1OXKA

Complex between ypd1 and sln1 response regulator domain in space group p3(2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
166
structure length
156
Chain Sequence
STIPSEIINWTILNEIISMDDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypd1p
publication title The Yeast YPD1/SLN1 Complex. Insights into Molecular Recognition in Two-Component Signaling Systems.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 69
structure length 156
sequence length 166
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1oxkA00
2A0BA 2LD6A 1A0BA 1SR2A 2Q4FA 1WN0A 1OXBA 4EUKB 4G78A 1C02A 1YVIA 1OXKA 3U3BA 1FR0A 1QSPA 1C03A 2LCHA 3US6A 2LP4A 1TQGA 2R25A 3IQTA 3KYIA 1I5NA 1BDJB 2OOCA 4PACA 1Y6DA 3MYFA 3KYJA
chains in the Genus database with same CATH superfamily
2VB6A 3GANA 2WB7A 1FMVA 1TR2A 2AWYA 2IXMA 2OCCC 4LLEA 3J06A 1TFOB 2W45A 4JKVA 1GGQA 4NTFA 1GS9A 2YL0A 2ZXRA 3B9QA 4CJOA 1ORSC 2J9UA 2YLIA 3AJMA 3DE9A 4H4KC 1EA8A 1NSGB 3O55A 2O9XA 2Q9BA 4M63A 4D4NA 2NSGA 3UMHA 4PR9A 5JVEA 3AQBA 2PFDA 2EIJC 2L6FA 3EFOB 1QSPA 2JD3A 2LCHA 4O6NA 1YA9A 1M6TA 3LLKA 3VF0A 2XS1A 1T6UA 4YWQA 5F5FA 4WJ0A 2C04A 2WVQA 4EKWA 2CCYA 3U2MA 2RSEB 3UGPA 1ZU5A 2LFFA 4U5FE 3NKDA 2Q7RA 4I1OB 3A11A 3T6GB 3UNGC 1A7EA 4HFFB 4AL0A 2QLAA 1C17M 4AE4B 4E0IA 3S84A 2A1DD 4RDAA 3PDMP 4UDVA 2Q9AA 3UMKA 3FDQA 2A6EF 3V5YA 3DKAA 2HUJA 2PX0A 4CSAC 4XTKA 3CZ6A 4YK5A 5COGA 5COMA 2KYHA 2GWWA 4FESA 4JTCB 4JURI 4KNWA 3DM5A 3T6JA 2XL4A 3GEEA 3U8PA 1MMGA 4ZLDA 1ZHWA 1VLSA 3I4UA 4G0HA 4MVMA 4OINF 3WAQA 3G50A 4CDVA 4DVZA 2J46A 3HNKA 2QE9A 1BR4A 3EG9A 1XWJA 3TULA 2R7VA 4OD4A 1FR0A 4G7ZF 3NYMA 3M1CB 3H2VA 4P9FA 1KNYA 5L0FA 3UGOA 1XZQA 4MNDA 2HSQA 3ABMC 1H9GA 2D5RB 3B0PA 5B1BC 3AGTA 3B0UX 1M57C 4KC9A 1ZW3A 5F5HA 5DS4A 1D1CA 3AG4C 4MVOA 1NZEA 2OOCA 4PACA 3F47A 5L0DA 5JT4A 4MS2A 3H2UA 4K0DA 3EH2A 5B3IA 1LI7A 4KI2A 3HLZA 2LSEA 3K1HA 2MWQA 1MMAA 3GORA 3GWLA 3JTLO 4C3EA 4CS9A 3DJNB 2BC5A 1WN0A 3QZCA 3KPHA 4JCZA 2XRHA 3RVYA 1YARO 3PHF2 1CGOA 4BJ1A 1UG7A 2HSBA 1M2VA 2IXNA 4QI0A 1MMDA 5KYYB 3DD7A 4PJMA 2KJGA 3ATPA 4CS8C 2OJED 1EQ1A 2HMZA 2NSFA 2LQGA 3ZSUA 1BBHA 1IZMA 1LKXA 3IQTA 4CX9A 4PJLA 3C8GA 3FOPA 3QW1A 4XLNF 4BG0A 2R7WA 4DVYP 4MVQA 1HW2A 3U8VA 2ETSA 3EGXA 2V3CC 2NUTB 3S90A 2L9JA 5L3VA 1QVXA 2YKZA 1E83A 3DJUB 3LEVA 4N6HA 1OR3A 4XPYA 4DXWA 1OW7A 2XL6A 5DLJA 1YYJA 4KNVA 4HE8D 3TQOA 2KW3C 3CQZA 5DS6A 2CNWA 2DB4A 2P6VA 4W8KA 2BE5F 2ZXOA 3A9CA 3AOUA 3R2PA 3RW0A 4E17A 1LVKA 2H7OA 4WABA 3UMIA 3ZTZA 4CIPA 2J7PA 2YVKA 1L7CA 2XLHA 4LACB 2X51A 1Q0GA 3DE8A 3HNJA 4P6IC 3HJCA 5KYWA 3X1OA 3CAXA 4NY3A 2WZFA 3V5XA 2KK1A 1Q0FA 1TWCA 3IQ6A 4NTAA 3DM9B 3LJBA 5T1DB 1YLMA 3T6BA 3ABLC 3GM3A 4J7TA 4MTGA 3RKOF 3N24A 2EPMX 4BJ5A 1V55C 3NMIA 1RJ9A 1YJGA 2NUPB 1TWAA 3C63A 1SMYF 1E2XA 1M56C 2XLOA 3AG1C 2KNHA 1A41A 1LI5A 3ASNC 3EQLF 3OA1A 4RBNA 5FZTA 4OIPF 2XXAA 1OXBA 1D0YA 4U5BE 1ZYRF 3NDBB 2YLGA 1D0ZA 3AG2C 2R7SA 2AWCA 5KYUB 2Y3GA 1EKYA 4QDLA 4U5GA 4U9EA 5DS5A 2WL8A 2OKUA 2HJMA 1GM5A 3W2WA 3AQCA 1LPEA 1ZHYA 5E2QA 5EHHA 1KTMA 4EBJA 1ZHXA 3QVZA 2C03A 2LP4A 1JAFA 2R25A 4MTFA 4N4WA 2EPLX 5JSLA 2CYDA 1VMAA 5TJ5E 1VTMP 2W4MA 1OCZC 5BQHA 2J8WA 2Y3BA 5E3CA 3S28A 2RD9A 4JC7A 1E84A 1NFNA 2ICWG 4LLCA 2DGJA 1JR8A 3G4XA 1XZPA 4PFOA 3N0TA 4R32A 2YL7A 2IYLD 2FFHA 4C3BA 3E9VA 5A6BD 1SR2A 2OU6A 4P9TA 4AK9A 1AEPA 4FAPB 2HKVA 3HKKA 4BJ6A 5A6KA 1G8XA 4JRZA 5L0GA 1BR1A 4O7GA 2OEXA 3EZIA 3DI5A 1T01A 2Y3HA 3C62A 5FCLA 4MVUA 3C8GD 1PD0A 2P1AA 2XLDA 1T6QA 5AC5A 3KH2A 1C03A 3SXMA 3U9MA 1ZHZA 4E0HA 1Z6AA 1Z7Qc 5EGYA 1HE1A 1F1MA 1H7IA 3GODA 3NRHA 4D4XA 4XLPF 2LFDA 1TFKB 4PJJA 1VYKA 4CDAA 3FHDA 2J9BA 4O6YA 3V7OA 1ORJA 4BJTA 2J7PD 2GAQA 1WASA 1ZU4A 2P0NA 4U5DE 4NCQA 3CEXA 3K1IA 5BUOA 2EPNA 3MBGA 1WTYA 1K04A 2E87A 4I3MA 3NYJA 1YAUO 4MVRA 3VAYA 2P61A 5JP7A 2YRFA 4Z9JA 4J30B 4DRJB 2TMVP 3VM6A 1B68A 2Z15A 2G3VA 2EINC 4MVZA 3QTHA 4I1MA 4BPMA 1NG1A 2CDQA 5L0JA 1UFBA 2EPOA 2XXAB 5HV9A 1TQGA 4GQHA 4EBBA 1I5NA 3NMKA 2A68F 2M64A 2IXOA 2J9WA 2MHRA 3H65A 3WHNA 3L0IA 3RQEA 2A0UA 2PF4E 3E70C 1D0XA 2A0BA 4N06A 3M4BA 3HTKC 4XEKA 1ZHTA 3L1MA 3PCVA 2GA0A 1OCCC 3LUTB 3VYWA 3I5PA 2EILC 2OQMA 1R4TA 2MYSA 3QMKA 4XEFA 1OCOC 2WZGA 3EHNA 4U5HA 3NMJA 4C7OA 3FOOA 4E7ZA 3OWTA 3EG9B 3Q6NA 4BEJA 1NBBA 3DXJF 4JW1A 4Z9HA 4B6IA 3SEOA 4YT2A 1M2OA 1MNDA 1RXQA 4L6RA 4YJWA 2FGYA 5KYYA 3RH3A 4XQ1A 2Q9CA 4XWJA 1OKKA 2F22A 3KYIA 3K6BA 3EHMA 2YL1A 4MW3A 4JIOA 4W8PA 5CI8A 4NC3A 4EIYA 1SYQA 4U5CE 1BDJB 1D1AA 4QI2A 2CGEA 3AGUA 3NYLA 2R7OA 4YT5A 3TD7A 3ZWIA 1OW8A 4ULWA 4XPXA 2HV6A 3ZC4A 3B0VC 4GEHA 3SZRA 2WVOA 3JSZA 4F4BA 4OIRF 5HSWA 1TKNA 4A4AA 1FMWA 1O87A 3W2VA 3MLGA 2Q00A 2AP3A 1M2VB 4CS7A 1K40A 3U0CA 2R7RA 3M79A 4U9DA 3EH1A 2VCBA 5COFA 3X2QC 3MFNA 3RYLA 3DAFA 2XLVA 3LNMB 1YVIA 4ONSA 2A6HF 3O6XA 2QUPA 1JMWA 3JT1A 1EI7A 2DYRC 3U3BA 3GM1A 3B71A 1WWPA 2CW0F 1LE4A 3C8GB 2QTVA 3VRCA 1FTSA 1T5OA 1Q0KA 3EGXB 1Q0MA 2R9RB 3FXHA 2UUHA 4AX2A 1BR2A 5K0IA 1VLTA 3U9JA 4ER9A 1T6IA 2XM0A 4IARA 2QNLA 3FMSA 4Q5SF 1S05A 3ZVRA 1RMVA 1FFHA 3LNRA 4YL0A 4DBQA 4LERA 1MNEA 2ZXWC 3ABKC 2YHSA 3MX3A 4IJJA 5JLIA 5KYNA 1E85A 2YQYA 2QY9A 4RD9A 1VOMA 1OQCA 2YLDA 3TJ6A 1PCXA 3F46A 3T9OA 3L8IA 2AVKA 2J9VA 5D92A 5KYWB 4PK4A 1C02A 3WG7C 2IBFA 4EWCA 5KYXA 1OCRC 4FWVA 5AGFA 4LDRA 2GDCA 4WGZA 3PMRA 2KC3A 3JYYA 4IGGA 3U3FA 2XL8A 3K66A 3RQGA 2R7UA 1QPUA 2G3KA 1YZCA 2JX0A 2NPUA 2VASA 3QVYA 2IXPA 2Q3TA 3B29A 4JVSA 1I4YA 4JZAA 1Z5ZA 3G4ZA 2WVNA 3IQ5A 4X0RA 3EGDA 4PJNA 2I15A 5EK0A 3SXKA 1RKEA 1Y6DA 1U6HA 1VYIA 2ZD9A 1JPNA 1AUEA 1V4AA 1Q0DA 1WOLA 3IPMO 4IAOA 4U5EE 1NLXA 4HEAJ 4YT4A 1H9TA 3O39A 3Q7LA 2W9YA 4JEBA 4K7BA 3POVA 1DOVA 256BA 3MYIA 3ZIBA 1OKKD 2YEVA 1L3PA 3TOLA 2R7QA 5BQGA 3LS1A 4XPWA 4BJ5C 4J32B 4MVSA 1RKCA 2J45A 2XLEA 1V74B 4CSAA 1NU7D 2HFIA 4OIOF 1NU9C 1RCPA 3ZG1A 3DWWA 3N2ZB 3S29A 3EFOA 4YL3A 2JPUA 3TJ5A 4WGYA 4FX5A 3LEOA 3W8HA 3S9OA 1LS1A 3DZAA 3RF3A 1CGNA 1VB5A 5B1AC 5BQIA 4G7OF 4XEVA 2IM8A 3L8JA 2B0HA 3JZ0A 3MYFA 1FNTc 1HE9A 2CNWD 2Y39A 4AE4A 4C3DA 1A7DA 2EIKC 2LK4A 3IHUA 1SF8A 1T9KA 2I8BA 3C7JA 5L0HA 2M4EA 5CIVA 3JRMO 2IOQA 2KSFA 2OEVA 1DOWA 2L7AA 4G78A 1AVOB 4JTAB 3K7DA 2VC9A 1QKRA 1TWHA 5L3QA 5JUAA 4A2NB 2R03A 2AU5A 3RQFA 2KGOA 3JCUQ 4EBKA 1E86A 1CGME 2V26A 3DAGA 3KKBA 4IB4A 4IRUA 2DYSC 4DRIB 3UR3C 1Z63A 1QLEC 3NKEA 2H7VC 4KBLA 3BEHA 4YL1A 4BJ6C 4H54A 1FAPB 1YA7O 2ZPAA 3EZHA 3KMIA 4IAQA 4YT8A 3QW0A 1OW6A 2D4UA 1S7ZA 3S0XA 4Z9IA 2LD6A 2UUIA 4CS8A 3EJNA 4ZLCA 4BEMJ 1A0BA 3FAPB 5CI9A 1JPJA 2PNOA 1Z3IX 5T3WA 2KQ9A 1Z23A 4MQ9F 4G7HF 3M15A 2ASRA 1ORYA 4DJ9A 3ZQVA 4OIQF 5D91A 1OXKA 3C8ZA 3C18A 4I44A 1WATA 1QQ3A 1V54C 2EIMC 3R7CA 3US6A 3KL4A 3LLIA 2G62A 2R7TA 1ST6A 3K1IC 2YL3A 3ZQYA 2BL2A 4Q4ZF 2B0JA 2Y3DA 4ULVA 3LS0A 4JE9A 4DBRA 1J8MF 1H6GA 1G4WR 3AG3C 2X0CA 1HMOA 4E18A 2NUTA 2H7BA 3TOMA 1J8YF 4CIHA 2EPKX 3ZTMA 5IY5C 3S27A 1BZ4A 1U89A 4O6MA 2YZSA 5JRAA 4C7OB 4NTBA 1R5ID 1FFTC 2A69F 4JJFA 3SXZA 5A6JA 1TWGA 2XM4A 2L6GA 3V5ZA 1G5ZA 1LIHA 4HFKB 5A6BA 2L81A 4E7SA 1ZW2A 3JRTA 1QZXA 5DVWA 2J0XA 4IWBA 4AL1A 3ECSA 4DRHB 1WGWA 1Y4CA 3BRJA 3U5SA 1K05A 2FAPB 2XS8A 4CDYA 5L0CA 2HS5A 3M4CA 1CPRA 1O3UA 2YWAA 4JJGA 2HMQA 2HZ8A 1A7VA 4CS9C 2R02A 5L0IA 2XLWA 4YN0B 3I5QA 1JOGA 2OJQA 2Y69C 3KYJA 3SP1A 4JTDB 1MMNA 4ANJA 2R7XA 2WZLA 2J0WA 3L34A 1OR2A 2NG1A 1VK5A 2NUPA 3GEHA 4GYTA 3RFYA 3IEEA 3RVZA 3RIPA 4N6CA 4JCHA 4LDQA 3OEOA 2W4BA 3U2LA 1CPQA 5A6AA 1KU2A 1MQVA 4J7YA 2GFHA 4JEAA 5B3SC 3SYNA 3LESA 3GM2A 1G4US 5E3AA 1HMDA 3EPVA 5KYUA 1YYXA 3HNLA 3O10A 5A69A 4CJGA 1YDIA 2HV7A 4DOZA 2LIGA 3JSEO 1U0BB 2VCAA 3FVYA 1LS4A 2VCCA 3GWNA 4O79A 5GPGB 1APCA 2PX3A 3SXYA 2P7VA 1HW1A 2PP4A 2VH3A 3T4RA 3Q7GA 4MW8A 1ZVZA 2HJ3A 1RJ9B 3LAYA 4LDKA 1PV3A 3SNHA 1IW7F 2PBEA 2R05A 4NQFA 3ITFA 2L6HA 3Q6MA 3FAJA 1O5HA 4PFPA 5JS5A 4MTOA 4Q7CA 1PD1A 2Q4FA 2OG2A 3WODF 4EUKB 1HY5A 2ZXPA 3W8IA 1LE2A 5KYXB 1ZZPA 1YZAA 3K33A 4K1OA 1GQAA 3NG1A 3ASOC 3ZDLA 4EHPA 5AC4A 5E33A 3TK0A 1I4ZA 3HNIA 5F28E 3EGDB 2XSEA 5DQZA 2DI3A 3IQCA 3DMDA 2XLMA 4CBEA 1JRAA 1RKEB 4OD5A 5DQTA 1SZIA 1LM3B 1D1BA 1NFOA 3CSKA 5T3TA 1N1CA 1W2WA 3GEIA 3JYHA 2H8AA 3W4YA
chains in the Genus database with same CATH topology
2A0BA 2LD6A 1A0BA 1SR2A 2Q4FA 1WN0A 1OXBA 4EUKB 4G78A 1C02A 1YVIA 1OXKA 3U3BA 1FR0A 1QSPA 1C03A 2LCHA 3US6A 2LP4A 1TQGA 2R25A 3IQTA 3KYIA 1I5NA 1BDJB 2OOCA 4PACA 1Y6DA 3MYFA 3KYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0B A;  2LD6 A;  1A0B A;  1SR2 A;  2Q4F A;  1WN0 A;  1OXB A;  4EUK B;  4G78 A;  1C02 A;  1YVI A;  1OXK A;  3U3B A;  1FR0 A;  1QSP A;  1C03 A;  2LCH A;  3US6 A;  2LP4 A;  1TQG A;  2R25 A;  3IQT A;  3KYI A;  1I5N A;  1BDJ B;  2OOC A;  4PAC A;  1Y6D A;  3MYF A;  3KYJ A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  3GAN A;  2WB7 A;  1FMV A;  1TR2 A;  2AWY A;  2IXM A;  2OCC C;  4LLE A;  3J06 A;  1TFO B;  2W45 A;  4JKV A;  1GGQ A;  4NTF A;  1GS9 A;  2YL0 A;  2ZXR A;  3B9Q A;  4CJO A;  1ORS C;  2J9U A;  2YLI A;  3AJM A;  3DE9 A;  4H4K C;  1EA8 A;  1NSG B;  3O55 A;  2O9X A;  2Q9B A;  4M63 A;  4D4N A;  2NSG A;  3UMH A;  4PR9 A;  5JVE A;  3AQB A;  2PFD A;  2EIJ C;  2L6F A;  3EFO B;  1QSP A;  2JD3 A;  2LCH A;  4O6N A;  1YA9 A;  1M6T A;  3LLK A;  3VF0 A;  2XS1 A;  1T6U A;  4YWQ A;  5F5F A;  4WJ0 A;  2C04 A;  2WVQ A;  4EKW A;  2CCY A;  3U2M A;  2RSE B;  3UGP A;  1ZU5 A;  2LFF A;  4U5F E;  3NKD A;  2Q7R A;  4I1O B;  3A11 A;  3T6G B;  3UNG C;  1A7E A;  4HFF B;  4AL0 A;  2QLA A;  1C17 M;  4AE4 B;  4E0I A;  3S84 A;  2A1D D;  4RDA A;  3PDM P;  4UDV A;  2Q9A A;  3UMK A;  3FDQ A;  2A6E F;  3V5Y A;  3DKA A;  2HUJ A;  2PX0 A;  4CSA C;  4XTK A;  3CZ6 A;  4YK5 A;  5COG A;  5COM A;  2KYH A;  2GWW A;  4FES A;  4JTC B;  4JUR I;  4KNW A;  3DM5 A;  3T6J A;  2XL4 A;  3GEE A;  3U8P A;  1MMG A;  4ZLD A;  1ZHW A;  1VLS A;  3I4U A;  4G0H A;  4MVM A;  4OIN F;  3WAQ A;  3G50 A;  4CDV A;  4DVZ A;  2J46 A;  3HNK A;  2QE9 A;  1BR4 A;  3EG9 A;  1XWJ A;  3TUL A;  2R7V A;  4OD4 A;  1FR0 A;  4G7Z F;  3NYM A;  3M1C B;  3H2V A;  4P9F A;  1KNY A;  5L0F A;  3UGO A;  1XZQ A;  4MND A;  2HSQ A;  3ABM C;  1H9G A;  2D5R B;  3B0P A;  5B1B C;  3AGT A;  3B0U X;  1M57 C;  4KC9 A;  1ZW3 A;  5F5H A;  5DS4 A;  1D1C A;  3AG4 C;  4MVO A;  1NZE A;  2OOC A;  4PAC A;  3F47 A;  5L0D A;  5JT4 A;  4MS2 A;  3H2U A;  4K0D A;  3EH2 A;  5B3I A;  1LI7 A;  4KI2 A;  3HLZ A;  2LSE A;  3K1H A;  2MWQ A;  1MMA A;  3GOR A;  3GWL A;  3JTL O;  4C3E A;  4CS9 A;  3DJN B;  2BC5 A;  1WN0 A;  3QZC A;  3KPH A;  4JCZ A;  2XRH A;  3RVY A;  1YAR O;  3PHF 2;  1CGO A;  4BJ1 A;  1UG7 A;  2HSB A;  1M2V A;  2IXN A;  4QI0 A;  1MMD A;  5KYY B;  3DD7 A;  4PJM A;  2KJG A;  3ATP A;  4CS8 C;  2OJE D;  1EQ1 A;  2HMZ A;  2NSF A;  2LQG A;  3ZSU A;  1BBH A;  1IZM A;  1LKX A;  3IQT A;  4CX9 A;  4PJL A;  3C8G A;  3FOP A;  3QW1 A;  4XLN F;  4BG0 A;  2R7W A;  4DVY P;  4MVQ A;  1HW2 A;  3U8V A;  2ETS A;  3EGX A;  2V3C C;  2NUT B;  3S90 A;  2L9J A;  5L3V A;  1QVX A;  2YKZ A;  1E83 A;  3DJU B;  3LEV A;  4N6H A;  1OR3 A;  4XPY A;  4DXW A;  1OW7 A;  2XL6 A;  5DLJ A;  1YYJ A;  4KNV A;  4HE8 D;  3TQO A;  2KW3 C;  3CQZ A;  5DS6 A;  2CNW A;  2DB4 A;  2P6V A;  4W8K A;  2BE5 F;  2ZXO A;  3A9C A;  3AOU A;  3R2P A;  3RW0 A;  4E17 A;  1LVK A;  2H7O A;  4WAB A;  3UMI A;  3ZTZ A;  4CIP A;  2J7P A;  2YVK A;  1L7C A;  2XLH A;  4LAC B;  2X51 A;  1Q0G A;  3DE8 A;  3HNJ A;  4P6I C;  3HJC A;  5KYW A;  3X1O A;  3CAX A;  4NY3 A;  2WZF A;  3V5X A;  2KK1 A;  1Q0F A;  1TWC A;  3IQ6 A;  4NTA A;  3DM9 B;  3LJB A;  5T1D B;  1YLM A;  3T6B A;  3ABL C;  3GM3 A;  4J7T A;  4MTG A;  3RKO F;  3N24 A;  2EPM X;  4BJ5 A;  1V55 C;  3NMI A;  1RJ9 A;  1YJG A;  2NUP B;  1TWA A;  3C63 A;  1SMY F;  1E2X A;  1M56 C;  2XLO A;  3AG1 C;  2KNH A;  1A41 A;  1LI5 A;  3ASN C;  3EQL F;  3OA1 A;  4RBN A;  5FZT A;  4OIP F;  2XXA A;  1OXB A;  1D0Y A;  4U5B E;  1ZYR F;  3NDB B;  2YLG A;  1D0Z A;  3AG2 C;  2R7S A;  2AWC A;  5KYU B;  2Y3G A;  1EKY A;  4QDL A;  4U5G A;  4U9E A;  5DS5 A;  2WL8 A;  2OKU A;  2HJM A;  1GM5 A;  3W2W A;  3AQC A;  1LPE A;  1ZHY A;  5E2Q A;  5EHH A;  1KTM A;  4EBJ A;  1ZHX A;  3QVZ A;  2C03 A;  2LP4 A;  1JAF A;  2R25 A;  4MTF A;  4N4W A;  2EPL X;  5JSL A;  2CYD A;  1VMA A;  5TJ5 E;  1VTM P;  2W4M A;  1OCZ C;  5BQH A;  2J8W A;  2Y3B A;  5E3C A;  3S28 A;  2RD9 A;  4JC7 A;  1E84 A;  1NFN A;  2ICW G;  4LLC A;  2DGJ A;  1JR8 A;  3G4X A;  1XZP A;  4PFO A;  3N0T A;  4R32 A;  2YL7 A;  2IYL D;  2FFH A;  4C3B A;  3E9V A;  5A6B D;  1SR2 A;  2OU6 A;  4P9T A;  4AK9 A;  1AEP A;  4FAP B;  2HKV A;  3HKK A;  4BJ6 A;  5A6K A;  1G8X A;  4JRZ A;  5L0G A;  1BR1 A;  4O7G A;  2OEX A;  3EZI A;  3DI5 A;  1T01 A;  2Y3H A;  3C62 A;  5FCL A;  4MVU A;  3C8G D;  1PD0 A;  2P1A A;  2XLD A;  1T6Q A;  5AC5 A;  3KH2 A;  1C03 A;  3SXM A;  3U9M A;  1ZHZ A;  4E0H A;  1Z6A A;  1Z7Q c;  5EGY A;  1HE1 A;  1F1M A;  1H7I A;  3GOD A;  3NRH A;  4D4X A;  4XLP F;  2LFD A;  1TFK B;  4PJJ A;  1VYK A;  4CDA A;  3FHD A;  2J9B A;  4O6Y A;  3V7O A;  1ORJ A;  4BJT A;  2J7P D;  2GAQ A;  1WAS A;  1ZU4 A;  2P0N A;  4U5D E;  4NCQ A;  3CEX A;  3K1I A;  5BUO A;  2EPN A;  3MBG A;  1WTY A;  1K04 A;  2E87 A;  4I3M A;  3NYJ A;  1YAU O;  4MVR A;  3VAY A;  2P61 A;  5JP7 A;  2YRF A;  4Z9J A;  4J30 B;  4DRJ B;  2TMV P;  3VM6 A;  1B68 A;  2Z15 A;  2G3V A;  2EIN C;  4MVZ A;  3QTH A;  4I1M A;  4BPM A;  1NG1 A;  2CDQ A;  5L0J A;  1UFB A;  2EPO A;  2XXA B;  5HV9 A;  1TQG A;  4GQH A;  4EBB A;  1I5N A;  3NMK A;  2A68 F;  2M64 A;  2IXO A;  2J9W A;  2MHR A;  3H65 A;  3WHN A;  3L0I A;  3RQE A;  2A0U A;  2PF4 E;  3E70 C;  1D0X A;  2A0B A;  4N06 A;  3M4B A;  3HTK C;  4XEK A;  1ZHT A;  3L1M A;  3PCV A;  2GA0 A;  1OCC C;  3LUT B;  3VYW A;  3I5P A;  2EIL C;  2OQM A;  1R4T A;  2MYS A;  3QMK A;  4XEF A;  1OCO C;  2WZG A;  3EHN A;  4U5H A;  3NMJ A;  4C7O A;  3FOO A;  4E7Z A;  3OWT A;  3EG9 B;  3Q6N A;  4BEJ A;  1NBB A;  3DXJ F;  4JW1 A;  4Z9H A;  4B6I A;  3SEO A;  4YT2 A;  1M2O A;  1MND A;  1RXQ A;  4L6R A;  4YJW A;  2FGY A;  5KYY A;  3RH3 A;  4XQ1 A;  2Q9C A;  4XWJ A;  1OKK A;  2F22 A;  3KYI A;  3K6B A;  3EHM A;  2YL1 A;  4MW3 A;  4JIO A;  4W8P A;  5CI8 A;  4NC3 A;  4EIY A;  1SYQ A;  4U5C E;  1BDJ B;  1D1A A;  4QI2 A;  2CGE A;  3AGU A;  3NYL A;  2R7O A;  4YT5 A;  3TD7 A;  3ZWI A;  1OW8 A;  4ULW A;  4XPX A;  2HV6 A;  3ZC4 A;  3B0V C;  4GEH A;  3SZR A;  2WVO A;  3JSZ A;  4F4B A;  4OIR F;  5HSW A;  1TKN A;  4A4A A;  1FMW A;  1O87 A;  3W2V A;  3MLG A;  2Q00 A;  2AP3 A;  1M2V B;  4CS7 A;  1K40 A;  3U0C A;  2R7R A;  3M79 A;  4U9D A;  3EH1 A;  2VCB A;  5COF A;  3X2Q C;  3MFN A;  3RYL A;  3DAF A;  2XLV A;  3LNM B;  1YVI A;  4ONS A;  2A6H F;  3O6X A;  2QUP A;  1JMW A;  3JT1 A;  1EI7 A;  2DYR C;  3U3B A;  3GM1 A;  3B71 A;  1WWP A;  2CW0 F;  1LE4 A;  3C8G B;  2QTV A;  3VRC A;  1FTS A;  1T5O A;  1Q0K A;  3EGX B;  1Q0M A;  2R9R B;  3FXH A;  2UUH A;  4AX2 A;  1BR2 A;  5K0I A;  1VLT A;  3U9J A;  4ER9 A;  1T6I A;  2XM0 A;  4IAR A;  2QNL A;  3FMS A;  4Q5S F;  1S05 A;  3ZVR A;  1RMV A;  1FFH A;  3LNR A;  4YL0 A;  4DBQ A;  4LER A;  1MNE A;  2ZXW C;  3ABK C;  2YHS A;  3MX3 A;  4IJJ A;  5JLI A;  5KYN A;  1E85 A;  2YQY A;  2QY9 A;  4RD9 A;  1VOM A;  1OQC A;  2YLD A;  3TJ6 A;  1PCX A;  3F46 A;  3T9O A;  3L8I A;  2AVK A;  2J9V A;  5D92 A;  5KYW B;  4PK4 A;  1C02 A;  3WG7 C;  2IBF A;  4EWC A;  5KYX A;  1OCR C;  4FWV A;  5AGF A;  4LDR A;  2GDC A;  4WGZ A;  3PMR A;  2KC3 A;  3JYY A;  4IGG A;  3U3F A;  2XL8 A;  3K66 A;  3RQG A;  2R7U A;  1QPU A;  2G3K A;  1YZC A;  2JX0 A;  2NPU A;  2VAS A;  3QVY A;  2IXP A;  2Q3T A;  3B29 A;  4JVS A;  1I4Y A;  4JZA A;  1Z5Z A;  3G4Z A;  2WVN A;  3IQ5 A;  4X0R A;  3EGD A;  4PJN A;  2I15 A;  5EK0 A;  3SXK A;  1RKE A;  1Y6D A;  1U6H A;  1VYI A;  2ZD9 A;  1JPN A;  1AUE A;  1V4A A;  1Q0D A;  1WOL A;  3IPM O;  4IAO A;  4U5E E;  1NLX A;  4HEA J;  4YT4 A;  1H9T A;  3O39 A;  3Q7L A;  2W9Y A;  4JEB A;  4K7B A;  3POV A;  1DOV A;  256B A;  3MYI A;  3ZIB A;  1OKK D;  2YEV A;  1L3P A;  3TOL A;  2R7Q A;  5BQG A;  3LS1 A;  4XPW A;  4BJ5 C;  4J32 B;  4MVS A;  1RKC A;  2J45 A;  2XLE A;  1V74 B;  4CSA A;  1NU7 D;  2HFI A;  4OIO F;  1NU9 C;  1RCP A;  3ZG1 A;  3DWW A;  3N2Z B;  3S29 A;  3EFO A;  4YL3 A;  2JPU A;  3TJ5 A;  4WGY A;  4FX5 A;  3LEO A;  3W8H A;  3S9O A;  1LS1 A;  3DZA A;  3RF3 A;  1CGN A;  1VB5 A;  5B1A C;  5BQI A;  4G7O F;  4XEV A;  2IM8 A;  3L8J A;  2B0H A;  3JZ0 A;  3MYF A;  1FNT c;  1HE9 A;  2CNW D;  2Y39 A;  4AE4 A;  4C3D A;  1A7D A;  2EIK C;  2LK4 A;  3IHU A;  1SF8 A;  1T9K A;  2I8B A;  3C7J A;  5L0H A;  2M4E A;  5CIV A;  3JRM O;  2IOQ A;  2KSF A;  2OEV A;  1DOW A;  2L7A A;  4G78 A;  1AVO B;  4JTA B;  3K7D A;  2VC9 A;  1QKR A;  1TWH A;  5L3Q A;  5JUA A;  4A2N B;  2R03 A;  2AU5 A;  3RQF A;  2KGO A;  3JCU Q;  4EBK A;  1E86 A;  1CGM E;  2V26 A;  3DAG A;  3KKB A;  4IB4 A;  4IRU A;  2DYS C;  4DRI B;  3UR3 C;  1Z63 A;  1QLE C;  3NKE A;  2H7V C;  4KBL A;  3BEH A;  4YL1 A;  4BJ6 C;  4H54 A;  1FAP B;  1YA7 O;  2ZPA A;  3EZH A;  3KMI A;  4IAQ A;  4YT8 A;  3QW0 A;  1OW6 A;  2D4U A;  1S7Z A;  3S0X A;  4Z9I A;  2LD6 A;  2UUI A;  4CS8 A;  3EJN A;  4ZLC A;  4BEM J;  1A0B A;  3FAP B;  5CI9 A;  1JPJ A;  2PNO A;  1Z3I X;  5T3W A;  2KQ9 A;  1Z23 A;  4MQ9 F;  4G7H F;  3M15 A;  2ASR A;  1ORY A;  4DJ9 A;  3ZQV A;  4OIQ F;  5D91 A;  1OXK A;  3C8Z A;  3C18 A;  4I44 A;  1WAT A;  1QQ3 A;  1V54 C;  2EIM C;  3R7C A;  3US6 A;  3KL4 A;  3LLI A;  2G62 A;  2R7T A;  1ST6 A;  3K1I C;  2YL3 A;  3ZQY A;  2BL2 A;  4Q4Z F;  2B0J A;  2Y3D A;  4ULV A;  3LS0 A;  4JE9 A;  4DBR A;  1J8M F;  1H6G A;  1G4W R;  3AG3 C;  2X0C A;  1HMO A;  4E18 A;  2NUT A;  2H7B A;  3TOM A;  1J8Y F;  4CIH A;  2EPK X;  3ZTM A;  5IY5 C;  3S27 A;  1BZ4 A;  1U89 A;  4O6M A;  2YZS A;  5JRA A;  4C7O B;  4NTB A;  1R5I D;  1FFT C;  2A69 F;  4JJF A;  3SXZ A;  5A6J A;  1TWG A;  2XM4 A;  2L6G A;  3V5Z A;  1G5Z A;  1LIH A;  4HFK B;  5A6B A;  2L81 A;  4E7S A;  1ZW2 A;  3JRT A;  1QZX A;  5DVW A;  2J0X A;  4IWB A;  4AL1 A;  3ECS A;  4DRH B;  1WGW A;  1Y4C A;  3BRJ A;  3U5S A;  1K05 A;  2FAP B;  2XS8 A;  4CDY A;  5L0C A;  2HS5 A;  3M4C A;  1CPR A;  1O3U A;  2YWA A;  4JJG A;  2HMQ A;  2HZ8 A;  1A7V A;  4CS9 C;  2R02 A;  5L0I A;  2XLW A;  4YN0 B;  3I5Q A;  1JOG A;  2OJQ A;  2Y69 C;  3KYJ A;  3SP1 A;  4JTD B;  1MMN A;  4ANJ A;  2R7X A;  2WZL A;  2J0W A;  3L34 A;  1OR2 A;  2NG1 A;  1VK5 A;  2NUP A;  3GEH A;  4GYT A;  3RFY A;  3IEE A;  3RVZ A;  3RIP A;  4N6C A;  4JCH A;  4LDQ A;  3OEO A;  2W4B A;  3U2L A;  1CPQ A;  5A6A A;  1KU2 A;  1MQV A;  4J7Y A;  2GFH A;  4JEA A;  5B3S C;  3SYN A;  3LES A;  3GM2 A;  1G4U S;  5E3A A;  1HMD A;  3EPV A;  5KYU A;  1YYX A;  3HNL A;  3O10 A;  5A69 A;  4CJG A;  1YDI A;  2HV7 A;  4DOZ A;  2LIG A;  3JSE O;  1U0B B;  2VCA A;  3FVY A;  1LS4 A;  2VCC A;  3GWN A;  4O79 A;  5GPG B;  1APC A;  2PX3 A;  3SXY A;  2P7V A;  1HW1 A;  2PP4 A;  2VH3 A;  3T4R A;  3Q7G A;  4MW8 A;  1ZVZ A;  2HJ3 A;  1RJ9 B;  3LAY A;  4LDK A;  1PV3 A;  3SNH A;  1IW7 F;  2PBE A;  2R05 A;  4NQF A;  3ITF A;  2L6H A;  3Q6M A;  3FAJ A;  1O5H A;  4PFP A;  5JS5 A;  4MTO A;  4Q7C A;  1PD1 A;  2Q4F A;  2OG2 A;  3WOD F;  4EUK B;  1HY5 A;  2ZXP A;  3W8I A;  1LE2 A;  5KYX B;  1ZZP A;  1YZA A;  3K33 A;  4K1O A;  1GQA A;  3NG1 A;  3ASO C;  3ZDL A;  4EHP A;  5AC4 A;  5E33 A;  3TK0 A;  1I4Z A;  3HNI A;  5F28 E;  3EGD B;  2XSE A;  5DQZ A;  2DI3 A;  3IQC A;  3DMD A;  2XLM A;  4CBE A;  1JRA A;  1RKE B;  4OD5 A;  5DQT A;  1SZI A;  1LM3 B;  1D1B A;  1NFO A;  3CSK A;  5T3T A;  1N1C A;  1W2W A;  3GEI A;  3JYH A;  2H8A A;  3W4Y A; 
#chains in the Genus database with same CATH homology
 2A0B A;  2LD6 A;  1A0B A;  1SR2 A;  2Q4F A;  1WN0 A;  1OXB A;  4EUK B;  4G78 A;  1C02 A;  1YVI A;  1OXK A;  3U3B A;  1FR0 A;  1QSP A;  1C03 A;  2LCH A;  3US6 A;  2LP4 A;  1TQG A;  2R25 A;  3IQT A;  3KYI A;  1I5N A;  1BDJ B;  2OOC A;  4PAC A;  1Y6D A;  3MYF A;  3KYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...