4D4XA

Nitrosyl complex of the d121i variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHIAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4xA00
3QW0A 1LM3B 3IQ6A 4EIYA 4N6HA 2YL3A 1E85A 2XL6A 4ULVA 3QW1A 4L6RA 2XL8A 2YL1A 5JS5A 1A7VA 4D4XA 1CGOA 3DE9A 4JEBA 5JT4A 5JP7A 2YL0A 2YKZA 3ZWIA 2YLDA 4CIPA 4CJOA 3HNIA 3TOLA 4CX9A 1YYXA 3HNKA 1YZCA 1CGNA 4CDAA 3ZQVA 5JRAA 3ZQYA 3NMIA 3ZTMA 3QVYA 3VRCA 1EKYA 3HNLA 3M79A 4CDVA 1E84A 4N4WA 2XLHA 2XLOA 5AGFA 3IQ5A 2XLWA 5B3IA 4JKVA 3DE8A 3NMJA 4NC3A 4JE9A 5JSLA 3U8PA 1E86A 1CPQA 1M6TA 3FOPA 4IARA 1BBHA 2J9BA 2XLVA 3HNJA 256BA 3M4CA 3ZTZA 3NMKA 4CDYA 2XLDA 4WGYA 2YLGA 5JVEA 1S05A 1QQ3A 2XM4A 4WGZA 1E83A 1APCA 1NBBA 3M4BA 4IAQA 3C62A 4JEAA 2CCYA 1YYJA 2XLEA 3FOOA 2XM0A 3TOMA 1CPRA 2J8WA 4D4NA 5JUAA 2XLMA 3M15A 3C63A 2BC5A 1YZAA 3L1MA 2YL7A 1QPUA 1GQAA 4U9DA 4ER9A 1RCPA 4CJGA 2QLAA 4U9EA 1JAFA 4IB4A 1MQVA 2YLIA 3QVZA 5JLIA
chains in the Genus database with same CATH superfamily
4PK4A 2VCBA 3AJMA 3F47A 1LM3B 2YZSA 3W4YA 3SNHA 1ZYRF 3IQ6A 3TQOA 4EIYA 3G4XA 1YA7O 3AG4C 3HJCA 5KYXA 1T01A 2YL3A 3GANA 1HMDA 1VYKA 1E85A 2IYLD 3H65A 1RXQA 2NSFA 4PR9A 2HV7A 4JW1A 4ULVA 1G4WR 2LP4A 2A69F 3LLKA 2D5RB 2PFDA 2XL8A 1A7VA 1Q0KA 1XZQA 1Z6AA 3PDMP 2HV6A 1LS4A 2D4UA 2MYSA 1ZHXA 4JEBA 4JZAA 4U5FE 3GM1A 4C7OA 2J46A 3NRHA 2R7WA 2LSEA 3O10A 2YL0A 1KU2A 2WL8A 3DWWA 4JTCB 2UUHA 4NTFA 1G4US 2OEXA 2DGJA 5DVWA 2IM8A 1L3PA 2J9WA 2YKZA 4QDLA 2H8AA 3Q6NA 5T3WA 3UMHA 3GORA 1MMDA 4RDAA 4WABA 4K0DA 3LUTB 1F1MA 3OWTA 1B68A 3HNIA 4CJOA 1D0XA 5L0GA 4LDRA 4Z9IA 1FMWA 3W8HA 3DM9B 5A6BA 3EFOA 4JTDB 1UFBA 3HTKC 2R7VA 4FAPB 2WVQA 3GEHA 3JT1A 1BDJB 1M2VB 3L8IA 3Q7LA 1OXKA 3US6A 5JLIA 4EBJA 3LESA 5JRAA 4H54A 5BQHA 1H9GA 2KYHA 3HNLA 1HE9A 4O6MA 3AQBA 4N6CA 3SZRA 3JSZA 4BEJA 4CS8A 1SYQA 4Q7CA 5L0FA 1D1CA 1Q0GA 4MW8A 2GWWA 3SXZA 4F4BA 1TWHA 3LNMB 5AGFA 2HZ8A 2MWQA 1U89A 1WN0A 2XRHA 3N24A 2Y3HA 4JCHA 3V5ZA 3B9QA 5GPGB 4C3EA 2UUIA 5B3IA 1M56C 1OW7A 3DJUB 3L0IA 4JKVA 4U5EE 3EG9B 4U5BE 3ZDLA 2EINC 3DE8A 3NMJA 3B0VC 1VTMP 4OINF 2VB6A 3WODF 3G4ZA 4I1MA 3EGXA 2R7RA 3LLIA 1E86A 1NSGB 1LPEA 2OQMA 5KYYA 4XTKA 3DKAA 5L3QA 2VH3A 2ASRA 1TR2A 2Q9AA 3KYIA 3DJNB 2HSBA 3ZSUA 2G62A 1T9KA 3KMIA 4J30B 3ZVRA 3QTHA 2Y3DA 5KYWB 2CNWD 5JVEA 3C8GB 4LDKA 4CBEA 1MMNA 3K66A 3QZCA 1ST6A 1KTMA 4ZLCA 1QQ3A 3UR3C 1D0ZA 3A11A 3WAQA 4CS8C 4U5GA 1E2XA 1Y4CA 3ECSA 4JEAA 1OW6A 1LE2A 1RMVA 4I3MA 1GS9A 2A6HF 2OJQA 2CCYA 3GWLA 2NUPB 4MNDA 3EHMA 4PJLA 3RQEA 5HSWA 3U9MA 2Y69C 4Z9HA 3IQTA 2XM0A 1BR4A 3JCUQ 2V3CC 2WZGA 3RVZA 4NTAA 5COMA 5IY5C 3AG1C 2F22A 5JUAA 1NG1A 4AL1A 2IXMA 2HUJA 3VM6A 1BZ4A 3L1MA 2R7XA 1V74B 3JYHA 4QI2A 4IAOA 3UMKA 4B6IA 3O55A 4RD9A 4MW3A 3SP1A 2JX0A 3L8JA 1K04A 1JAFA 2WB7A 1C17M 3LAYA 4I44A 3PHF2 2R7TA 2CNWA 3S90A 1JPNA 5CI8A 2NG1A 2G3KA 2PX3A 3EZIA 1PV3A 4BG0A 1PD0A 1VLSA 2EPLX 2WVNA 2VC9A 1FMVA 4HEAJ 4IWBA 3JSEO 1T6UA 3O6XA 4BJ6A 2J9UA 4DRHB 2HJ3A 1RJ9A 2L9JA 3U2LA 3X2QC 4EKWA 2ZXWC 3AGTA 4IRUA 1T5OA 2YWAA 3ASOC 1LIHA 5JS5A 1H9TA 3T4RA 1CGOA 2L6FA 3EH2A 3IHUA 4EBBA 3RIPA 2DYSC 4BJ5A 1Q0MA 2Y39A 1HY5A 1VYIA 2R03A 4E7ZA 2XXAA 3UGPA 3OA1A 3ZWIA 2AP3A 2R9RB 2X0CA 4CIPA 4P9TA 4YT4A 3DAGA 4JIOA 2P1AA 4MVMA 2R7SA 2KGOA 3V5XA 3TOLA 4HFFB 3ZIBA 2NUPA 4CX9A 5A6BD 3U3FA 4ULWA 3KPHA 3HNKA 5B3SC 4XPYA 2Q9BA 2AWYA 1ZZPA 2OJED 1OKKD 4CIHA 2NUTB 3SEOA 2J45A 3NMIA 2JD3A 2XL4A 4BJ6C 1K40A 3RVYA 3RH3A 3C7JA 4MVZA 1QKRA 3KYJA 4OD5A 3I4UA 2XLHA 3S84A 3KL4A 5KYUA 4QI0A 3LJBA 3TK0A 2AVKA 1J8MF 3T6BA 1OCCC 2KW3C 3IQ5A 4XWJA 4AE4A 3W2WA 4O6NA 1GM5A 2XLWA 4BJ5C 3UNGC 3B71A 1LE4A 2OKUA 2LFFA 2ZD9A 4U5CE 3GM3A 4OD4A 1OCZC 1T6IA 1XWJA 1XZPA 4YN0B 4DXWA 2IXNA 2J0WA 2X51A 1LS1A 5TJ5E 3U8PA 3N0TA 1RKEB 1UG7A 2PBEA 2Y3BA 5DQZA 3W2VA 3ZC4A 1O3UA 1OKKA 2ICWG 2J9BA 4A4AA 1SMYF 1SZIA 4O79A 2Q00A 3CZ6A 4N06A 3U5SA 1O87A 3HNJA 4G7OF 3IEEA 1K05A 4I1OB 3GWNA 4G7HF 5COFA 5E3AA 1I4ZA 1WTYA 4JCZA 1Q0DA 1M57C 2DI3A 2YLGA 4W8KA 4YT8A 4GEHA 3U9JA 4LERA 3ZG1A 4ZLDA 1A0BA 1S05A 1OR2A 3BRJA 1DOWA 3BEHA 4AX2A 1WWPA 4Q4ZF 1ZHZA 3JZ0A 4XLNF 2LCHA 5L0CA 1APCA 1JRAA 4JTAB 1HMOA 3M4BA 3C62A 3G50A 3O39A 4R32A 3K1HA 2L6GA 4NCQA 4EBKA 1TQGA 1TFKB 5BQIA 2YHSA 3K1IA 4GYTA 1A41A 3DI5A 5E3CA 2JPUA 3DAFA 3K6BA 4JC7A 2XLEA 3FOOA 1VMAA 2GAQA 4OIPF 3VYWA 2YVKA 3VF0A 2R7OA 5EGYA 1I5NA 3HKKA 2XLMA 3M15A 4CSAA 2IXPA 3MLGA 1C02A 1OQCA 5D92A 5EHHA 3RW0A 3FVYA 3EGDB 2L6HA 3ABLC 4FESA 4XEVA 5D91A 1RCPA 2QLAA 3B0PA 1KNYA 2XSEA 4J32B 4LACB 3NYJA 4P9FA 4P6IC 1N1CA 5B1BC 4IB4A 1MNDA 1TKNA 1D0YA 3TJ5A 5L0HA 1BR2A 1HW1A 4C3DA 5HV9A 3QW0A 3CSKA 2OCCC 4O7GA 3KH2A 5T1DB 2ETSA 1D1BA 2WZLA 5AC5A 3K33A 1HE1A 4DBRA 1LKXA 2KQ9A 3FMSA 3LS0A 4N6HA 4DRJB 2IBFA 2TMVP 3NDBB 1R5ID 2CW0F 2NSGA 4O6YA 3N2ZB 3SXKA 3RF3A 3V5YA 2HKVA 1M2VA 2M64A 3PCVA 4NQFA 4YL3A 4E17A 3K1IC 5E2QA 3T9OA 4H4KC 4PJJA 3QW1A 4L6RA 2EILC 5DS6A 4DRIB 3L34A 4EUKB 2XS8A 3C8GD 2ZXRA 3TJ6A 5JT4A 4CS7A 3EHNA 4J7YA 1EQ1A 5JP7A 2YRFA 4UDVA 4CSAC 5L0JA 2BE5F 1JOGA 3S9OA 1LVKA 1WGWA 3VAYA 1NFOA 2J7PD 3MYFA 4BEMJ 4YJWA 1G5ZA 2EIKC 3KKBA 3H2VA 3AOUA 2EPNA 4XEFA 5E33A 2CYDA 1JR8A 4NTBA 5K0IA 2L81A 3M1CB 1V4AA 3EG9A 1YYXA 4MVSA 3SXYA 2P61A 5KYXB 2ZXPA 1CGME 2IOQA 1CGNA 2EPKX 4PJMA 3WG7C 1TWCA 2I8BA 4YL1A 3FAJA 1IZMA 3ZQYA 1J8YF 3UGOA 3RFYA 4U5DE 2ZPAA 2HFIA 2BL2A 2Y3GA 1Z7Qc 1PD1A 1VOMA 3JTLO 2DYRC 5B1AC 3VRCA 5L3VA 1HW2A 3M79A 4XPWA 4C7OB 5EK0A 2O9XA 1JMWA 2NPUA 2VCCA 4N4WA 3S0XA 3LNRA 1FR0A 5KYWA 3DM5A 3C8GA 2H7OA 1ORJA 2LFDA 4DBQA 3ABMC 4KI2A 2OOCA 1Q0FA 2Q9CA 2QY9A 4YT2A 5L0DA 2PNOA 1TWGA 1DOVA 3OEOA 4Z9JA 2J7PA 2VASA 1JPJA 4FX5A 1ZHYA 3NKEA 4OIQF 3B29A 1A7DA 4GQHA 4DJ9A 4WJ0A 3EFOB 1IW7F 3A9CA 3NYLA 4U5HA 2A0UA 5CIVA 2GDCA 4MTOA 5JSLA 2Q4FA 1CPQA 4G0HA 2HMQA 3LEVA 1U6HA 2KSFA 3I5PA 5DS4A 1OR3A 2PF4E 1MMAA 2KJGA 2A68F 2XLVA 4XQ1A 5COGA 3E9VA 2QUPA 2A1DD 3AQCA 3NMKA 4CDYA 1ZW2A 2XLDA 4YT5A 4WGYA 5F5HA 2EIJC 2J0XA 3CAXA 3LS1A 3S29A 3T6GB 5DQTA 3W8IA 1YJGA 4DVZA 3J06A 4HFKB 5FCLA 1OCOC 2WZFA 1PCXA 4ANJA 1NBBA 2GFHA 4IAQA 3RQGA 3LEOA 1WOLA 2B0JA 3E70C 2QE9A 4J7TA 3RQFA 3S27A 4JJFA 5A6JA 3CEXA 1ZHTA 3MX3A 4MTGA 1YYJA 2M4EA 3RKOF 2P0NA 2C04A 3EZHA 4BJTA 3EGXB 3DZAA 4W8PA 3QMKA 3TOMA 1CPRA 2H7VC 1VK5A 2I15A 3GODA 5KYYB 2W4MA 3EQLF 4D4NA 4E0HA 5DS5A 2FFHA 2R05A 5KYNA 3FDQA 2KK1A 4JVSA 3RYLA 3FXHA 2BC5A 1S7ZA 2B0HA 4LLEA 2YL7A 2OG2A 1I4YA 1V55C 4MVUA 3SXMA 1GQAA 5F5FA 2OEVA 4K7BA 2FGYA 1MNEA 2PP4A 3EPVA 4CJGA 5BQGA 1WASA 4JJGA 2DB4A 1U0BB 3F46A 1MQVA 2YLIA 3WHNA 3QVZA 3T6JA 1TFOB 1BR1A 1FAPB 3GM2A 2Q7RA 1G8XA 1FTSA 1VLTA 2V26A 2YEVA 1Z23A 4G78A 1YDIA 4PFOA 4Q5SF 1LI7A 2W4BA 5FZTA 3U2MA 4EHPA 5AC4A 4E0IA 4PACA 3EH1A 1VB5A 1R4TA 4YL0A 2YQYA 3HLZA 4MVOA 2XL6A 2RSEB 1YARO 4RBNA 3DD7A 4MVRA 3B0UX 3Q6MA 2NUTA 3K7DA 3ABKC 2CDQA 3I5QA 2OU6A 2YL1A 2HJMA 4D4XA 3DE9A 4M63A 4HE8D 1OXBA 1TWAA 2QNLA 1O5HA 3C18A 1M2OA 5BUOA 1YA9A 4G7ZF 4KNWA 1NU7D 2YLDA 4FWVA 3EJNA 1YAUO 1SR2A 4MQ9F 2Q3TA 4MVQA 2ZXOA 3TD7A 1RKCA 3Q7GA 3V7OA 2HMZA 1H6GA 1YVIA 2HS5A 4YK5A 4OIOF 3POVA 1ZVZA 3C8ZA 2PX0A 2A6EF 3CQZA 1AEPA 1QVXA 1YZCA 2KC3A 1ZW3A 2KNHA 3U3BA 2R7UA 4CS9A 1RKEA 4OIRF 1OW8A 4CDAA 1RJ9B 1GGQA 2EPMX 3ZQVA 4E18A 5F28E 3H2UA 2J9VA 3U8VA 3ZTMA 4PJNA 3QVYA 4IJJA 1EKYA 3U0CA 1FFHA 2HSQA 4CDVA 1FFTC 1ORYA 1E84A 4JURI 1AVOB 5CI9A 1AUEA 2IXOA 3MBGA 1MMGA 2MHRA 2XLOA 3MYIA 2QTVA 4A2NB 3GEEA 2XXAB 1Z5ZA 2C03A 5A6KA 3UMIA 4C3BA 1C03A 4KC9A 1SF8A 1T6QA 1LI5A 2AU5A 3IPMO 4X0RA 1ZU5A 2EPOA 2W45A 1OCRC 4AL0A 3MFNA 5L0IA 2E87A 4NC3A 1A7EA 4E7SA 2AWCA 3IQCA 4JE9A 2A0BA 1EA8A 3NKDA 1FNTc 4IGGA 1L7CA 3S28A 1M6TA 1ZHWA 3FOPA 2LQGA 4IARA 2LK4A 4XLPF 1BBHA 3FHDA 1NZEA 4CS9C 2P6VA 256BA 3M4CA 2Z15A 2VCAA 4MS2A 3ZTZA 5DLJA 3X1OA 4DOZA 1V54C 1YLMA 3ATPA 4MTFA 1ZU4A 2W9YA 3EGDA 3JRTA 5KYUB 2H7BA 2WVOA 3DXJF 4YWQA 4K1OA 4ONSA 2XM4A 4AE4B 3AG3C 4WGZA 4NY3A 3ASNC 3JRMO 1E83A 4PFPA 1WATA 1ORSC 2XS1A 3SYNA 1Y6DA 3R2PA 3JYYA 4XEKA 3R7CA 3FAPB 2G3VA 2R25A 1Z63A 2FAPB 3ITFA 1QLEC 3AG2C 4AK9A 2LD6A 2RD9A 2P7VA 1NU9C 1QSPA 1H7IA 2J8WA 4LDQA 4BPMA 3NYMA 3AGUA 4DVYP 2CGEA 2R02A 5A69A 2GA0A 1Z3IX 2R7QA 4KNVA 3C63A 2L7AA 4XPXA 2LIGA 1YZAA 3TULA 4BJ1A 1W2WA 5T3TA 1QPUA 4JRZA 4U9DA 4ER9A 1D1AA 1NFNA 5A6AA 4EWCA 4KBLA 4U9EA 3GEIA 1QZXA 1EI7A 3PMRA 2EIMC 1NLXA 3NG1A 4LLCA 3DMDA
chains in the Genus database with same CATH topology
3QW0A 1LM3B 3IQ6A 4EIYA 4N6HA 2YL3A 1E85A 2XL6A 4ULVA 3QW1A 4L6RA 2XL8A 2YL1A 5JS5A 1A7VA 4D4XA 1CGOA 3DE9A 4JEBA 5JT4A 5JP7A 2YL0A 2YKZA 3ZWIA 2YLDA 4CIPA 4CJOA 3HNIA 3TOLA 4CX9A 1YYXA 3HNKA 1YZCA 1CGNA 4CDAA 3ZQVA 5JRAA 3ZQYA 3NMIA 3ZTMA 3QVYA 3VRCA 1EKYA 3HNLA 3M79A 4CDVA 1E84A 4N4WA 2XLHA 2XLOA 5AGFA 3IQ5A 2XLWA 5B3IA 4JKVA 3DE8A 3NMJA 4NC3A 4JE9A 5JSLA 3U8PA 1E86A 1CPQA 1M6TA 3FOPA 4IARA 1BBHA 2J9BA 2XLVA 3HNJA 256BA 3M4CA 3ZTZA 3NMKA 4CDYA 2XLDA 4WGYA 2YLGA 5JVEA 1S05A 1QQ3A 2XM4A 4WGZA 1E83A 1APCA 1NBBA 3M4BA 4IAQA 3C62A 4JEAA 2CCYA 1YYJA 2XLEA 3FOOA 2XM0A 3TOMA 1CPRA 2J8WA 4D4NA 5JUAA 2XLMA 3M15A 3C63A 2BC5A 1YZAA 3L1MA 2YL7A 1QPUA 1GQAA 4U9DA 4ER9A 1RCPA 4CJGA 2QLAA 4U9EA 1JAFA 4IB4A 1MQVA 2YLIA 3QVZA 5JLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW0 A;  1LM3 B;  3IQ6 A;  4EIY A;  4N6H A;  2YL3 A;  1E85 A;  2XL6 A;  4ULV A;  3QW1 A;  4L6R A;  2XL8 A;  2YL1 A;  5JS5 A;  1A7V A;  4D4X A;  1CGO A;  3DE9 A;  4JEB A;  5JT4 A;  5JP7 A;  2YL0 A;  2YKZ A;  3ZWI A;  2YLD A;  4CIP A;  4CJO A;  3HNI A;  3TOL A;  4CX9 A;  1YYX A;  3HNK A;  1YZC A;  1CGN A;  4CDA A;  3ZQV A;  5JRA A;  3ZQY A;  3NMI A;  3ZTM A;  3QVY A;  3VRC A;  1EKY A;  3HNL A;  3M79 A;  4CDV A;  1E84 A;  4N4W A;  2XLH A;  2XLO A;  5AGF A;  3IQ5 A;  2XLW A;  5B3I A;  4JKV A;  3DE8 A;  3NMJ A;  4NC3 A;  4JE9 A;  5JSL A;  3U8P A;  1E86 A;  1CPQ A;  1M6T A;  3FOP A;  4IAR A;  1BBH A;  2J9B A;  2XLV A;  3HNJ A;  256B A;  3M4C A;  3ZTZ A;  3NMK A;  4CDY A;  2XLD A;  4WGY A;  2YLG A;  5JVE A;  1S05 A;  1QQ3 A;  2XM4 A;  4WGZ A;  1E83 A;  1APC A;  1NBB A;  3M4B A;  4IAQ A;  3C62 A;  4JEA A;  2CCY A;  1YYJ A;  2XLE A;  3FOO A;  2XM0 A;  3TOM A;  1CPR A;  2J8W A;  4D4N A;  5JUA A;  2XLM A;  3M15 A;  3C63 A;  2BC5 A;  1YZA A;  3L1M A;  2YL7 A;  1QPU A;  1GQA A;  4U9D A;  4ER9 A;  1RCP A;  4CJG A;  2QLA A;  4U9E A;  1JAF A;  4IB4 A;  1MQV A;  2YLI A;  3QVZ A;  5JLI A; 
#chains in the Genus database with same CATH topology
 4PK4 A;  2VCB A;  3AJM A;  3F47 A;  1LM3 B;  2YZS A;  3W4Y A;  3SNH A;  1ZYR F;  3IQ6 A;  3TQO A;  4EIY A;  3G4X A;  1YA7 O;  3AG4 C;  3HJC A;  5KYX A;  1T01 A;  2YL3 A;  3GAN A;  1HMD A;  1VYK A;  1E85 A;  2IYL D;  3H65 A;  1RXQ A;  2NSF A;  4PR9 A;  2HV7 A;  4JW1 A;  4ULV A;  1G4W R;  2LP4 A;  2A69 F;  3LLK A;  2D5R B;  2PFD A;  2XL8 A;  1A7V A;  1Q0K A;  1XZQ A;  1Z6A A;  3PDM P;  2HV6 A;  1LS4 A;  2D4U A;  2MYS A;  1ZHX A;  4JEB A;  4JZA A;  4U5F E;  3GM1 A;  4C7O A;  2J46 A;  3NRH A;  2R7W A;  2LSE A;  3O10 A;  2YL0 A;  1KU2 A;  2WL8 A;  3DWW A;  4JTC B;  2UUH A;  4NTF A;  1G4U S;  2OEX A;  2DGJ A;  5DVW A;  2IM8 A;  1L3P A;  2J9W A;  2YKZ A;  4QDL A;  2H8A A;  3Q6N A;  5T3W A;  3UMH A;  3GOR A;  1MMD A;  4RDA A;  4WAB A;  4K0D A;  3LUT B;  1F1M A;  3OWT A;  1B68 A;  3HNI A;  4CJO A;  1D0X A;  5L0G A;  4LDR A;  4Z9I A;  1FMW A;  3W8H A;  3DM9 B;  5A6B A;  3EFO A;  4JTD B;  1UFB A;  3HTK C;  2R7V A;  4FAP B;  2WVQ A;  3GEH A;  3JT1 A;  1BDJ B;  1M2V B;  3L8I A;  3Q7L A;  1OXK A;  3US6 A;  5JLI A;  4EBJ A;  3LES A;  5JRA A;  4H54 A;  5BQH A;  1H9G A;  2KYH A;  3HNL A;  1HE9 A;  4O6M A;  3AQB A;  4N6C A;  3SZR A;  3JSZ A;  4BEJ A;  4CS8 A;  1SYQ A;  4Q7C A;  5L0F A;  1D1C A;  1Q0G A;  4MW8 A;  2GWW A;  3SXZ A;  4F4B A;  1TWH A;  3LNM B;  5AGF A;  2HZ8 A;  2MWQ A;  1U89 A;  1WN0 A;  2XRH A;  3N24 A;  2Y3H A;  4JCH A;  3V5Z A;  3B9Q A;  5GPG B;  4C3E A;  2UUI A;  5B3I A;  1M56 C;  1OW7 A;  3DJU B;  3L0I A;  4JKV A;  4U5E E;  3EG9 B;  4U5B E;  3ZDL A;  2EIN C;  3DE8 A;  3NMJ A;  3B0V C;  1VTM P;  4OIN F;  2VB6 A;  3WOD F;  3G4Z A;  4I1M A;  3EGX A;  2R7R A;  3LLI A;  1E86 A;  1NSG B;  1LPE A;  2OQM A;  5KYY A;  4XTK A;  3DKA A;  5L3Q A;  2VH3 A;  2ASR A;  1TR2 A;  2Q9A A;  3KYI A;  3DJN B;  2HSB A;  3ZSU A;  2G62 A;  1T9K A;  3KMI A;  4J30 B;  3ZVR A;  3QTH A;  2Y3D A;  5KYW B;  2CNW D;  5JVE A;  3C8G B;  4LDK A;  4CBE A;  1MMN A;  3K66 A;  3QZC A;  1ST6 A;  1KTM A;  4ZLC A;  1QQ3 A;  3UR3 C;  1D0Z A;  3A11 A;  3WAQ A;  4CS8 C;  4U5G A;  1E2X A;  1Y4C A;  3ECS A;  4JEA A;  1OW6 A;  1LE2 A;  1RMV A;  4I3M A;  1GS9 A;  2A6H F;  2OJQ A;  2CCY A;  3GWL A;  2NUP B;  4MND A;  3EHM A;  4PJL A;  3RQE A;  5HSW A;  3U9M A;  2Y69 C;  4Z9H A;  3IQT A;  2XM0 A;  1BR4 A;  3JCU Q;  2V3C C;  2WZG A;  3RVZ A;  4NTA A;  5COM A;  5IY5 C;  3AG1 C;  2F22 A;  5JUA A;  1NG1 A;  4AL1 A;  2IXM A;  2HUJ A;  3VM6 A;  1BZ4 A;  3L1M A;  2R7X A;  1V74 B;  3JYH A;  4QI2 A;  4IAO A;  3UMK A;  4B6I A;  3O55 A;  4RD9 A;  4MW3 A;  3SP1 A;  2JX0 A;  3L8J A;  1K04 A;  1JAF A;  2WB7 A;  1C17 M;  3LAY A;  4I44 A;  3PHF 2;  2R7T A;  2CNW A;  3S90 A;  1JPN A;  5CI8 A;  2NG1 A;  2G3K A;  2PX3 A;  3EZI A;  1PV3 A;  4BG0 A;  1PD0 A;  1VLS A;  2EPL X;  2WVN A;  2VC9 A;  1FMV A;  4HEA J;  4IWB A;  3JSE O;  1T6U A;  3O6X A;  4BJ6 A;  2J9U A;  4DRH B;  2HJ3 A;  1RJ9 A;  2L9J A;  3U2L A;  3X2Q C;  4EKW A;  2ZXW C;  3AGT A;  4IRU A;  1T5O A;  2YWA A;  3ASO C;  1LIH A;  5JS5 A;  1H9T A;  3T4R A;  1CGO A;  2L6F A;  3EH2 A;  3IHU A;  4EBB A;  3RIP A;  2DYS C;  4BJ5 A;  1Q0M A;  2Y39 A;  1HY5 A;  1VYI A;  2R03 A;  4E7Z A;  2XXA A;  3UGP A;  3OA1 A;  3ZWI A;  2AP3 A;  2R9R B;  2X0C A;  4CIP A;  4P9T A;  4YT4 A;  3DAG A;  4JIO A;  2P1A A;  4MVM A;  2R7S A;  2KGO A;  3V5X A;  3TOL A;  4HFF B;  3ZIB A;  2NUP A;  4CX9 A;  5A6B D;  3U3F A;  4ULW A;  3KPH A;  3HNK A;  5B3S C;  4XPY A;  2Q9B A;  2AWY A;  1ZZP A;  2OJE D;  1OKK D;  4CIH A;  2NUT B;  3SEO A;  2J45 A;  3NMI A;  2JD3 A;  2XL4 A;  4BJ6 C;  1K40 A;  3RVY A;  3RH3 A;  3C7J A;  4MVZ A;  1QKR A;  3KYJ A;  4OD5 A;  3I4U A;  2XLH A;  3S84 A;  3KL4 A;  5KYU A;  4QI0 A;  3LJB A;  3TK0 A;  2AVK A;  1J8M F;  3T6B A;  1OCC C;  2KW3 C;  3IQ5 A;  4XWJ A;  4AE4 A;  3W2W A;  4O6N A;  1GM5 A;  2XLW A;  4BJ5 C;  3UNG C;  3B71 A;  1LE4 A;  2OKU A;  2LFF A;  2ZD9 A;  4U5C E;  3GM3 A;  4OD4 A;  1OCZ C;  1T6I A;  1XWJ A;  1XZP A;  4YN0 B;  4DXW A;  2IXN A;  2J0W A;  2X51 A;  1LS1 A;  5TJ5 E;  3U8P A;  3N0T A;  1RKE B;  1UG7 A;  2PBE A;  2Y3B A;  5DQZ A;  3W2V A;  3ZC4 A;  1O3U A;  1OKK A;  2ICW G;  2J9B A;  4A4A A;  1SMY F;  1SZI A;  4O79 A;  2Q00 A;  3CZ6 A;  4N06 A;  3U5S A;  1O87 A;  3HNJ A;  4G7O F;  3IEE A;  1K05 A;  4I1O B;  3GWN A;  4G7H F;  5COF A;  5E3A A;  1I4Z A;  1WTY A;  4JCZ A;  1Q0D A;  1M57 C;  2DI3 A;  2YLG A;  4W8K A;  4YT8 A;  4GEH A;  3U9J A;  4LER A;  3ZG1 A;  4ZLD A;  1A0B A;  1S05 A;  1OR2 A;  3BRJ A;  1DOW A;  3BEH A;  4AX2 A;  1WWP A;  4Q4Z F;  1ZHZ A;  3JZ0 A;  4XLN F;  2LCH A;  5L0C A;  1APC A;  1JRA A;  4JTA B;  1HMO A;  3M4B A;  3C62 A;  3G50 A;  3O39 A;  4R32 A;  3K1H A;  2L6G A;  4NCQ A;  4EBK A;  1TQG A;  1TFK B;  5BQI A;  2YHS A;  3K1I A;  4GYT A;  1A41 A;  3DI5 A;  5E3C A;  2JPU A;  3DAF A;  3K6B A;  4JC7 A;  2XLE A;  3FOO A;  1VMA A;  2GAQ A;  4OIP F;  3VYW A;  2YVK A;  3VF0 A;  2R7O A;  5EGY A;  1I5N A;  3HKK A;  2XLM A;  3M15 A;  4CSA A;  2IXP A;  3MLG A;  1C02 A;  1OQC A;  5D92 A;  5EHH A;  3RW0 A;  3FVY A;  3EGD B;  2L6H A;  3ABL C;  4FES A;  4XEV A;  5D91 A;  1RCP A;  2QLA A;  3B0P A;  1KNY A;  2XSE A;  4J32 B;  4LAC B;  3NYJ A;  4P9F A;  4P6I C;  1N1C A;  5B1B C;  4IB4 A;  1MND A;  1TKN A;  1D0Y A;  3TJ5 A;  5L0H A;  1BR2 A;  1HW1 A;  4C3D A;  5HV9 A;  3QW0 A;  3CSK A;  2OCC C;  4O7G A;  3KH2 A;  5T1D B;  2ETS A;  1D1B A;  2WZL A;  5AC5 A;  3K33 A;  1HE1 A;  4DBR A;  1LKX A;  2KQ9 A;  3FMS A;  3LS0 A;  4N6H A;  4DRJ B;  2IBF A;  2TMV P;  3NDB B;  1R5I D;  2CW0 F;  2NSG A;  4O6Y A;  3N2Z B;  3SXK A;  3RF3 A;  3V5Y A;  2HKV A;  1M2V A;  2M64 A;  3PCV A;  4NQF A;  4YL3 A;  4E17 A;  3K1I C;  5E2Q A;  3T9O A;  4H4K C;  4PJJ A;  3QW1 A;  4L6R A;  2EIL C;  5DS6 A;  4DRI B;  3L34 A;  4EUK B;  2XS8 A;  3C8G D;  2ZXR A;  3TJ6 A;  5JT4 A;  4CS7 A;  3EHN A;  4J7Y A;  1EQ1 A;  5JP7 A;  2YRF A;  4UDV A;  4CSA C;  5L0J A;  2BE5 F;  1JOG A;  3S9O A;  1LVK A;  1WGW A;  3VAY A;  1NFO A;  2J7P D;  3MYF A;  4BEM J;  4YJW A;  1G5Z A;  2EIK C;  3KKB A;  3H2V A;  3AOU A;  2EPN A;  4XEF A;  5E33 A;  2CYD A;  1JR8 A;  4NTB A;  5K0I A;  2L81 A;  3M1C B;  1V4A A;  3EG9 A;  1YYX A;  4MVS A;  3SXY A;  2P61 A;  5KYX B;  2ZXP A;  1CGM E;  2IOQ A;  1CGN A;  2EPK X;  4PJM A;  3WG7 C;  1TWC A;  2I8B A;  4YL1 A;  3FAJ A;  1IZM A;  3ZQY A;  1J8Y F;  3UGO A;  3RFY A;  4U5D E;  2ZPA A;  2HFI A;  2BL2 A;  2Y3G A;  1Z7Q c;  1PD1 A;  1VOM A;  3JTL O;  2DYR C;  5B1A C;  3VRC A;  5L3V A;  1HW2 A;  3M79 A;  4XPW A;  4C7O B;  5EK0 A;  2O9X A;  1JMW A;  2NPU A;  2VCC A;  4N4W A;  3S0X A;  3LNR A;  1FR0 A;  5KYW A;  3DM5 A;  3C8G A;  2H7O A;  1ORJ A;  2LFD A;  4DBQ A;  3ABM C;  4KI2 A;  2OOC A;  1Q0F A;  2Q9C A;  2QY9 A;  4YT2 A;  5L0D A;  2PNO A;  1TWG A;  1DOV A;  3OEO A;  4Z9J A;  2J7P A;  2VAS A;  1JPJ A;  4FX5 A;  1ZHY A;  3NKE A;  4OIQ F;  3B29 A;  1A7D A;  4GQH A;  4DJ9 A;  4WJ0 A;  3EFO B;  1IW7 F;  3A9C A;  3NYL A;  4U5H A;  2A0U A;  5CIV A;  2GDC A;  4MTO A;  5JSL A;  2Q4F A;  1CPQ A;  4G0H A;  2HMQ A;  3LEV A;  1U6H A;  2KSF A;  3I5P A;  5DS4 A;  1OR3 A;  2PF4 E;  1MMA A;  2KJG A;  2A68 F;  2XLV A;  4XQ1 A;  5COG A;  3E9V A;  2QUP A;  2A1D D;  3AQC A;  3NMK A;  4CDY A;  1ZW2 A;  2XLD A;  4YT5 A;  4WGY A;  5F5H A;  2EIJ C;  2J0X A;  3CAX A;  3LS1 A;  3S29 A;  3T6G B;  5DQT A;  3W8I A;  1YJG A;  4DVZ A;  3J06 A;  4HFK B;  5FCL A;  1OCO C;  2WZF A;  1PCX A;  4ANJ A;  1NBB A;  2GFH A;  4IAQ A;  3RQG A;  3LEO A;  1WOL A;  2B0J A;  3E70 C;  2QE9 A;  4J7T A;  3RQF A;  3S27 A;  4JJF A;  5A6J A;  3CEX A;  1ZHT A;  3MX3 A;  4MTG A;  1YYJ A;  2M4E A;  3RKO F;  2P0N A;  2C04 A;  3EZH A;  4BJT A;  3EGX B;  3DZA A;  4W8P A;  3QMK A;  3TOM A;  1CPR A;  2H7V C;  1VK5 A;  2I15 A;  3GOD A;  5KYY B;  2W4M A;  3EQL F;  4D4N A;  4E0H A;  5DS5 A;  2FFH A;  2R05 A;  5KYN A;  3FDQ A;  2KK1 A;  4JVS A;  3RYL A;  3FXH A;  2BC5 A;  1S7Z A;  2B0H A;  4LLE A;  2YL7 A;  2OG2 A;  1I4Y A;  1V55 C;  4MVU A;  3SXM A;  1GQA A;  5F5F A;  2OEV A;  4K7B A;  2FGY A;  1MNE A;  2PP4 A;  3EPV A;  4CJG A;  5BQG A;  1WAS A;  4JJG A;  2DB4 A;  1U0B B;  3F46 A;  1MQV A;  2YLI A;  3WHN A;  3QVZ A;  3T6J A;  1TFO B;  1BR1 A;  1FAP B;  3GM2 A;  2Q7R A;  1G8X A;  1FTS A;  1VLT A;  2V26 A;  2YEV A;  1Z23 A;  4G78 A;  1YDI A;  4PFO A;  4Q5S F;  1LI7 A;  2W4B A;  5FZT A;  3U2M A;  4EHP A;  5AC4 A;  4E0I A;  4PAC A;  3EH1 A;  1VB5 A;  1R4T A;  4YL0 A;  2YQY A;  3HLZ A;  4MVO A;  2XL6 A;  2RSE B;  1YAR O;  4RBN A;  3DD7 A;  4MVR A;  3B0U X;  3Q6M A;  2NUT A;  3K7D A;  3ABK C;  2CDQ A;  3I5Q A;  2OU6 A;  2YL1 A;  2HJM A;  4D4X A;  3DE9 A;  4M63 A;  4HE8 D;  1OXB A;  1TWA A;  2QNL A;  1O5H A;  3C18 A;  1M2O A;  5BUO A;  1YA9 A;  4G7Z F;  4KNW A;  1NU7 D;  2YLD A;  4FWV A;  3EJN A;  1YAU O;  1SR2 A;  4MQ9 F;  2Q3T A;  4MVQ A;  2ZXO A;  3TD7 A;  1RKC A;  3Q7G A;  3V7O A;  2HMZ A;  1H6G A;  1YVI A;  2HS5 A;  4YK5 A;  4OIO F;  3POV A;  1ZVZ A;  3C8Z A;  2PX0 A;  2A6E F;  3CQZ A;  1AEP A;  1QVX A;  1YZC A;  2KC3 A;  1ZW3 A;  2KNH A;  3U3B A;  2R7U A;  4CS9 A;  1RKE A;  4OIR F;  1OW8 A;  4CDA A;  1RJ9 B;  1GGQ A;  2EPM X;  3ZQV A;  4E18 A;  5F28 E;  3H2U A;  2J9V A;  3U8V A;  3ZTM A;  4PJN A;  3QVY A;  4IJJ A;  1EKY A;  3U0C A;  1FFH A;  2HSQ A;  4CDV A;  1FFT C;  1ORY A;  1E84 A;  4JUR I;  1AVO B;  5CI9 A;  1AUE A;  2IXO A;  3MBG A;  1MMG A;  2MHR A;  2XLO A;  3MYI A;  2QTV A;  4A2N B;  3GEE A;  2XXA B;  1Z5Z A;  2C03 A;  5A6K A;  3UMI A;  4C3B A;  1C03 A;  4KC9 A;  1SF8 A;  1T6Q A;  1LI5 A;  2AU5 A;  3IPM O;  4X0R A;  1ZU5 A;  2EPO A;  2W45 A;  1OCR C;  4AL0 A;  3MFN A;  5L0I A;  2E87 A;  4NC3 A;  1A7E A;  4E7S A;  2AWC A;  3IQC A;  4JE9 A;  2A0B A;  1EA8 A;  3NKD A;  1FNT c;  4IGG A;  1L7C A;  3S28 A;  1M6T A;  1ZHW A;  3FOP A;  2LQG A;  4IAR A;  2LK4 A;  4XLP F;  1BBH A;  3FHD A;  1NZE A;  4CS9 C;  2P6V A;  256B A;  3M4C A;  2Z15 A;  2VCA A;  4MS2 A;  3ZTZ A;  5DLJ A;  3X1O A;  4DOZ A;  1V54 C;  1YLM A;  3ATP A;  4MTF A;  1ZU4 A;  2W9Y A;  3EGD A;  3JRT A;  5KYU B;  2H7B A;  2WVO A;  3DXJ F;  4YWQ A;  4K1O A;  4ONS A;  2XM4 A;  4AE4 B;  3AG3 C;  4WGZ A;  4NY3 A;  3ASN C;  3JRM O;  1E83 A;  4PFP A;  1WAT A;  1ORS C;  2XS1 A;  3SYN A;  1Y6D A;  3R2P A;  3JYY A;  4XEK A;  3R7C A;  3FAP B;  2G3V A;  2R25 A;  1Z63 A;  2FAP B;  3ITF A;  1QLE C;  3AG2 C;  4AK9 A;  2LD6 A;  2RD9 A;  2P7V A;  1NU9 C;  1QSP A;  1H7I A;  2J8W A;  4LDQ A;  4BPM A;  3NYM A;  3AGU A;  4DVY P;  2CGE A;  2R02 A;  5A69 A;  2GA0 A;  1Z3I X;  2R7Q A;  4KNV A;  3C63 A;  2L7A A;  4XPX A;  2LIG A;  1YZA A;  3TUL A;  4BJ1 A;  1W2W A;  5T3T A;  1QPU A;  4JRZ A;  4U9D A;  4ER9 A;  1D1A A;  1NFN A;  5A6A A;  4EWC A;  4KBL A;  4U9E A;  3GEI A;  1QZX A;  1EI7 A;  3PMR A;  2EIM C;  1NLX A;  3NG1 A;  4LLC A;  3DMD A; 
#chains in the Genus database with same CATH homology
 3QW0 A;  1LM3 B;  3IQ6 A;  4EIY A;  4N6H A;  2YL3 A;  1E85 A;  2XL6 A;  4ULV A;  3QW1 A;  4L6R A;  2XL8 A;  2YL1 A;  5JS5 A;  1A7V A;  4D4X A;  1CGO A;  3DE9 A;  4JEB A;  5JT4 A;  5JP7 A;  2YL0 A;  2YKZ A;  3ZWI A;  2YLD A;  4CIP A;  4CJO A;  3HNI A;  3TOL A;  4CX9 A;  1YYX A;  3HNK A;  1YZC A;  1CGN A;  4CDA A;  3ZQV A;  5JRA A;  3ZQY A;  3NMI A;  3ZTM A;  3QVY A;  3VRC A;  1EKY A;  3HNL A;  3M79 A;  4CDV A;  1E84 A;  4N4W A;  2XLH A;  2XLO A;  5AGF A;  3IQ5 A;  2XLW A;  5B3I A;  4JKV A;  3DE8 A;  3NMJ A;  4NC3 A;  4JE9 A;  5JSL A;  3U8P A;  1E86 A;  1CPQ A;  1M6T A;  3FOP A;  4IAR A;  1BBH A;  2J9B A;  2XLV A;  3HNJ A;  256B A;  3M4C A;  3ZTZ A;  3NMK A;  4CDY A;  2XLD A;  4WGY A;  2YLG A;  5JVE A;  1S05 A;  1QQ3 A;  2XM4 A;  4WGZ A;  1E83 A;  1APC A;  1NBB A;  3M4B A;  4IAQ A;  3C62 A;  4JEA A;  2CCY A;  1YYJ A;  2XLE A;  3FOO A;  2XM0 A;  3TOM A;  1CPR A;  2J8W A;  4D4N A;  5JUA A;  2XLM A;  3M15 A;  3C63 A;  2BC5 A;  1YZA A;  3L1M A;  2YL7 A;  1QPU A;  1GQA A;  4U9D A;  4ER9 A;  1RCP A;  4CJG A;  2QLA A;  4U9E A;  1JAF A;  4IB4 A;  1MQV A;  2YLI A;  3QVZ A;  5JLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...