5JSLA

The l16f mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jslA00
4IB4A 3TOLA 1CGNA 3QVZA 256BA 5B3IA 3HNKA 5AGFA 5JP7A 3C62A 1CPRA 3M15A 4N6HA 1E83A 1EKYA 5JUAA 3HNIA 3ZWIA 2QLAA 5JT4A 3ZQVA 2XLMA 4EIYA 2XL6A 1NBBA 2YL0A 3C63A 1APCA 4WGYA 3IQ6A 5JRAA 1YZCA 3FOOA 4IAQA 4CIPA 1YYXA 3FOPA 2XLHA 4CDAA 3QW1A 4N4WA 2BC5A 4WGZA 2YKZA 3HNJA 1LM3B 2J9BA 3DE8A 1E85A 4L6RA 3NMIA 3QW0A 3ZTZA 3VRCA 3L1MA 1S05A 1QQ3A 2YLIA 1E84A 1GQAA 2YLDA 2XM0A 3NMJA 2CCYA 2J8WA 3ZTMA 1CGOA 4CX9A 1QPUA 1BBHA 4CDYA 5JLIA 2XLOA 2XLWA 3QVYA 1YYJA 4JEBA 3HNLA 1MQVA 2YL3A 4U9EA 3NMKA 4IARA 5JSLA 1E86A 2YL1A 4D4NA 2XL8A 4U9DA 3IQ5A 3M4CA 4JEAA 4CJGA 2YL7A 5JS5A 5JVEA 3M79A 1CPQA 3M4BA 1YZAA 4ER9A 2YLGA 4NC3A 1JAFA 4CDVA 3ZQYA 4JE9A 4D4XA 4ULVA 2XLEA 1M6TA 3DE9A 3TOMA 2XLDA 2XM4A 1RCPA 3U8PA 1A7VA 4CJOA 4JKVA 2XLVA
chains in the Genus database with same CATH superfamily
1NU9C 4IB4A 1FMVA 1XZPA 3W8HA 3IQTA 256BA 1Q0KA 3U5SA 4K7BA 3NYLA 2TMVP 4A4AA 1U0BB 4BEMJ 1D0YA 1V4AA 3C62A 4U5EE 1ZHYA 3ABLC 4JW1A 5DLJA 3IHUA 2P61A 3MLGA 1TQGA 3SEOA 2LQGA 2KGOA 3UNGC 1PV3A 3EGXA 2VCCA 3GANA 3H2VA 1VOMA 3HNIA 4GEHA 3JCUQ 3FAPB 3TJ6A 2OG2A 3WHNA 3ZWIA 4ANJA 5JT4A 2L6HA 3U9MA 3HJCA 1DOWA 4JTAB 2VC9A 5COMA 5L0HA 1JOGA 2IYLD 4BJ6C 4EIYA 2V26A 1YARO 4MNDA 1KTMA 2O9XA 1FFTC 2J7PA 3JYYA 1JPNA 4P9TA 5KYYA 2Q4FA 2J9WA 3R2PA 3AG4C 2YL0A 1AEPA 2KYHA 4I1OB 5COFA 3T6BA 1APCA 3O55A 1FR0A 2LIGA 1ORSC 3IQ6A 2WL8A 1YZCA 4IAOA 4MTOA 5JRAA 3H2UA 4CS8C 1KU2A 5L0DA 1OCCC 2EPLX 4CIPA 3V5ZA 2Y3HA 1R4TA 2NUTB 4BJ1A 1M57C 2NSFA 4XWJA 1WATA 3EHMA 2J46A 1T6IA 4EBJA 1ZHWA 1TWGA 3B0PA 5GPGB 4EWCA 3ASOC 3ZC4A 3HLZA 1FAPB 3NYJA 3S90A 4CX9A 1BR2A 3HNJA 4AE4A 4HFFB 4K0DA 2FFHA 1JRAA 4LLCA 3EH1A 2XS1A 4O7GA 4FWVA 3JYHA 5F5FA 4F4BA 5BQHA 3UMHA 1RJ9A 2MHRA 4MVQA 3C8ZA 2R7TA 4XQ1A 4MW8A 4JJGA 5DVWA 2LD6A 2HJMA 4J7TA 3CAXA 5F28E 3W2VA 2LK4A 3L0IA 1G8XA 2EIJC 3ZQYA 2ZXWC 2YLDA 4YT5A 4MVOA 2IXOA 4G7HF 3WAQA 4PFPA 1CGOA 2PBEA 1GM5A 4JVSA 1FFHA 3NKDA 1BBHA 4CDYA 1EA8A 1OCOC 1YAUO 1WWPA 2GAQA 1B68A 2XLWA 5B1BC 5JLIA 1H7IA 1OXBA 2Q9BA 4I44A 4JEBA 4JURI 1Z7Qc 3CQZA 5T1DB 1HE9A 1L7CA 3U3FA 4XLPF 2KK1A 4U9EA 1V74B 5K0IA 3QZCA 4BEJA 5CIVA 2ZPAA 4YT4A 5BUOA 4JTDB 1ZW3A 4NY3A 1Z23A 1VMAA 3TULA 1A0BA 1J8YF 1KNYA 3JT1A 2Q7RA 2W45A 4K1OA 4MVUA 4D4NA 4U9DA 3H65A 1PD0A 2VB6A 4A2NB 4U5DE 4E18A 4XPYA 2KSFA 4CJGA 1JMWA 1BZ4A 2YL7A 2ZXPA 3EHNA 1FNTc 1GS9A 1OKKD 3M79A 1YZAA 1WOLA 1OQCA 4RD9A 1D1BA 1JAFA 2H7OA 4AL0A 1S7ZA 2AU5A 5KYUA 2XXAA 1K04A 2R7SA 1K40A 1RKCA 1MMGA 3C8GA 5A6BD 1NFOA 2OEVA 2R7UA 3DAFA 2R7VA 1M56C 1T5OA 2WVNA 4LACB 3RH3A 3DE9A 3TOMA 4C7OB 4XLNF 1HE1A 3AGUA 2XM4A 1ORYA 3U8PA 1A7VA 3VF0A 4WJ0A 1VB5A 3SYNA 4CJOA 3S0XA 2XLVA 4PACA 1EI7A 3LEVA 4O6NA 3T6JA 2L6GA 2MWQA 2NPUA 3HNKA 3NG1A 1T01A 4HFKB 3EQLF 1PCXA 4DBQA 2J9UA 3LS0A 4RBNA 2ZD9A 5JP7A 3M15A 2DI3A 2R7WA 4JCHA 2AP3A 4N6HA 2PP4A 2R7XA 1V54C 3GORA 5JUAA 1BR1A 1NZEA 3OWTA 1DOVA 2R03A 2QY9A 2R25A 1A41A 3G50A 4PJMA 2QLAA 1Z63A 3UMIA 2WZGA 1YDIA 2XL4A 4W8PA 2P6VA 4OIRF 4DVYP 3Q6MA 2I8BA 4MTGA 3LJBA 1OCZC 5A69A 3U2MA 1F1MA 2YRFA 2PFDA 4AK9A 1IW7F 3N24A 3B29A 3FHDA 3L8IA 3OA1A 4BJ5C 3FVYA 4ZLDA 1D1AA 5DS5A 3K66A 1VYIA 1U89A 4R32A 4PK4A 2D4UA 3I5PA 1YYXA 2Y39A 3AG1C 3DMDA 2CW0F 2GFHA 3EZIA 4KI2A 2XLHA 4YT2A 5BQIA 4MTFA 2A6EF 4MW3A 4XTKA 1MMAA 2FAPB 3MBGA 3MYFA 4C3BA 2Q9CA 3OEOA 1OXKA 4N4WA 5E3CA 3LEOA 3K1HA 1N1CA 1Y6DA 1LM3B 2J9BA 3EGDA 5HSWA 4PFOA 1OW7A 4PJNA 3QW0A 4CIHA 1H6GA 1QSPA 1LI5A 3LS1A 4DRHB 2IXPA 4OIPF 2F22A 1SR2A 3E70C 3L1MA 3VRCA 1FTSA 1AUEA 2L6FA 4XEFA 1D0ZA 5L0JA 3MFNA 1MMDA 3KYJA 3Q6NA 1GQAA 2XM0A 2G3VA 2CCYA 1OR3A 5L0GA 3ZTMA 3GM2A 2PF4E 1RKEA 3NRHA 4AL1A 3JSEO 3KPHA 1YJGA 2R7OA 3C7JA 2IBFA 3V5XA 3QVYA 5T3TA 3X2QC 2W4MA 2YHSA 4I3MA 3SXMA 3ABMC 3DZAA 3LUTB 1MQVA 3EG9A 4MVSA 4M63A 2DYSC 3VYWA 5L0CA 1Y4CA 2A1DD 2CGEA 3U2LA 4OINF 4G7OF 2AWYA 4U5FE 5L3VA 2VCAA 1LKXA 2A68F 2HV6A 3RQFA 5IY5C 4FX5A 3WG7C 4FAPB 4GYTA 2JX0A 5DS6A 1E86A 3LNRA 3U9JA 4MVZA 5EGYA 2KQ9A 3DJUB 1NU7D 3EPVA 4WABA 1M2VB 2KNHA 2WVOA 3GODA 3W2WA 3PDMP 1CPQA 4JCZA 4HEAJ 4YL3A 3T4RA 4CS9A 3SZRA 4DRIB 1NLXA 1HY5A 3JRTA 2IXNA 3EH2A 4JJFA 1LPEA 1ZVZA 2HFIA 3K33A 2AVKA 1ORJA 4YN0B 1ZZPA 2RD9A 4IGGA 4JE9A 1G4US 4NTFA 1MNDA 3KYIA 3NYMA 4D4XA 4PR9A 2XLEA 1M6TA 2XSEA 3KL4A 4BG0A 2W4BA 2R05A 2VCBA 3DWWA 1AVOB 3SXKA 1RCPA 3EGXB 4B6IA 2PX3A 2R7RA 1RMVA 1TFKB 1G4WR 2EINC 3IEEA 5B1AC 3QMKA 3FAJA 4IRUA 5B3SC 4CSAA 4FESA 3UGPA 3K6BA 1CGNA 1ST6A 2EPKX 2KJGA 2NG1A 1ZHXA 3GEIA 3JRMO 5KYXA 4G78A 4U5GA 1YA9A 5KYWA 3MYIA 1BDJB 4KC9A 5D91A 1CGME 1HW1A 2C04A 2I15A 3KMIA 3LAYA 3GEHA 2NUPA 3O10A 4Q7CA 1EKYA 3CEXA 3EFOA 4QI0A 3T6GB 1XZQA 4P6IC 1V55C 2CNWD 4G7ZF 3ZQVA 1OKKA 4IWBA 4MVRA 2XLMA 2R02A 4JRZA 2V3CC 2DB4A 2P1AA 3ABKC 1SMYF 3AGTA 3W8IA 5CI9A 3NDBB 4AX2A 3V7OA 2Y3DA 1PD1A 4DBRA 4NTAA 1NBBA 1VYKA 3DI5A 2J9VA 4Z9IA 4DVZA 3B0VC 5A6BA 3C63A 2WZFA 3O39A 3I5QA 2VH3A 4AE4B 4E0IA 2Y3GA 4LLEA 3FXHA 1VLTA 4DOZA 3FOOA 3Q7GA 4IAQA 4J32B 1W2WA 1I4ZA 2OQMA 4O6MA 1XWJA 3FOPA 3W4YA 4BPMA 4P9FA 4MQ9F 2Y3BA 3SNHA 2D5RB 4LDQA 4U5HA 4Q4ZF 2HSQA 4ULWA 1UG7A 2EPMX 3QW1A 3JZ0A 3RFYA 3S84A 2G62A 3L8JA 2C03A 4O6YA 4BJ6A 4O79A 4KNWA 4YJWA 1VK5A 1H9TA 1LE4A 2YKZA 3PMRA 3U3BA 3VAYA 3K1IA 4EHPA 5BQGA 1E85A 5KYNA 2H7BA 1R5ID 3HKKA 3NMIA 4MS2A 5DS4A 2OCCC 3AG3C 3POVA 4N6CA 2NUTA 2HKVA 1ZHZA 1NG1A 2HMQA 1S05A 1RXQA 3EZHA 5DQTA 4CS8A 4CSAC 2YLIA 1E84A 1ZU5A 4MVMA 1YA7O 4Z9HA 3TK0A 2M4EA 2B0JA 2DGJA 2LFFA 2L7AA 1TKNA 2YQYA 4XPXA 4DRJB 3IQCA 4QI2A 3S28A 1O5HA 4NTBA 1J8MF 2XLOA 2Q3TA 2X0CA 3S27A 3DD7A 1MNEA 1SF8A 1WN0A 1QKRA 1ZU4A 3HNLA 2OOCA 3RIPA 3AOUA 2YL3A 3VM6A 3MX3A 3SP1A 1M2OA 1JPJA 2ETSA 3C18A 4HE8D 4IARA 5JSLA 1M2VA 2BE5F 3GEEA 3G4XA 5KYUB 1D0XA 1YLMA 2XXAB 2DYRC 4YT8A 3C8GB 5E3AA 2YL1A 3FMSA 3R7CA 2H8AA 2PX0A 1ZHTA 2HS5A 2A0BA 1OCRC 2G3KA 2HJ3A 2LSEA 2OKUA 3ATPA 2QE9A 3DAGA 2YZSA 2E87A 5JS5A 4ONSA 4JIOA 5EK0A 1I4YA 2RSEB 3BRJA 1Z6AA 1HMOA 2YLGA 3EJNA 2VASA 2J7PD 2IM8A 1UFBA 4OD5A 1Q0DA 2ASRA 2QUPA 1ZW2A 2LFDA 1WTYA 2HSBA 2GA0A 2Q00A 3BEHA 3DM5A 2JPUA 3I4UA 4ULVA 1K05A 3GM3A 5COGA 3RKOF 3RW0A 3RVZA 3NKEA 3SXZA 3UR3C 4BJTA 3N0TA 3RVYA 4CBEA 3PHF2 3K1IC 1QVXA 2B0HA 3LLIA 4EBBA 1Z5ZA 1TWAA 1QZXA 1JR8A 4JKVA 3F46A 1TWHA 4IJJA 3RQEA 2UUHA 3A11A 2Y69C 3FDQA 4E7ZA 3TOLA 2BL2A 3QVZA 1BR4A 3A9CA 5B3IA 5AGFA 1C03A 4JTCB 5F5HA 1SYQA 4E7SA 4QDLA 3N2ZB 1CPRA 1TWCA 3US6A 2R7QA 5L0FA 2OU6A 3F47A 1TR2A 1E83A 2OEXA 1I5NA 2WZLA 5TJ5E 4U5BE 1HW2A 2ICWG 3S9OA 4X0RA 4C7OA 4NCQA 2HUJA 4PJLA 3G4ZA 2JD3A 3AG2C 1U6HA 4YL1A 2XRHA 1T6UA 2QNLA 1C02A 4I1MA 3U8VA 1O87A 2XL6A 1G5ZA 1Q0FA 1Q0GA 4XEKA 2J0WA 2X51A 1NFNA 2GDCA 2ZXRA 3TD7A 4E0HA 4ZLCA 4H4KC 1LIHA 3QTHA 1LS1A 4Z9JA 1O3UA 1L3PA 3JSZA 4JC7A 3DXJF 4KBLA 1D1CA 3O6XA 4WGYA 3EGDB 2ZXOA 3RQGA 3AQBA 4CS7A 5AC4A 4Q5SF 3LNMB 5KYYB 1LE2A 1WASA 2PNOA 3K7DA 3SXYA 3GWNA 4YL0A 1T6QA 2EILC 3DM9B 1MMNA 2H7VC 3ZVRA 2L81A 3M1CB 4CDAA 1OW8A 4EKWA 1A7DA 2WB7A 4J30B 4DJ9A 5A6KA 1RKEB 2BC5A 2XS8A 3Q7LA 2J45A 4LDKA 4WGZA 3TJ5A 3DKAA 3DE8A 2LP4A 3KKBA 4H54A 3TQOA 1HMDA 4L6RA 5T3WA 2KW3C 4LERA 4YK5A 1C17M 2EPOA 1ZYRF 3DJNB 3ZTZA 4YWQA 4BJ5A 3ZDLA 3EG9B 4G0HA 2CNWA 5CI8A 3T9OA 4EUKB 2IOQA 4W8KA 1YVIA 1QQ3A 2GWWA 2LCHA 3UMKA 1GGQA 3B71A 3CZ6A 4C3EA 3V5YA 3NMJA 4EBKA 1VLSA 2J8WA 2EPNA 2P0NA 3C8GD 4GQHA 3ZSUA 4U5CE 2HV7A 5A6AA 3JTLO 1RJ9B 2Z15A 1IZMA 2UUIA 2YVKA 3PCVA 3ASNC 1SZIA 1QPUA 3ZIBA 1LVKA 4CS9C 4LDRA 4XEVA 3B0UX 1YYJA 2KC3A 2P7VA 2EIKC 2OJQA 3ECSA 4OIQF 2FGYA 3U0CA 2HZ8A 1OR2A 3E9VA 3ITFA 5FZTA 3AJMA 3NMKA 2NSGA 2A69F 1T9KA 4DXWA 2A6HF 1LI7A 2QTVA 5D92A 2R9RB 3L34A 3HTKC 2IXMA 3GM1A 3RF3A 2OJED 2XL8A 3IQ5A 2YWAA 1FMWA 2Q9AA 3LESA 3M4CA 4KNVA 4JEAA 4JZAA 5JVEA 2M64A 1Q0MA 3UGOA 5E33A 2J0XA 2HMZA 1OW6A 2CYDA 3M4BA 4RDAA 4ER9A 1LS4A 3B9QA 2A0UA 4OIOF 1H9GA 3LLKA 4OD4A 4N06A 4NC3A 3S29A 2WVQA 3WODF 5EHHA 5L3QA 2MYSA 3X1OA 3IPMO 4CDVA 1NSGB 5A6JA 3KH2A 1VTMP 5KYXB 3CSKA 1A7EA 1Z3IX 4C3DA 5HV9A 4J7YA 5L0IA 5E2QA 5KYWB 5AC5A 4UDVA 3J06A 4E17A 3ZG1A 1EQ1A 1TFOB 2CDQA 3RYLA 2YEVA 2XLDA 2NUPB 5FCLA 3GWLA 2L9JA 5DQZA 4XPWA 1WGWA 3EFOB 2EIMC 4NQFA 4PJJA 3AQCA 2W9YA 1QLEC 1E2XA 2AWCA
chains in the Genus database with same CATH topology
4IB4A 3TOLA 1CGNA 3QVZA 256BA 5B3IA 3HNKA 5AGFA 5JP7A 3C62A 1CPRA 3M15A 4N6HA 1E83A 1EKYA 5JUAA 3HNIA 3ZWIA 2QLAA 5JT4A 3ZQVA 2XLMA 4EIYA 2XL6A 1NBBA 2YL0A 3C63A 1APCA 4WGYA 3IQ6A 5JRAA 1YZCA 3FOOA 4IAQA 4CIPA 1YYXA 3FOPA 2XLHA 4CDAA 3QW1A 4N4WA 2BC5A 4WGZA 2YKZA 3HNJA 1LM3B 2J9BA 3DE8A 1E85A 4L6RA 3NMIA 3QW0A 3ZTZA 3VRCA 3L1MA 1S05A 1QQ3A 2YLIA 1E84A 1GQAA 2YLDA 2XM0A 3NMJA 2CCYA 2J8WA 3ZTMA 1CGOA 4CX9A 1QPUA 1BBHA 4CDYA 5JLIA 2XLOA 2XLWA 3QVYA 1YYJA 4JEBA 3HNLA 1MQVA 2YL3A 4U9EA 3NMKA 4IARA 5JSLA 1E86A 2YL1A 4D4NA 2XL8A 4U9DA 3IQ5A 3M4CA 4JEAA 4CJGA 2YL7A 5JS5A 5JVEA 3M79A 1CPQA 3M4BA 1YZAA 4ER9A 2YLGA 4NC3A 1JAFA 4CDVA 3ZQYA 4JE9A 4D4XA 4ULVA 2XLEA 1M6TA 3DE9A 3TOMA 2XLDA 2XM4A 1RCPA 3U8PA 1A7VA 4CJOA 4JKVA 2XLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IB4 A;  3TOL A;  1CGN A;  3QVZ A;  256B A;  5B3I A;  3HNK A;  5AGF A;  5JP7 A;  3C62 A;  1CPR A;  3M15 A;  4N6H A;  1E83 A;  1EKY A;  5JUA A;  3HNI A;  3ZWI A;  2QLA A;  5JT4 A;  3ZQV A;  2XLM A;  4EIY A;  2XL6 A;  1NBB A;  2YL0 A;  3C63 A;  1APC A;  4WGY A;  3IQ6 A;  5JRA A;  1YZC A;  3FOO A;  4IAQ A;  4CIP A;  1YYX A;  3FOP A;  2XLH A;  4CDA A;  3QW1 A;  4N4W A;  2BC5 A;  4WGZ A;  2YKZ A;  3HNJ A;  1LM3 B;  2J9B A;  3DE8 A;  1E85 A;  4L6R A;  3NMI A;  3QW0 A;  3ZTZ A;  3VRC A;  3L1M A;  1S05 A;  1QQ3 A;  2YLI A;  1E84 A;  1GQA A;  2YLD A;  2XM0 A;  3NMJ A;  2CCY A;  2J8W A;  3ZTM A;  1CGO A;  4CX9 A;  1QPU A;  1BBH A;  4CDY A;  5JLI A;  2XLO A;  2XLW A;  3QVY A;  1YYJ A;  4JEB A;  3HNL A;  1MQV A;  2YL3 A;  4U9E A;  3NMK A;  4IAR A;  5JSL A;  1E86 A;  2YL1 A;  4D4N A;  2XL8 A;  4U9D A;  3IQ5 A;  3M4C A;  4JEA A;  4CJG A;  2YL7 A;  5JS5 A;  5JVE A;  3M79 A;  1CPQ A;  3M4B A;  1YZA A;  4ER9 A;  2YLG A;  4NC3 A;  1JAF A;  4CDV A;  3ZQY A;  4JE9 A;  4D4X A;  4ULV A;  2XLE A;  1M6T A;  3DE9 A;  3TOM A;  2XLD A;  2XM4 A;  1RCP A;  3U8P A;  1A7V A;  4CJO A;  4JKV A;  2XLV A; 
#chains in the Genus database with same CATH topology
 1NU9 C;  4IB4 A;  1FMV A;  1XZP A;  3W8H A;  3IQT A;  256B A;  1Q0K A;  3U5S A;  4K7B A;  3NYL A;  2TMV P;  4A4A A;  1U0B B;  4BEM J;  1D0Y A;  1V4A A;  3C62 A;  4U5E E;  1ZHY A;  3ABL C;  4JW1 A;  5DLJ A;  3IHU A;  2P61 A;  3MLG A;  1TQG A;  3SEO A;  2LQG A;  2KGO A;  3UNG C;  1PV3 A;  3EGX A;  2VCC A;  3GAN A;  3H2V A;  1VOM A;  3HNI A;  4GEH A;  3JCU Q;  3FAP B;  3TJ6 A;  2OG2 A;  3WHN A;  3ZWI A;  4ANJ A;  5JT4 A;  2L6H A;  3U9M A;  3HJC A;  1DOW A;  4JTA B;  2VC9 A;  5COM A;  5L0H A;  1JOG A;  2IYL D;  4BJ6 C;  4EIY A;  2V26 A;  1YAR O;  4MND A;  1KTM A;  2O9X A;  1FFT C;  2J7P A;  3JYY A;  1JPN A;  4P9T A;  5KYY A;  2Q4F A;  2J9W A;  3R2P A;  3AG4 C;  2YL0 A;  1AEP A;  2KYH A;  4I1O B;  5COF A;  3T6B A;  1APC A;  3O55 A;  1FR0 A;  2LIG A;  1ORS C;  3IQ6 A;  2WL8 A;  1YZC A;  4IAO A;  4MTO A;  5JRA A;  3H2U A;  4CS8 C;  1KU2 A;  5L0D A;  1OCC C;  2EPL X;  4CIP A;  3V5Z A;  2Y3H A;  1R4T A;  2NUT B;  4BJ1 A;  1M57 C;  2NSF A;  4XWJ A;  1WAT A;  3EHM A;  2J46 A;  1T6I A;  4EBJ A;  1ZHW A;  1TWG A;  3B0P A;  5GPG B;  4EWC A;  3ASO C;  3ZC4 A;  3HLZ A;  1FAP B;  3NYJ A;  3S90 A;  4CX9 A;  1BR2 A;  3HNJ A;  4AE4 A;  4HFF B;  4K0D A;  2FFH A;  1JRA A;  4LLC A;  3EH1 A;  2XS1 A;  4O7G A;  4FWV A;  3JYH A;  5F5F A;  4F4B A;  5BQH A;  3UMH A;  1RJ9 A;  2MHR A;  4MVQ A;  3C8Z A;  2R7T A;  4XQ1 A;  4MW8 A;  4JJG A;  5DVW A;  2LD6 A;  2HJM A;  4J7T A;  3CAX A;  5F28 E;  3W2V A;  2LK4 A;  3L0I A;  1G8X A;  2EIJ C;  3ZQY A;  2ZXW C;  2YLD A;  4YT5 A;  4MVO A;  2IXO A;  4G7H F;  3WAQ A;  4PFP A;  1CGO A;  2PBE A;  1GM5 A;  4JVS A;  1FFH A;  3NKD A;  1BBH A;  4CDY A;  1EA8 A;  1OCO C;  1YAU O;  1WWP A;  2GAQ A;  1B68 A;  2XLW A;  5B1B C;  5JLI A;  1H7I A;  1OXB A;  2Q9B A;  4I44 A;  4JEB A;  4JUR I;  1Z7Q c;  3CQZ A;  5T1D B;  1HE9 A;  1L7C A;  3U3F A;  4XLP F;  2KK1 A;  4U9E A;  1V74 B;  5K0I A;  3QZC A;  4BEJ A;  5CIV A;  2ZPA A;  4YT4 A;  5BUO A;  4JTD B;  1ZW3 A;  4NY3 A;  1Z23 A;  1VMA A;  3TUL A;  1A0B A;  1J8Y F;  1KNY A;  3JT1 A;  2Q7R A;  2W45 A;  4K1O A;  4MVU A;  4D4N A;  4U9D A;  3H65 A;  1PD0 A;  2VB6 A;  4A2N B;  4U5D E;  4E18 A;  4XPY A;  2KSF A;  4CJG A;  1JMW A;  1BZ4 A;  2YL7 A;  2ZXP A;  3EHN A;  1FNT c;  1GS9 A;  1OKK D;  3M79 A;  1YZA A;  1WOL A;  1OQC A;  4RD9 A;  1D1B A;  1JAF A;  2H7O A;  4AL0 A;  1S7Z A;  2AU5 A;  5KYU A;  2XXA A;  1K04 A;  2R7S A;  1K40 A;  1RKC A;  1MMG A;  3C8G A;  5A6B D;  1NFO A;  2OEV A;  2R7U A;  3DAF A;  2R7V A;  1M56 C;  1T5O A;  2WVN A;  4LAC B;  3RH3 A;  3DE9 A;  3TOM A;  4C7O B;  4XLN F;  1HE1 A;  3AGU A;  2XM4 A;  1ORY A;  3U8P A;  1A7V A;  3VF0 A;  4WJ0 A;  1VB5 A;  3SYN A;  4CJO A;  3S0X A;  2XLV A;  4PAC A;  1EI7 A;  3LEV A;  4O6N A;  3T6J A;  2L6G A;  2MWQ A;  2NPU A;  3HNK A;  3NG1 A;  1T01 A;  4HFK B;  3EQL F;  1PCX A;  4DBQ A;  2J9U A;  3LS0 A;  4RBN A;  2ZD9 A;  5JP7 A;  3M15 A;  2DI3 A;  2R7W A;  4JCH A;  2AP3 A;  4N6H A;  2PP4 A;  2R7X A;  1V54 C;  3GOR A;  5JUA A;  1BR1 A;  1NZE A;  3OWT A;  1DOV A;  2R03 A;  2QY9 A;  2R25 A;  1A41 A;  3G50 A;  4PJM A;  2QLA A;  1Z63 A;  3UMI A;  2WZG A;  1YDI A;  2XL4 A;  4W8P A;  2P6V A;  4OIR F;  4DVY P;  3Q6M A;  2I8B A;  4MTG A;  3LJB A;  1OCZ C;  5A69 A;  3U2M A;  1F1M A;  2YRF A;  2PFD A;  4AK9 A;  1IW7 F;  3N24 A;  3B29 A;  3FHD A;  3L8I A;  3OA1 A;  4BJ5 C;  3FVY A;  4ZLD A;  1D1A A;  5DS5 A;  3K66 A;  1VYI A;  1U89 A;  4R32 A;  4PK4 A;  2D4U A;  3I5P A;  1YYX A;  2Y39 A;  3AG1 C;  3DMD A;  2CW0 F;  2GFH A;  3EZI A;  4KI2 A;  2XLH A;  4YT2 A;  5BQI A;  4MTF A;  2A6E F;  4MW3 A;  4XTK A;  1MMA A;  2FAP B;  3MBG A;  3MYF A;  4C3B A;  2Q9C A;  3OEO A;  1OXK A;  4N4W A;  5E3C A;  3LEO A;  3K1H A;  1N1C A;  1Y6D A;  1LM3 B;  2J9B A;  3EGD A;  5HSW A;  4PFO A;  1OW7 A;  4PJN A;  3QW0 A;  4CIH A;  1H6G A;  1QSP A;  1LI5 A;  3LS1 A;  4DRH B;  2IXP A;  4OIP F;  2F22 A;  1SR2 A;  3E70 C;  3L1M A;  3VRC A;  1FTS A;  1AUE A;  2L6F A;  4XEF A;  1D0Z A;  5L0J A;  3MFN A;  1MMD A;  3KYJ A;  3Q6N A;  1GQA A;  2XM0 A;  2G3V A;  2CCY A;  1OR3 A;  5L0G A;  3ZTM A;  3GM2 A;  2PF4 E;  1RKE A;  3NRH A;  4AL1 A;  3JSE O;  3KPH A;  1YJG A;  2R7O A;  3C7J A;  2IBF A;  3V5X A;  3QVY A;  5T3T A;  3X2Q C;  2W4M A;  2YHS A;  4I3M A;  3SXM A;  3ABM C;  3DZA A;  3LUT B;  1MQV A;  3EG9 A;  4MVS A;  4M63 A;  2DYS C;  3VYW A;  5L0C A;  1Y4C A;  2A1D D;  2CGE A;  3U2L A;  4OIN F;  4G7O F;  2AWY A;  4U5F E;  5L3V A;  2VCA A;  1LKX A;  2A68 F;  2HV6 A;  3RQF A;  5IY5 C;  4FX5 A;  3WG7 C;  4FAP B;  4GYT A;  2JX0 A;  5DS6 A;  1E86 A;  3LNR A;  3U9J A;  4MVZ A;  5EGY A;  2KQ9 A;  3DJU B;  1NU7 D;  3EPV A;  4WAB A;  1M2V B;  2KNH A;  2WVO A;  3GOD A;  3W2W A;  3PDM P;  1CPQ A;  4JCZ A;  4HEA J;  4YL3 A;  3T4R A;  4CS9 A;  3SZR A;  4DRI B;  1NLX A;  1HY5 A;  3JRT A;  2IXN A;  3EH2 A;  4JJF A;  1LPE A;  1ZVZ A;  2HFI A;  3K33 A;  2AVK A;  1ORJ A;  4YN0 B;  1ZZP A;  2RD9 A;  4IGG A;  4JE9 A;  1G4U S;  4NTF A;  1MND A;  3KYI A;  3NYM A;  4D4X A;  4PR9 A;  2XLE A;  1M6T A;  2XSE A;  3KL4 A;  4BG0 A;  2W4B A;  2R05 A;  2VCB A;  3DWW A;  1AVO B;  3SXK A;  1RCP A;  3EGX B;  4B6I A;  2PX3 A;  2R7R A;  1RMV A;  1TFK B;  1G4W R;  2EIN C;  3IEE A;  5B1A C;  3QMK A;  3FAJ A;  4IRU A;  5B3S C;  4CSA A;  4FES A;  3UGP A;  3K6B A;  1CGN A;  1ST6 A;  2EPK X;  2KJG A;  2NG1 A;  1ZHX A;  3GEI A;  3JRM O;  5KYX A;  4G78 A;  4U5G A;  1YA9 A;  5KYW A;  3MYI A;  1BDJ B;  4KC9 A;  5D91 A;  1CGM E;  1HW1 A;  2C04 A;  2I15 A;  3KMI A;  3LAY A;  3GEH A;  2NUP A;  3O10 A;  4Q7C A;  1EKY A;  3CEX A;  3EFO A;  4QI0 A;  3T6G B;  1XZQ A;  4P6I C;  1V55 C;  2CNW D;  4G7Z F;  3ZQV A;  1OKK A;  4IWB A;  4MVR A;  2XLM A;  2R02 A;  4JRZ A;  2V3C C;  2DB4 A;  2P1A A;  3ABK C;  1SMY F;  3AGT A;  3W8I A;  5CI9 A;  3NDB B;  4AX2 A;  3V7O A;  2Y3D A;  1PD1 A;  4DBR A;  4NTA A;  1NBB A;  1VYK A;  3DI5 A;  2J9V A;  4Z9I A;  4DVZ A;  3B0V C;  5A6B A;  3C63 A;  2WZF A;  3O39 A;  3I5Q A;  2VH3 A;  4AE4 B;  4E0I A;  2Y3G A;  4LLE A;  3FXH A;  1VLT A;  4DOZ A;  3FOO A;  3Q7G A;  4IAQ A;  4J32 B;  1W2W A;  1I4Z A;  2OQM A;  4O6M A;  1XWJ A;  3FOP A;  3W4Y A;  4BPM A;  4P9F A;  4MQ9 F;  2Y3B A;  3SNH A;  2D5R B;  4LDQ A;  4U5H A;  4Q4Z F;  2HSQ A;  4ULW A;  1UG7 A;  2EPM X;  3QW1 A;  3JZ0 A;  3RFY A;  3S84 A;  2G62 A;  3L8J A;  2C03 A;  4O6Y A;  4BJ6 A;  4O79 A;  4KNW A;  4YJW A;  1VK5 A;  1H9T A;  1LE4 A;  2YKZ A;  3PMR A;  3U3B A;  3VAY A;  3K1I A;  4EHP A;  5BQG A;  1E85 A;  5KYN A;  2H7B A;  1R5I D;  3HKK A;  3NMI A;  4MS2 A;  5DS4 A;  2OCC C;  3AG3 C;  3POV A;  4N6C A;  2NUT A;  2HKV A;  1ZHZ A;  1NG1 A;  2HMQ A;  1S05 A;  1RXQ A;  3EZH A;  5DQT A;  4CS8 A;  4CSA C;  2YLI A;  1E84 A;  1ZU5 A;  4MVM A;  1YA7 O;  4Z9H A;  3TK0 A;  2M4E A;  2B0J A;  2DGJ A;  2LFF A;  2L7A A;  1TKN A;  2YQY A;  4XPX A;  4DRJ B;  3IQC A;  4QI2 A;  3S28 A;  1O5H A;  4NTB A;  1J8M F;  2XLO A;  2Q3T A;  2X0C A;  3S27 A;  3DD7 A;  1MNE A;  1SF8 A;  1WN0 A;  1QKR A;  1ZU4 A;  3HNL A;  2OOC A;  3RIP A;  3AOU A;  2YL3 A;  3VM6 A;  3MX3 A;  3SP1 A;  1M2O A;  1JPJ A;  2ETS A;  3C18 A;  4HE8 D;  4IAR A;  5JSL A;  1M2V A;  2BE5 F;  3GEE A;  3G4X A;  5KYU B;  1D0X A;  1YLM A;  2XXA B;  2DYR C;  4YT8 A;  3C8G B;  5E3A A;  2YL1 A;  3FMS A;  3R7C A;  2H8A A;  2PX0 A;  1ZHT A;  2HS5 A;  2A0B A;  1OCR C;  2G3K A;  2HJ3 A;  2LSE A;  2OKU A;  3ATP A;  2QE9 A;  3DAG A;  2YZS A;  2E87 A;  5JS5 A;  4ONS A;  4JIO A;  5EK0 A;  1I4Y A;  2RSE B;  3BRJ A;  1Z6A A;  1HMO A;  2YLG A;  3EJN A;  2VAS A;  2J7P D;  2IM8 A;  1UFB A;  4OD5 A;  1Q0D A;  2ASR A;  2QUP A;  1ZW2 A;  2LFD A;  1WTY A;  2HSB A;  2GA0 A;  2Q00 A;  3BEH A;  3DM5 A;  2JPU A;  3I4U A;  4ULV A;  1K05 A;  3GM3 A;  5COG A;  3RKO F;  3RW0 A;  3RVZ A;  3NKE A;  3SXZ A;  3UR3 C;  4BJT A;  3N0T A;  3RVY A;  4CBE A;  3PHF 2;  3K1I C;  1QVX A;  2B0H A;  3LLI A;  4EBB A;  1Z5Z A;  1TWA A;  1QZX A;  1JR8 A;  4JKV A;  3F46 A;  1TWH A;  4IJJ A;  3RQE A;  2UUH A;  3A11 A;  2Y69 C;  3FDQ A;  4E7Z A;  3TOL A;  2BL2 A;  3QVZ A;  1BR4 A;  3A9C A;  5B3I A;  5AGF A;  1C03 A;  4JTC B;  5F5H A;  1SYQ A;  4E7S A;  4QDL A;  3N2Z B;  1CPR A;  1TWC A;  3US6 A;  2R7Q A;  5L0F A;  2OU6 A;  3F47 A;  1TR2 A;  1E83 A;  2OEX A;  1I5N A;  2WZL A;  5TJ5 E;  4U5B E;  1HW2 A;  2ICW G;  3S9O A;  4X0R A;  4C7O A;  4NCQ A;  2HUJ A;  4PJL A;  3G4Z A;  2JD3 A;  3AG2 C;  1U6H A;  4YL1 A;  2XRH A;  1T6U A;  2QNL A;  1C02 A;  4I1M A;  3U8V A;  1O87 A;  2XL6 A;  1G5Z A;  1Q0F A;  1Q0G A;  4XEK A;  2J0W A;  2X51 A;  1NFN A;  2GDC A;  2ZXR A;  3TD7 A;  4E0H A;  4ZLC A;  4H4K C;  1LIH A;  3QTH A;  1LS1 A;  4Z9J A;  1O3U A;  1L3P A;  3JSZ A;  4JC7 A;  3DXJ F;  4KBL A;  1D1C A;  3O6X A;  4WGY A;  3EGD B;  2ZXO A;  3RQG A;  3AQB A;  4CS7 A;  5AC4 A;  4Q5S F;  3LNM B;  5KYY B;  1LE2 A;  1WAS A;  2PNO A;  3K7D A;  3SXY A;  3GWN A;  4YL0 A;  1T6Q A;  2EIL C;  3DM9 B;  1MMN A;  2H7V C;  3ZVR A;  2L81 A;  3M1C B;  4CDA A;  1OW8 A;  4EKW A;  1A7D A;  2WB7 A;  4J30 B;  4DJ9 A;  5A6K A;  1RKE B;  2BC5 A;  2XS8 A;  3Q7L A;  2J45 A;  4LDK A;  4WGZ A;  3TJ5 A;  3DKA A;  3DE8 A;  2LP4 A;  3KKB A;  4H54 A;  3TQO A;  1HMD A;  4L6R A;  5T3W A;  2KW3 C;  4LER A;  4YK5 A;  1C17 M;  2EPO A;  1ZYR F;  3DJN B;  3ZTZ A;  4YWQ A;  4BJ5 A;  3ZDL A;  3EG9 B;  4G0H A;  2CNW A;  5CI8 A;  3T9O A;  4EUK B;  2IOQ A;  4W8K A;  1YVI A;  1QQ3 A;  2GWW A;  2LCH A;  3UMK A;  1GGQ A;  3B71 A;  3CZ6 A;  4C3E A;  3V5Y A;  3NMJ A;  4EBK A;  1VLS A;  2J8W A;  2EPN A;  2P0N A;  3C8G D;  4GQH A;  3ZSU A;  4U5C E;  2HV7 A;  5A6A A;  3JTL O;  1RJ9 B;  2Z15 A;  1IZM A;  2UUI A;  2YVK A;  3PCV A;  3ASN C;  1SZI A;  1QPU A;  3ZIB A;  1LVK A;  4CS9 C;  4LDR A;  4XEV A;  3B0U X;  1YYJ A;  2KC3 A;  2P7V A;  2EIK C;  2OJQ A;  3ECS A;  4OIQ F;  2FGY A;  3U0C A;  2HZ8 A;  1OR2 A;  3E9V A;  3ITF A;  5FZT A;  3AJM A;  3NMK A;  2NSG A;  2A69 F;  1T9K A;  4DXW A;  2A6H F;  1LI7 A;  2QTV A;  5D92 A;  2R9R B;  3L34 A;  3HTK C;  2IXM A;  3GM1 A;  3RF3 A;  2OJE D;  2XL8 A;  3IQ5 A;  2YWA A;  1FMW A;  2Q9A A;  3LES A;  3M4C A;  4KNV A;  4JEA A;  4JZA A;  5JVE A;  2M64 A;  1Q0M A;  3UGO A;  5E33 A;  2J0X A;  2HMZ A;  1OW6 A;  2CYD A;  3M4B A;  4RDA A;  4ER9 A;  1LS4 A;  3B9Q A;  2A0U A;  4OIO F;  1H9G A;  3LLK A;  4OD4 A;  4N06 A;  4NC3 A;  3S29 A;  2WVQ A;  3WOD F;  5EHH A;  5L3Q A;  2MYS A;  3X1O A;  3IPM O;  4CDV A;  1NSG B;  5A6J A;  3KH2 A;  1VTM P;  5KYX B;  3CSK A;  1A7E A;  1Z3I X;  4C3D A;  5HV9 A;  4J7Y A;  5L0I A;  5E2Q A;  5KYW B;  5AC5 A;  4UDV A;  3J06 A;  4E17 A;  3ZG1 A;  1EQ1 A;  1TFO B;  2CDQ A;  3RYL A;  2YEV A;  2XLD A;  2NUP B;  5FCL A;  3GWL A;  2L9J A;  5DQZ A;  4XPW A;  1WGW A;  3EFO B;  2EIM C;  4NQF A;  4PJJ A;  3AQC A;  2W9Y A;  1QLE C;  1E2X A;  2AWC A; 
#chains in the Genus database with same CATH homology
 4IB4 A;  3TOL A;  1CGN A;  3QVZ A;  256B A;  5B3I A;  3HNK A;  5AGF A;  5JP7 A;  3C62 A;  1CPR A;  3M15 A;  4N6H A;  1E83 A;  1EKY A;  5JUA A;  3HNI A;  3ZWI A;  2QLA A;  5JT4 A;  3ZQV A;  2XLM A;  4EIY A;  2XL6 A;  1NBB A;  2YL0 A;  3C63 A;  1APC A;  4WGY A;  3IQ6 A;  5JRA A;  1YZC A;  3FOO A;  4IAQ A;  4CIP A;  1YYX A;  3FOP A;  2XLH A;  4CDA A;  3QW1 A;  4N4W A;  2BC5 A;  4WGZ A;  2YKZ A;  3HNJ A;  1LM3 B;  2J9B A;  3DE8 A;  1E85 A;  4L6R A;  3NMI A;  3QW0 A;  3ZTZ A;  3VRC A;  3L1M A;  1S05 A;  1QQ3 A;  2YLI A;  1E84 A;  1GQA A;  2YLD A;  2XM0 A;  3NMJ A;  2CCY A;  2J8W A;  3ZTM A;  1CGO A;  4CX9 A;  1QPU A;  1BBH A;  4CDY A;  5JLI A;  2XLO A;  2XLW A;  3QVY A;  1YYJ A;  4JEB A;  3HNL A;  1MQV A;  2YL3 A;  4U9E A;  3NMK A;  4IAR A;  5JSL A;  1E86 A;  2YL1 A;  4D4N A;  2XL8 A;  4U9D A;  3IQ5 A;  3M4C A;  4JEA A;  4CJG A;  2YL7 A;  5JS5 A;  5JVE A;  3M79 A;  1CPQ A;  3M4B A;  1YZA A;  4ER9 A;  2YLG A;  4NC3 A;  1JAF A;  4CDV A;  3ZQY A;  4JE9 A;  4D4X A;  4ULV A;  2XLE A;  1M6T A;  3DE9 A;  3TOM A;  2XLD A;  2XM4 A;  1RCP A;  3U8P A;  1A7V A;  4CJO A;  4JKV A;  2XLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...