1OXKA

Complex between ypd1 and sln1 response regulator domain in space group p3(2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
166
structure length
156
Chain Sequence
STIPSEIINWTILNEIISMDDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ypd1p
publication title The Yeast YPD1/SLN1 Complex. Insights into Molecular Recognition in Two-Component Signaling Systems.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 69
structure length 156
sequence length 166
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1oxkA00
2Q4FA 1SR2A 2LCHA 3KYIA 3U3BA 4G78A 3MYFA 2A0BA 2LP4A 1FR0A 1QSPA 2R25A 4EUKB 1C02A 3KYJA 1WN0A 1TQGA 3US6A 1BDJB 1Y6DA 1YVIA 4PACA 3IQTA 1C03A 1A0BA 2LD6A 1OXKA 1I5NA 2OOCA 1OXBA
chains in the Genus database with same CATH superfamily
2EIKC 5A69A 3JRTA 4YT4A 5IY5C 2A68F 1NSGB 2RSEB 3NKDA 1VOMA 2IXOA 3M4BA 4CDVA 1PCXA 1MQVA 2LIGA 4Z9JA 1LS1A 2WVOA 4WABA 1QSPA 2A69F 4LLCA 4U9EA 3SYNA 2X51A 4EBKA 4BJ5C 3KYJA 1BR4A 1QZXA 3C7JA 3EZHA 2KW3C 1K04A 1LI5A 2VCAA 1J8YF 4Z9IA 4YN0B 5E33A 3CEXA 2TMVP 5L0CA 4DVZA 1DOWA 3NMJA 1WOLA 2M4EA 4IARA 5BQHA 3HJCA 5JVEA 1V54C 2LSEA 4YL0A 5KYYB 3EFOB 5CI8A 3ABLC 3L1MA 1AVOB 3FMSA 3S90A 1LI7A 3RQFA 2PF4E 1HMOA 1M2VA 4LDKA 3GM2A 3JRMO 1YYXA 3PMRA 4LERA 1TR2A 3T9OA 2ZXOA 1MMAA 2DYSC 3QW0A 1NU7D 2A0UA 3HNIA 4KNVA 2XL4A 3NG1A 3SZRA 4EUKB 2LFDA 3NKEA 1Z5ZA 5JP7A 3H2UA 1U89A 1ZHZA 1TWGA 3BEHA 2L6FA 3GWNA 3TOMA 3VRCA 4BJ5A 3TQOA 1KU2A 2ZD9A 4XQ1A 2PX3A 2OJQA 4HFKB 3S0XA 3AGTA 4ANJA 4EHPA 2EPMX 2JD3A 2EPLX 3GANA 1A7EA 1NU9C 4PJNA 4JTDB 3T6JA 4JW1A 3S9OA 3KYIA 4KNWA 4N06A 2Q7RA 3DAGA 2YQYA 3DAFA 3IPMO 2VC9A 2R7OA 5K0IA 4O7GA 3AG2C 1WATA 2ETSA 2HV6A 2CNWD 1H9GA 3O39A 1TFOB 3B0UX 2LP4A 4IRUA 3K1IA 4C3DA 4NTFA 3ATPA 3DM5A 4NY3A 2ZPAA 2GDCA 1L7CA 2IYLD 4O6MA 3IEEA 5A6AA 1G8XA 2QTVA 3KKBA 3N24A 3NYMA 4EIYA 4U5EE 2EILC 2XS1A 5L0IA 3LLKA 3QW1A 4YT8A 5E3CA 1D0ZA 2OEVA 3K33A 3R2PA 2XL8A 3H2VA 1M57C 1T6IA 3DJNB 4HE8D 5CIVA 2J45A 2D4UA 3Q7GA 3OA1A 4RBNA 4M63A 1ZHTA 3M1CB 1B68A 2J7PD 4YL3A 4EBJA 5A6BD 3X2QC 3E9VA 4PR9A 1BZ4A 3FHDA 3VAYA 4A2NB 4E0IA 4DBRA 2YRFA 3O6XA 3QTHA 3DKAA 2E87A 5B1AC 4CBEA 4E17A 4YWQA 2CYDA 2Y3DA 4IGGA 2WZFA 1ZHYA 2P1AA 2DI3A 4R32A 1JPNA 2YHSA 5KYYA 1MNDA 1Q0MA 4HEAJ 2PX0A 3M79A 1TQGA 4WGZA 2X0CA 2AVKA 1CPRA 3TD7A 4ZLDA 3L8IA 2M64A 4K7BA 1ZU5A 5COMA 2R7VA 3RYLA 3GWLA 3I5QA 2Y3HA 5L0FA 3KPHA 4JTAB 1PD0A 1EI7A 2FGYA 3KMIA 3NMKA 3OEOA 4WGYA 4JE9A 3SXMA 4XPWA 2VCCA 2O9XA 1LE2A 1ORJA 2A6HF 1F1MA 3FAJA 4OIRF 5KYWB 1JMWA 2GA0A 2CCYA 2OOCA 1HY5A 1ST6A 5E2QA 1YJGA 2HUJA 3IQCA 4Q4ZF 1Z7Qc 4KBLA 3IHUA 5F28E 3ZQYA 2NG1A 2H7OA 4W8PA 2HKVA 5BUOA 1CGME 2XLEA 3OWTA 3FXHA 3EHNA 3T6GB 3LESA 4U5FE 1LKXA 3JZ0A 1W2WA 1WWPA 4Q7CA 1OW7A 2YZSA 2HV7A 1JRAA 1OW8A 1Y6DA 5KYUB 3ZC4A 1LE4A 3A11A 3C8ZA 3DE8A 4YK5A 4CJOA 1OCOC 4CSAC 4G7HF 3IQ5A 3ZQVA 1SMYF 2L7AA 3POVA 1D1BA 1NFNA 3PCVA 4MW3A 3GEHA 1ZZPA 2JX0A 2R03A 3U8VA 3K6BA 1A7VA 4U5HA 3LNRA 1H6GA 3EHMA 5F5FA 5B3SC 1Q0KA 3VM6A 4A4AA 4DBQA 3L34A 2Q4FA 1I4YA 2XLHA 1KNYA 1Q0GA 2KNHA 2UUHA 2Z15A 3C8GD 3PHF2 4JZAA 2YWAA 2KK1A 3FOPA 4YT2A 2YL0A 3GEIA 3R7CA 5EK0A 2NSGA 2MWQA 4NCQA 1I4ZA 1H7IA 2R25A 3UR3C 4XLNF 1OKKA 2AWCA 4QDLA 4XPXA 1O5HA 1OR2A 1QLEC 4D4NA 5EGYA 2AU5A 4PFPA 1RJ9B 4JEBA 2V26A 4AL0A 1C03A 3S27A 5EHHA 4AX2A 4MVMA 1OCCC 3ASNC 1JR8A 4XEFA 3UGOA 4CSAA 5B3IA 1WTYA 2YKZA 2WB7A 2YEVA 3A9CA 4O79A 4J7TA 4H54A 4QI2A 2H7BA 3HNLA 2B0HA 3FDQA 4I3MA 2VASA 3WAQA 2Q9AA 4BJ6C 3N0TA 3U3BA 3LS0A 2CGEA 1PD1A 2XLVA 5AGFA 1E85A 2CNWA 2HMQA 2R05A 4K0DA 2EPKX 1BBHA 4MTOA 3KH2A 2OU6A 1XZQA 3B9QA 4JJFA 2NUPA 2R7RA 5DQTA 2PBEA 3EQLF 5KYWA 3C8GB 3ABMC 1BR1A 3RIPA 3HKKA 4E0HA 2Y39A 1RMVA 3QZCA 1Q0DA 3IQTA 5KYXB 4XPYA 1OW6A 1LIHA 3HTKC 2A6EF 4DJ9A 4JKVA 3GEEA 2PNOA 5B1BC 4XLPF 1OXKA 4PJJA 2J7PA 4MVZA 5A6BA 2Y3GA 4EKWA 2D5RB 3QVZA 2KC3A 4MVUA 3FOOA 2W4MA 2ZXRA 4U9DA 3C63A 4CIPA 1OQCA 4I44A 3WODF 4BJ6A 1VB5A 4JRZA 2QUPA 2XLDA 4DRIB 1KTMA 2DB4A 4G7OF 2J0WA 1U6HA 2I8BA 3HLZA 2WVNA 3UNGC 2VH3A 5BQGA 3E70C 4LACB 1HE9A 3SXYA 2HZ8A 1FTSA 1RKCA 2MHRA 1QVXA 1T01A 2LFFA 3TULA 2YLDA 1GGQA 3ZDLA 4G7ZF 2R7QA 2R7TA 4RD9A 2ZXWC 2ICWG 4JJGA 4PFOA 4C3BA 1I5NA 1K40A 2IBFA 2YVKA 2R7XA 3LEOA 2R7WA 2EINC 1M56C 3JYHA 1T9KA 2HJMA 5L0HA 2R7SA 2F22A 3U2LA 1ZW2A 1Z23A 3CZ6A 1T5OA 1RJ9A 5JS5A 4ZLCA 2J8WA 3JCUQ 2G3KA 3M15A 4GYTA 3U8PA 3V5XA 3PDMP 1OR3A 2P7VA 2Q9BA 3IQ6A 1VMAA 3SP1A 3LAYA 1O87A 1E83A 1GS9A 2YL7A 4CS7A 3EJNA 3T6BA 2P0NA 4BJ1A 3EFOA 2OJED 1XZPA 3US6A 4EWCA 3B29A 4MS2A 2Q9CA 1FMVA 2GWWA 3MX3A 4DVYP 3ECSA 1FMWA 2J46A 3DWWA 3WHNA 4UDVA 3ZIBA 1A0BA 4N6HA 5JUAA 1TWHA 1TWCA 4U5GA 5A6JA 2BE5F 3M4CA 5HSWA 5JT4A 2QLAA 1G4US 2VCBA 3B71A 1ZHWA 3LUTB 4JIOA 2KQ9A 1MNEA 4JTCB 3C8GA 5GPGB 4OIPF 1PV3A 2DGJA 2QY9A 3DE9A 3DM9B 2UUIA 2B0JA 5KYXA 2I15A 2QNLA 4DRJB 2CDQA 1R4TA 2YLIA 3EZIA 1G5ZA 3JT1A 4IAQA 1TKNA 5JSLA 2A0BA 4OIOF 2AWYA 3HNJA 3LJBA 4XEKA 3AG3C 2YLGA 1LS4A 3AG4C 1LM3B 2L6GA 2NPUA 3RKOF 5F5HA 4MQ9F 2XXAB 3RW0A 5A6KA 2OCCC 2GFHA 3NYJA 4MTGA 3U2MA 1RKEB 2IXPA 2NUTB 2Q00A 2OQMA 3MFNA 3O10A 4P9FA 5JLIA 4E7ZA 4X0RA 2YL1A 2Y69C 3T4RA 4MVRA 2XLOA 1CGNA 3AJMA 5TJ5E 1HW2A 4RDAA 3O55A 3CSKA 3ABKC 1OCRC 3AGUA 3C18A 2NSFA 2W4BA 2WZLA 1FAPB 1M2OA 3N2ZB 3G4XA 2XRHA 3U9MA 2EIMC 3SXZA 1ZHXA 3S29A 1V4AA 5BQIA 1YDIA 1HE1A 1C02A 4CS9C 5E3AA 4BG0A 3UMHA 1UG7A 1WN0A 3GM1A 1MMDA 3GM3A 4WJ0A 4YL1A 1NG1A 4PACA 4CIHA 1FNTc 4D4XA 3W4YA 1DOVA 3CAXA 4LLEA 5AC4A 3EH1A 1VK5A 3RH3A 4DOZA 1U0BB 3EGXB 4JC7A 2HSBA 4GEHA 5L3QA 1YLMA 4MVQA 1YZAA 3H65A 2XS8A 5T1DB 1QPUA 1G4WR 2FAPB 4CDAA 3VF0A 3NDBB 2FFHA 1S7ZA 2LCHA 4AE4B 3RVYA 3LEVA 4C3EA 4U5DE 3JSEO 3LS1A 3EG9B 3NYLA 1YYJA 4AK9A 3W2VA 3DMDA 3V5ZA 3ZTZA 2Y3BA 5COGA 2JPUA 3G50A 2W45A 1RCPA 3QMKA 4IWBA 4W8KA 2AP3A 1SF8A 1NZEA 2C03A 1T6UA 3JSZA 3RF3A 2WZGA 1A41A 3WG7C 2G62A 2KGOA 3SEOA 2EPOA 3G4ZA 3DXJF 4CS9A 4U5CE 4FX5A 5KYNA 1JPJA 2OKUA 5DS4A 2J9BA 1Z6AA 2LQGA 1EKYA 1MMNA 5T3WA 4B6IA 4JVSA 4KC9A 1D1CA 1T6QA 2H7VC 3MBGA 1ZVZA 5DS5A 4G0HA 3EPVA 3GODA 3ITFA 1NLXA 5D92A 2EIJC 3TOLA 4H4KC 1NBBA 3X1OA 4BEJA 1OXBA 2XXAA 3Q6NA 2RD9A 1Z63A 2BL2A 1Y4CA 1UFBA 2XM4A 4MVSA 4O6YA 5KYUA 1RKEA 2NUTA 4QI0A 3K1IC 4YJWA 3ZG1A 1CPQA 2YL3A 5L0JA 3ZTMA 2H8AA 3ZSUA 4IAOA 5T3TA 4OIQF 2HSQA 1YA9A 4ONSA 1VYIA 2HS5A 4PK4A 5DLJA 5D91A 1J8MF 3I5PA 1OKKD 4JEAA 4I1OB 1BR2A 4LDRA 2XSEA 1ZYRF 2EPNA 3TJ6A 2ZXPA 3FAPB 1CGOA 3SNHA 3W8HA 2L81A 4NTBA 4YT5A 4BPMA 5JRAA 1C17M 2L6HA 2WVQA 2KJGA 1L3PA 3BRJA 4OD5A 5L0GA 2V3CC 4HFFB 4JCZA 4JCHA 1SZIA 4MNDA 4ULWA 3Q7LA 2XL6A 3L0IA 3U5SA 1VLSA 4CS8C 1ORSC 3TJ5A 3FVYA 3EGDB 3AQBA 1VYKA 1N1CA 3K66A 1D1AA 2PP4A 1SYQA 2HFIA 3U3FA 5COFA 3MYFA 3K1HA 3Q6MA 4E7SA 1YZCA 4EBBA 4E18A 4CJGA 2BC5A 1HW1A 3EGXA 1FR0A 3HNKA 3RFYA 4C7OB 3ASOC 4LDQA 4NTAA 3B0VC 4J30B 3JYYA 4XEVA 1TWAA 2IXMA 2J0XA 5DS6A 3CQZA 1Z3IX 3JTLO 4AE4A 1D0XA 4I1MA 5L3VA 1E86A 2C04A 2R9RB 1E2XA 2XM0A 3EG9A 3W2WA 3UGPA 1GM5A 3RQEA 2P61A 4P9TA 1GQAA 4BJTA 4J32B 1QQ3A 2J9UA 2LK4A 3DZAA 4BEMJ 1D0YA 2LD6A 1XWJA 2KSFA 2GAQA 1JOGA 3V7OA 4CS8A 1S05A 1R5ID 4ULVA 4O6NA 4U5BE 4CX9A 3AQCA 2MYSA 1SR2A 3L8JA 1APCA 3AG1C 3UMKA 5CI9A 1WGWA 2DYRC 2IOQA 4FAPB 5FCLA 1IW7F 4Q5SF 1OCZC 3F46A 3LLIA 3MYIA 2OG2A 2J9WA 2ASRA 4IB4A 1HMDA 3U9JA 1QKRA 1Q0FA 4OINF 3AOUA 4N6CA 5FZTA 3F47A 2HMZA 3KL4A 3C62A 4K1OA 3RVZA 5DQZA 1H9TA 2PFDA 3K7DA 1M2VB 4J7YA 3S84A 1IZMA 4MW8A 4DRHB 2W9YA 1AEPA 4N4WA 4NQFA 1FFHA 4OD4A 3VYWA 4MVOA 1TFKB 3MLGA 2XLWA 1FFTC 2NUPB 4L6RA 2VB6A 1YAUO 2HJ3A 2IM8A 1ORYA 1JAFA 2QE9A 4XTKA 3DI5A 2A1DD 3B0PA 4FESA 1NFOA 4XWJA 2Q3TA 2WL8A 3GORA 1LVKA 2R7UA 3ZVRA 1YARO 2OEXA 1K05A 4G78A 4IJJA 4P6IC 1V55C 1EQ1A 5AC5A 4KI2A 1ZU4A 3I4UA 2J9VA 2XLMA 4JURI 3TK0A 5HV9A 1E84A 3EH2A 2CW0F 2P6VA 2L9JA 4CDYA 4FWVA 1YA7O 3NRHA 3DJUB 4MTFA 256BA 3V5YA 1VTMP 4PJMA 1RXQA 3EGDA 5L0DA 3UMIA 1LPEA 2G3VA 3NMIA 2KYHA 1EA8A 1MMGA 1BDJB 1V74B 3LNMB 1A7DA 1YVIA 2R02A 1AUEA 4Z9HA 3QVYA 4NC3A 4AL1A 3U0CA 2IXNA 4GQHA 1WASA 3J06A 3W8IA 4F4BA 1M6TA 3DD7A 1VLTA 1O3UA 3SXKA 3ZWIA 4C7OA 3S28A 4PJLA 4DXWA 5DVWA 1ZW3A 3RQGA 4ER9A
chains in the Genus database with same CATH topology
2Q4FA 1SR2A 2LCHA 3KYIA 3U3BA 4G78A 3MYFA 2A0BA 2LP4A 1FR0A 1QSPA 2R25A 4EUKB 1C02A 3KYJA 1WN0A 1TQGA 3US6A 1BDJB 1Y6DA 1YVIA 4PACA 3IQTA 1C03A 1A0BA 2LD6A 1OXKA 1I5NA 2OOCA 1OXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4F A;  1SR2 A;  2LCH A;  3KYI A;  3U3B A;  4G78 A;  3MYF A;  2A0B A;  2LP4 A;  1FR0 A;  1QSP A;  2R25 A;  4EUK B;  1C02 A;  3KYJ A;  1WN0 A;  1TQG A;  3US6 A;  1BDJ B;  1Y6D A;  1YVI A;  4PAC A;  3IQT A;  1C03 A;  1A0B A;  2LD6 A;  1OXK A;  1I5N A;  2OOC A;  1OXB A; 
#chains in the Genus database with same CATH topology
 2EIK C;  5A69 A;  3JRT A;  4YT4 A;  5IY5 C;  2A68 F;  1NSG B;  2RSE B;  3NKD A;  1VOM A;  2IXO A;  3M4B A;  4CDV A;  1PCX A;  1MQV A;  2LIG A;  4Z9J A;  1LS1 A;  2WVO A;  4WAB A;  1QSP A;  2A69 F;  4LLC A;  4U9E A;  3SYN A;  2X51 A;  4EBK A;  4BJ5 C;  3KYJ A;  1BR4 A;  1QZX A;  3C7J A;  3EZH A;  2KW3 C;  1K04 A;  1LI5 A;  2VCA A;  1J8Y F;  4Z9I A;  4YN0 B;  5E33 A;  3CEX A;  2TMV P;  5L0C A;  4DVZ A;  1DOW A;  3NMJ A;  1WOL A;  2M4E A;  4IAR A;  5BQH A;  3HJC A;  5JVE A;  1V54 C;  2LSE A;  4YL0 A;  5KYY B;  3EFO B;  5CI8 A;  3ABL C;  3L1M A;  1AVO B;  3FMS A;  3S90 A;  1LI7 A;  3RQF A;  2PF4 E;  1HMO A;  1M2V A;  4LDK A;  3GM2 A;  3JRM O;  1YYX A;  3PMR A;  4LER A;  1TR2 A;  3T9O A;  2ZXO A;  1MMA A;  2DYS C;  3QW0 A;  1NU7 D;  2A0U A;  3HNI A;  4KNV A;  2XL4 A;  3NG1 A;  3SZR A;  4EUK B;  2LFD A;  3NKE A;  1Z5Z A;  5JP7 A;  3H2U A;  1U89 A;  1ZHZ A;  1TWG A;  3BEH A;  2L6F A;  3GWN A;  3TOM A;  3VRC A;  4BJ5 A;  3TQO A;  1KU2 A;  2ZD9 A;  4XQ1 A;  2PX3 A;  2OJQ A;  4HFK B;  3S0X A;  3AGT A;  4ANJ A;  4EHP A;  2EPM X;  2JD3 A;  2EPL X;  3GAN A;  1A7E A;  1NU9 C;  4PJN A;  4JTD B;  3T6J A;  4JW1 A;  3S9O A;  3KYI A;  4KNW A;  4N06 A;  2Q7R A;  3DAG A;  2YQY A;  3DAF A;  3IPM O;  2VC9 A;  2R7O A;  5K0I A;  4O7G A;  3AG2 C;  1WAT A;  2ETS A;  2HV6 A;  2CNW D;  1H9G A;  3O39 A;  1TFO B;  3B0U X;  2LP4 A;  4IRU A;  3K1I A;  4C3D A;  4NTF A;  3ATP A;  3DM5 A;  4NY3 A;  2ZPA A;  2GDC A;  1L7C A;  2IYL D;  4O6M A;  3IEE A;  5A6A A;  1G8X A;  2QTV A;  3KKB A;  3N24 A;  3NYM A;  4EIY A;  4U5E E;  2EIL C;  2XS1 A;  5L0I A;  3LLK A;  3QW1 A;  4YT8 A;  5E3C A;  1D0Z A;  2OEV A;  3K33 A;  3R2P A;  2XL8 A;  3H2V A;  1M57 C;  1T6I A;  3DJN B;  4HE8 D;  5CIV A;  2J45 A;  2D4U A;  3Q7G A;  3OA1 A;  4RBN A;  4M63 A;  1ZHT A;  3M1C B;  1B68 A;  2J7P D;  4YL3 A;  4EBJ A;  5A6B D;  3X2Q C;  3E9V A;  4PR9 A;  1BZ4 A;  3FHD A;  3VAY A;  4A2N B;  4E0I A;  4DBR A;  2YRF A;  3O6X A;  3QTH A;  3DKA A;  2E87 A;  5B1A C;  4CBE A;  4E17 A;  4YWQ A;  2CYD A;  2Y3D A;  4IGG A;  2WZF A;  1ZHY A;  2P1A A;  2DI3 A;  4R32 A;  1JPN A;  2YHS A;  5KYY A;  1MND A;  1Q0M A;  4HEA J;  2PX0 A;  3M79 A;  1TQG A;  4WGZ A;  2X0C A;  2AVK A;  1CPR A;  3TD7 A;  4ZLD A;  3L8I A;  2M64 A;  4K7B A;  1ZU5 A;  5COM A;  2R7V A;  3RYL A;  3GWL A;  3I5Q A;  2Y3H A;  5L0F A;  3KPH A;  4JTA B;  1PD0 A;  1EI7 A;  2FGY A;  3KMI A;  3NMK A;  3OEO A;  4WGY A;  4JE9 A;  3SXM A;  4XPW A;  2VCC A;  2O9X A;  1LE2 A;  1ORJ A;  2A6H F;  1F1M A;  3FAJ A;  4OIR F;  5KYW B;  1JMW A;  2GA0 A;  2CCY A;  2OOC A;  1HY5 A;  1ST6 A;  5E2Q A;  1YJG A;  2HUJ A;  3IQC A;  4Q4Z F;  1Z7Q c;  4KBL A;  3IHU A;  5F28 E;  3ZQY A;  2NG1 A;  2H7O A;  4W8P A;  2HKV A;  5BUO A;  1CGM E;  2XLE A;  3OWT A;  3FXH A;  3EHN A;  3T6G B;  3LES A;  4U5F E;  1LKX A;  3JZ0 A;  1W2W A;  1WWP A;  4Q7C A;  1OW7 A;  2YZS A;  2HV7 A;  1JRA A;  1OW8 A;  1Y6D A;  5KYU B;  3ZC4 A;  1LE4 A;  3A11 A;  3C8Z A;  3DE8 A;  4YK5 A;  4CJO A;  1OCO C;  4CSA C;  4G7H F;  3IQ5 A;  3ZQV A;  1SMY F;  2L7A A;  3POV A;  1D1B A;  1NFN A;  3PCV A;  4MW3 A;  3GEH A;  1ZZP A;  2JX0 A;  2R03 A;  3U8V A;  3K6B A;  1A7V A;  4U5H A;  3LNR A;  1H6G A;  3EHM A;  5F5F A;  5B3S C;  1Q0K A;  3VM6 A;  4A4A A;  4DBQ A;  3L34 A;  2Q4F A;  1I4Y A;  2XLH A;  1KNY A;  1Q0G A;  2KNH A;  2UUH A;  2Z15 A;  3C8G D;  3PHF 2;  4JZA A;  2YWA A;  2KK1 A;  3FOP A;  4YT2 A;  2YL0 A;  3GEI A;  3R7C A;  5EK0 A;  2NSG A;  2MWQ A;  4NCQ A;  1I4Z A;  1H7I A;  2R25 A;  3UR3 C;  4XLN F;  1OKK A;  2AWC A;  4QDL A;  4XPX A;  1O5H A;  1OR2 A;  1QLE C;  4D4N A;  5EGY A;  2AU5 A;  4PFP A;  1RJ9 B;  4JEB A;  2V26 A;  4AL0 A;  1C03 A;  3S27 A;  5EHH A;  4AX2 A;  4MVM A;  1OCC C;  3ASN C;  1JR8 A;  4XEF A;  3UGO A;  4CSA A;  5B3I A;  1WTY A;  2YKZ A;  2WB7 A;  2YEV A;  3A9C A;  4O79 A;  4J7T A;  4H54 A;  4QI2 A;  2H7B A;  3HNL A;  2B0H A;  3FDQ A;  4I3M A;  2VAS A;  3WAQ A;  2Q9A A;  4BJ6 C;  3N0T A;  3U3B A;  3LS0 A;  2CGE A;  1PD1 A;  2XLV A;  5AGF A;  1E85 A;  2CNW A;  2HMQ A;  2R05 A;  4K0D A;  2EPK X;  1BBH A;  4MTO A;  3KH2 A;  2OU6 A;  1XZQ A;  3B9Q A;  4JJF A;  2NUP A;  2R7R A;  5DQT A;  2PBE A;  3EQL F;  5KYW A;  3C8G B;  3ABM C;  1BR1 A;  3RIP A;  3HKK A;  4E0H A;  2Y39 A;  1RMV A;  3QZC A;  1Q0D A;  3IQT A;  5KYX B;  4XPY A;  1OW6 A;  1LIH A;  3HTK C;  2A6E F;  4DJ9 A;  4JKV A;  3GEE A;  2PNO A;  5B1B C;  4XLP F;  1OXK A;  4PJJ A;  2J7P A;  4MVZ A;  5A6B A;  2Y3G A;  4EKW A;  2D5R B;  3QVZ A;  2KC3 A;  4MVU A;  3FOO A;  2W4M A;  2ZXR A;  4U9D A;  3C63 A;  4CIP A;  1OQC A;  4I44 A;  3WOD F;  4BJ6 A;  1VB5 A;  4JRZ A;  2QUP A;  2XLD A;  4DRI B;  1KTM A;  2DB4 A;  4G7O F;  2J0W A;  1U6H A;  2I8B A;  3HLZ A;  2WVN A;  3UNG C;  2VH3 A;  5BQG A;  3E70 C;  4LAC B;  1HE9 A;  3SXY A;  2HZ8 A;  1FTS A;  1RKC A;  2MHR A;  1QVX A;  1T01 A;  2LFF A;  3TUL A;  2YLD A;  1GGQ A;  3ZDL A;  4G7Z F;  2R7Q A;  2R7T A;  4RD9 A;  2ZXW C;  2ICW G;  4JJG A;  4PFO A;  4C3B A;  1I5N A;  1K40 A;  2IBF A;  2YVK A;  2R7X A;  3LEO A;  2R7W A;  2EIN C;  1M56 C;  3JYH A;  1T9K A;  2HJM A;  5L0H A;  2R7S A;  2F22 A;  3U2L A;  1ZW2 A;  1Z23 A;  3CZ6 A;  1T5O A;  1RJ9 A;  5JS5 A;  4ZLC A;  2J8W A;  3JCU Q;  2G3K A;  3M15 A;  4GYT A;  3U8P A;  3V5X A;  3PDM P;  1OR3 A;  2P7V A;  2Q9B A;  3IQ6 A;  1VMA A;  3SP1 A;  3LAY A;  1O87 A;  1E83 A;  1GS9 A;  2YL7 A;  4CS7 A;  3EJN A;  3T6B A;  2P0N A;  4BJ1 A;  3EFO A;  2OJE D;  1XZP A;  3US6 A;  4EWC A;  3B29 A;  4MS2 A;  2Q9C A;  1FMV A;  2GWW A;  3MX3 A;  4DVY P;  3ECS A;  1FMW A;  2J46 A;  3DWW A;  3WHN A;  4UDV A;  3ZIB A;  1A0B A;  4N6H A;  5JUA A;  1TWH A;  1TWC A;  4U5G A;  5A6J A;  2BE5 F;  3M4C A;  5HSW A;  5JT4 A;  2QLA A;  1G4U S;  2VCB A;  3B71 A;  1ZHW A;  3LUT B;  4JIO A;  2KQ9 A;  1MNE A;  4JTC B;  3C8G A;  5GPG B;  4OIP F;  1PV3 A;  2DGJ A;  2QY9 A;  3DE9 A;  3DM9 B;  2UUI A;  2B0J A;  5KYX A;  2I15 A;  2QNL A;  4DRJ B;  2CDQ A;  1R4T A;  2YLI A;  3EZI A;  1G5Z A;  3JT1 A;  4IAQ A;  1TKN A;  5JSL A;  2A0B A;  4OIO F;  2AWY A;  3HNJ A;  3LJB A;  4XEK A;  3AG3 C;  2YLG A;  1LS4 A;  3AG4 C;  1LM3 B;  2L6G A;  2NPU A;  3RKO F;  5F5H A;  4MQ9 F;  2XXA B;  3RW0 A;  5A6K A;  2OCC C;  2GFH A;  3NYJ A;  4MTG A;  3U2M A;  1RKE B;  2IXP A;  2NUT B;  2Q00 A;  2OQM A;  3MFN A;  3O10 A;  4P9F A;  5JLI A;  4E7Z A;  4X0R A;  2YL1 A;  2Y69 C;  3T4R A;  4MVR A;  2XLO A;  1CGN A;  3AJM A;  5TJ5 E;  1HW2 A;  4RDA A;  3O55 A;  3CSK A;  3ABK C;  1OCR C;  3AGU A;  3C18 A;  2NSF A;  2W4B A;  2WZL A;  1FAP B;  1M2O A;  3N2Z B;  3G4X A;  2XRH A;  3U9M A;  2EIM C;  3SXZ A;  1ZHX A;  3S29 A;  1V4A A;  5BQI A;  1YDI A;  1HE1 A;  1C02 A;  4CS9 C;  5E3A A;  4BG0 A;  3UMH A;  1UG7 A;  1WN0 A;  3GM1 A;  1MMD A;  3GM3 A;  4WJ0 A;  4YL1 A;  1NG1 A;  4PAC A;  4CIH A;  1FNT c;  4D4X A;  3W4Y A;  1DOV A;  3CAX A;  4LLE A;  5AC4 A;  3EH1 A;  1VK5 A;  3RH3 A;  4DOZ A;  1U0B B;  3EGX B;  4JC7 A;  2HSB A;  4GEH A;  5L3Q A;  1YLM A;  4MVQ A;  1YZA A;  3H65 A;  2XS8 A;  5T1D B;  1QPU A;  1G4W R;  2FAP B;  4CDA A;  3VF0 A;  3NDB B;  2FFH A;  1S7Z A;  2LCH A;  4AE4 B;  3RVY A;  3LEV A;  4C3E A;  4U5D E;  3JSE O;  3LS1 A;  3EG9 B;  3NYL A;  1YYJ A;  4AK9 A;  3W2V A;  3DMD A;  3V5Z A;  3ZTZ A;  2Y3B A;  5COG A;  2JPU A;  3G50 A;  2W45 A;  1RCP A;  3QMK A;  4IWB A;  4W8K A;  2AP3 A;  1SF8 A;  1NZE A;  2C03 A;  1T6U A;  3JSZ A;  3RF3 A;  2WZG A;  1A41 A;  3WG7 C;  2G62 A;  2KGO A;  3SEO A;  2EPO A;  3G4Z A;  3DXJ F;  4CS9 A;  4U5C E;  4FX5 A;  5KYN A;  1JPJ A;  2OKU A;  5DS4 A;  2J9B A;  1Z6A A;  2LQG A;  1EKY A;  1MMN A;  5T3W A;  4B6I A;  4JVS A;  4KC9 A;  1D1C A;  1T6Q A;  2H7V C;  3MBG A;  1ZVZ A;  5DS5 A;  4G0H A;  3EPV A;  3GOD A;  3ITF A;  1NLX A;  5D92 A;  2EIJ C;  3TOL A;  4H4K C;  1NBB A;  3X1O A;  4BEJ A;  1OXB A;  2XXA A;  3Q6N A;  2RD9 A;  1Z63 A;  2BL2 A;  1Y4C A;  1UFB A;  2XM4 A;  4MVS A;  4O6Y A;  5KYU A;  1RKE A;  2NUT A;  4QI0 A;  3K1I C;  4YJW A;  3ZG1 A;  1CPQ A;  2YL3 A;  5L0J A;  3ZTM A;  2H8A A;  3ZSU A;  4IAO A;  5T3T A;  4OIQ F;  2HSQ A;  1YA9 A;  4ONS A;  1VYI A;  2HS5 A;  4PK4 A;  5DLJ A;  5D91 A;  1J8M F;  3I5P A;  1OKK D;  4JEA A;  4I1O B;  1BR2 A;  4LDR A;  2XSE A;  1ZYR F;  2EPN A;  3TJ6 A;  2ZXP A;  3FAP B;  1CGO A;  3SNH A;  3W8H A;  2L81 A;  4NTB A;  4YT5 A;  4BPM A;  5JRA A;  1C17 M;  2L6H A;  2WVQ A;  2KJG A;  1L3P A;  3BRJ A;  4OD5 A;  5L0G A;  2V3C C;  4HFF B;  4JCZ A;  4JCH A;  1SZI A;  4MND A;  4ULW A;  3Q7L A;  2XL6 A;  3L0I A;  3U5S A;  1VLS A;  4CS8 C;  1ORS C;  3TJ5 A;  3FVY A;  3EGD B;  3AQB A;  1VYK A;  1N1C A;  3K66 A;  1D1A A;  2PP4 A;  1SYQ A;  2HFI A;  3U3F A;  5COF A;  3MYF A;  3K1H A;  3Q6M A;  4E7S A;  1YZC A;  4EBB A;  4E18 A;  4CJG A;  2BC5 A;  1HW1 A;  3EGX A;  1FR0 A;  3HNK A;  3RFY A;  4C7O B;  3ASO C;  4LDQ A;  4NTA A;  3B0V C;  4J30 B;  3JYY A;  4XEV A;  1TWA A;  2IXM A;  2J0X A;  5DS6 A;  3CQZ A;  1Z3I X;  3JTL O;  4AE4 A;  1D0X A;  4I1M A;  5L3V A;  1E86 A;  2C04 A;  2R9R B;  1E2X A;  2XM0 A;  3EG9 A;  3W2W A;  3UGP A;  1GM5 A;  3RQE A;  2P61 A;  4P9T A;  1GQA A;  4BJT A;  4J32 B;  1QQ3 A;  2J9U A;  2LK4 A;  3DZA A;  4BEM J;  1D0Y A;  2LD6 A;  1XWJ A;  2KSF A;  2GAQ A;  1JOG A;  3V7O A;  4CS8 A;  1S05 A;  1R5I D;  4ULV A;  4O6N A;  4U5B E;  4CX9 A;  3AQC A;  2MYS A;  1SR2 A;  3L8J A;  1APC A;  3AG1 C;  3UMK A;  5CI9 A;  1WGW A;  2DYR C;  2IOQ A;  4FAP B;  5FCL A;  1IW7 F;  4Q5S F;  1OCZ C;  3F46 A;  3LLI A;  3MYI A;  2OG2 A;  2J9W A;  2ASR A;  4IB4 A;  1HMD A;  3U9J A;  1QKR A;  1Q0F A;  4OIN F;  3AOU A;  4N6C A;  5FZT A;  3F47 A;  2HMZ A;  3KL4 A;  3C62 A;  4K1O A;  3RVZ A;  5DQZ A;  1H9T A;  2PFD A;  3K7D A;  1M2V B;  4J7Y A;  3S84 A;  1IZM A;  4MW8 A;  4DRH B;  2W9Y A;  1AEP A;  4N4W A;  4NQF A;  1FFH A;  4OD4 A;  3VYW A;  4MVO A;  1TFK B;  3MLG A;  2XLW A;  1FFT C;  2NUP B;  4L6R A;  2VB6 A;  1YAU O;  2HJ3 A;  2IM8 A;  1ORY A;  1JAF A;  2QE9 A;  4XTK A;  3DI5 A;  2A1D D;  3B0P A;  4FES A;  1NFO A;  4XWJ A;  2Q3T A;  2WL8 A;  3GOR A;  1LVK A;  2R7U A;  3ZVR A;  1YAR O;  2OEX A;  1K05 A;  4G78 A;  4IJJ A;  4P6I C;  1V55 C;  1EQ1 A;  5AC5 A;  4KI2 A;  1ZU4 A;  3I4U A;  2J9V A;  2XLM A;  4JUR I;  3TK0 A;  5HV9 A;  1E84 A;  3EH2 A;  2CW0 F;  2P6V A;  2L9J A;  4CDY A;  4FWV A;  1YA7 O;  3NRH A;  3DJU B;  4MTF A;  256B A;  3V5Y A;  1VTM P;  4PJM A;  1RXQ A;  3EGD A;  5L0D A;  3UMI A;  1LPE A;  2G3V A;  3NMI A;  2KYH A;  1EA8 A;  1MMG A;  1BDJ B;  1V74 B;  3LNM B;  1A7D A;  1YVI A;  2R02 A;  1AUE A;  4Z9H A;  3QVY A;  4NC3 A;  4AL1 A;  3U0C A;  2IXN A;  4GQH A;  1WAS A;  3J06 A;  3W8I A;  4F4B A;  1M6T A;  3DD7 A;  1VLT A;  1O3U A;  3SXK A;  3ZWI A;  4C7O A;  3S28 A;  4PJL A;  4DXW A;  5DVW A;  1ZW3 A;  3RQG A;  4ER9 A; 
#chains in the Genus database with same CATH homology
 2Q4F A;  1SR2 A;  2LCH A;  3KYI A;  3U3B A;  4G78 A;  3MYF A;  2A0B A;  2LP4 A;  1FR0 A;  1QSP A;  2R25 A;  4EUK B;  1C02 A;  3KYJ A;  1WN0 A;  1TQG A;  3US6 A;  1BDJ B;  1Y6D A;  1YVI A;  4PAC A;  3IQT A;  1C03 A;  1A0B A;  2LD6 A;  1OXK A;  1I5N A;  2OOC A;  1OXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...