3PHF2

Crystal structure of the epstein-barr virus gh and gl complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
WAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein H
publication title Crystal structure of the Epstein-Barr virus (EBV) glycoprotein H/glycoprotein L (gH/gL) complex.
pubmed doi rcsb
source organism Human herpesvirus 4
total genus 19
structure length 108
sequence length 108
chains with identical sequence 4, 6, B, D, F, H, J, L, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF11108 Phage_glycop_gL Viral glycoprotein L
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3phf200
3PHF2 5T1DB
chains in the Genus database with same CATH superfamily
1WWPA 3AG4C 4EBBA 2YKZA 3C63A 4LDRA 4JZAA 4DOZA 1ZU4A 5KYUA 1TFOB 3UR3C 3TD7A 3U9MA 1A7EA 2J9WA 3QVZA 4CS8A 2ASRA 3EZHA 1I4ZA 1Y6DA 4YJWA 5A6AA 4U5FE 3C8GD 4CS7A 3DXJF 2Y3GA 3UNGC 5DS4A 4CJGA 3PCVA 1L3PA 3W2WA 1CGOA 1H9GA 2CNWD 2NPUA 2J9VA 4WABA 3ZDLA 2ZXPA 3FXHA 4JKVA 1YDIA 2QY9A 2OJED 2FAPB 4I44A 2QNLA 3RQGA 3ZQYA 3FHDA 5JVEA 1YA7O 3L8JA 5JT4A 4D4NA 4E0IA 4DBQA 4L6RA 3HTKC 4K0DA 3JRTA 1QPUA 4E7SA 2R7QA 4E18A 1HE9A 4HFFB 1LS1A 2PX0A 2XSEA 5E33A 3RVYA 1Z6AA 5L0JA 4O79A 1E83A 3TJ6A 4XEFA 2MWQA 1PV3A 3ZQVA 3K33A 3EH2A 1YYXA 2HFIA 3JTLO 4WGZA 4DRIB 4G78A 2XLHA 3T6BA 4PJNA 2KSFA 1T6QA 2BE5F 2M64A 2WVQA 3FOPA 4IJJA 2W4MA 1O3UA 3M79A 4KNWA 4PACA 3JT1A 1E84A 3EGXA 3U2LA 2XXAB 2LD6A 2YWAA 1ZHTA 3TK0A 4YT8A 4GQHA 1U6HA 2IXOA 4U5DE 3UGOA 1ZZPA 3EH1A 3NG1A 5B1AC 2DYSC 1H6GA 1ZVZA 2ZXOA 5JUAA 3K7DA 3TQOA 1QZXA 3DJNB 4G7OF 5F28E 2AVKA 4B6IA 1JMWA 2YL7A 1LE4A 1RXQA 2ICWG 1M2VA 1T6IA 3ZWIA 3U3FA 5KYXB 3RW0A 3MYIA 1G5ZA 1APCA 5T3WA 3V5YA 3H2UA 4C7OA 1TFKB 2OEXA 2YLIA 4PFOA 4YL1A 5HSWA 3G4ZA 3B0UX 4AK9A 3CQZA 3IQ5A 2WZFA 3VF0A 2DI3A 3U8PA 1QLEC 2H8AA 3IQ6A 4OIQF 4YT2A 1PD1A 3EZIA 3ZIBA 4CX9A 1D1CA 2PFDA 4QI2A 3RH3A 2F22A 3VM6A 3MYFA 1SMYF 4MTOA 3K1IC 3WHNA 1R4TA 1Q0FA 2HJ3A 2HUJA 2KJGA 4CDVA 2ZXWC 2R7UA 1MNEA 1M56C 5HV9A 2CCYA 3EFOB 3L1MA 1J8MF 3LLKA 3SXMA 1OQCA 2KK1A 4IGGA 1FFHA 1LM3B 1DOWA 1O87A 3FAPB 4YN0B 1AEPA 1D0YA 3V5XA 2XLDA 3Q6NA 5FCLA 4CSAC 3KPHA 3SXKA 3S90A 3EHNA 3K6BA 4H4KC 2WL8A 3ASNC 2YL3A 4HFKB 4XTKA 3RQEA 3BRJA 3T6GB 4DJ9A 2W9YA 1XZQA 4XPYA 2HV6A 4LDQA 5JLIA 1ORSC 2NUPA 3B0PA 3GEHA 3E70C 3C7JA 3W8IA 3ZTZA 3FDQA 5DVWA 4JCZA 5JS5A 5BQHA 1Z23A 4EBJA 4NC3A 2HZ8A 2IOQA 3WG7C 2PBEA 3NKDA 1C03A 2XLVA 4AX2A 4F4BA 3CZ6A 1NU9C 4J32B 2BL2A 1MMNA 3KMIA 3HJCA 2OQMA 1ZU5A 3U0CA 4NTFA 1NLXA 2OG2A 3UMHA 3J06A 2WB7A 2HKVA 1M6TA 3E9VA 3FVYA 4ANJA 1VMAA 4YWQA 2X0CA 4LLCA 3DAFA 4ULVA 2P7VA 1FAPB 3DAGA 3LS1A 5L0GA 4CIPA 1VK5A 1YZAA 2RSEB 3FOOA 5E3CA 4MS2A 1ST6A 2PF4E 2VCAA 3C8GA 2ZXRA 1Q0DA 3AGTA 1HE1A 1Z3IX 4XQ1A 4EBKA 2CNWA 1U89A 3KYIA 5L0HA 1DOVA 2VASA 3OA1A 4BJTA 5B3IA 2C04A 3B9QA 3RIPA 1E86A 1M2OA 1EA8A 3ITFA 3L34A 3LS0A 2GDCA 3ABLC 3LJBA 3RF3A 2OCCC 4YT5A 1HMOA 2Q9AA 4G0HA 1OW8A 2D5RB 3QW1A 4BJ6A 2AP3A 3NYMA 5BUOA 5B3SC 4I1MA 3AOUA 2XRHA 1C02A 4H54A 3UMIA 4MVRA 4BJ1A 4I1OB 4NTBA 4RDAA 1LKXA 3SNHA 1GGQA 3O55A 4C3EA 3DI5A 2LCHA 5EK0A 3LNRA 3K66A 2WZLA 4DXWA 3FMSA 4RBNA 2A0BA 2EINC 3EGXB 2HV7A 1RMVA 2IXNA 3LEVA 1IZMA 3QVYA 4BJ5A 2TMVP 4U9DA 2GFHA 4KC9A 2XM4A 4MVUA 4FAPB 4ER9A 3U9JA 2Q00A 4Q4ZF 2E87A 4XEKA 3A9CA 2H7VC 5L3VA 4ONSA 3TULA 1OCOC 2L9JA 4MVQA 3S29A 1IW7F 1M2VB 1PCXA 2EILC 4CSAA 4Q5SF 4OIPF 2G62A 2GAQA 2LSEA 2Y69C 3HNKA 1OW7A 2Z15A 3HNIA 5F5HA 2CDQA 2XL6A 2LQGA 2VC9A 1FMWA 2JPUA 2P0NA 3H65A 1FR0A 1YJGA 3VRCA 4JCHA 3JZ0A 1VLTA 4MW3A 5D92A 2Q9CA 1KNYA 3B29A 5IY5C 3HKKA 2X51A 2J45A 3NDBB 4N6HA 3POVA 4XPWA 2YVKA 2R25A 1T6UA 3Q6MA 4Q7CA 3T4RA 2XLOA 2R7WA 4DVZA 1XZPA 3H2VA 3ZG1A 2HMQA 2OJQA 1QSPA 2KW3C 3KL4A 3X1OA 1TWCA 4A4AA 2YL0A 3MLGA 1OXBA 2PP4A 1YZCA 1MMDA 3NMIA 4CS9A 2KGOA 5EHHA 2W45A 2R7XA 1RCPA 1MMAA 4FESA 2MYSA 2YEVA 4YL0A 2O9XA 1TR2A 2XL8A 3F47A 4CIHA 5A6BD 1M57C 3LLIA 1GS9A 4N6CA 3RYLA 2I15A 5JSLA 1VB5A 1ZW3A 4JURI 1UFBA 4HEAJ 3LNMB 5EGYA 2KYHA 3SEOA 2CGEA 5DS6A 2IXPA 3SYNA 1D0XA 2R9RB 3JRMO 2YZSA 4CBEA 1BBHA 2OKUA 2J8WA 1E2XA 2PX3A 2L6GA 2V3CC 1WN0A 1BDJB 2VB6A 4EIYA 2IM8A 3DMDA 3Q7GA 2IXMA 2EPKX 3GM3A 2XLEA 4LDKA 4AL1A 2Y3BA 3QMKA 1T01A 3DZAA 1T9KA 3ZVRA 5COGA 3EGDA 1BR2A 2EIMC 2OU6A 3C18A 3EPVA 1Z5ZA 1LI7A 4IAQA 4XLPF 2EIJC 2AWCA 5CI9A 2LFDA 1YYJA 1OW6A 2HSQA 2EPNA 1L7CA 1ZYRF 2Q4FA 3LAYA 4K7BA 4PJJA 3SXZA 1Z63A 1GM5A 4E0HA 2EPMX 2A1DD 1EQ1A 3C8GB 3AQCA 4XLNF 3I5QA 3NKEA 4U5BE 4Z9JA 1VTMP 3M4BA 1NFOA 2R7VA 4IAOA 2Y3HA 4Z9IA 3VAYA 256BA 1F1MA 5DLJA 3V5ZA 1JRAA 4MTFA 1I5NA 1UG7A 2VCCA 3ABMC 4JVSA 3U2MA 1A7VA 2I8BA 1KU2A 3GANA 5AGFA 2J9BA 4IB4A 5K0IA 4CS8C 4YK5A 1XWJA 3I4UA 1RKEA 1YAUO 1D1BA 3ZSUA 2WZGA 4DRJB 1RKCA 2M4EA 2OEVA 4MVOA 5KYUB 1Y4CA 4G7ZF 2XXAA 3EG9A 5JP7A 2JX0A 1OKKD 1BR1A 5A6JA 5CIVA 2C03A 1H7IA 1R5ID 1O5HA 1HY5A 3HNJA 5CI8A 3X2QC 2R03A 3B71A 4DVYP 2G3VA 3DM9B 3L8IA 4W8PA 1YA9A 3LUTB 2HSBA 5T1DB 1EKYA 2IBFA 2UUHA 2A68F 2DB4A 3AJMA 3JSEO 4XEVA 1NSGB 4U5EE 3ZC4A 4J7TA 4XPXA 4OIRF 4U5HA 4U5GA 3W8HA 2WVNA 3A11A 3CEXA 1HW1A 3HLZA 2P1AA 3LESA 1HW2A 4MTGA 4O6YA 3L0IA 4JTCB 4ZLDA 2KQ9A 3MBGA 3U8VA 4UDVA 2FGYA 2RD9A 4CDAA 3F46A 4JTDB 4U9EA 1AUEA 1MNDA 3M15A 1T5OA 5TJ5E 3Q7LA 2ETSA 1G4US 4J7YA 2Y39A 1V74B 1ZW2A 1JPNA 1OR2A 1Q0GA 1S7ZA 2QE9A 3ASOC 2J7PD 3C62A 4P9TA 1E85A 1YARO 3LEOA 1N1CA 4IRUA 3WAQA 4EKWA 1D1AA 1I4YA 1JPJA 1SZIA 2Q3TA 5DQZA 5DQTA 4MVZA 2R05A 1V54C 4NTAA 3T6JA 2YHSA 3DM5A 4BPMA 4C3DA 4HE8D 3U3BA 3HNLA 5BQIA 3QW0A 3EHMA 1NG1A 4O6NA 5KYWA 5GPGB 1NU7D 3JYYA 2Q7RA 2OOCA 3RVZA 2YRFA 4OD4A 3R7CA 3K1IA 4O6MA 4IARA 3ATPA 1ORYA 1ZHWA 2XLMA 2H7OA 1V4AA 1OCZC 4FX5A 2QUPA 3NRHA 5L0FA 1W2WA 4E17A 3PHF2 2CW0F 4NCQA 3G50A 4JEBA 1SR2A 2VH3A 4O7GA 2NUTA 5A6BA 3OWTA 3IHUA 2R7TA 2CYDA 4C7OB 3B0VC 4AE4A 3US6A 1HMDA 3NMKA 1SYQA 4BEJA 1YLMA 1ORJA 3S0XA 2L7AA 2ZPAA 1A41A 3O6XA 4D4XA 2A6EF 2R7RA 1JOGA 1S05A 2A6HF 3AGUA 3SXYA 3EGDB 3JSZA 5KYYA 4DRHB 2B0JA 4MQ9F 4JTAB 4PJMA 1VLSA 3EQLF 5FZTA 5B1BC 1RJ9A 4GYTA 4YL3A 3IEEA 1TQGA 3K1HA 3NMJA 3RQFA 3C8ZA 4JEAA 4KNVA 2FFHA 2LK4A 1TWGA 5D91A 4JIOA 3M4CA 4OIOF 3AQBA 1OR3A 5L3QA 5F5FA 1OXKA 1CPRA 1ZHXA 2KNHA 3SZRA 2Y3DA 4JRZA 3S28A 1CGNA 3DKAA 1G8XA 3WODF 4CDYA 1LS4A 1NZEA 1VYKA 2AWYA 2HMZA 5AC4A 5COMA 1JR8A 1NFNA 3JCUQ 1A0BA 4JJGA 4BG0A 5L0CA 4R32A 4MNDA 1SF8A 4MVSA 2KC3A 2XLWA 2YQYA 3BEHA 2P6VA 2EPOA 4G7HF 1QQ3A 2NUPB 1FFTC 1RKEB 1CPQA 2MHRA 1BR4A 3ZTMA 2W4BA 2H7BA 2L6FA 3AG3C 3NYLA 3ECSA 3U5SA 3UGPA 3GM1A 4AL0A 4JJFA 2HS5A 2J46A 2LFFA 3EG9B 4CJOA 5L0IA 2L81A 3G4XA 2A69F 3S27A 1FNTc 4FWVA 2NSFA 4ZLCA 3DWWA 1EI7A 1LIHA 5A69A 1LI5A 2JD3A 1ZHYA 1K04A 2A0UA 3EJNA 2D4UA 1OKKA 2XL4A 2YL1A 4WGYA 3S9OA 1WGWA 3MFNA 1G4WR 1J8YF 4Z9HA 3R2PA 1ZHZA 3QZCA 1LVKA 4QI0A 4PR9A 4ULWA 2XS1A 1QVXA 2WVOA 3O39A 4LACB 2YLGA 3JYHA 2XS8A 4BJ6C 1LE2A 3OEOA 4C3BA 5A6KA 5JRAA 3T9OA 3AG1C 2DYRC 1Z7Qc 3W2VA 1KTMA 2AU5A 4GEHA 4JE9A 4P9FA 4PFPA 3N24A 5E2QA 1K05A 3N2ZB 1TKNA 3TOLA 4E7ZA 5AC5A 2QTVA 5BQGA 2NG1A 3ABKC 2G3KA 1AVOB 3GEEA 3GODA 2Q9BA 2HJMA 1Q0KA 3UMKA 4BJ5C 3IQTA 3AG2C 4W8KA 5DS5A 4OD5A 1V55C 1FMVA 3NYJA 1MQVA 1WTYA 3TOMA 1OCRC 5COFA 4P6IC 2J7PA 5E3AA 1VYIA 1QKRA 1WASA 2PNOA 2QLAA 2LP4A 2J9UA 2NSGA 3I5PA 4KBLA 3GORA 4XWJA 3N0TA 4BEMJ 5KYWB 1WATA 2GA0A 3M1CB 1K40A 2DGJA 3SP1A 3MX3A 4EHPA 2EIKC 2V26A 1U0BB 5KYNA 2J0WA 4I3MA 3DD7A 1WOLA 2R02A 2XM0A 2ZD9A 4IWBA 3GWNA 3W4YA 4EUKB 5KYXA 3DE9A 4J30B 3RKOF 3IQCA 2P61A 3PMRA 4JC7A 4WJ0A 3RFYA 3VYWA 1GQAA 3GM2A 4K1OA 2LIGA 4MW8A 2R7SA 1B68A 4M63A 1Q0MA 1MMGA 4YT4A 3FAJA 3V7OA 4EWCA 3KKBA 2NUTB 4DBRA 5L0DA 4MVMA 3KH2A 1JAFA 1BZ4A 2YLDA 1TWHA 3CAXA 4PJLA 2VCBA 4LERA 1TWAA 4AE4B 4OINF 1H9TA 3GWLA 4NY3A 3KYJA 4LLEA 3TJ5A 2R7OA 4CS9C 4U5CE 2IYLD 1YVIA 2EPLX 1D0ZA 1NBBA 2L6HA 4JW1A 4RD9A 1CGME 4KI2A 4PK4A 5KYYB 1VOMA 3CSKA 1FTSA 3EFOA 2GWWA 1RJ9B 1PD0A 2BC5A 3DJUB 5T3TA 4QDLA 1LPEA 2UUIA 3QTHA 1C17M 3GEIA 4NQFA 4A2NB 4X0RA 1A7DA 3O10A 1OCCC 3IPMO 2B0HA 4N4WA 3S84A 4N06A 3PDMP 2J0XA 3DE8A
chains in the Genus database with same CATH topology
3AG4C 4EBBA 4JZAA 4DOZA 1ZU4A 5KYUA 3UR3C 3TD7A 2J9WA 4CS8A 3EZHA 4YJWA 4U5FE 4CS7A 3DXJF 2Y3GA 3UNGC 5DS4A 3W2WA 2CNWD 2J9VA 2ZXPA 2QY9A 4I44A 3FHDA 4DBQA 3HTKC 4K0DA 3JRTA 4E7SA 2R7QA 4HFFB 5E33A 1LS1A 2PX0A 2XSEA 1Z6AA 4O79A 2MWQA 3K33A 3EH2A 3T6BA 4PJNA 2BE5F 2WVQA 4IJJA 2W4MA 4KNWA 3JT1A 3EGXA 2XXAB 1ZHTA 4YT8A 2IXOA 4U5DE 3UGOA 3NG1A 3EH1A 5B1AC 2DYSC 2ZXOA 3K7DA 1QZXA 3DJNB 4G7OF 4B6IA 5KYXB 1M2VA 5T3WA 4C7OA 4PFOA 5HSWA 3B0UX 4AK9A 3CQZA 2WZFA 1QLEC 4OIQF 4YT2A 1PD1A 3EZIA 3ZIBA 1D1CA 2PFDA 4QI2A 3RH3A 1SMYF 3K1IC 2R7UA 2KJGA 2ZXWC 1MNEA 1M56C 3EFOB 3LLKA 1J8MF 1FFHA 1O87A 1D0YA 3Q6NA 5FCLA 4CSAC 3EHNA 3K6BA 4H4KC 2WL8A 3ASNC 4HFKB 4XTKA 2W9YA 2HV6A 2NUPA 3B0PA 3FDQA 3E70C 3W8IA 5DVWA 1Z23A 3WG7C 2IOQA 4F4BA 3NKDA 4AX2A 3CZ6A 1NU9C 4J32B 3KMIA 1MMNA 3HJCA 1ZU5A 2OG2A 3UMHA 2WB7A 3E9VA 3FVYA 1VMAA 4YWQA 4LLCA 3DAFA 2P7VA 3DAGA 3LS1A 1VK5A 5E3CA 1ST6A 2PF4E 2ZXRA 1Z3IX 2CNWA 2VASA 3OA1A 2C04A 3B9QA 3RIPA 1M2OA 3L34A 3ITFA 3LS0A 3ABLC 3LJBA 2OCCC 4YT5A 2Q9AA 4G0HA 2D5RB 4BJ6A 5BUOA 3NYMA 5B3SC 4I1MA 2XRHA 3UMIA 4BJ1A 4I1OB 4RDAA 1LKXA 3SNHA 4C3EA 3LNRA 3K66A 2WZLA 4RBNA 2EINC 3EGXB 2HV7A 2IXNA 3LEVA 1IZMA 4BJ5A 2GFHA 4KC9A 4Q4ZF 2E87A 2H7VC 5L3VA 1OCOC 2L9JA 3S29A 1IW7F 1PCXA 1M2VB 2EILC 4CSAA 4Q5SF 4OIPF 2G62A 2LSEA 2Y69C 2Z15A 5F5HA 2CDQA 1FMWA 3H65A 4JCHA 5D92A 2Q9CA 5IY5C 2X51A 2J45A 3NDBB 3POVA 4Q7CA 3T4RA 2R7WA 3Q6MA 4DVZA 3ZG1A 3X1OA 2KW3C 3KL4A 1TWCA 3MLGA 2PP4A 1MMDA 4CS9A 2KGOA 5EHHA 2W45A 2R7XA 1MMAA 4FESA 2MYSA 2YEVA 2O9XA 1TR2A 3F47A 4CIHA 1M57C 3LLIA 3RYLA 4JURI 4HEAJ 5EGYA 3SEOA 2CGEA 5DS6A 2IXPA 3SYNA 1D0XA 2YZSA 4CBEA 2PX3A 2V3CC 2VB6A 3DMDA 3Q7GA 2IXMA 2Y3BA 3QMKA 3ZVRA 3DZAA 3EGDA 1BR2A 2EIMC 3EPVA 1Z5ZA 4XLPF 2EIJC 5CI9A 4PJJA 3LAYA 1ZYRF 4K7BA 1Z63A 2A1DD 4XLNF 3AQCA 3I5QA 3NKEA 4U5BE 2R7VA 4IAOA 2Y3HA 3VAYA 5DLJA 3ABMC 4JVSA 2I8BA 1KU2A 3GANA 4CS8C 3I4UA 1D1BA 3ZSUA 2WZGA 2M4EA 5KYUB 4G7ZF 2XXAA 3EG9A 1OKKD 1BR1A 2C03A 3X2QC 1O5HA 5CI8A 4DVYP 2G3VA 3DM9B 5T1DB 2A68F 4U5EE 3ZC4A 4OIRF 4U5HA 4U5GA 3W8HA 2WVNA 3HLZA 3LESA 4O6YA 3L0IA 4ZLDA 2KQ9A 2FGYA 3F46A 1MNDA 3Q7LA 2Y39A 3ASOC 1JPNA 1S7ZA 4YN0B 2J7PD 1N1CA 4IRUA 1D1AA 1JPJA 1SZIA 2Q3TA 5DQZA 5DQTA 3T6JA 1V54C 4C3DA 2YHSA 3DM5A 4HE8D 3EHMA 1NG1A 4O6NA 5KYWA 1NU7D 4OD4A 4O6MA 1ZHWA 2H7OA 1OCZC 4FX5A 3NRHA 1W2WA 3PHF2 2CW0F 2VH3A 4O7GA 2NUTA 3OWTA 2R7TA 4C7OB 3B0VC 4AE4A 4BEJA 3S0XA 2ZPAA 3O6XA 2A6EF 2R7RA 2A6HF 5KYYA 3EGDB 3JSZA 2B0JA 4MQ9F 4PJMA 5B1BC 3EQLF 1RJ9A 4GYTA 3IEEA 3K1HA 4KNVA 2FFHA 1TWGA 5D91A 4OIOF 3AQBA 5L3QA 5F5FA 1ZHXA 2KNHA 3SZRA 2Y3DA 3S28A 1G8XA 3WODF 1NZEA 1VYKA 3JCUQ 4BG0A 4JJGA 4MNDA 1SF8A 2P6VA 4G7HF 2NUPB 1FFTC 1BR4A 2W4BA 2H7BA 3NYLA 3AG3C 3ECSA 3UGPA 4JJFA 2J46A 3EG9B 2L81A 3S27A 2A69F 4FWVA 4ZLCA 2JD3A 1ZHYA 3EJNA 2XL4A 1OKKA 1WGWA 1J8YF 1ZHZA 3QZCA 1LVKA 4QI0A 4ULWA 2WVOA 3O39A 4LACB 3JYHA 4BJ6C 3OEOA 4C3BA 3AG1C 2DYRC 3W2VA 4GEHA 4PFPA 3N24A 5E2QA 3N2ZB 1TKNA 4E7ZA 2QTVA 2NG1A 3ABKC 2G3KA 3GODA 2Q9BA 3UMKA 4BJ5C 5DS5A 3AG2C 4W8KA 4OD5A 1V55C 1FMVA 3NYJA 1OCRC 4P6IC 2J7PA 5E3AA 1VYIA 4ANJA 3I5PA 4XWJA 4BJTA 2J9UA 5KYWB 4KBLA 3N0TA 3M1CB 2DGJA 3SP1A 3MX3A 2EIKC 2V26A 5KYNA 2J0WA 4I3MA 3DD7A 4IWBA 5KYXA 4J30B 3RKOF 3PMRA 4WJ0A 3RFYA 3VYWA 2R7SA 4M63A 1MMGA 4YT4A 3FAJA 3V7OA 4EWCA 3KKBA 2NUTB 4DBRA 3KH2A 4PJLA 1TWHA 4LERA 1TWAA 4AE4B 4OINF 4NY3A 4LLEA 2R7OA 4CS9C 4U5CE 2IYLD 4JW1A 1D0ZA 4RD9A 4KI2A 4PK4A 5KYYB 1VOMA 3CSKA 1FTSA 3EFOA 1RJ9B 1PD0A 3DJUB 5T3TA 4QDLA 4A2NB 4X0RA 1OCCC 4N06A 2J0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHF 2;  5T1D B; 
#chains in the Genus database with same CATH topology
 1WWP A;  3AG4 C;  4EBB A;  2YKZ A;  3C63 A;  4LDR A;  4JZA A;  4DOZ A;  1ZU4 A;  5KYU A;  1TFO B;  3UR3 C;  3TD7 A;  3U9M A;  1A7E A;  2J9W A;  3QVZ A;  4CS8 A;  2ASR A;  3EZH A;  1I4Z A;  1Y6D A;  4YJW A;  5A6A A;  4U5F E;  3C8G D;  4CS7 A;  3DXJ F;  2Y3G A;  3UNG C;  5DS4 A;  4CJG A;  3PCV A;  1L3P A;  3W2W A;  1CGO A;  1H9G A;  2CNW D;  2NPU A;  2J9V A;  4WAB A;  3ZDL A;  2ZXP A;  3FXH A;  4JKV A;  1YDI A;  2QY9 A;  2OJE D;  2FAP B;  4I44 A;  2QNL A;  3RQG A;  3ZQY A;  3FHD A;  5JVE A;  1YA7 O;  3L8J A;  5JT4 A;  4D4N A;  4E0I A;  4DBQ A;  4L6R A;  3HTK C;  4K0D A;  3JRT A;  1QPU A;  4E7S A;  2R7Q A;  4E18 A;  1HE9 A;  4HFF B;  1LS1 A;  2PX0 A;  2XSE A;  5E33 A;  3RVY A;  1Z6A A;  5L0J A;  4O79 A;  1E83 A;  3TJ6 A;  4XEF A;  2MWQ A;  1PV3 A;  3ZQV A;  3K33 A;  3EH2 A;  1YYX A;  2HFI A;  3JTL O;  4WGZ A;  4DRI B;  4G78 A;  2XLH A;  3T6B A;  4PJN A;  2KSF A;  1T6Q A;  2BE5 F;  2M64 A;  2WVQ A;  3FOP A;  4IJJ A;  2W4M A;  1O3U A;  3M79 A;  4KNW A;  4PAC A;  3JT1 A;  1E84 A;  3EGX A;  3U2L A;  2XXA B;  2LD6 A;  2YWA A;  1ZHT A;  3TK0 A;  4YT8 A;  4GQH A;  1U6H A;  2IXO A;  4U5D E;  3UGO A;  1ZZP A;  3EH1 A;  3NG1 A;  5B1A C;  2DYS C;  1H6G A;  1ZVZ A;  2ZXO A;  5JUA A;  3K7D A;  3TQO A;  1QZX A;  3DJN B;  4G7O F;  5F28 E;  2AVK A;  4B6I A;  1JMW A;  2YL7 A;  1LE4 A;  1RXQ A;  2ICW G;  1M2V A;  1T6I A;  3ZWI A;  3U3F A;  5KYX B;  3RW0 A;  3MYI A;  1G5Z A;  1APC A;  5T3W A;  3V5Y A;  3H2U A;  4C7O A;  1TFK B;  2OEX A;  2YLI A;  4PFO A;  4YL1 A;  5HSW A;  3G4Z A;  3B0U X;  4AK9 A;  3CQZ A;  3IQ5 A;  2WZF A;  3VF0 A;  2DI3 A;  3U8P A;  1QLE C;  2H8A A;  3IQ6 A;  4OIQ F;  4YT2 A;  1PD1 A;  3EZI A;  3ZIB A;  4CX9 A;  1D1C A;  2PFD A;  4QI2 A;  3RH3 A;  2F22 A;  3VM6 A;  3MYF A;  1SMY F;  4MTO A;  3K1I C;  3WHN A;  1R4T A;  1Q0F A;  2HJ3 A;  2HUJ A;  2KJG A;  4CDV A;  2ZXW C;  2R7U A;  1MNE A;  1M56 C;  5HV9 A;  2CCY A;  3EFO B;  3L1M A;  1J8M F;  3LLK A;  3SXM A;  1OQC A;  2KK1 A;  4IGG A;  1FFH A;  1LM3 B;  1DOW A;  1O87 A;  3FAP B;  4YN0 B;  1AEP A;  1D0Y A;  3V5X A;  2XLD A;  3Q6N A;  5FCL A;  4CSA C;  3KPH A;  3SXK A;  3S90 A;  3EHN A;  3K6B A;  4H4K C;  2WL8 A;  3ASN C;  2YL3 A;  4HFK B;  4XTK A;  3RQE A;  3BRJ A;  3T6G B;  4DJ9 A;  2W9Y A;  1XZQ A;  4XPY A;  2HV6 A;  4LDQ A;  5JLI A;  1ORS C;  2NUP A;  3B0P A;  3GEH A;  3E70 C;  3C7J A;  3W8I A;  3ZTZ A;  3FDQ A;  5DVW A;  4JCZ A;  5JS5 A;  5BQH A;  1Z23 A;  4EBJ A;  4NC3 A;  2HZ8 A;  2IOQ A;  3WG7 C;  2PBE A;  3NKD A;  1C03 A;  2XLV A;  4AX2 A;  4F4B A;  3CZ6 A;  1NU9 C;  4J32 B;  2BL2 A;  1MMN A;  3KMI A;  3HJC A;  2OQM A;  1ZU5 A;  3U0C A;  4NTF A;  1NLX A;  2OG2 A;  3UMH A;  3J06 A;  2WB7 A;  2HKV A;  1M6T A;  3E9V A;  3FVY A;  4ANJ A;  1VMA A;  4YWQ A;  2X0C A;  4LLC A;  3DAF A;  4ULV A;  2P7V A;  1FAP B;  3DAG A;  3LS1 A;  5L0G A;  4CIP A;  1VK5 A;  1YZA A;  2RSE B;  3FOO A;  5E3C A;  4MS2 A;  1ST6 A;  2PF4 E;  2VCA A;  3C8G A;  2ZXR A;  1Q0D A;  3AGT A;  1HE1 A;  1Z3I X;  4XQ1 A;  4EBK A;  2CNW A;  1U89 A;  3KYI A;  5L0H A;  1DOV A;  2VAS A;  3OA1 A;  4BJT A;  5B3I A;  2C04 A;  3B9Q A;  3RIP A;  1E86 A;  1M2O A;  1EA8 A;  3ITF A;  3L34 A;  3LS0 A;  2GDC A;  3ABL C;  3LJB A;  3RF3 A;  2OCC C;  4YT5 A;  1HMO A;  2Q9A A;  4G0H A;  1OW8 A;  2D5R B;  3QW1 A;  4BJ6 A;  2AP3 A;  3NYM A;  5BUO A;  5B3S C;  4I1M A;  3AOU A;  2XRH A;  1C02 A;  4H54 A;  3UMI A;  4MVR A;  4BJ1 A;  4I1O B;  4NTB A;  4RDA A;  1LKX A;  3SNH A;  1GGQ A;  3O55 A;  4C3E A;  3DI5 A;  2LCH A;  5EK0 A;  3LNR A;  3K66 A;  2WZL A;  4DXW A;  3FMS A;  4RBN A;  2A0B A;  2EIN C;  3EGX B;  2HV7 A;  1RMV A;  2IXN A;  3LEV A;  1IZM A;  3QVY A;  4BJ5 A;  2TMV P;  4U9D A;  2GFH A;  4KC9 A;  2XM4 A;  4MVU A;  4FAP B;  4ER9 A;  3U9J A;  2Q00 A;  4Q4Z F;  2E87 A;  4XEK A;  3A9C A;  2H7V C;  5L3V A;  4ONS A;  3TUL A;  1OCO C;  2L9J A;  4MVQ A;  3S29 A;  1IW7 F;  1M2V B;  1PCX A;  2EIL C;  4CSA A;  4Q5S F;  4OIP F;  2G62 A;  2GAQ A;  2LSE A;  2Y69 C;  3HNK A;  1OW7 A;  2Z15 A;  3HNI A;  5F5H A;  2CDQ A;  2XL6 A;  2LQG A;  2VC9 A;  1FMW A;  2JPU A;  2P0N A;  3H65 A;  1FR0 A;  1YJG A;  3VRC A;  4JCH A;  3JZ0 A;  1VLT A;  4MW3 A;  5D92 A;  2Q9C A;  1KNY A;  3B29 A;  5IY5 C;  3HKK A;  2X51 A;  2J45 A;  3NDB B;  4N6H A;  3POV A;  4XPW A;  2YVK A;  2R25 A;  1T6U A;  3Q6M A;  4Q7C A;  3T4R A;  2XLO A;  2R7W A;  4DVZ A;  1XZP A;  3H2V A;  3ZG1 A;  2HMQ A;  2OJQ A;  1QSP A;  2KW3 C;  3KL4 A;  3X1O A;  1TWC A;  4A4A A;  2YL0 A;  3MLG A;  1OXB A;  2PP4 A;  1YZC A;  1MMD A;  3NMI A;  4CS9 A;  2KGO A;  5EHH A;  2W45 A;  2R7X A;  1RCP A;  1MMA A;  4FES A;  2MYS A;  2YEV A;  4YL0 A;  2O9X A;  1TR2 A;  2XL8 A;  3F47 A;  4CIH A;  5A6B D;  1M57 C;  3LLI A;  1GS9 A;  4N6C A;  3RYL A;  2I15 A;  5JSL A;  1VB5 A;  1ZW3 A;  4JUR I;  1UFB A;  4HEA J;  3LNM B;  5EGY A;  2KYH A;  3SEO A;  2CGE A;  5DS6 A;  2IXP A;  3SYN A;  1D0X A;  2R9R B;  3JRM O;  2YZS A;  4CBE A;  1BBH A;  2OKU A;  2J8W A;  1E2X A;  2PX3 A;  2L6G A;  2V3C C;  1WN0 A;  1BDJ B;  2VB6 A;  4EIY A;  2IM8 A;  3DMD A;  3Q7G A;  2IXM A;  2EPK X;  3GM3 A;  2XLE A;  4LDK A;  4AL1 A;  2Y3B A;  3QMK A;  1T01 A;  3DZA A;  1T9K A;  3ZVR A;  5COG A;  3EGD A;  1BR2 A;  2EIM C;  2OU6 A;  3C18 A;  3EPV A;  1Z5Z A;  1LI7 A;  4IAQ A;  4XLP F;  2EIJ C;  2AWC A;  5CI9 A;  2LFD A;  1YYJ A;  1OW6 A;  2HSQ A;  2EPN A;  1L7C A;  1ZYR F;  2Q4F A;  3LAY A;  4K7B A;  4PJJ A;  3SXZ A;  1Z63 A;  1GM5 A;  4E0H A;  2EPM X;  2A1D D;  1EQ1 A;  3C8G B;  3AQC A;  4XLN F;  3I5Q A;  3NKE A;  4U5B E;  4Z9J A;  1VTM P;  3M4B A;  1NFO A;  2R7V A;  4IAO A;  2Y3H A;  4Z9I A;  3VAY A;  256B A;  1F1M A;  5DLJ A;  3V5Z A;  1JRA A;  4MTF A;  1I5N A;  1UG7 A;  2VCC A;  3ABM C;  4JVS A;  3U2M A;  1A7V A;  2I8B A;  1KU2 A;  3GAN A;  5AGF A;  2J9B A;  4IB4 A;  5K0I A;  4CS8 C;  4YK5 A;  1XWJ A;  3I4U A;  1RKE A;  1YAU O;  1D1B A;  3ZSU A;  2WZG A;  4DRJ B;  1RKC A;  2M4E A;  2OEV A;  4MVO A;  5KYU B;  1Y4C A;  4G7Z F;  2XXA A;  3EG9 A;  5JP7 A;  2JX0 A;  1OKK D;  1BR1 A;  5A6J A;  5CIV A;  2C03 A;  1H7I A;  1R5I D;  1O5H A;  1HY5 A;  3HNJ A;  5CI8 A;  3X2Q C;  2R03 A;  3B71 A;  4DVY P;  2G3V A;  3DM9 B;  3L8I A;  4W8P A;  1YA9 A;  3LUT B;  2HSB A;  5T1D B;  1EKY A;  2IBF A;  2UUH A;  2A68 F;  2DB4 A;  3AJM A;  3JSE O;  4XEV A;  1NSG B;  4U5E E;  3ZC4 A;  4J7T A;  4XPX A;  4OIR F;  4U5H A;  4U5G A;  3W8H A;  2WVN A;  3A11 A;  3CEX A;  1HW1 A;  3HLZ A;  2P1A A;  3LES A;  1HW2 A;  4MTG A;  4O6Y A;  3L0I A;  4JTC B;  4ZLD A;  2KQ9 A;  3MBG A;  3U8V A;  4UDV A;  2FGY A;  2RD9 A;  4CDA A;  3F46 A;  4JTD B;  4U9E A;  1AUE A;  1MND A;  3M15 A;  1T5O A;  5TJ5 E;  3Q7L A;  2ETS A;  1G4U S;  4J7Y A;  2Y39 A;  1V74 B;  1ZW2 A;  1JPN A;  1OR2 A;  1Q0G A;  1S7Z A;  2QE9 A;  3ASO C;  2J7P D;  3C62 A;  4P9T A;  1E85 A;  1YAR O;  3LEO A;  1N1C A;  4IRU A;  3WAQ A;  4EKW A;  1D1A A;  1I4Y A;  1JPJ A;  1SZI A;  2Q3T A;  5DQZ A;  5DQT A;  4MVZ A;  2R05 A;  1V54 C;  4NTA A;  3T6J A;  2YHS A;  3DM5 A;  4BPM A;  4C3D A;  4HE8 D;  3U3B A;  3HNL A;  5BQI A;  3QW0 A;  3EHM A;  1NG1 A;  4O6N A;  5KYW A;  5GPG B;  1NU7 D;  3JYY A;  2Q7R A;  2OOC A;  3RVZ A;  2YRF A;  4OD4 A;  3R7C A;  3K1I A;  4O6M A;  4IAR A;  3ATP A;  1ORY A;  1ZHW A;  2XLM A;  2H7O A;  1V4A A;  1OCZ C;  4FX5 A;  2QUP A;  3NRH A;  5L0F A;  1W2W A;  4E17 A;  3PHF 2;  2CW0 F;  4NCQ A;  3G50 A;  4JEB A;  1SR2 A;  2VH3 A;  4O7G A;  2NUT A;  5A6B A;  3OWT A;  3IHU A;  2R7T A;  2CYD A;  4C7O B;  3B0V C;  4AE4 A;  3US6 A;  1HMD A;  3NMK A;  1SYQ A;  4BEJ A;  1YLM A;  1ORJ A;  3S0X A;  2L7A A;  2ZPA A;  1A41 A;  3O6X A;  4D4X A;  2A6E F;  2R7R A;  1JOG A;  1S05 A;  2A6H F;  3AGU A;  3SXY A;  3EGD B;  3JSZ A;  5KYY A;  4DRH B;  2B0J A;  4MQ9 F;  4JTA B;  4PJM A;  1VLS A;  3EQL F;  5FZT A;  5B1B C;  1RJ9 A;  4GYT A;  4YL3 A;  3IEE A;  1TQG A;  3K1H A;  3NMJ A;  3RQF A;  3C8Z A;  4JEA A;  4KNV A;  2FFH A;  2LK4 A;  1TWG A;  5D91 A;  4JIO A;  3M4C A;  4OIO F;  3AQB A;  1OR3 A;  5L3Q A;  5F5F A;  1OXK A;  1CPR A;  1ZHX A;  2KNH A;  3SZR A;  2Y3D A;  4JRZ A;  3S28 A;  1CGN A;  3DKA A;  1G8X A;  3WOD F;  4CDY A;  1LS4 A;  1NZE A;  1VYK A;  2AWY A;  2HMZ A;  5AC4 A;  5COM A;  1JR8 A;  1NFN A;  3JCU Q;  1A0B A;  4JJG A;  4BG0 A;  5L0C A;  4R32 A;  4MND A;  1SF8 A;  4MVS A;  2KC3 A;  2XLW A;  2YQY A;  3BEH A;  2P6V A;  2EPO A;  4G7H F;  1QQ3 A;  2NUP B;  1FFT C;  1RKE B;  1CPQ A;  2MHR A;  1BR4 A;  3ZTM A;  2W4B A;  2H7B A;  2L6F A;  3AG3 C;  3NYL A;  3ECS A;  3U5S A;  3UGP A;  3GM1 A;  4AL0 A;  4JJF A;  2HS5 A;  2J46 A;  2LFF A;  3EG9 B;  4CJO A;  5L0I A;  2L81 A;  3G4X A;  2A69 F;  3S27 A;  1FNT c;  4FWV A;  2NSF A;  4ZLC A;  3DWW A;  1EI7 A;  1LIH A;  5A69 A;  1LI5 A;  2JD3 A;  1ZHY A;  1K04 A;  2A0U A;  3EJN A;  2D4U A;  1OKK A;  2XL4 A;  2YL1 A;  4WGY A;  3S9O A;  1WGW A;  3MFN A;  1G4W R;  1J8Y F;  4Z9H A;  3R2P A;  1ZHZ A;  3QZC A;  1LVK A;  4QI0 A;  4PR9 A;  4ULW A;  2XS1 A;  1QVX A;  2WVO A;  3O39 A;  4LAC B;  2YLG A;  3JYH A;  2XS8 A;  4BJ6 C;  1LE2 A;  3OEO A;  4C3B A;  5A6K A;  5JRA A;  3T9O A;  3AG1 C;  2DYR C;  1Z7Q c;  3W2V A;  1KTM A;  2AU5 A;  4GEH A;  4JE9 A;  4P9F A;  4PFP A;  3N24 A;  5E2Q A;  1K05 A;  3N2Z B;  1TKN A;  3TOL A;  4E7Z A;  5AC5 A;  2QTV A;  5BQG A;  2NG1 A;  3ABK C;  2G3K A;  1AVO B;  3GEE A;  3GOD A;  2Q9B A;  2HJM A;  1Q0K A;  3UMK A;  4BJ5 C;  3IQT A;  3AG2 C;  4W8K A;  5DS5 A;  4OD5 A;  1V55 C;  1FMV A;  3NYJ A;  1MQV A;  1WTY A;  3TOM A;  1OCR C;  5COF A;  4P6I C;  2J7P A;  5E3A A;  1VYI A;  1QKR A;  1WAS A;  2PNO A;  2QLA A;  2LP4 A;  2J9U A;  2NSG A;  3I5P A;  4KBL A;  3GOR A;  4XWJ A;  3N0T A;  4BEM J;  5KYW B;  1WAT A;  2GA0 A;  3M1C B;  1K40 A;  2DGJ A;  3SP1 A;  3MX3 A;  4EHP A;  2EIK C;  2V26 A;  1U0B B;  5KYN A;  2J0W A;  4I3M A;  3DD7 A;  1WOL A;  2R02 A;  2XM0 A;  2ZD9 A;  4IWB A;  3GWN A;  3W4Y A;  4EUK B;  5KYX A;  3DE9 A;  4J30 B;  3RKO F;  3IQC A;  2P61 A;  3PMR A;  4JC7 A;  4WJ0 A;  3RFY A;  3VYW A;  1GQA A;  3GM2 A;  4K1O A;  2LIG A;  4MW8 A;  2R7S A;  1B68 A;  4M63 A;  1Q0M A;  1MMG A;  4YT4 A;  3FAJ A;  3V7O A;  4EWC A;  3KKB A;  2NUT B;  4DBR A;  5L0D A;  4MVM A;  3KH2 A;  1JAF A;  1BZ4 A;  2YLD A;  1TWH A;  3CAX A;  4PJL A;  2VCB A;  4LER A;  1TWA A;  4AE4 B;  4OIN F;  1H9T A;  3GWL A;  4NY3 A;  3KYJ A;  4LLE A;  3TJ5 A;  2R7O A;  4CS9 C;  4U5C E;  2IYL D;  1YVI A;  2EPL X;  1D0Z A;  1NBB A;  2L6H A;  4JW1 A;  4RD9 A;  1CGM E;  4KI2 A;  4PK4 A;  5KYY B;  1VOM A;  3CSK A;  1FTS A;  3EFO A;  2GWW A;  1RJ9 B;  1PD0 A;  2BC5 A;  3DJU B;  5T3T A;  4QDL A;  1LPE A;  2UUI A;  3QTH A;  1C17 M;  3GEI A;  4NQF A;  4A2N B;  4X0R A;  1A7D A;  3O10 A;  1OCC C;  3IPM O;  2B0H A;  4N4W A;  3S84 A;  4N06 A;  3PDM P;  2J0X A;  3DE8 A; 
#chains in the Genus database with same CATH homology
 3AG4 C;  4EBB A;  4JZA A;  4DOZ A;  1ZU4 A;  5KYU A;  3UR3 C;  3TD7 A;  2J9W A;  4CS8 A;  3EZH A;  4YJW A;  4U5F E;  4CS7 A;  3DXJ F;  2Y3G A;  3UNG C;  5DS4 A;  3W2W A;  2CNW D;  2J9V A;  2ZXP A;  2QY9 A;  4I44 A;  3FHD A;  4DBQ A;  3HTK C;  4K0D A;  3JRT A;  4E7S A;  2R7Q A;  4HFF B;  5E33 A;  1LS1 A;  2PX0 A;  2XSE A;  1Z6A A;  4O79 A;  2MWQ A;  3K33 A;  3EH2 A;  3T6B A;  4PJN A;  2BE5 F;  2WVQ A;  4IJJ A;  2W4M A;  4KNW A;  3JT1 A;  3EGX A;  2XXA B;  1ZHT A;  4YT8 A;  2IXO A;  4U5D E;  3UGO A;  3NG1 A;  3EH1 A;  5B1A C;  2DYS C;  2ZXO A;  3K7D A;  1QZX A;  3DJN B;  4G7O F;  4B6I A;  5KYX B;  1M2V A;  5T3W A;  4C7O A;  4PFO A;  5HSW A;  3B0U X;  4AK9 A;  3CQZ A;  2WZF A;  1QLE C;  4OIQ F;  4YT2 A;  1PD1 A;  3EZI A;  3ZIB A;  1D1C A;  2PFD A;  4QI2 A;  3RH3 A;  1SMY F;  3K1I C;  2R7U A;  2KJG A;  2ZXW C;  1MNE A;  1M56 C;  3EFO B;  3LLK A;  1J8M F;  1FFH A;  1O87 A;  1D0Y A;  3Q6N A;  5FCL A;  4CSA C;  3EHN A;  3K6B A;  4H4K C;  2WL8 A;  3ASN C;  4HFK B;  4XTK A;  2W9Y A;  2HV6 A;  2NUP A;  3B0P A;  3FDQ A;  3E70 C;  3W8I A;  5DVW A;  1Z23 A;  3WG7 C;  2IOQ A;  4F4B A;  3NKD A;  4AX2 A;  3CZ6 A;  1NU9 C;  4J32 B;  3KMI A;  1MMN A;  3HJC A;  1ZU5 A;  2OG2 A;  3UMH A;  2WB7 A;  3E9V A;  3FVY A;  1VMA A;  4YWQ A;  4LLC A;  3DAF A;  2P7V A;  3DAG A;  3LS1 A;  1VK5 A;  5E3C A;  1ST6 A;  2PF4 E;  2ZXR A;  1Z3I X;  2CNW A;  2VAS A;  3OA1 A;  2C04 A;  3B9Q A;  3RIP A;  1M2O A;  3L34 A;  3ITF A;  3LS0 A;  3ABL C;  3LJB A;  2OCC C;  4YT5 A;  2Q9A A;  4G0H A;  2D5R B;  4BJ6 A;  5BUO A;  3NYM A;  5B3S C;  4I1M A;  2XRH A;  3UMI A;  4BJ1 A;  4I1O B;  4RDA A;  1LKX A;  3SNH A;  4C3E A;  3LNR A;  3K66 A;  2WZL A;  4RBN A;  2EIN C;  3EGX B;  2HV7 A;  2IXN A;  3LEV A;  1IZM A;  4BJ5 A;  2GFH A;  4KC9 A;  4Q4Z F;  2E87 A;  2H7V C;  5L3V A;  1OCO C;  2L9J A;  3S29 A;  1IW7 F;  1PCX A;  1M2V B;  2EIL C;  4CSA A;  4Q5S F;  4OIP F;  2G62 A;  2LSE A;  2Y69 C;  2Z15 A;  5F5H A;  2CDQ A;  1FMW A;  3H65 A;  4JCH A;  5D92 A;  2Q9C A;  5IY5 C;  2X51 A;  2J45 A;  3NDB B;  3POV A;  4Q7C A;  3T4R A;  2R7W A;  3Q6M A;  4DVZ A;  3ZG1 A;  3X1O A;  2KW3 C;  3KL4 A;  1TWC A;  3MLG A;  2PP4 A;  1MMD A;  4CS9 A;  2KGO A;  5EHH A;  2W45 A;  2R7X A;  1MMA A;  4FES A;  2MYS A;  2YEV A;  2O9X A;  1TR2 A;  3F47 A;  4CIH A;  1M57 C;  3LLI A;  3RYL A;  4JUR I;  4HEA J;  5EGY A;  3SEO A;  2CGE A;  5DS6 A;  2IXP A;  3SYN A;  1D0X A;  2YZS A;  4CBE A;  2PX3 A;  2V3C C;  2VB6 A;  3DMD A;  3Q7G A;  2IXM A;  2Y3B A;  3QMK A;  3ZVR A;  3DZA A;  3EGD A;  1BR2 A;  2EIM C;  3EPV A;  1Z5Z A;  4XLP F;  2EIJ C;  5CI9 A;  4PJJ A;  3LAY A;  1ZYR F;  4K7B A;  1Z63 A;  2A1D D;  4XLN F;  3AQC A;  3I5Q A;  3NKE A;  4U5B E;  2R7V A;  4IAO A;  2Y3H A;  3VAY A;  5DLJ A;  3ABM C;  4JVS A;  2I8B A;  1KU2 A;  3GAN A;  4CS8 C;  3I4U A;  1D1B A;  3ZSU A;  2WZG A;  2M4E A;  5KYU B;  4G7Z F;  2XXA A;  3EG9 A;  1OKK D;  1BR1 A;  2C03 A;  3X2Q C;  1O5H A;  5CI8 A;  4DVY P;  2G3V A;  3DM9 B;  5T1D B;  2A68 F;  4U5E E;  3ZC4 A;  4OIR F;  4U5H A;  4U5G A;  3W8H A;  2WVN A;  3HLZ A;  3LES A;  4O6Y A;  3L0I A;  4ZLD A;  2KQ9 A;  2FGY A;  3F46 A;  1MND A;  3Q7L A;  2Y39 A;  3ASO C;  1JPN A;  1S7Z A;  4YN0 B;  2J7P D;  1N1C A;  4IRU A;  1D1A A;  1JPJ A;  1SZI A;  2Q3T A;  5DQZ A;  5DQT A;  3T6J A;  1V54 C;  4C3D A;  2YHS A;  3DM5 A;  4HE8 D;  3EHM A;  1NG1 A;  4O6N A;  5KYW A;  1NU7 D;  4OD4 A;  4O6M A;  1ZHW A;  2H7O A;  1OCZ C;  4FX5 A;  3NRH A;  1W2W A;  3PHF 2;  2CW0 F;  2VH3 A;  4O7G A;  2NUT A;  3OWT A;  2R7T A;  4C7O B;  3B0V C;  4AE4 A;  4BEJ A;  3S0X A;  2ZPA A;  3O6X A;  2A6E F;  2R7R A;  2A6H F;  5KYY A;  3EGD B;  3JSZ A;  2B0J A;  4MQ9 F;  4PJM A;  5B1B C;  3EQL F;  1RJ9 A;  4GYT A;  3IEE A;  3K1H A;  4KNV A;  2FFH A;  1TWG A;  5D91 A;  4OIO F;  3AQB A;  5L3Q A;  5F5F A;  1ZHX A;  2KNH A;  3SZR A;  2Y3D A;  3S28 A;  1G8X A;  3WOD F;  1NZE A;  1VYK A;  3JCU Q;  4BG0 A;  4JJG A;  4MND A;  1SF8 A;  2P6V A;  4G7H F;  2NUP B;  1FFT C;  1BR4 A;  2W4B A;  2H7B A;  3NYL A;  3AG3 C;  3ECS A;  3UGP A;  4JJF A;  2J46 A;  3EG9 B;  2L81 A;  3S27 A;  2A69 F;  4FWV A;  4ZLC A;  2JD3 A;  1ZHY A;  3EJN A;  2XL4 A;  1OKK A;  1WGW A;  1J8Y F;  1ZHZ A;  3QZC A;  1LVK A;  4QI0 A;  4ULW A;  2WVO A;  3O39 A;  4LAC B;  3JYH A;  4BJ6 C;  3OEO A;  4C3B A;  3AG1 C;  2DYR C;  3W2V A;  4GEH A;  4PFP A;  3N24 A;  5E2Q A;  3N2Z B;  1TKN A;  4E7Z A;  2QTV A;  2NG1 A;  3ABK C;  2G3K A;  3GOD A;  2Q9B A;  3UMK A;  4BJ5 C;  5DS5 A;  3AG2 C;  4W8K A;  4OD5 A;  1V55 C;  1FMV A;  3NYJ A;  1OCR C;  4P6I C;  2J7P A;  5E3A A;  1VYI A;  4ANJ A;  3I5P A;  4XWJ A;  4BJT A;  2J9U A;  5KYW B;  4KBL A;  3N0T A;  3M1C B;  2DGJ A;  3SP1 A;  3MX3 A;  2EIK C;  2V26 A;  5KYN A;  2J0W A;  4I3M A;  3DD7 A;  4IWB A;  5KYX A;  4J30 B;  3RKO F;  3PMR A;  4WJ0 A;  3RFY A;  3VYW A;  2R7S A;  4M63 A;  1MMG A;  4YT4 A;  3FAJ A;  3V7O A;  4EWC A;  3KKB A;  2NUT B;  4DBR A;  3KH2 A;  4PJL A;  1TWH A;  4LER A;  1TWA A;  4AE4 B;  4OIN F;  4NY3 A;  4LLE A;  2R7O A;  4CS9 C;  4U5C E;  2IYL D;  4JW1 A;  1D0Z A;  4RD9 A;  4KI2 A;  4PK4 A;  5KYY B;  1VOM A;  3CSK A;  1FTS A;  3EFO A;  1RJ9 B;  1PD0 A;  3DJU B;  5T3T A;  4QDL A;  4A2N B;  4X0R A;  1OCC C;  4N06 A;  2J0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...