4D4XA

Nitrosyl complex of the d121i variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHIAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4xA00
1CGOA 2YL0A 1MQVA 2XLEA 2XL8A 2XLOA 4ULVA 5B3IA 3FOOA 3TOLA 3IQ5A 4CX9A 3VRCA 2YL7A 3ZTMA 4U9DA 4CIPA 1LM3B 3IQ6A 1E86A 4NC3A 4CDAA 4IB4A 3M4BA 4L6RA 1S05A 4CJOA 4JEAA 3ZTZA 3ZQYA 1GQAA 2QLAA 1JAFA 2XLVA 1EKYA 5JLIA 4EIYA 1BBHA 2XM0A 3NMJA 3TOMA 5JS5A 2XLDA 2BC5A 2XLHA 1NBBA 3DE8A 4D4XA 1A7VA 2XLMA 4WGYA 2J8WA 4CDVA 256BA 4N6HA 1CPRA 4N4WA 1YZAA 2XM4A 3C62A 1YYXA 3NMKA 3M4CA 4CDYA 4JEBA 3M15A 2YLIA 1CPQA 1YYJA 1YZCA 5JRAA 4IAQA 1E84A 3QW0A 3HNKA 1QQ3A 4IARA 3ZWIA 3C63A 1E83A 3NMIA 2YLGA 5JUAA 2YLDA 3QW1A 3U8PA 5JT4A 3L1MA 1QPUA 2J9BA 1RCPA 2YKZA 2CCYA 4JE9A 1CGNA 3HNLA 4JKVA 5JSLA 4D4NA 4ER9A 3QVYA 4U9EA 1APCA 3FOPA 5AGFA 3DE9A 2XL6A 4WGZA 1M6TA 5JP7A 5JVEA 1E85A 3HNIA 3M79A 3HNJA 3QVZA 2YL3A 3ZQVA 2XLWA 2YL1A 4CJGA
chains in the Genus database with same CATH superfamily
4XEKA 1PV3A 3S29A 4NTAA 3JT1A 1MQVA 1ZU4A 3M1CB 4JURI 2XL8A 3B0UX 2EPLX 1RKEB 2ZXWC 4MVUA 3S90A 2MHRA 2ZD9A 3Q6MA 3DXJF 4C3EA 2WVQA 5TJ5E 2X0CA 3U3FA 3GEEA 3F47A 3IQ5A 4N06A 3L34A 4K7BA 5KYXB 3VRCA 1CGME 2R7OA 4MVSA 5A6BA 4J30B 3W8IA 3IQTA 5DS4A 1OXKA 3UNGC 1NSGB 1E2XA 2G62A 2OJED 2EPMX 4I3MA 5T1DB 4CDAA 2PF4E 1V4AA 5KYUA 2WL8A 1R4TA 2ZXRA 4IB4A 2VC9A 3JRTA 3UMIA 3UR3C 1S05A 1T5OA 5FZTA 3PDMP 1L3PA 2J0WA 4G0HA 3EGXB 4J7YA 4XPYA 4BJ5C 3RVYA 1JAFA 4QI0A 2IXPA 1YA7O 4U5DE 5A69A 4NTBA 1NLXA 2Q7RA 1I4YA 1KNYA 1Q0FA 1R5ID 2NSGA 4IRUA 5CIVA 5GPGB 3CQZA 4U5CE 1MNDA 3FAJA 5COGA 2FAPB 1WATA 2OOCA 5COMA 4Q7CA 3JYHA 2XLDA 2XS1A 2YEVA 4MVOA 4U5HA 2R7TA 2XRHA 3LNMB 5DLJA 1PD1A 3EHNA 2J7PD 4OIRF 4AL0A 3ITFA 3SP1A 2TMVP 4Q5SF 1J8YF 1T6IA 3MFNA 4M63A 3OEOA 4DOZA 1OXBA 4XPWA 1XWJA 1IZMA 2J8WA 3SZRA 4JJFA 3TK0A 4RD9A 3WODF 1CPRA 5BUOA 5KYNA 2Y3BA 1H6GA 1B68A 2XM4A 3C62A 2J9UA 2NPUA 4XEFA 4QDLA 3U2LA 3NMKA 3CEXA 3M4CA 3RF3A 2GA0A 3K6BA 1VB5A 1RJ9A 1OKKA 3ASOC 3EQLF 4HEAJ 4PFPA 1D1BA 4KI2A 1VLTA 3DJUB 1CPQA 2KSFA 3LS1A 1YZCA 1TWHA 2IM8A 2MYSA 3AGTA 1E84A 1UG7A 3AG3C 3RW0A 2NUPA 3C8GD 3ECSA 3Q7GA 1QQ3A 4LLEA 4E0IA 1QLEC 4BJ5A 2CNWA 4BJTA 2A69F 3OWTA 4J32B 4I1OB 3PMRA 4WJ0A 4YT8A 1O87A 3EZHA 4YT2A 5JUAA 2Q00A 1MMDA 2PNOA 3EG9A 3MBGA 4CS9C 4DRJB 4EBJA 2AWCA 2HV6A 2PFDA 1PD0A 2Q3TA 1QPUA 2YKZA 2CCYA 1T9KA 3JYYA 3KH2A 3A11A 4XPXA 1HMOA 3K1IC 4KNWA 3DI5A 3U5SA 1PCXA 3NKDA 3SXKA 4IAOA 2CW0F 2LQGA 4WABA 4XLNF 2R05A 1I5NA 4PJJA 3SXYA 4U9EA 4EBKA 1BR4A 2OU6A 3QMKA 5BQIA 3W2VA 1V55C 1SZIA 5D91A 2PBEA 3AG4C 4ULWA 3VM6A 3U2MA 1ORJA 2B0JA 4C7OB 3N0TA 1QSPA 2RD9A 3MX3A 1AVOB 5DVWA 1M6TA 2BE5F 2IXNA 2VCBA 4MS2A 1NU9C 2V3CC 3TJ5A 5EHHA 2EPOA 1HW1A 4Z9JA 2H7VC 1A41A 3QVZA 4DRIB 2XLWA 5KYUB 2HJMA 1LS4A 1RKCA 4PACA 1H9TA 1N1CA 2YL0A 2D4UA 5D92A 1Q0DA 3ZDLA 3RQEA 4O6MA 2KK1A 5CI9A 3PHF2 1JR8A 3C7JA 2DYRC 1H7IA 3MYIA 3S9OA 1YARO 2YHSA 3JZ0A 1VYKA 4E17A 2A1DD 3WHNA 1U89A 4W8KA 4E7ZA 1M57C 1OCCC 2OCCC 2R9RB 3K1IA 4DJ9A 1GS9A 3U8VA 5KYYA 3IQ6A 1F1MA 2Y3HA 3DAGA 4EUKB 2Y69C 3I4UA 3I5QA 4OD4A 4EBBA 2R7XA 2PX0A 1MMGA 2YRFA 3H65A 4L6RA 1C02A 4JEAA 3ZTZA 3H2UA 4O7GA 3BRJA 3KMIA 1U0BB 4P9FA 1AEPA 2XLVA 4PJMA 1S7ZA 1EKYA 4C3BA 4MW8A 1Z5ZA 4MTFA 1LI7A 2G3VA 2YWAA 4YL3A 4EIYA 5DQTA 4PR9A 3W2WA 1EQ1A 2JPUA 1QVXA 1RJ9B 2H7OA 1M56C 2EIKC 2LIGA 4FWVA 1ZYRF 3F46A 1JRAA 4JTDB 3RKOF 1LI5A 2BC5A 5F28E 1OCOC 3B0VC 3POVA 4K1OA 4G78A 2XLHA 1WTYA 2NUPB 2OJQA 2P1AA 2WVNA 3TJ6A 3V7OA 2LD6A 2VB6A 3Q7LA 4O79A 1LKXA 2EILC 2L81A 3SXZA 3G50A 1HE1A 2Z15A 3SYNA 4D4XA 2XLMA 1ZW3A 4QI2A 3DM9B 4DBRA 2QUPA 4CDVA 1T01A 4JRZA 4RBNA 4YT5A 2VCCA 2WVOA 1U6HA 3WAQA 1YZAA 1D0XA 3DD7A 5L0JA 3EG9B 5DS5A 4OD5A 4YL0A 3DMDA 2R7SA 3T4RA 4I1MA 3JSZA 4XWJA 2ZPAA 1G8XA 3T6JA 4MTGA 3FHDA 1A0BA 5AC4A 3CZ6A 2QE9A 4JEBA 1VK5A 2ICWG 3HJCA 3W4YA 1NFOA 3ABMC 4GYTA 1YYJA 5COFA 3GM2A 1SYQA 5JRAA 1QZXA 4OIOF 3J06A 5A6JA 3HNKA 1L7CA 3NYLA 2J7PA 4EWCA 4MNDA 4CS8C 4IWBA 2YZSA 2ASRA 1BZ4A 2R7RA 2VCAA 2AWYA 2YLGA 3HLZA 2YLDA 3QW1A 4BG0A 5DQZA 3RFYA 5KYWA 2W45A 2L7AA 3L1MA 4AL1A 2J9BA 3E9VA 2P6VA 4MVRA 3T6GB 1RCPA 3EFOA 3B0PA 4JE9A 1OR3A 1DOVA 3E70C 2H8AA 2LSEA 3AG1C 1FMVA 2CDQA 3UGOA 5F5HA 3LEVA 2IXMA 2EPKX 4HE8D 5T3WA 2KYHA 3TULA 3O6XA 4CBEA 3FOPA 1BR2A 2E87A 2W4BA 3C8GA 2P61A 3MYFA 2HUJA 2XL6A 1FTSA 1ORYA 1HE9A 2HZ8A 3O55A 2F22A 2R02A 3EJNA 4PFOA 2Q4FA 2XL4A 1WWPA 2H7BA 4YK5A 2OEXA 2UUIA 4FX5A 3RVZA 4NY3A 3LESA 5JP7A 1LPEA 4GQHA 1NZEA 5KYYB 4Z9HA 4GEHA 1ZHYA 4LACB 4YT4A 2ETSA 1WGWA 2WZLA 3H2VA 4JVSA 5E3CA 2KGOA 3VF0A 3CAXA 3X2QC 1HMDA 4A2NB 4YL1A 3N24A 4U5FE 4CJGA 4CX9A 5B3SC 3TQOA 4G7HF 4CS8A 2XXAA 2CYDA 5DS6A 1M2VA 2Y3GA 2P0NA 3QZCA 2L6FA 1WOLA 4EKWA 2Y39A 4R32A 3DAFA 4O6NA 4BEJA 3DZAA 2PP4A 3FOOA 5B3IA 1T6UA 3R7CA 2LCHA 3RQGA 4KBLA 1Q0MA 2A6HF 4H4KC 3LS0A 3UMHA 1FAPB 1D0YA 3EGDA 2NUTA 1HW2A 3U3BA 2HS5A 4MQ9F 3LAYA 4U9DA 5L0FA 4DBQA 4CIPA 3GODA 5FCLA 2Q9BA 3EH1A 5L0HA 1E86A 3N2ZB 2YQYA 1W2WA 4KC9A 4I44A 1K05A 4LLCA 3U9MA 3M4BA 3U9JA 1ZHXA 3GM3A 4CJOA 1Z6AA 1BR1A 1OW7A 3DM5A 2GDCA 2QLAA 2NSFA 2GFHA 3L0IA 5L0CA 5K0IA 4XQ1A 3ASNC 1OW6A 4YJWA 5JLIA 1BBHA 2XM0A 2R7WA 1TWAA 3VYWA 3EPVA 1ST6A 4F4BA 4NTFA 2DB4A 2DYSC 2ZXOA 1LVKA 3V5ZA 4EHPA 1VOMA 5JS5A 5L0GA 3RYLA 1TWCA 2NG1A 3SXMA 3U0CA 3ZC4A 4E18A 1AUEA 2OEVA 3LJBA 4MTOA 4O6YA 1KTMA 2HJ3A 3LEOA 2L9JA 3AQCA 3DE8A 4DRHB 1ZU5A 2JX0A 2HFIA 2PX3A 2XS8A 3AOUA 3US6A 4E0HA 4E7SA 1ZHWA 256BA 4MW3A 3FDQA 4G7OF 2M4EA 3HTKC 4B6IA 2R03A 5L0DA 1D1AA 2FFHA 1V74B 1OR2A 1VLSA 2D5RB 1G4WR 1YVIA 1K04A 2EINC 2HMZA 2JD3A 2WZGA 3O39A 2R7UA 3EFOB 1MMNA 3X1OA 3A9CA 1YDIA 1Q0GA 4CDYA 4LDRA 5B1BC 3JTLO 2EIJC 3M15A 3AG2C 3G4XA 1EA8A 2WZFA 2YLIA 3IEEA 3IPMO 3KL4A 3AJMA 1JMWA 2AVKA 3O10A 3ZSUA 1ORSC 3S0XA 1NU7D 3K7DA 4JC7A 4P9TA 3C8GB 4H54A 3GWNA 4X0RA 3ZWIA 2DGJA 2RSEB 3AGUA 2CGEA 2C03A 3NG1A 4AK9A 1OCRC 2IYLD 4LDKA 3LLKA 5JT4A 4JW1A 2FGYA 3RQFA 1NG1A 3WG7C 5BQGA 1CGNA 1O5HA 3T9OA 2QNLA 1LIHA 3S27A 5L3VA 2J9WA 3L8IA 4HFKB 3HNLA 3JCUQ 4LERA 3ZVRA 4YWQA 2XXAB 2W4MA 1V54C 2IXOA 2L6HA 1M2VB 3K66A 4XTKA 3VAYA 1O3UA 2LK4A 3G4ZA 1A7DA 4A4AA 2W9YA 4MVZA 3C8ZA 1Z23A 4N6CA 5E2QA 1XZQA 1YAUO 3R2PA 4U5GA 4MVQA 4BJ1A 2KJGA 2NUTB 1JPNA 3EGDB 1H9GA 5E3AA 5E33A 3L8JA 2EPNA 3OA1A 5A6BD 1E85A 4UDVA 3HNIA 3MLGA 4CS7A 1MMAA 2BL2A 2J9VA 3M79A 1FMWA 2MWQA 4JZAA 2HKVA 1BDJB 2LFFA 2YL3A 1Z7Qc 3IHUA 5EK0A 2YL1A 4DXWA 2VASA 2R7VA 1TFOB 1Q0KA 4FESA 4ANJA 1CGOA 3RH3A 2UUHA 4YN0B 2AU5A 2XLEA 1KU2A 1TQGA 1YJGA 4ZLDA 2QTVA 2DI3A 5AC5A 2XLOA 4ULVA 3FMSA 3V5YA 3S28A 1SR2A 3GEHA 1C03A 3BEHA 4BJ6C 3TOLA 1JPJA 2KC3A 1TR2A 3IQCA 3W8HA 4CSAC 1FNTc 2YL7A 4W8PA 3ZTMA 4AE4A 4XLPF 3GORA 3FAPB 2LP4A 3GEIA 1LM3B 2A6EF 2M64A 3LUTB 1T6QA 2KQ9A 1RMVA 5L3QA 4NC3A 2OQMA 2P7VA 2AP3A 2B0HA 4C7OA 3LLIA 4ONSA 1YA9A 3NYMA 3SEOA 4XEVA 3ZQYA 3HKKA 1GQAA 4JCHA 4C3DA 1VMAA 1FR0A 1OQCA 1G4US 3K1HA 2WB7A 3JRMO 3AQBA 3KKBA 2OG2A 5BQHA 1RKEA 1TFKB 4FAPB 5IY5C 5L0IA 4PJLA 1OKKD 3ATPA 2A0UA 3NMJA 3Q6NA 4RDAA 4U5EE 5HV9A 3UGPA 2V26A 4G7ZF 3TOMA 1WN0A 2HMQA 3NKEA 1IW7F 4K0DA 4KNVA 4NQFA 2R25A 5KYXA 1ZZPA 1DOWA 4DVZA 1NBBA 1SMYF 4NCQA 2IOQA 1G5ZA 2CNWD 2LFDA 3SNHA 5A6AA 2XSEA 4Q4ZF 3DKAA 1A7VA 4WGYA 3UMKA 3S84A 1GM5A 1K40A 4N6HA 1FFHA 2A68F 5B1AC 4N4WA 4ZLCA 3C18A 4IGGA 3EGXA 1OW8A 1I4ZA 3TD7A 2HSQA 1ZHZA 3EHMA 4JCZA 5CI8A 1OCZC 1MNEA 4BJ6A 1M2OA 1YYXA 2GAQA 4IJJA 4BPMA 4OIPF 4CSAA 2KNHA 3K33A 3NRHA 3NYJA 1VTMP 4AX2A 4PK4A 2OKUA 3I5PA 5A6KA 3KYJA 3LNRA 1XZPA 3T6BA 2Y3DA 4IAQA 4P6IC 1GGQA 2KW3C 2R7QA 3QW0A 4U5BE 1VYIA 4Z9IA 5HSWA 2L6GA 1HY5A 3B29A 1EI7A 2GWWA 3GM1A 3FVYA 4IARA 1LE4A 2HV7A 3B71A 3NDBB 1Y4CA 3RIPA 1D1CA 3V5XA 2Q9CA 1SF8A 4BEMJ 3C63A 1E83A 4JJGA 3NMIA 1TKNA 4MVMA 4CIHA 4J7TA 3EZIA 1J8MF 3GANA 3KPHA 1Z3IX 3U8PA 2O9XA 3EH2A 2C04A 2A0BA 1A7EA 2J45A 2Q9AA 5T3TA 5KYWB 3FXHA 1QKRA 3DJNB 3KYIA 3B9QA 1ZVZA 5F5FA 2VH3A 1JOGA 1YLMA 4JKVA 2IBFA 5JSLA 3QTHA 3ZG1A 4D4NA 4ER9A 3QVYA 4CS9A 1APCA 1ZW2A 1Y6DA 2HSBA 5AGFA 5EGYA 4HFFB 3DE9A 1UFBA 2J46A 3JSEO 1D0ZA 3GWLA 2I8BA 1NFNA 1LE2A 4JTAB 4WGZA 4OINF 1TWGA 2ZXPA 3CSKA 1C17M 1WASA 4DVYP 2J0XA 3ABLC 1LS1A 2X51A 3ABKC 2EIMC 2G3KA 4AE4B 3DWWA 3ZIBA 5JVEA 3PCVA 2YVKA 4JTCB 4LDQA 4OIQF 4JIOA 1RXQA 4PJNA 3HNJA 3ZQVA 2I15A 1FFTC 1Z63A 1ZHTA 2QY9A
chains in the Genus database with same CATH topology
1CGOA 2YL0A 1MQVA 2XLEA 2XL8A 2XLOA 4ULVA 5B3IA 3FOOA 3TOLA 3IQ5A 4CX9A 3VRCA 2YL7A 3ZTMA 4U9DA 4CIPA 1LM3B 3IQ6A 1E86A 4NC3A 4CDAA 4IB4A 3M4BA 4L6RA 1S05A 4CJOA 4JEAA 3ZTZA 3ZQYA 1GQAA 2QLAA 1JAFA 2XLVA 1EKYA 5JLIA 4EIYA 1BBHA 2XM0A 3NMJA 3TOMA 5JS5A 2XLDA 2BC5A 2XLHA 1NBBA 3DE8A 4D4XA 1A7VA 2XLMA 4WGYA 2J8WA 4CDVA 256BA 4N6HA 1CPRA 4N4WA 1YZAA 2XM4A 3C62A 1YYXA 3NMKA 3M4CA 4CDYA 4JEBA 3M15A 2YLIA 1CPQA 1YYJA 1YZCA 5JRAA 4IAQA 1E84A 3QW0A 3HNKA 1QQ3A 4IARA 3ZWIA 3C63A 1E83A 3NMIA 2YLGA 5JUAA 2YLDA 3QW1A 3U8PA 5JT4A 3L1MA 1QPUA 2J9BA 1RCPA 2YKZA 2CCYA 4JE9A 1CGNA 3HNLA 4JKVA 5JSLA 4D4NA 4ER9A 3QVYA 4U9EA 1APCA 3FOPA 5AGFA 3DE9A 2XL6A 4WGZA 1M6TA 5JP7A 5JVEA 1E85A 3HNIA 3M79A 3HNJA 3QVZA 2YL3A 3ZQVA 2XLWA 2YL1A 4CJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGO A;  2YL0 A;  1MQV A;  2XLE A;  2XL8 A;  2XLO A;  4ULV A;  5B3I A;  3FOO A;  3TOL A;  3IQ5 A;  4CX9 A;  3VRC A;  2YL7 A;  3ZTM A;  4U9D A;  4CIP A;  1LM3 B;  3IQ6 A;  1E86 A;  4NC3 A;  4CDA A;  4IB4 A;  3M4B A;  4L6R A;  1S05 A;  4CJO A;  4JEA A;  3ZTZ A;  3ZQY A;  1GQA A;  2QLA A;  1JAF A;  2XLV A;  1EKY A;  5JLI A;  4EIY A;  1BBH A;  2XM0 A;  3NMJ A;  3TOM A;  5JS5 A;  2XLD A;  2BC5 A;  2XLH A;  1NBB A;  3DE8 A;  4D4X A;  1A7V A;  2XLM A;  4WGY A;  2J8W A;  4CDV A;  256B A;  4N6H A;  1CPR A;  4N4W A;  1YZA A;  2XM4 A;  3C62 A;  1YYX A;  3NMK A;  3M4C A;  4CDY A;  4JEB A;  3M15 A;  2YLI A;  1CPQ A;  1YYJ A;  1YZC A;  5JRA A;  4IAQ A;  1E84 A;  3QW0 A;  3HNK A;  1QQ3 A;  4IAR A;  3ZWI A;  3C63 A;  1E83 A;  3NMI A;  2YLG A;  5JUA A;  2YLD A;  3QW1 A;  3U8P A;  5JT4 A;  3L1M A;  1QPU A;  2J9B A;  1RCP A;  2YKZ A;  2CCY A;  4JE9 A;  1CGN A;  3HNL A;  4JKV A;  5JSL A;  4D4N A;  4ER9 A;  3QVY A;  4U9E A;  1APC A;  3FOP A;  5AGF A;  3DE9 A;  2XL6 A;  4WGZ A;  1M6T A;  5JP7 A;  5JVE A;  1E85 A;  3HNI A;  3M79 A;  3HNJ A;  3QVZ A;  2YL3 A;  3ZQV A;  2XLW A;  2YL1 A;  4CJG A; 
#chains in the Genus database with same CATH topology
 4XEK A;  1PV3 A;  3S29 A;  4NTA A;  3JT1 A;  1MQV A;  1ZU4 A;  3M1C B;  4JUR I;  2XL8 A;  3B0U X;  2EPL X;  1RKE B;  2ZXW C;  4MVU A;  3S90 A;  2MHR A;  2ZD9 A;  3Q6M A;  3DXJ F;  4C3E A;  2WVQ A;  5TJ5 E;  2X0C A;  3U3F A;  3GEE A;  3F47 A;  3IQ5 A;  4N06 A;  3L34 A;  4K7B A;  5KYX B;  3VRC A;  1CGM E;  2R7O A;  4MVS A;  5A6B A;  4J30 B;  3W8I A;  3IQT A;  5DS4 A;  1OXK A;  3UNG C;  1NSG B;  1E2X A;  2G62 A;  2OJE D;  2EPM X;  4I3M A;  5T1D B;  4CDA A;  2PF4 E;  1V4A A;  5KYU A;  2WL8 A;  1R4T A;  2ZXR A;  4IB4 A;  2VC9 A;  3JRT A;  3UMI A;  3UR3 C;  1S05 A;  1T5O A;  5FZT A;  3PDM P;  1L3P A;  2J0W A;  4G0H A;  3EGX B;  4J7Y A;  4XPY A;  4BJ5 C;  3RVY A;  1JAF A;  4QI0 A;  2IXP A;  1YA7 O;  4U5D E;  5A69 A;  4NTB A;  1NLX A;  2Q7R A;  1I4Y A;  1KNY A;  1Q0F A;  1R5I D;  2NSG A;  4IRU A;  5CIV A;  5GPG B;  3CQZ A;  4U5C E;  1MND A;  3FAJ A;  5COG A;  2FAP B;  1WAT A;  2OOC A;  5COM A;  4Q7C A;  3JYH A;  2XLD A;  2XS1 A;  2YEV A;  4MVO A;  4U5H A;  2R7T A;  2XRH A;  3LNM B;  5DLJ A;  1PD1 A;  3EHN A;  2J7P D;  4OIR F;  4AL0 A;  3ITF A;  3SP1 A;  2TMV P;  4Q5S F;  1J8Y F;  1T6I A;  3MFN A;  4M63 A;  3OEO A;  4DOZ A;  1OXB A;  4XPW A;  1XWJ A;  1IZM A;  2J8W A;  3SZR A;  4JJF A;  3TK0 A;  4RD9 A;  3WOD F;  1CPR A;  5BUO A;  5KYN A;  2Y3B A;  1H6G A;  1B68 A;  2XM4 A;  3C62 A;  2J9U A;  2NPU A;  4XEF A;  4QDL A;  3U2L A;  3NMK A;  3CEX A;  3M4C A;  3RF3 A;  2GA0 A;  3K6B A;  1VB5 A;  1RJ9 A;  1OKK A;  3ASO C;  3EQL F;  4HEA J;  4PFP A;  1D1B A;  4KI2 A;  1VLT A;  3DJU B;  1CPQ A;  2KSF A;  3LS1 A;  1YZC A;  1TWH A;  2IM8 A;  2MYS A;  3AGT A;  1E84 A;  1UG7 A;  3AG3 C;  3RW0 A;  2NUP A;  3C8G D;  3ECS A;  3Q7G A;  1QQ3 A;  4LLE A;  4E0I A;  1QLE C;  4BJ5 A;  2CNW A;  4BJT A;  2A69 F;  3OWT A;  4J32 B;  4I1O B;  3PMR A;  4WJ0 A;  4YT8 A;  1O87 A;  3EZH A;  4YT2 A;  5JUA A;  2Q00 A;  1MMD A;  2PNO A;  3EG9 A;  3MBG A;  4CS9 C;  4DRJ B;  4EBJ A;  2AWC A;  2HV6 A;  2PFD A;  1PD0 A;  2Q3T A;  1QPU A;  2YKZ A;  2CCY A;  1T9K A;  3JYY A;  3KH2 A;  3A11 A;  4XPX A;  1HMO A;  3K1I C;  4KNW A;  3DI5 A;  3U5S A;  1PCX A;  3NKD A;  3SXK A;  4IAO A;  2CW0 F;  2LQG A;  4WAB A;  4XLN F;  2R05 A;  1I5N A;  4PJJ A;  3SXY A;  4U9E A;  4EBK A;  1BR4 A;  2OU6 A;  3QMK A;  5BQI A;  3W2V A;  1V55 C;  1SZI A;  5D91 A;  2PBE A;  3AG4 C;  4ULW A;  3VM6 A;  3U2M A;  1ORJ A;  2B0J A;  4C7O B;  3N0T A;  1QSP A;  2RD9 A;  3MX3 A;  1AVO B;  5DVW A;  1M6T A;  2BE5 F;  2IXN A;  2VCB A;  4MS2 A;  1NU9 C;  2V3C C;  3TJ5 A;  5EHH A;  2EPO A;  1HW1 A;  4Z9J A;  2H7V C;  1A41 A;  3QVZ A;  4DRI B;  2XLW A;  5KYU B;  2HJM A;  1LS4 A;  1RKC A;  4PAC A;  1H9T A;  1N1C A;  2YL0 A;  2D4U A;  5D92 A;  1Q0D A;  3ZDL A;  3RQE A;  4O6M A;  2KK1 A;  5CI9 A;  3PHF 2;  1JR8 A;  3C7J A;  2DYR C;  1H7I A;  3MYI A;  3S9O A;  1YAR O;  2YHS A;  3JZ0 A;  1VYK A;  4E17 A;  2A1D D;  3WHN A;  1U89 A;  4W8K A;  4E7Z A;  1M57 C;  1OCC C;  2OCC C;  2R9R B;  3K1I A;  4DJ9 A;  1GS9 A;  3U8V A;  5KYY A;  3IQ6 A;  1F1M A;  2Y3H A;  3DAG A;  4EUK B;  2Y69 C;  3I4U A;  3I5Q A;  4OD4 A;  4EBB A;  2R7X A;  2PX0 A;  1MMG A;  2YRF A;  3H65 A;  4L6R A;  1C02 A;  4JEA A;  3ZTZ A;  3H2U A;  4O7G A;  3BRJ A;  3KMI A;  1U0B B;  4P9F A;  1AEP A;  2XLV A;  4PJM A;  1S7Z A;  1EKY A;  4C3B A;  4MW8 A;  1Z5Z A;  4MTF A;  1LI7 A;  2G3V A;  2YWA A;  4YL3 A;  4EIY A;  5DQT A;  4PR9 A;  3W2W A;  1EQ1 A;  2JPU A;  1QVX A;  1RJ9 B;  2H7O A;  1M56 C;  2EIK C;  2LIG A;  4FWV A;  1ZYR F;  3F46 A;  1JRA A;  4JTD B;  3RKO F;  1LI5 A;  2BC5 A;  5F28 E;  1OCO C;  3B0V C;  3POV A;  4K1O A;  4G78 A;  2XLH A;  1WTY A;  2NUP B;  2OJQ A;  2P1A A;  2WVN A;  3TJ6 A;  3V7O A;  2LD6 A;  2VB6 A;  3Q7L A;  4O79 A;  1LKX A;  2EIL C;  2L81 A;  3SXZ A;  3G50 A;  1HE1 A;  2Z15 A;  3SYN A;  4D4X A;  2XLM A;  1ZW3 A;  4QI2 A;  3DM9 B;  4DBR A;  2QUP A;  4CDV A;  1T01 A;  4JRZ A;  4RBN A;  4YT5 A;  2VCC A;  2WVO A;  1U6H A;  3WAQ A;  1YZA A;  1D0X A;  3DD7 A;  5L0J A;  3EG9 B;  5DS5 A;  4OD5 A;  4YL0 A;  3DMD A;  2R7S A;  3T4R A;  4I1M A;  3JSZ A;  4XWJ A;  2ZPA A;  1G8X A;  3T6J A;  4MTG A;  3FHD A;  1A0B A;  5AC4 A;  3CZ6 A;  2QE9 A;  4JEB A;  1VK5 A;  2ICW G;  3HJC A;  3W4Y A;  1NFO A;  3ABM C;  4GYT A;  1YYJ A;  5COF A;  3GM2 A;  1SYQ A;  5JRA A;  1QZX A;  4OIO F;  3J06 A;  5A6J A;  3HNK A;  1L7C A;  3NYL A;  2J7P A;  4EWC A;  4MND A;  4CS8 C;  4IWB A;  2YZS A;  2ASR A;  1BZ4 A;  2R7R A;  2VCA A;  2AWY A;  2YLG A;  3HLZ A;  2YLD A;  3QW1 A;  4BG0 A;  5DQZ A;  3RFY A;  5KYW A;  2W45 A;  2L7A A;  3L1M A;  4AL1 A;  2J9B A;  3E9V A;  2P6V A;  4MVR A;  3T6G B;  1RCP A;  3EFO A;  3B0P A;  4JE9 A;  1OR3 A;  1DOV A;  3E70 C;  2H8A A;  2LSE A;  3AG1 C;  1FMV A;  2CDQ A;  3UGO A;  5F5H A;  3LEV A;  2IXM A;  2EPK X;  4HE8 D;  5T3W A;  2KYH A;  3TUL A;  3O6X A;  4CBE A;  3FOP A;  1BR2 A;  2E87 A;  2W4B A;  3C8G A;  2P61 A;  3MYF A;  2HUJ A;  2XL6 A;  1FTS A;  1ORY A;  1HE9 A;  2HZ8 A;  3O55 A;  2F22 A;  2R02 A;  3EJN A;  4PFO A;  2Q4F A;  2XL4 A;  1WWP A;  2H7B A;  4YK5 A;  2OEX A;  2UUI A;  4FX5 A;  3RVZ A;  4NY3 A;  3LES A;  5JP7 A;  1LPE A;  4GQH A;  1NZE A;  5KYY B;  4Z9H A;  4GEH A;  1ZHY A;  4LAC B;  4YT4 A;  2ETS A;  1WGW A;  2WZL A;  3H2V A;  4JVS A;  5E3C A;  2KGO A;  3VF0 A;  3CAX A;  3X2Q C;  1HMD A;  4A2N B;  4YL1 A;  3N24 A;  4U5F E;  4CJG A;  4CX9 A;  5B3S C;  3TQO A;  4G7H F;  4CS8 A;  2XXA A;  2CYD A;  5DS6 A;  1M2V A;  2Y3G A;  2P0N A;  3QZC A;  2L6F A;  1WOL A;  4EKW A;  2Y39 A;  4R32 A;  3DAF A;  4O6N A;  4BEJ A;  3DZA A;  2PP4 A;  3FOO A;  5B3I A;  1T6U A;  3R7C A;  2LCH A;  3RQG A;  4KBL A;  1Q0M A;  2A6H F;  4H4K C;  3LS0 A;  3UMH A;  1FAP B;  1D0Y A;  3EGD A;  2NUT A;  1HW2 A;  3U3B A;  2HS5 A;  4MQ9 F;  3LAY A;  4U9D A;  5L0F A;  4DBQ A;  4CIP A;  3GOD A;  5FCL A;  2Q9B A;  3EH1 A;  5L0H A;  1E86 A;  3N2Z B;  2YQY A;  1W2W A;  4KC9 A;  4I44 A;  1K05 A;  4LLC A;  3U9M A;  3M4B A;  3U9J A;  1ZHX A;  3GM3 A;  4CJO A;  1Z6A A;  1BR1 A;  1OW7 A;  3DM5 A;  2GDC A;  2QLA A;  2NSF A;  2GFH A;  3L0I A;  5L0C A;  5K0I A;  4XQ1 A;  3ASN C;  1OW6 A;  4YJW A;  5JLI A;  1BBH A;  2XM0 A;  2R7W A;  1TWA A;  3VYW A;  3EPV A;  1ST6 A;  4F4B A;  4NTF A;  2DB4 A;  2DYS C;  2ZXO A;  1LVK A;  3V5Z A;  4EHP A;  1VOM A;  5JS5 A;  5L0G A;  3RYL A;  1TWC A;  2NG1 A;  3SXM A;  3U0C A;  3ZC4 A;  4E18 A;  1AUE A;  2OEV A;  3LJB A;  4MTO A;  4O6Y A;  1KTM A;  2HJ3 A;  3LEO A;  2L9J A;  3AQC A;  3DE8 A;  4DRH B;  1ZU5 A;  2JX0 A;  2HFI A;  2PX3 A;  2XS8 A;  3AOU A;  3US6 A;  4E0H A;  4E7S A;  1ZHW A;  256B A;  4MW3 A;  3FDQ A;  4G7O F;  2M4E A;  3HTK C;  4B6I A;  2R03 A;  5L0D A;  1D1A A;  2FFH A;  1V74 B;  1OR2 A;  1VLS A;  2D5R B;  1G4W R;  1YVI A;  1K04 A;  2EIN C;  2HMZ A;  2JD3 A;  2WZG A;  3O39 A;  2R7U A;  3EFO B;  1MMN A;  3X1O A;  3A9C A;  1YDI A;  1Q0G A;  4CDY A;  4LDR A;  5B1B C;  3JTL O;  2EIJ C;  3M15 A;  3AG2 C;  3G4X A;  1EA8 A;  2WZF A;  2YLI A;  3IEE A;  3IPM O;  3KL4 A;  3AJM A;  1JMW A;  2AVK A;  3O10 A;  3ZSU A;  1ORS C;  3S0X A;  1NU7 D;  3K7D A;  4JC7 A;  4P9T A;  3C8G B;  4H54 A;  3GWN A;  4X0R A;  3ZWI A;  2DGJ A;  2RSE B;  3AGU A;  2CGE A;  2C03 A;  3NG1 A;  4AK9 A;  1OCR C;  2IYL D;  4LDK A;  3LLK A;  5JT4 A;  4JW1 A;  2FGY A;  3RQF A;  1NG1 A;  3WG7 C;  5BQG A;  1CGN A;  1O5H A;  3T9O A;  2QNL A;  1LIH A;  3S27 A;  5L3V A;  2J9W A;  3L8I A;  4HFK B;  3HNL A;  3JCU Q;  4LER A;  3ZVR A;  4YWQ A;  2XXA B;  2W4M A;  1V54 C;  2IXO A;  2L6H A;  1M2V B;  3K66 A;  4XTK A;  3VAY A;  1O3U A;  2LK4 A;  3G4Z A;  1A7D A;  4A4A A;  2W9Y A;  4MVZ A;  3C8Z A;  1Z23 A;  4N6C A;  5E2Q A;  1XZQ A;  1YAU O;  3R2P A;  4U5G A;  4MVQ A;  4BJ1 A;  2KJG A;  2NUT B;  1JPN A;  3EGD B;  1H9G A;  5E3A A;  5E33 A;  3L8J A;  2EPN A;  3OA1 A;  5A6B D;  1E85 A;  4UDV A;  3HNI A;  3MLG A;  4CS7 A;  1MMA A;  2BL2 A;  2J9V A;  3M79 A;  1FMW A;  2MWQ A;  4JZA A;  2HKV A;  1BDJ B;  2LFF A;  2YL3 A;  1Z7Q c;  3IHU A;  5EK0 A;  2YL1 A;  4DXW A;  2VAS A;  2R7V A;  1TFO B;  1Q0K A;  4FES A;  4ANJ A;  1CGO A;  3RH3 A;  2UUH A;  4YN0 B;  2AU5 A;  2XLE A;  1KU2 A;  1TQG A;  1YJG A;  4ZLD A;  2QTV A;  2DI3 A;  5AC5 A;  2XLO A;  4ULV A;  3FMS A;  3V5Y A;  3S28 A;  1SR2 A;  3GEH A;  1C03 A;  3BEH A;  4BJ6 C;  3TOL A;  1JPJ A;  2KC3 A;  1TR2 A;  3IQC A;  3W8H A;  4CSA C;  1FNT c;  2YL7 A;  4W8P A;  3ZTM A;  4AE4 A;  4XLP F;  3GOR A;  3FAP B;  2LP4 A;  3GEI A;  1LM3 B;  2A6E F;  2M64 A;  3LUT B;  1T6Q A;  2KQ9 A;  1RMV A;  5L3Q A;  4NC3 A;  2OQM A;  2P7V A;  2AP3 A;  2B0H A;  4C7O A;  3LLI A;  4ONS A;  1YA9 A;  3NYM A;  3SEO A;  4XEV A;  3ZQY A;  3HKK A;  1GQA A;  4JCH A;  4C3D A;  1VMA A;  1FR0 A;  1OQC A;  1G4U S;  3K1H A;  2WB7 A;  3JRM O;  3AQB A;  3KKB A;  2OG2 A;  5BQH A;  1RKE A;  1TFK B;  4FAP B;  5IY5 C;  5L0I A;  4PJL A;  1OKK D;  3ATP A;  2A0U A;  3NMJ A;  3Q6N A;  4RDA A;  4U5E E;  5HV9 A;  3UGP A;  2V26 A;  4G7Z F;  3TOM A;  1WN0 A;  2HMQ A;  3NKE A;  1IW7 F;  4K0D A;  4KNV A;  4NQF A;  2R25 A;  5KYX A;  1ZZP A;  1DOW A;  4DVZ A;  1NBB A;  1SMY F;  4NCQ A;  2IOQ A;  1G5Z A;  2CNW D;  2LFD A;  3SNH A;  5A6A A;  2XSE A;  4Q4Z F;  3DKA A;  1A7V A;  4WGY A;  3UMK A;  3S84 A;  1GM5 A;  1K40 A;  4N6H A;  1FFH A;  2A68 F;  5B1A C;  4N4W A;  4ZLC A;  3C18 A;  4IGG A;  3EGX A;  1OW8 A;  1I4Z A;  3TD7 A;  2HSQ A;  1ZHZ A;  3EHM A;  4JCZ A;  5CI8 A;  1OCZ C;  1MNE A;  4BJ6 A;  1M2O A;  1YYX A;  2GAQ A;  4IJJ A;  4BPM A;  4OIP F;  4CSA A;  2KNH A;  3K33 A;  3NRH A;  3NYJ A;  1VTM P;  4AX2 A;  4PK4 A;  2OKU A;  3I5P A;  5A6K A;  3KYJ A;  3LNR A;  1XZP A;  3T6B A;  2Y3D A;  4IAQ A;  4P6I C;  1GGQ A;  2KW3 C;  2R7Q A;  3QW0 A;  4U5B E;  1VYI A;  4Z9I A;  5HSW A;  2L6G A;  1HY5 A;  3B29 A;  1EI7 A;  2GWW A;  3GM1 A;  3FVY A;  4IAR A;  1LE4 A;  2HV7 A;  3B71 A;  3NDB B;  1Y4C A;  3RIP A;  1D1C A;  3V5X A;  2Q9C A;  1SF8 A;  4BEM J;  3C63 A;  1E83 A;  4JJG A;  3NMI A;  1TKN A;  4MVM A;  4CIH A;  4J7T A;  3EZI A;  1J8M F;  3GAN A;  3KPH A;  1Z3I X;  3U8P A;  2O9X A;  3EH2 A;  2C04 A;  2A0B A;  1A7E A;  2J45 A;  2Q9A A;  5T3T A;  5KYW B;  3FXH A;  1QKR A;  3DJN B;  3KYI A;  3B9Q A;  1ZVZ A;  5F5F A;  2VH3 A;  1JOG A;  1YLM A;  4JKV A;  2IBF A;  5JSL A;  3QTH A;  3ZG1 A;  4D4N A;  4ER9 A;  3QVY A;  4CS9 A;  1APC A;  1ZW2 A;  1Y6D A;  2HSB A;  5AGF A;  5EGY A;  4HFF B;  3DE9 A;  1UFB A;  2J46 A;  3JSE O;  1D0Z A;  3GWL A;  2I8B A;  1NFN A;  1LE2 A;  4JTA B;  4WGZ A;  4OIN F;  1TWG A;  2ZXP A;  3CSK A;  1C17 M;  1WAS A;  4DVY P;  2J0X A;  3ABL C;  1LS1 A;  2X51 A;  3ABK C;  2EIM C;  2G3K A;  4AE4 B;  3DWW A;  3ZIB A;  5JVE A;  3PCV A;  2YVK A;  4JTC B;  4LDQ A;  4OIQ F;  4JIO A;  1RXQ A;  4PJN A;  3HNJ A;  3ZQV A;  2I15 A;  1FFT C;  1Z63 A;  1ZHT A;  2QY9 A; 
#chains in the Genus database with same CATH homology
 1CGO A;  2YL0 A;  1MQV A;  2XLE A;  2XL8 A;  2XLO A;  4ULV A;  5B3I A;  3FOO A;  3TOL A;  3IQ5 A;  4CX9 A;  3VRC A;  2YL7 A;  3ZTM A;  4U9D A;  4CIP A;  1LM3 B;  3IQ6 A;  1E86 A;  4NC3 A;  4CDA A;  4IB4 A;  3M4B A;  4L6R A;  1S05 A;  4CJO A;  4JEA A;  3ZTZ A;  3ZQY A;  1GQA A;  2QLA A;  1JAF A;  2XLV A;  1EKY A;  5JLI A;  4EIY A;  1BBH A;  2XM0 A;  3NMJ A;  3TOM A;  5JS5 A;  2XLD A;  2BC5 A;  2XLH A;  1NBB A;  3DE8 A;  4D4X A;  1A7V A;  2XLM A;  4WGY A;  2J8W A;  4CDV A;  256B A;  4N6H A;  1CPR A;  4N4W A;  1YZA A;  2XM4 A;  3C62 A;  1YYX A;  3NMK A;  3M4C A;  4CDY A;  4JEB A;  3M15 A;  2YLI A;  1CPQ A;  1YYJ A;  1YZC A;  5JRA A;  4IAQ A;  1E84 A;  3QW0 A;  3HNK A;  1QQ3 A;  4IAR A;  3ZWI A;  3C63 A;  1E83 A;  3NMI A;  2YLG A;  5JUA A;  2YLD A;  3QW1 A;  3U8P A;  5JT4 A;  3L1M A;  1QPU A;  2J9B A;  1RCP A;  2YKZ A;  2CCY A;  4JE9 A;  1CGN A;  3HNL A;  4JKV A;  5JSL A;  4D4N A;  4ER9 A;  3QVY A;  4U9E A;  1APC A;  3FOP A;  5AGF A;  3DE9 A;  2XL6 A;  4WGZ A;  1M6T A;  5JP7 A;  5JVE A;  1E85 A;  3HNI A;  3M79 A;  3HNJ A;  3QVZ A;  2YL3 A;  3ZQV A;  2XLW A;  2YL1 A;  4CJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...