWTA 4NTBA 3U8VA 5L0GA 4PR9A 4QI2A 3MBGA 1NU7D 1WOLA 3GEIA 4CDAA 2G62A 1LS1A 2IXPA 3H2UA 1FNTc 2R7TA 4Q4ZF 2YQYA 1RKCA 1TKNA 3DAGA 1EKYA 3JZ0A 3GORA 3S9OA 3FAPB 1LE4A 3CAXA 3U8PA 3M1CB 2BC5A 2CNWA 3C8GA 3U3FA 1Z63A 4XPYA 2A6EF 1CPQA 2GAQA 5JSLA 3SEOA 2H7OA 3O39A 4AE4A 3M15A 3HNJA 3KH2A 4W8PA 2IYLD 2AWCA 4OIRF 3K1HA 2P61A 5F5HA 3UNGC 1TWHA 1LE2A 2GA0A 2W4MA 1CGNA 1FMWA 2WVQA 4JVSA 1SR2A 3GODA 2OJQA 3N0TA 4JTDB 2CW0F 1M2VA 3DM5A 3KKBA 2R05A 3EGDA 3UMIA 3AG1C 3NG1A 2UUIA 3I5PA 1FFTC 4RDAA 4E18A 2GWWA 1Z3IX 1Z6AA 1NFNA 1C02A 2PFDA 4I1OB 1TWAA 1H6GA 2CDQA 4G7HF 1QVXA 3DD7A 1Z23A 1Q0KA 3ZQVA 1AEPA 3EFOA 5T3WA 3TJ5A 4CS9C 4E0IA 2LFFA 3U2LA 4C3DA 3RH3A 4R32A 4ONSA 1RJ9A 3EGXB 3QVYA 5DLJA 3W2VA 2P1AA 3AG4C 4NQFA 4K1OA 2J7PA 2HSQA 3EG9A 3UGPA 4BEMJ 2R7XA 3GM3A 4IB4A 2Q9BA 2Q4FA 4JJFA 2IXNA 4N6HA 3PMRA 2IM8A 1ZHTA 2HKVA 1LPEA 3CQZA 2WZFA 3B29A 4PJMA 5T3TA 4DJ9A 4QI0A 2YL0A 3RF3A 1J8YF 1A0BA 1T9KA 4WABA 1L3PA 2X0CA 3SXYA 1HE9A 3IHUA 3IQTA 1O3UA 4EKWA 3U9MA 3TJ6A 1IW7F 3DXJF 3PHF2 4I44A 4KC9A 4PJNA 2AVKA 3ZG1A 2HV7A 4Z9HA 3T9OA 1K04A 4PK4A 1C17M 4PACA 2XS8A 3LAYA 4W8KA 5JS5A 1BDJB 4J7TA 4MTFA 4CX9A 1D1BA 1VLSA 3X2QC 1DOWA 1WGWA 1E85A 2IXOA 3QZCA 2KK1A 2B0HA 3W2WA 2M64A 4BJ1A 3NYJA 3GM1A 3U5SA 3HLZA 2OCCC 4BJ5A 1LKXA 4P9FA 1M2OA 3U0CA 4J30B 1F1MA 2I15A 4BEJA 3H65A 1QZXA 3DAFA 3NKEA 2Q9AA 4XPWA 1CGME 2YEVA 3L1MA 1S7ZA 2EIMC 3US6A 2CCYA 2NG1A 2LK4A 3RQFA 3SXKA 1HY5A 3CEXA 5DS4A 2E87A 4C3BA 2ZXOA 1OW8A 2L81A 3LEOA 5KYUB 1ZVZA 1TR2A 3AJMA 1OR3A 2HZ8A 3O55A 3QVZA 2QE9A 1LIHA 3JSZA 1B68A 2FGYA 3EH1A 1Z5ZA 3AG3C 3B0VC 2ZD9A 4XEFA 2R7VA 2V26A 1PD0A 4ANJA 1OCCC 1T5OA 1A41A 2G3KA 2QTVA 4K0DA 1BR4A 2EPOA 3LEVA 5E3AA 1E84A 1CPRA 1YZCA 2RD9A 3FVYA 1VK5A 1OCOC 3SNHA 3VF0A 5AC5A 3C8GD 4JJGA 2EPKX 3SZRA 3W8HA 4K7BA 4AL1A 5L3VA 4G78A 4CDYA 3WODF 2HFIA 3F47A 3UMKA 1MQVA 2XS1A 3IQ6A 4CS8A 3PDMP 2Q9CA 3ABLC 3DJNB 4I1MA 1PV3A 4M63A 1GQAA 4LDRA 1FFHA 3M4BA 3DM9B 4YT5A 2EIKC 1Y4CA 4HFKB 3FXHA 4O79A 3FDQA 4CSAA 4OIQF 2JD3A 1E2XA 1V55C 1T6UA 2XL6A 1ZHYA 2WZGA 4O6YA 2HMQA 3Q7GA 4OD4A 1VB5A 2DI3A 3RFYA 1OCZC 4IGGA 4JZAA 1YA7O 4U9DA 4HE8D 3ASNC 3EGXA 5DS5A 3EZIA 1V54C 3SYNA 4KBLA 2EPNA 1ZU5A 3W4YA 1NLXA 3G4XA 3K6BA 4JC7A 4XLNF 4JTAB 3ZSUA 5L0JA 5KYYB 2ICWG 3GWNA 3G4ZA 5L0HA 4C7OA 4JW1A 4C3EA 2YLGA 4JCHA 2J7PD 1OXKA 2DB4A 4XPXA 5JRAA 2F22A 2YLIA 4LERA 1OCRC 4ULWA 2J8WA 4PFOA 4QDLA 1BZ4A 3ZDLA 3AQCA 4U5FE 2YWAA 1YYXA 1E86A 2M4EA 3O6XA 4BJTA 4G7ZF 4RBNA 3C8ZA 2KC3A 2LQGA 1QLEC 1VYIA 3KYJA 1M6TA 1ZW3A 2Z15A 2NSGA 4F4BA 5B3IA 3K1IC 4MVUA 1ZHXA 3CZ6A 5BQGA 3RVYA 3NMIA 1ZZPA 5TJ5E 4B6IA 1ZW2A 3NMKA 4JRZA 2LSEA 3H2VA 2DGJA 2C04A 3F46A 3HNKA 4X0RA 3X1OA 2ETSA 1OKKA 2KW3C 2R9RB 2YL1A 4DRHB 3ATPA 1GS9A 3JYYA 3ZC4A 4G0HA 2XLHA 1YLMA 1GGQA 1Y6DA 4Q7CA 2J9UA 1M56C 4AX2A 1QKRA 3SP1A 4OD5A 3C18A 1T01A 4J32B 4MVOA 1JPNA 1LM3B 3SXMA 3M79A 3LESA 3G50A 5D92A 3JSEO 3R7CA
chains in the Genus database with same CATH topology
4JEAA 5AGFA 1YYJA 3FOPA 1E83A 4D4XA 3IQ5A 3TOMA 5JS5A 4CX9A 256BA 2XM0A 1E85A 5JUAA 4CIPA 2YL7A 3QW0A 3M4CA 4N4WA 4JE9A 4CJGA 2YLDA 3ZTZA 1A7VA 4L6RA 4ER9A 3L1MA 2CCYA 3C62A 2XLMA 3ZTMA 4EIYA 2YKZA 1QPUA 4IARA 2XLDA 1NBBA 1BBHA 1JAFA 2J9BA 3QVZA 2XLWA 2XLEA 3FOOA 1E84A 1APCA 1CPRA 1YZCA 1QQ3A 2XM4A 3DE8A 4CJOA 4CDYA 1MQVA 2QLAA 3IQ6A 3HNIA 2XLOA 4CDAA 1GQAA 2YL3A 3C63A 3M4BA 1EKYA 2XL6A 4CDVA 5JT4A 3U8PA 3TOLA 4NC3A 2BC5A 4U9DA 1CPQA 3HNLA 5JSLA 3M15A 3HNJA 1CGNA 2YLGA 5JRAA 4WGYA 2YLIA 4JKVA 1CGOA 4WGZA 2J8WA 1RCPA 1E86A 2XLVA 1YYXA 1YZAA 3ZQVA 5JLIA 3VRCA 4IAQA 1M6TA 4D4NA 1S05A 3QVYA 5B3IA 3NMJA 3NMIA 5JP7A 3NMKA 5JVEA 3HNKA 4IB4A 3ZQYA 4N6HA 4JEBA 2YL1A 4ULVA 3DE9A 3QW1A 2YL0A 2XLHA 4U9EA 2XL8A 1LM3B 3M79A 3ZWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEA A;  5AGF A;  1YYJ A;  3FOP A;  1E83 A;  4D4X A;  3IQ5 A;  3TOM A;  5JS5 A;  4CX9 A;  256B A;  2XM0 A;  1E85 A;  5JUA A;  4CIP A;  2YL7 A;  3QW0 A;  3M4C A;  4N4W A;  4JE9 A;  4CJG A;  2YLD A;  3ZTZ A;  1A7V A;  4L6R A;  4ER9 A;  3L1M A;  2CCY A;  3C62 A;  2XLM A;  3ZTM A;  4EIY A;  2YKZ A;  1QPU A;  4IAR A;  2XLD A;  1NBB A;  1BBH A;  1JAF A;  2J9B A;  3QVZ A;  2XLW A;  2XLE A;  3FOO A;  1E84 A;  1APC A;  1CPR A;  1YZC A;  1QQ3 A;  2XM4 A;  3DE8 A;  4CJO A;  4CDY A;  1MQV A;  2QLA A;  3IQ6 A;  3HNI A;  2XLO A;  4CDA A;  1GQA A;  2YL3 A;  3C63 A;  3M4B A;  1EKY A;  2XL6 A;  4CDV A;  5JT4 A;  3U8P A;  3TOL A;  4NC3 A;  2BC5 A;  4U9D A;  1CPQ A;  3HNL A;  5JSL A;  3M15 A;  3HNJ A;  1CGN A;  2YLG A;  5JRA A;  4WGY A;  2YLI A;  4JKV A;  1CGO A;  4WGZ A;  2J8W A;  1RCP A;  1E86 A;  2XLV A;  1YYX A;  1YZA A;  3ZQV A;  5JLI A;  3VRC A;  4IAQ A;  1M6T A;  4D4N A;  1S05 A;  3QVY A;  5B3I A;  3NMJ A;  3NMI A;  5JP7 A;  3NMK A;  5JVE A;  3HNK A;  4IB4 A;  3ZQY A;  4N6H A;  4JEB A;  2YL1 A;  4ULV A;  3DE9 A;  3QW1 A;  2YL0 A;  2XLH A;  4U9E A;  2XL8 A;  1LM3 B;  3M79 A;  3ZWI A; 
#chains in the Genus database with same CATH topology
 3NYM A;  4JEA A;  4BJ6 C;  1RXQ A;  3E70 C;  5CIV A;  4JCZ A;  4D4X A;  1HW1 A;  1SMY F;  2EIN C;  3TOM A;  2NUT A;  1ORJ A;  1R5I D;  4LAC B;  3GAN A;  1H7I A;  3NDB B;  2C03 A;  2PP4 A;  4CIP A;  5JUA A;  5KYU A;  2AWY A;  1YA9 A;  2W9Y A;  5A6A A;  1D1C A;  3W8I A;  2R7W A;  2HUJ A;  3S84 A;  1WTY A;  4GEH A;  4IAO A;  3B0P A;  4N4W A;  1TQG A;  3PCV A;  2Y39 A;  2BE5 F;  3IEE A;  3FAJ A;  4JE9 A;  4CJG A;  3JTL O;  3L8J A;  2WZL A;  1A7V A;  2UUH A;  1D0Y A;  3LJB A;  1WWP A;  2A69 F;  2EPL X;  4CS7 A;  4LDQ A;  4XEV A;  4ER9 A;  3S90 A;  4GQH A;  4H54 A;  3DJU B;  1RKE B;  4JTC B;  2XLM A;  5K0I A;  1UG7 A;  2W45 A;  2IOQ A;  2R7Q A;  3JCU Q;  3TK0 A;  4DBQ A;  3RVZ A;  1D0Z A;  2KJG A;  1MMN A;  3O10 A;  2H7B A;  2NSF A;  3KPH A;  2HSB A;  4FWV A;  2A0U A;  2Y3G A;  3IQC A;  1LI5 A;  4H4K C;  5FCL A;  5D91 A;  2XL4 A;  4MTG A;  1SZI A;  3WAQ A;  4IRU A;  5E2Q A;  2EPM X;  2P6V A;  4HFF B;  1ORS C;  1TFK B;  1WAT A;  2AP3 A;  2HV6 A;  4XLP F;  1J8M F;  3JRT A;  1OR2 A;  5A6B D;  3EHN A;  5KYX B;  1QQ3 A;  1ST6 A;  2XM4 A;  3ITF A;  1BR1 A;  5KYY A;  3DZA A;  1K40 A;  4E7S A;  1SF8 A;  2Y3B A;  5IY5 C;  2QLA A;  1XWJ A;  3HNI A;  2XLO A;  1NFO A;  1OQC A;  3OEO A;  4NTF A;  3JT1 A;  4NCQ A;  1G4U S;  4ZLD A;  2A0B A;  2YL3 A;  3AOU A;  3C63 A;  3EZH A;  3UMH A;  5AC4 A;  1BR2 A;  2Q7R A;  2A1D D;  3MX3 A;  2VCB A;  3BRJ A;  4NC3 A;  2JX0 A;  3EHM A;  1LI7 A;  4E7Z A;  4YT8 A;  2GFH A;  2J0W A;  2WL8 A;  3K66 A;  1Q0F A;  1Q0D A;  2ZXP A;  3HNL A;  2P7V A;  3L0I A;  4MTO A;  1FTS A;  4YT2 A;  1U0B B;  2YZS A;  1VLT A;  1I4Y A;  4UDV A;  3EJN A;  2NUP B;  1M2V B;  1G5Z A;  1HW2 A;  4RD9 A;  4BJ5 C;  4YK5 A;  1A7E A;  2J46 A;  1XZP A;  1D0X A;  2Q3T A;  1Q0M A;  1G4W R;  1YAR O;  4U5C E;  4WGY A;  4YN0 B;  5FZT A;  1ZYR F;  1CGO A;  2HJ3 A;  3EFO B;  3GEH A;  1HE1 A;  4WGZ A;  2CYD A;  1OKK D;  4OIN F;  2DYS C;  3RYL A;  5L0D A;  1UFB A;  2IXM A;  4PJL A;  2XLV A;  5KYW A;  2OKU A;  3GWL A;  2L7A A;  2B0J A;  1YZA A;  5CI9 A;  1Z7Q c;  4IAQ A;  3VRC A;  3HKK A;  4MW8 A;  5A6K A;  3AGT A;  1NSG B;  3NYL A;  2XXA A;  3GM2 A;  3RW0 A;  4JUR I;  3T4R A;  1S05 A;  3NMJ A;  2LIG A;  3CSK A;  4P6I C;  5EK0 A;  3POV A;  2WB7 A;  3WG7 C;  4E0H A;  3QMK A;  2OEV A;  5A69 A;  5A6B A;  3MYI A;  4MVQ A;  2V3C C;  2G3V A;  2OQM A;  2P0N A;  1YVI A;  1VOM A;  1N1C A;  4A2N B;  2EIJ C;  5L3Q A;  3ASO C;  2GDC A;  3UGO A;  1C03 A;  5L0I A;  1OW7 A;  3RIP A;  2ASR A;  1LVK A;  1ZU4 A;  2XXA B;  4E17 A;  2WVO A;  2XL8 A;  1AVO B;  2CGE A;  2XSE A;  4EBJ A;  4EUK B;  1TFO B;  2J0X A;  4CS8 C;  5B1B C;  3ZWI A;  4U5H A;  2ZXR A;  3BEH A;  3N24 A;  2D4U A;  3WHN A;  5AGF A;  4Q5S F;  4J7Y A;  2OEX A;  1E83 A;  3IQ5 A;  3K1I A;  4DBR A;  1WAS A;  2NPU A;  1HMD A;  4BG0 A;  5BUO A;  4I3M A;  3V7O A;  2HJM A;  1EQ1 A;  1AUE A;  3Q6N A;  2YRF A;  3AG2 C;  2L9J A;  3DWW A;  3QW0 A;  5HV9 A;  4AL0 A;  3M4C A;  2OG2 A;  1DOV A;  1NZE A;  3C7J A;  1V4A A;  4U5B E;  5DVW A;  3U2M A;  5B3S C;  1JR8 A;  3AQB A;  1O87 A;  1WN0 A;  2W4B A;  4MVZ A;  2RSE B;  4O6M A;  1ZHW A;  3KMI A;  3VAY A;  3ZTZ A;  1JOG A;  4P9T A;  5KYX A;  2QNL A;  2VAS A;  3JRM O;  4JIO A;  5F5F A;  3EH2 A;  4BJ6 A;  5L0C A;  2HS5 A;  3B9Q A;  5DQZ A;  4O6N A;  2DYR C;  2Q00 A;  3ZTM A;  2MYS A;  3AGU A;  1VYK A;  2Y3H A;  5GPG B;  4AK9 A;  2TMV P;  2VB6 A;  4GYT A;  3RQG A;  2XLD A;  1NBB A;  4NY3 A;  1JAF A;  1MNE A;  2R7R A;  1U89 A;  2YHS A;  4YT4 A;  1T6Q A;  3L34 A;  2VCC A;  2J9W A;  4Z9I A;  1RMV A;  3V5Z A;  2VCA A;  2R25 A;  3L8I A;  1HMO A;  3LNR A;  2ZXW C;  4N6C A;  2XLW A;  2J9V A;  2L6H A;  1U6H A;  2XLE A;  4XQ1 A;  3RKO F;  2EIL C;  4BPM A;  2L6G A;  2OJE D;  1SYQ A;  3U3B A;  3DE8 A;  1KTM A;  3EQL F;  2NUP A;  4DRJ B;  1FAP B;  1JRA A;  4FX5 A;  3ECS A;  4LLC A;  3K33 A;  3T6J A;  2KSF A;  3DI5 A;  3A11 A;  1TWG A;  3NKD A;  4U5E E;  2VH3 A;  2YVK A;  1GM5 A;  3HJC A;  1QSP A;  1MMD A;  2LD6 A;  3Q6M A;  2J45 A;  3FMS A;  2JPU A;  1TWC A;  4MS2 A;  2A6H F;  3LLI A;  1H9T A;  4KNV A;  1NU9 C;  3B0U X;  2R7O A;  4CDV A;  4LDK A;  5JT4 A;  2D5R B;  3R2P A;  1KU2 A;  1EI7 A;  2FAP B;  1MND A;  1OXB A;  3E9V A;  1IZM A;  3TOL A;  4DOZ A;  4DVY P;  1D1A A;  4C7O B;  5KYN A;  4MVS A;  4EBB A;  4O7G A;  5DS6 A;  4WJ0 A;  3J06 A;  5E3C A;  3ZVR A;  2R03 A;  2X51 A;  3VM6 A;  3S0X A;  3RQE A;  5L0F A;  1W2W A;  2MWQ A;  1NG1 A;  5BQI A;  1R4T A;  5COM A;  2OU6 A;  3TQO A;  4JKV A;  4PJJ A;  4NTA A;  1RCP A;  5KYW B;  5COF A;  4DXW A;  1MMG A;  3GEE A;  4EHP A;  1I5N A;  3T6G B;  1V74 B;  5JLI A;  2FFH A;  4YL3 A;  1PD1 A;  3ABK C;  3LS0 A;  1XZQ A;  3NRH A;  3C8G B;  2PX0 A;  4A4A A;  4D4N A;  2AU5 A;  5CI8 A;  4YWQ A;  4U5D E;  4AE4 B;  5JP7 A;  2L6F A;  3V5Y A;  3LLK A;  1YJG A;  3EPV A;  3I4U A;  4HEA J;  5JVE A;  4OIP F;  4KNW A;  2R02 A;  3LNM B;  4PFP A;  2PX3 A;  2A68 F;  3ZQY A;  5B1A C;  2R7S A;  1L7C A;  2ZPA A;  4JEB A;  4ULV A;  3EGD B;  3DE9 A;  3QW1 A;  4XEK A;  2LFD A;  5F28 E;  3ZIB A;  1YDI A;  2WVN A;  3OA1 A;  4U9E A;  3TUL A;  3MLG A;  2KNH A;  4EBK A;  2PF4 E;  3Q7L A;  5EHH A;  4G7O F;  4Z9J A;  2NUT B;  3ABM C;  1PCX A;  1RJ9 B;  3KL4 A;  4DRI B;  4MW3 A;  3TD7 A;  1ORY A;  1YYJ A;  3FOP A;  4DVZ A;  5EGY A;  3JYH A;  2I8B A;  1JPJ A;  2LCH A;  3EG9 B;  3U9J A;  256B A;  2XM0 A;  3S27 A;  2O9X A;  3A9C A;  4YL0 A;  4IWB A;  2YL7 A;  4N06 A;  2QUP A;  3DMD A;  4U5G A;  5A6J A;  3VYW A;  4CBE A;  3DKA A;  5E33 A;  1G8X A;  5DQT A;  5HSW A;  1KNY A;  4ZLC A;  2CNW D;  1O5H A;  2XRH A;  2YLD A;  4YJW A;  1EA8 A;  5COG A;  2H8A A;  5T1D B;  3MFN A;  4MQ9 F;  3QTH A;  3UR3 C;  2PBE A;  4FES A;  4L6R A;  4MVR A;  4XTK A;  2LP4 A;  4OIO F;  2HMZ A;  1LS4 A;  4MVM A;  3C62 A;  2H7V C;  3N2Z B;  2IBF A;  1K05 A;  1OW6 A;  3MYF A;  3LUT B;  3B71 A;  3I5Q A;  4EIY A;  2YKZ A;  1YAU O;  1ZHZ A;  3HTK C;  4FAP B;  1QPU A;  5BQH A;  4IAR A;  2R7U A;  3KYI A;  4CSA C;  1JMW A;  1BBH A;  1RKE A;  2J9B A;  2KQ9 A;  4CS9 A;  2QY9 A;  1Q0G A;  1T6I A;  2Y3D A;  2KYH A;  1I4Z A;  1FMV A;  4CIH A;  1M57 C;  4KI2 A;  3FOO A;  2KGO A;  2PNO A;  1FR0 A;  1APC A;  3K7D A;  4XWJ A;  1MMA A;  3S29 A;  2BL2 A;  2Y69 C;  4IJJ A;  3FHD A;  3S28 A;  2VC9 A;  4LLE A;  3LS1 A;  4CJO A;  4YL1 A;  4EWC A;  1VTM P;  1A7D A;  1VMA A;  3SXZ A;  3T6B A;  2OOC A;  4MND A;  2MHR A;  1H9G A;  3V5X A;  3IPM O;  3OWT A;  4NTB A;  3U8V A;  5L0G A;  4PR9 A;  4QI2 A;  3MBG A;  1NU7 D;  1WOL A;  3GEI A;  4CDA A;  2G62 A;  1LS1 A;  2IXP A;  3H2U A;  1FNT c;  2R7T A;  4Q4Z F;  2YQY A;  1RKC A;  1TKN A;  3DAG A;  1EKY A;  3JZ0 A;  3GOR A;  3S9O A;  3FAP B;  1LE4 A;  3CAX A;  3U8P A;  3M1C B;  2BC5 A;  2CNW A;  3C8G A;  3U3F A;  1Z63 A;  4XPY A;  2A6E F;  1CPQ A;  2GAQ A;  5JSL A;  3SEO A;  2H7O A;  3O39 A;  4AE4 A;  3M15 A;  3HNJ A;  3KH2 A;  4W8P A;  2IYL D;  2AWC A;  4OIR F;  3K1H A;  2P61 A;  5F5H A;  3UNG C;  1TWH A;  1LE2 A;  2GA0 A;  2W4M A;  1CGN A;  1FMW A;  2WVQ A;  4JVS A;  1SR2 A;  3GOD A;  2OJQ A;  3N0T A;  4JTD B;  2CW0 F;  1M2V A;  3DM5 A;  3KKB A;  2R05 A;  3EGD A;  3UMI A;  3AG1 C;  3NG1 A;  2UUI A;  3I5P A;  1FFT C;  4RDA A;  4E18 A;  2GWW A;  1Z3I X;  1Z6A A;  1NFN A;  1C02 A;  2PFD A;  4I1O B;  1TWA A;  1H6G A;  2CDQ A;  4G7H F;  1QVX A;  3DD7 A;  1Z23 A;  1Q0K A;  3ZQV A;  1AEP A;  3EFO A;  5T3W A;  3TJ5 A;  4CS9 C;  4E0I A;  2LFF A;  3U2L A;  4C3D A;  3RH3 A;  4R32 A;  4ONS A;  1RJ9 A;  3EGX B;  3QVY A;  5DLJ A;  3W2V A;  2P1A A;  3AG4 C;  4NQF A;  4K1O A;  2J7P A;  2HSQ A;  3EG9 A;  3UGP A;  4BEM J;  2R7X A;  3GM3 A;  4IB4 A;  2Q9B A;  2Q4F A;  4JJF A;  2IXN A;  4N6H A;  3PMR A;  2IM8 A;  1ZHT A;  2HKV A;  1LPE A;  3CQZ A;  2WZF A;  3B29 A;  4PJM A;  5T3T A;  4DJ9 A;  4QI0 A;  2YL0 A;  3RF3 A;  1J8Y F;  1A0B A;  1T9K A;  4WAB A;  1L3P A;  2X0C A;  3SXY A;  1HE9 A;  3IHU A;  3IQT A;  1O3U A;  4EKW A;  3U9M A;  3TJ6 A;  1IW7 F;  3DXJ F;  3PHF 2;  4I44 A;  4KC9 A;  4PJN A;  2AVK A;  3ZG1 A;  2HV7 A;  4Z9H A;  3T9O A;  1K04 A;  4PK4 A;  1C17 M;  4PAC A;  2XS8 A;  3LAY A;  4W8K A;  5JS5 A;  1BDJ B;  4J7T A;  4MTF A;  4CX9 A;  1D1B A;  1VLS A;  3X2Q C;  1DOW A;  1WGW A;  1E85 A;  2IXO A;  3QZC A;  2KK1 A;  2B0H A;  3W2W A;  2M64 A;  4BJ1 A;  3NYJ A;  3GM1 A;  3U5S A;  3HLZ A;  2OCC C;  4BJ5 A;  1LKX A;  4P9F A;  1M2O A;  3U0C A;  4J30 B;  1F1M A;  2I15 A;  4BEJ A;  3H65 A;  1QZX A;  3DAF A;  3NKE A;  2Q9A A;  4XPW A;  1CGM E;  2YEV A;  3L1M A;  1S7Z A;  2EIM C;  3US6 A;  2CCY A;  2NG1 A;  2LK4 A;  3RQF A;  3SXK A;  1HY5 A;  3CEX A;  5DS4 A;  2E87 A;  4C3B A;  2ZXO A;  1OW8 A;  2L81 A;  3LEO A;  5KYU B;  1ZVZ A;  1TR2 A;  3AJM A;  1OR3 A;  2HZ8 A;  3O55 A;  3QVZ A;  2QE9 A;  1LIH A;  3JSZ A;  1B68 A;  2FGY A;  3EH1 A;  1Z5Z A;  3AG3 C;  3B0V C;  2ZD9 A;  4XEF A;  2R7V A;  2V26 A;  1PD0 A;  4ANJ A;  1OCC C;  1T5O A;  1A41 A;  2G3K A;  2QTV A;  4K0D A;  1BR4 A;  2EPO A;  3LEV A;  5E3A A;  1E84 A;  1CPR A;  1YZC A;  2RD9 A;  3FVY A;  1VK5 A;  1OCO C;  3SNH A;  3VF0 A;  5AC5 A;  3C8G D;  4JJG A;  2EPK X;  3SZR A;  3W8H A;  4K7B A;  4AL1 A;  5L3V A;  4G78 A;  4CDY A;  3WOD F;  2HFI A;  3F47 A;  3UMK A;  1MQV A;  2XS1 A;  3IQ6 A;  4CS8 A;  3PDM P;  2Q9C A;  3ABL C;  3DJN B;  4I1M A;  1PV3 A;  4M63 A;  1GQA A;  4LDR A;  1FFH A;  3M4B A;  3DM9 B;  4YT5 A;  2EIK C;  1Y4C A;  4HFK B;  3FXH A;  4O79 A;  3FDQ A;  4CSA A;  4OIQ F;  2JD3 A;  1E2X A;  1V55 C;  1T6U A;  2XL6 A;  1ZHY A;  2WZG A;  4O6Y A;  2HMQ A;  3Q7G A;  4OD4 A;  1VB5 A;  2DI3 A;  3RFY A;  1OCZ C;  4IGG A;  4JZA A;  1YA7 O;  4U9D A;  4HE8 D;  3ASN C;  3EGX A;  5DS5 A;  3EZI A;  1V54 C;  3SYN A;  4KBL A;  2EPN A;  1ZU5 A;  3W4Y A;  1NLX A;  3G4X A;  3K6B A;  4JC7 A;  4XLN F;  4JTA B;  3ZSU A;  5L0J A;  5KYY B;  2ICW G;  3GWN A;  3G4Z A;  5L0H A;  4C7O A;  4JW1 A;  4C3E A;  2YLG A;  4JCH A;  2J7P D;  1OXK A;  2DB4 A;  4XPX A;  5JRA A;  2F22 A;  2YLI A;  4LER A;  1OCR C;  4ULW A;  2J8W A;  4PFO A;  4QDL A;  1BZ4 A;  3ZDL A;  3AQC A;  4U5F E;  2YWA A;  1YYX A;  1E86 A;  2M4E A;  3O6X A;  4BJT A;  4G7Z F;  4RBN A;  3C8Z A;  2KC3 A;  2LQG A;  1QLE C;  1VYI A;  3KYJ A;  1M6T A;  1ZW3 A;  2Z15 A;  2NSG A;  4F4B A;  5B3I A;  3K1I C;  4MVU A;  1ZHX A;  3CZ6 A;  5BQG A;  3RVY A;  3NMI A;  1ZZP A;  5TJ5 E;  4B6I A;  1ZW2 A;  3NMK A;  4JRZ A;  2LSE A;  3H2V A;  2DGJ A;  2C04 A;  3F46 A;  3HNK A;  4X0R A;  3X1O A;  2ETS A;  1OKK A;  2KW3 C;  2R9R B;  2YL1 A;  4DRH B;  3ATP A;  1GS9 A;  3JYY A;  3ZC4 A;  4G0H A;  2XLH A;  1YLM A;  1GGQ A;  1Y6D A;  4Q7C A;  2J9U A;  1M56 C;  4AX2 A;  1QKR A;  3SP1 A;  4OD5 A;  3C18 A;  1T01 A;  4J32 B;  4MVO A;  1JPN A;  1LM3 B;  3SXM A;  3M79 A;  3LES A;  3G50 A;  5D92 A;  3JSE O;  3R7C A; 
#chains in the Genus database with same CATH homology
 4JEA A;  5AGF A;  1YYJ A;  3FOP A;  1E83 A;  4D4X A;  3IQ5 A;  3TOM A;  5JS5 A;  4CX9 A;  256B A;  2XM0 A;  1E85 A;  5JUA A;  4CIP A;  2YL7 A;  3QW0 A;  3M4C A;  4N4W A;  4JE9 A;  4CJG A;  2YLD A;  3ZTZ A;  1A7V A;  4L6R A;  4ER9 A;  3L1M A;  2CCY A;  3C62 A;  2XLM A;  3ZTM A;  4EIY A;  2YKZ A;  1QPU A;  4IAR A;  2XLD A;  1NBB A;  1BBH A;  1JAF A;  2J9B A;  3QVZ A;  2XLW A;  2XLE A;  3FOO A;  1E84 A;  1APC A;  1CPR A;  1YZC A;  1QQ3 A;  2XM4 A;  3DE8 A;  4CJO A;  4CDY A;  1MQV A;  2QLA A;  3IQ6 A;  3HNI A;  2XLO A;  4CDA A;  1GQA A;  2YL3 A;  3C63 A;  3M4B A;  1EKY A;  2XL6 A;  4CDV A;  5JT4 A;  3U8P A;  3TOL A;  4NC3 A;  2BC5 A;  4U9D A;  1CPQ A;  3HNL A;  5JSL A;  3M15 A;  3HNJ A;  1CGN A;  2YLG A;  5JRA A;  4WGY A;  2YLI A;  4JKV A;  1CGO A;  4WGZ A;  2J8W A;  1RCP A;  1E86 A;  2XLV A;  1YYX A;  1YZA A;  3ZQV A;  5JLI A;  3VRC A;  4IAQ A;  1M6T A;  4D4N A;  1S05 A;  3QVY A;  5B3I A;  3NMJ A;  3NMI A;  5JP7 A;  3NMK A;  5JVE A;  3HNK A;  4IB4 A;  3ZQY A;  4N6H A;  4JEB A;  2YL1 A;  4ULV A;  3DE9 A;  3QW1 A;  2YL0 A;  2XLH A;  4U9E A;  2XL8 A;  1LM3 B;  3M79 A;  3ZWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...