4D4XA

Nitrosyl complex of the d121i variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHIAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4xA00
4NC3A 2YL3A 3FOPA 3QW0A 4CDAA 4JEBA 4D4XA 1YZAA 3M4BA 3ZTMA 1CPQA 2XLWA 3ZWIA 1CPRA 3FOOA 4ER9A 4CDVA 3HNKA 3TOLA 4ULVA 3IQ6A 256BA 3C63A 1YYXA 2YLDA 4L6RA 5JS5A 4WGZA 1BBHA 1YYJA 1QQ3A 5JRAA 2YLIA 1E84A 4EIYA 5JSLA 1JAFA 1S05A 5JP7A 1EKYA 4CDYA 3HNLA 1E85A 4U9EA 2XL6A 4CJOA 5JLIA 3M15A 2XM0A 2BC5A 3C62A 1E83A 5JT4A 4N4WA 4IAQA 3QW1A 3HNJA 3QVYA 2XL8A 2YL7A 3IQ5A 5B3IA 3M4CA 3TOMA 2XLOA 5AGFA 1CGOA 2XM4A 1A7VA 5JVEA 1RCPA 1NBBA 2J9BA 3ZQVA 2XLDA 2CCYA 2YL0A 3HNIA 3U8PA 4U9DA 3NMIA 3DE8A 2YLGA 1MQVA 1M6TA 2XLMA 3VRCA 4N6HA 3NMJA 4WGYA 4IARA 4D4NA 2YL1A 1LM3B 4CX9A 3QVZA 2XLHA 4JEAA 1GQAA 1E86A 3ZTZA 2YKZA 4JKVA 5JUAA 1QPUA 4CIPA 2XLVA 2QLAA 3DE9A 4CJGA 1CGNA 1YZCA 4JE9A 3L1MA 3M79A 2J8WA 2XLEA 1APCA 4IB4A 3NMKA 3ZQYA
chains in the Genus database with same CATH superfamily
4C3BA 3DWWA 3K33A 4JTAB 4P9TA 1OKKA 4OD5A 2YHSA 1Q0DA 2WZLA 3FOPA 4IWBA 2LIGA 4BEJA 4CIHA 4YL1A 3UMKA 4U5BE 2IM8A 3K1IC 2A68F 2KSFA 3ZSUA 3ASNC 1CPQA 3ZWIA 3DAFA 1QZXA 2NSGA 3SXKA 1M57C 3J06A 1IZMA 3U2MA 1ORJA 2P61A 5L3QA 4CS8A 3LESA 4CDVA 1OR2A 4DBRA 3HNKA 3TOLA 3S9OA 4OIOF 3NYMA 2VC9A 3FXHA 3I5PA 2R7OA 2XXAB 3ECSA 3CAXA 3SXMA 1T9KA 3K7DA 5B1AC 1NFOA 2CW0F 1XZQA 2M64A 4CBEA 1V54C 3A11A 2CDQA 3ITFA 3AG2C 3N0TA 3RQFA 1W2WA 3H2UA 4PK4A 2ASRA 4FWVA 1BR1A 2GDCA 3AGUA 3FAJA 4W8PA 4JW1A 2AVKA 3AJMA 3ABMC 3C8GA 3JZ0A 1K40A 4YN0B 2AWYA 3HTKC 4AX2A 5JRAA 2Q00A 2MWQA 4G78A 2FGYA 1WASA 1MNEA 2P1AA 3GM3A 2A0UA 3FHDA 3Q7LA 2HFIA 5GPGB 1SZIA 3EQLF 3S28A 1FMVA 2ZXRA 2H7BA 4E17A 1WOLA 3F47A 2LFDA 1Q0GA 1OR3A 3VAYA 4BJ6A 1ZHWA 1JPNA 3RKOF 5DS4A 5BQHA 2Y3DA 3KMIA 3GODA 3M15A 4JTCB 2HS5A 1M2OA 2Q9CA 1G5ZA 4XQ1A 2XM0A 3VYWA 1A0BA 3U5SA 4XLNF 4JCZA 3B9QA 1O5HA 2IXMA 4N4WA 1BZ4A 1MMGA 2GAQA 5AC4A 2KW3C 5E2QA 2VASA 1H6GA 4I1OB 3GANA 3EH1A 4MVZA 4DRHB 5A69A 1PD0A 4YJWA 3DZAA 4A2NB 3IQ5A 2QUPA 2OJQA 4LACB 3AG4C 4WJ0A 3CZ6A 3W2VA 1OKKD 2IXOA 3O10A 4K7BA 2XM4A 2LFFA 3TK0A 1CGME 1LS4A 4J30B 4JVSA 3EGXB 2B0HA 2EINC 2CCYA 4BPMA 4U5EE 3DM5A 2HV6A 2UUHA 1ZZPA 4PR9A 3RYLA 2AP3A 3U9MA 5AC5A 2QE9A 3Q7GA 2X51A 3SP1A 1IW7F 5A6AA 3JYYA 1Q0KA 2R7WA 4AE4A 2YWAA 2Z15A 1SMYF 1JRAA 3V5XA 2EILC 3KH2A 1DOVA 1A7DA 1BR4A 2OG2A 2VCAA 2ZXOA 2DI3A 3GM1A 3QVZA 4JC7A 1D0XA 1TKNA 3AQCA 3TJ6A 2WVOA 4QDLA 3KPHA 3L8IA 3W2WA 1VLSA 2WVNA 1E86A 2NPUA 5E33A 2PX0A 3MX3A 2R7XA 1VTMP 1QPUA 4BJ6C 3S0XA 3EG9B 3T6JA 3S90A 1ZW2A 5A6JA 4K1OA 4FESA 4CJGA 2CNWD 2XS1A 1M2VA 1ZYRF 3GWNA 5A6KA 2J9UA 4NTFA 1HE9A 1WWPA 1T01A 4ANJA 4E7SA 1OQCA 2WZFA 1NFNA 2ZD9A 2EPMX 3VM6A 2EIKC 4OINF 4ZLDA 4MS2A 4XEKA 1O3UA 3BEHA 3B0UX 3MLGA 4NQFA 1RJ9B 3U0CA 2IXNA 1FFHA 1TR2A 3JYHA 3EZIA 3ZC4A 1AUEA 4D4XA 1YZAA 2XS8A 2R7TA 4K0DA 2L6GA 1KTMA 3L34A 3SYNA 2A0BA 4U5FE 3AG1C 4XPYA 3LAYA 4EBBA 3DMDA 2H7VC 2HSBA 4O6MA 1LS1A 3A9CA 4ER9A 2RSEB 3JRMO 1HMOA 4I44A 3LLIA 2Q7RA 1Z63A 2EPNA 2YRFA 4YT4A 5T1DB 4DBQA 4MVUA 3RQGA 4GYTA 1ZHTA 5KYWB 4PJLA 1OCCC 4QI2A 3US6A 3C63A 2EPLX 2ICWG 5KYXB 5EGYA 3PHF2 1T6UA 3V7OA 3JSZA 2YLDA 3EGDA 3LS0A 1XZPA 1SR2A 4L6RA 3U3BA 5L0HA 2JX0A 3EFOA 1HMDA 3U2LA 1BBHA 1JR8A 3GEEA 4DOZA 2C04A 3E9VA 4MW3A 5D92A 3U8VA 2HMZA 1YA7O 4JJGA 2OJED 2YLIA 3CEXA 4XPXA 4C7OA 5JSLA 1JAFA 1S05A 3DJUB 3LNMB 4U5CE 5COMA 5JP7A 1VK5A 3ZVRA 2P7VA 1TQGA 3HNLA 5F28E 3QZCA 1E84A 1HW1A 2B0JA 3Q6MA 1WN0A 3RVYA 1T5OA 2A6HF 2JD3A 2LCHA 4KNWA 1V4AA 1TFKB 2G3KA 1Z5ZA 1E83A 2RD9A 5JT4A 2NUTA 5F5FA 2V26A 1LI5A 3O39A 5BUOA 1TWHA 3V5YA 4U5GA 1Q0MA 3HLZA 4KC9A 2R7RA 5KYWA 2Q4FA 4A4AA 2YL7A 4XEVA 2DYSC 3KYJA 2KGOA 4AK9A 5KYYB 5B3IA 5D91A 3G50A 4MNDA 4NCQA 4G0HA 4IJJA 1FTSA 1QSPA 1H9TA 3G4XA 3JTLO 3EZHA 2KNHA 3FVYA 5JVEA 1RCPA 2J7PD 1NBBA 5B3SC 2J9BA 4LDKA 5BQGA 4Q4ZF 2XLDA 1ZHXA 1VYKA 2YL0A 1FMWA 3RW0A 3GORA 3R7CA 2AU5A 1ZVZA 3DE8A 3SXZA 3T6GB 3T6BA 2MHRA 2OKUA 4BJ5C 3FDQA 2JPUA 1TWGA 3B0PA 4HEAJ 4IRUA 2NG1A 3X1OA 1ST6A 4Z9HA 1A41A 2NSFA 1PD1A 2Y3HA 3EJNA 3K66A 4WGYA 1OW7A 3DAGA 3C8ZA 3EHNA 4OIRF 3S27A 3ZDLA 4DVYP 3OEOA 1FR0A 2G62A 2Q9AA 2L7AA 4YL0A 1GM5A 1Z3IX 4MTOA 4DXWA 3NRHA 4CX9A 1H9GA 5EHHA 5A6BD 3U9JA 1HY5A 1G8XA 1AVOB 2OEXA 4JEAA 3V5ZA 3SZRA 3C8GB 3ZIBA 3N24A 4AL0A 4FAPB 1LPEA 4YWQA 2FAPB 5JUAA 3U3FA 1XWJA 3TD7A 1GS9A 4RBNA 3L8JA 1TWCA 5COGA 2QLAA 3KYIA 2DB4A 1LIHA 1CGNA 3I4UA 1YZCA 5L0IA 1HE1A 1RKEB 5KYYA 1ORYA 4JE9A 4LDQA 3IEEA 4E7ZA 5L0FA 2I8BA 3M79A 2J8WA 4LLCA 5E3AA 5DQZA 3KL4A 1OCZC 3HJCA 1I5NA 4EBJA 1V55C 1RXQA 3JT1A 4U5DE 2D5RB 1OW6A 1J8YF 2HSQA 2PF4E 4GEHA 3K1HA 3JRTA 1VOMA 1YARO 2L81A 4JEBA 1WGWA 4B6IA 3M4BA 3CSKA 3ZTMA 1LI7A 5HV9A 4N6CA 4W8KA 4J7YA 2NUPA 3ABKC 2HKVA 3K1IA 1CPRA 4DVZA 5KYNA 3VF0A 4O6YA 3FOOA 1R5ID 3LUTB 1U6HA 2OEVA 3ATPA 2H7OA 3SXYA 2P0NA 3FAPB 5CIVA 2VB6A 2LP4A 4KNVA 4JRZA 5COFA 5L0DA 4E18A 3W8HA 4YT2A 1AEPA 3Q6NA 2PNOA 4MVRA 3DM9B 2R9RB 3KKBA 1BDJB 2FFHA 4XLPF 3UMIA 4G7ZF 4ULVA 3UGPA 4J7TA 4OIPF 3IQ6A 3ZQYA 5B1BC 2W45A 1YYXA 1C02A 1ZU5A 4I3MA 2KQ9A 4C7OB 2QNLA 1D1BA 1G4WR 3C8GD 3NKDA 4EUKB 2Y39A 1OXKA 1D1AA 2W9YA 2OQMA 4QI0A 4MTFA 4UDVA 2D4UA 4O79A 1E2XA 1MNDA 2DYRC 1PCXA 2HUJA 3R2PA 4MTGA 2XRHA 3T9OA 4EIYA 4P9FA 4E0IA 1EKYA 3POVA 1D0YA 1PV3A 4CDYA 1E85A 1QKRA 1DOWA 1YLMA 1Z6AA 3EG9A 4U9EA 5JLIA 1O87A 3DXJF 3NDBB 1RMVA 1JOGA 2YEVA 3W8IA 4BJ5A 4G7OF 3EGXA 2HZ8A 2H8AA 2R25A 2W4MA 3M1CB 1MMNA 4I1MA 5DLJA 3QVYA 2EIMC 2TMVP 5F5HA 4PJJA 1A7EA 3JCUQ 3WODF 3B71A 2EIJC 4R32A 3M4CA 2Y3GA 4U5HA 3TOMA 2C03A 2XLOA 2ZPAA 2J9VA 2M4EA 4Q5SF 2J0WA 3MYIA 2VCCA 5AGFA 2KC3A 4Z9JA 4EWCA 3TULA 2WB7A 1CGOA 4CS7A 1A7VA 4NTBA 1LE2A 4KBLA 3AGTA 1H7IA 4H4KC 4CS9A 5FCLA 1RKCA 3HNIA 2L6HA 1ORSC 4MVOA 3AG3C 3GEIA 5DVWA 2G3VA 4CSAC 1JPJA 2OCCC 2QTVA 2YLGA 2YQYA 3LS1A 1NU9C 2XLMA 1Y6DA 3H65A 3VRCA 5K0IA 1TWAA 1KU2A 4IGGA 4N6HA 3PMRA 3NMJA 1NG1A 2R7UA 4IARA 4D4NA 1ZU4A 4NTAA 3S29A 3AOUA 1LM3B 4PACA 1Z7Qc 2HMQA 1J8MF 2MYSA 4X0RA 5TJ5E 4HE8D 3RH3A 1YAUO 3OWTA 3C7JA 2W4BA 1R4TA 3BRJA 3X2QC 2O9XA 3ZG1A 4XTKA 1B68A 3LNRA 3O55A 4DRIB 2IXPA 1K05A 4RD9A 4JKVA 1RJ9A 3SNHA 1T6QA 2R03A 4CIPA 1LE4A 2XLVA 3RVZA 1NU7D 4IAOA 3SEOA 2GWWA 3I5QA 4Q7CA 3LLKA 1Z23A 3MBGA 4J32B 1Q0FA 3RQEA 3GM2A 2R05A 1GGQA 4P6IC 1ZHYA 2XLEA 2PX3A 1YJGA 2KJGA 1G4US 1VLTA 2A69F 3PCVA 4PFPA 1WTYA 3NMKA 1OXBA 5DS5A 5CI8A 4MQ9F 4PJMA 4NC3A 4DJ9A 4MVQA 1M56C 1D1CA 2YL3A 4OIQF 2XL4A 2HJMA 3QW0A 3B29A 4CDAA 1YVIA 2F22A 3GEHA 1KNYA 2EPKX 4C3EA 2A1DD 2J46A 3JSEO 2Q3TA 1UFBA 2XLWA 3MYFA 4Z9IA 3RIPA 2J9WA 3EHMA 4JCHA 5IY5C 4CSAA 4CS8C 1MMDA 3C18A 2KK1A 2KYHA 4EHPA 1V74B 2R7QA 3RF3A 4CS9C 5L0CA 5L0JA 3MFNA 4M63A 1MMAA 3GWLA 2J0XA 4LERA 3EFOB 2X0CA 2WZGA 3WAQA 4AE4B 3IQTA 1YA9A 5DS6A 2ZXWC 1EI7A 1L3PA 2HV7A 2YZSA 2ZXPA 4DRJB 2QY9A 4EBKA 2BL2A 3L0IA 2R7VA 3DI5A 1C03A 256BA 3NYLA 2GA0A 4OD4A 4AL1A 3HKKA 4LLEA 4MW8A 3AQBA 4MVMA 4JTDB 5A6BA 4F4BA 3QTHA 4BJ1A 2XXAA 3DD7A 1U0BB 3CQZA 5JS5A 1NLXA 2PFDA 2Q9BA 2L6FA 3EH2A 4WGZA 3UMHA 1JMWA 5KYUB 1QQ3A 1YYJA 4FX5A 3UNGC 1OW8A 5HSWA 3IHUA 2CYDA 1UG7A 2CNWA 3F46A 2IOQA 4JZAA 3NKEA 1F1MA 4XEFA 5L0GA 2XL6A 4CJOA 3EGDB 3N2ZB 2Y69C 1FNTc 1QLEC 2AWCA 4GQHA 3S84A 1C17M 2J7PA 1WATA 2BC5A 3ASOC 3C62A 2I15A 4JJFA 4YK5A 2HJ3A 1RKEA 3WG7C 4EKWA 1I4ZA 4IAQA 3QW1A 1I4YA 5EK0A 1VMAA 4HFFB 3K6BA 1NSGB 3HNJA 3PDMP 1SYQA 4YL3A 1U89A 2XL8A 1FAPB 1OCRC 4NY3A 1TFOB 2OU6A 2LD6A 1EA8A 3ABLC 3OA1A 4O7GA 3NG1A 3IQCA 2XSEA 4ONSA 1Y4CA 4ZLCA 4MVSA 3O6XA 3G4ZA 1T6IA 3H2VA 2NUTB 3LEOA 1BR2A 5E3CA 5KYUA 2P6VA 3ZQVA 2Y3BA 3U8PA 4BJTA 3DJNB 3LEVA 4U9DA 5CI9A 1ZHZA 2LK4A 1N1CA 3NMIA 4HFKB 4LDRA 5T3WA 3T4RA 3RFYA 4PJNA 3WHNA 2PBEA 4H54A 4E0HA 2R7SA 2EPOA 3DKAA 1M6TA 1MQVA 3TJ5A 4BEMJ 4WABA 3FMSA 4JURI 2YVKA 2GFHA 2PP4A 5KYXA 2LQGA 3B0VC 1FFTC 1HW2A 1ZW3A 4C3DA 2YL1A 3E70C 4N06A 4O6NA 3UR3C 2V3CC 2E87A 3EPVA 5BQIA 2BE5F 2DGJA 4KI2A 2WVQA 1YDIA 2XLHA 4PFOA 1LVKA 4XPWA 1VB5A 4YT8A 3QMKA 1SF8A 2J45A 1GQAA 4ULWA 1LKXA 5FZTA 1NZEA 2VCBA 2IYLD 2WL8A 2YKZA 4YT5A 3ZTZA 3W4YA 2VH3A 5L3VA 2CGEA 1D0ZA 2ETSA 3UGOA 3DE9A 1QVXA 2IBFA 1OCOC 2LSEA 4G7HF 1L7CA 4JIOA 2OOCA 2NUPB 4RDAA 3TQOA 4BG0A 1VYIA 3LJBA 4XWJA 5T3TA 5DQTA 3IPMO 3L1MA 1EQ1A 2L9JA 1APCA 2R02A 1K04A 1S7ZA 2A6EF 4IB4A 3NYJA 2UUIA 1M2VB
chains in the Genus database with same CATH topology
4NC3A 2YL3A 3FOPA 3QW0A 4CDAA 4JEBA 4D4XA 1YZAA 3M4BA 3ZTMA 1CPQA 2XLWA 3ZWIA 1CPRA 3FOOA 4ER9A 4CDVA 3HNKA 3TOLA 4ULVA 3IQ6A 256BA 3C63A 1YYXA 2YLDA 4L6RA 5JS5A 4WGZA 1BBHA 1YYJA 1QQ3A 5JRAA 2YLIA 1E84A 4EIYA 5JSLA 1JAFA 1S05A 5JP7A 1EKYA 4CDYA 3HNLA 1E85A 4U9EA 2XL6A 4CJOA 5JLIA 3M15A 2XM0A 2BC5A 3C62A 1E83A 5JT4A 4N4WA 4IAQA 3QW1A 3HNJA 3QVYA 2XL8A 2YL7A 3IQ5A 5B3IA 3M4CA 3TOMA 2XLOA 5AGFA 1CGOA 2XM4A 1A7VA 5JVEA 1RCPA 1NBBA 2J9BA 3ZQVA 2XLDA 2CCYA 2YL0A 3HNIA 3U8PA 4U9DA 3NMIA 3DE8A 2YLGA 1MQVA 1M6TA 2XLMA 3VRCA 4N6HA 3NMJA 4WGYA 4IARA 4D4NA 2YL1A 1LM3B 4CX9A 3QVZA 2XLHA 4JEAA 1GQAA 1E86A 3ZTZA 2YKZA 4JKVA 5JUAA 1QPUA 4CIPA 2XLVA 2QLAA 3DE9A 4CJGA 1CGNA 1YZCA 4JE9A 3L1MA 3M79A 2J8WA 2XLEA 1APCA 4IB4A 3NMKA 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC3 A;  2YL3 A;  3FOP A;  3QW0 A;  4CDA A;  4JEB A;  4D4X A;  1YZA A;  3M4B A;  3ZTM A;  1CPQ A;  2XLW A;  3ZWI A;  1CPR A;  3FOO A;  4ER9 A;  4CDV A;  3HNK A;  3TOL A;  4ULV A;  3IQ6 A;  256B A;  3C63 A;  1YYX A;  2YLD A;  4L6R A;  5JS5 A;  4WGZ A;  1BBH A;  1YYJ A;  1QQ3 A;  5JRA A;  2YLI A;  1E84 A;  4EIY A;  5JSL A;  1JAF A;  1S05 A;  5JP7 A;  1EKY A;  4CDY A;  3HNL A;  1E85 A;  4U9E A;  2XL6 A;  4CJO A;  5JLI A;  3M15 A;  2XM0 A;  2BC5 A;  3C62 A;  1E83 A;  5JT4 A;  4N4W A;  4IAQ A;  3QW1 A;  3HNJ A;  3QVY A;  2XL8 A;  2YL7 A;  3IQ5 A;  5B3I A;  3M4C A;  3TOM A;  2XLO A;  5AGF A;  1CGO A;  2XM4 A;  1A7V A;  5JVE A;  1RCP A;  1NBB A;  2J9B A;  3ZQV A;  2XLD A;  2CCY A;  2YL0 A;  3HNI A;  3U8P A;  4U9D A;  3NMI A;  3DE8 A;  2YLG A;  1MQV A;  1M6T A;  2XLM A;  3VRC A;  4N6H A;  3NMJ A;  4WGY A;  4IAR A;  4D4N A;  2YL1 A;  1LM3 B;  4CX9 A;  3QVZ A;  2XLH A;  4JEA A;  1GQA A;  1E86 A;  3ZTZ A;  2YKZ A;  4JKV A;  5JUA A;  1QPU A;  4CIP A;  2XLV A;  2QLA A;  3DE9 A;  4CJG A;  1CGN A;  1YZC A;  4JE9 A;  3L1M A;  3M79 A;  2J8W A;  2XLE A;  1APC A;  4IB4 A;  3NMK A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 4C3B A;  3DWW A;  3K33 A;  4JTA B;  4P9T A;  1OKK A;  4OD5 A;  2YHS A;  1Q0D A;  2WZL A;  3FOP A;  4IWB A;  2LIG A;  4BEJ A;  4CIH A;  4YL1 A;  3UMK A;  4U5B E;  2IM8 A;  3K1I C;  2A68 F;  2KSF A;  3ZSU A;  3ASN C;  1CPQ A;  3ZWI A;  3DAF A;  1QZX A;  2NSG A;  3SXK A;  1M57 C;  3J06 A;  1IZM A;  3U2M A;  1ORJ A;  2P61 A;  5L3Q A;  4CS8 A;  3LES A;  4CDV A;  1OR2 A;  4DBR A;  3HNK A;  3TOL A;  3S9O A;  4OIO F;  3NYM A;  2VC9 A;  3FXH A;  3I5P A;  2R7O A;  2XXA B;  3ECS A;  3CAX A;  3SXM A;  1T9K A;  3K7D A;  5B1A C;  1NFO A;  2CW0 F;  1XZQ A;  2M64 A;  4CBE A;  1V54 C;  3A11 A;  2CDQ A;  3ITF A;  3AG2 C;  3N0T A;  3RQF A;  1W2W A;  3H2U A;  4PK4 A;  2ASR A;  4FWV A;  1BR1 A;  2GDC A;  3AGU A;  3FAJ A;  4W8P A;  4JW1 A;  2AVK A;  3AJM A;  3ABM C;  3C8G A;  3JZ0 A;  1K40 A;  4YN0 B;  2AWY A;  3HTK C;  4AX2 A;  5JRA A;  2Q00 A;  2MWQ A;  4G78 A;  2FGY A;  1WAS A;  1MNE A;  2P1A A;  3GM3 A;  2A0U A;  3FHD A;  3Q7L A;  2HFI A;  5GPG B;  1SZI A;  3EQL F;  3S28 A;  1FMV A;  2ZXR A;  2H7B A;  4E17 A;  1WOL A;  3F47 A;  2LFD A;  1Q0G A;  1OR3 A;  3VAY A;  4BJ6 A;  1ZHW A;  1JPN A;  3RKO F;  5DS4 A;  5BQH A;  2Y3D A;  3KMI A;  3GOD A;  3M15 A;  4JTC B;  2HS5 A;  1M2O A;  2Q9C A;  1G5Z A;  4XQ1 A;  2XM0 A;  3VYW A;  1A0B A;  3U5S A;  4XLN F;  4JCZ A;  3B9Q A;  1O5H A;  2IXM A;  4N4W A;  1BZ4 A;  1MMG A;  2GAQ A;  5AC4 A;  2KW3 C;  5E2Q A;  2VAS A;  1H6G A;  4I1O B;  3GAN A;  3EH1 A;  4MVZ A;  4DRH B;  5A69 A;  1PD0 A;  4YJW A;  3DZA A;  4A2N B;  3IQ5 A;  2QUP A;  2OJQ A;  4LAC B;  3AG4 C;  4WJ0 A;  3CZ6 A;  3W2V A;  1OKK D;  2IXO A;  3O10 A;  4K7B A;  2XM4 A;  2LFF A;  3TK0 A;  1CGM E;  1LS4 A;  4J30 B;  4JVS A;  3EGX B;  2B0H A;  2EIN C;  2CCY A;  4BPM A;  4U5E E;  3DM5 A;  2HV6 A;  2UUH A;  1ZZP A;  4PR9 A;  3RYL A;  2AP3 A;  3U9M A;  5AC5 A;  2QE9 A;  3Q7G A;  2X51 A;  3SP1 A;  1IW7 F;  5A6A A;  3JYY A;  1Q0K A;  2R7W A;  4AE4 A;  2YWA A;  2Z15 A;  1SMY F;  1JRA A;  3V5X A;  2EIL C;  3KH2 A;  1DOV A;  1A7D A;  1BR4 A;  2OG2 A;  2VCA A;  2ZXO A;  2DI3 A;  3GM1 A;  3QVZ A;  4JC7 A;  1D0X A;  1TKN A;  3AQC A;  3TJ6 A;  2WVO A;  4QDL A;  3KPH A;  3L8I A;  3W2W A;  1VLS A;  2WVN A;  1E86 A;  2NPU A;  5E33 A;  2PX0 A;  3MX3 A;  2R7X A;  1VTM P;  1QPU A;  4BJ6 C;  3S0X A;  3EG9 B;  3T6J A;  3S90 A;  1ZW2 A;  5A6J A;  4K1O A;  4FES A;  4CJG A;  2CNW D;  2XS1 A;  1M2V A;  1ZYR F;  3GWN A;  5A6K A;  2J9U A;  4NTF A;  1HE9 A;  1WWP A;  1T01 A;  4ANJ A;  4E7S A;  1OQC A;  2WZF A;  1NFN A;  2ZD9 A;  2EPM X;  3VM6 A;  2EIK C;  4OIN F;  4ZLD A;  4MS2 A;  4XEK A;  1O3U A;  3BEH A;  3B0U X;  3MLG A;  4NQF A;  1RJ9 B;  3U0C A;  2IXN A;  1FFH A;  1TR2 A;  3JYH A;  3EZI A;  3ZC4 A;  1AUE A;  4D4X A;  1YZA A;  2XS8 A;  2R7T A;  4K0D A;  2L6G A;  1KTM A;  3L34 A;  3SYN A;  2A0B A;  4U5F E;  3AG1 C;  4XPY A;  3LAY A;  4EBB A;  3DMD A;  2H7V C;  2HSB A;  4O6M A;  1LS1 A;  3A9C A;  4ER9 A;  2RSE B;  3JRM O;  1HMO A;  4I44 A;  3LLI A;  2Q7R A;  1Z63 A;  2EPN A;  2YRF A;  4YT4 A;  5T1D B;  4DBQ A;  4MVU A;  3RQG A;  4GYT A;  1ZHT A;  5KYW B;  4PJL A;  1OCC C;  4QI2 A;  3US6 A;  3C63 A;  2EPL X;  2ICW G;  5KYX B;  5EGY A;  3PHF 2;  1T6U A;  3V7O A;  3JSZ A;  2YLD A;  3EGD A;  3LS0 A;  1XZP A;  1SR2 A;  4L6R A;  3U3B A;  5L0H A;  2JX0 A;  3EFO A;  1HMD A;  3U2L A;  1BBH A;  1JR8 A;  3GEE A;  4DOZ A;  2C04 A;  3E9V A;  4MW3 A;  5D92 A;  3U8V A;  2HMZ A;  1YA7 O;  4JJG A;  2OJE D;  2YLI A;  3CEX A;  4XPX A;  4C7O A;  5JSL A;  1JAF A;  1S05 A;  3DJU B;  3LNM B;  4U5C E;  5COM A;  5JP7 A;  1VK5 A;  3ZVR A;  2P7V A;  1TQG A;  3HNL A;  5F28 E;  3QZC A;  1E84 A;  1HW1 A;  2B0J A;  3Q6M A;  1WN0 A;  3RVY A;  1T5O A;  2A6H F;  2JD3 A;  2LCH A;  4KNW A;  1V4A A;  1TFK B;  2G3K A;  1Z5Z A;  1E83 A;  2RD9 A;  5JT4 A;  2NUT A;  5F5F A;  2V26 A;  1LI5 A;  3O39 A;  5BUO A;  1TWH A;  3V5Y A;  4U5G A;  1Q0M A;  3HLZ A;  4KC9 A;  2R7R A;  5KYW A;  2Q4F A;  4A4A A;  2YL7 A;  4XEV A;  2DYS C;  3KYJ A;  2KGO A;  4AK9 A;  5KYY B;  5B3I A;  5D91 A;  3G50 A;  4MND A;  4NCQ A;  4G0H A;  4IJJ A;  1FTS A;  1QSP A;  1H9T A;  3G4X A;  3JTL O;  3EZH A;  2KNH A;  3FVY A;  5JVE A;  1RCP A;  2J7P D;  1NBB A;  5B3S C;  2J9B A;  4LDK A;  5BQG A;  4Q4Z F;  2XLD A;  1ZHX A;  1VYK A;  2YL0 A;  1FMW A;  3RW0 A;  3GOR A;  3R7C A;  2AU5 A;  1ZVZ A;  3DE8 A;  3SXZ A;  3T6G B;  3T6B A;  2MHR A;  2OKU A;  4BJ5 C;  3FDQ A;  2JPU A;  1TWG A;  3B0P A;  4HEA J;  4IRU A;  2NG1 A;  3X1O A;  1ST6 A;  4Z9H A;  1A41 A;  2NSF A;  1PD1 A;  2Y3H A;  3EJN A;  3K66 A;  4WGY A;  1OW7 A;  3DAG A;  3C8Z A;  3EHN A;  4OIR F;  3S27 A;  3ZDL A;  4DVY P;  3OEO A;  1FR0 A;  2G62 A;  2Q9A A;  2L7A A;  4YL0 A;  1GM5 A;  1Z3I X;  4MTO A;  4DXW A;  3NRH A;  4CX9 A;  1H9G A;  5EHH A;  5A6B D;  3U9J A;  1HY5 A;  1G8X A;  1AVO B;  2OEX A;  4JEA A;  3V5Z A;  3SZR A;  3C8G B;  3ZIB A;  3N24 A;  4AL0 A;  4FAP B;  1LPE A;  4YWQ A;  2FAP B;  5JUA A;  3U3F A;  1XWJ A;  3TD7 A;  1GS9 A;  4RBN A;  3L8J A;  1TWC A;  5COG A;  2QLA A;  3KYI A;  2DB4 A;  1LIH A;  1CGN A;  3I4U A;  1YZC A;  5L0I A;  1HE1 A;  1RKE B;  5KYY A;  1ORY A;  4JE9 A;  4LDQ A;  3IEE A;  4E7Z A;  5L0F A;  2I8B A;  3M79 A;  2J8W A;  4LLC A;  5E3A A;  5DQZ A;  3KL4 A;  1OCZ C;  3HJC A;  1I5N A;  4EBJ A;  1V55 C;  1RXQ A;  3JT1 A;  4U5D E;  2D5R B;  1OW6 A;  1J8Y F;  2HSQ A;  2PF4 E;  4GEH A;  3K1H A;  3JRT A;  1VOM A;  1YAR O;  2L81 A;  4JEB A;  1WGW A;  4B6I A;  3M4B A;  3CSK A;  3ZTM A;  1LI7 A;  5HV9 A;  4N6C A;  4W8K A;  4J7Y A;  2NUP A;  3ABK C;  2HKV A;  3K1I A;  1CPR A;  4DVZ A;  5KYN A;  3VF0 A;  4O6Y A;  3FOO A;  1R5I D;  3LUT B;  1U6H A;  2OEV A;  3ATP A;  2H7O A;  3SXY A;  2P0N A;  3FAP B;  5CIV A;  2VB6 A;  2LP4 A;  4KNV A;  4JRZ A;  5COF A;  5L0D A;  4E18 A;  3W8H A;  4YT2 A;  1AEP A;  3Q6N A;  2PNO A;  4MVR A;  3DM9 B;  2R9R B;  3KKB A;  1BDJ B;  2FFH A;  4XLP F;  3UMI A;  4G7Z F;  4ULV A;  3UGP A;  4J7T A;  4OIP F;  3IQ6 A;  3ZQY A;  5B1B C;  2W45 A;  1YYX A;  1C02 A;  1ZU5 A;  4I3M A;  2KQ9 A;  4C7O B;  2QNL A;  1D1B A;  1G4W R;  3C8G D;  3NKD A;  4EUK B;  2Y39 A;  1OXK A;  1D1A A;  2W9Y A;  2OQM A;  4QI0 A;  4MTF A;  4UDV A;  2D4U A;  4O79 A;  1E2X A;  1MND A;  2DYR C;  1PCX A;  2HUJ A;  3R2P A;  4MTG A;  2XRH A;  3T9O A;  4EIY A;  4P9F A;  4E0I A;  1EKY A;  3POV A;  1D0Y A;  1PV3 A;  4CDY A;  1E85 A;  1QKR A;  1DOW A;  1YLM A;  1Z6A A;  3EG9 A;  4U9E A;  5JLI A;  1O87 A;  3DXJ F;  3NDB B;  1RMV A;  1JOG A;  2YEV A;  3W8I A;  4BJ5 A;  4G7O F;  3EGX A;  2HZ8 A;  2H8A A;  2R25 A;  2W4M A;  3M1C B;  1MMN A;  4I1M A;  5DLJ A;  3QVY A;  2EIM C;  2TMV P;  5F5H A;  4PJJ A;  1A7E A;  3JCU Q;  3WOD F;  3B71 A;  2EIJ C;  4R32 A;  3M4C A;  2Y3G A;  4U5H A;  3TOM A;  2C03 A;  2XLO A;  2ZPA A;  2J9V A;  2M4E A;  4Q5S F;  2J0W A;  3MYI A;  2VCC A;  5AGF A;  2KC3 A;  4Z9J A;  4EWC A;  3TUL A;  2WB7 A;  1CGO A;  4CS7 A;  1A7V A;  4NTB A;  1LE2 A;  4KBL A;  3AGT A;  1H7I A;  4H4K C;  4CS9 A;  5FCL A;  1RKC A;  3HNI A;  2L6H A;  1ORS C;  4MVO A;  3AG3 C;  3GEI A;  5DVW A;  2G3V A;  4CSA C;  1JPJ A;  2OCC C;  2QTV A;  2YLG A;  2YQY A;  3LS1 A;  1NU9 C;  2XLM A;  1Y6D A;  3H65 A;  3VRC A;  5K0I A;  1TWA A;  1KU2 A;  4IGG A;  4N6H A;  3PMR A;  3NMJ A;  1NG1 A;  2R7U A;  4IAR A;  4D4N A;  1ZU4 A;  4NTA A;  3S29 A;  3AOU A;  1LM3 B;  4PAC A;  1Z7Q c;  2HMQ A;  1J8M F;  2MYS A;  4X0R A;  5TJ5 E;  4HE8 D;  3RH3 A;  1YAU O;  3OWT A;  3C7J A;  2W4B A;  1R4T A;  3BRJ A;  3X2Q C;  2O9X A;  3ZG1 A;  4XTK A;  1B68 A;  3LNR A;  3O55 A;  4DRI B;  2IXP A;  1K05 A;  4RD9 A;  4JKV A;  1RJ9 A;  3SNH A;  1T6Q A;  2R03 A;  4CIP A;  1LE4 A;  2XLV A;  3RVZ A;  1NU7 D;  4IAO A;  3SEO A;  2GWW A;  3I5Q A;  4Q7C A;  3LLK A;  1Z23 A;  3MBG A;  4J32 B;  1Q0F A;  3RQE A;  3GM2 A;  2R05 A;  1GGQ A;  4P6I C;  1ZHY A;  2XLE A;  2PX3 A;  1YJG A;  2KJG A;  1G4U S;  1VLT A;  2A69 F;  3PCV A;  4PFP A;  1WTY A;  3NMK A;  1OXB A;  5DS5 A;  5CI8 A;  4MQ9 F;  4PJM A;  4NC3 A;  4DJ9 A;  4MVQ A;  1M56 C;  1D1C A;  2YL3 A;  4OIQ F;  2XL4 A;  2HJM A;  3QW0 A;  3B29 A;  4CDA A;  1YVI A;  2F22 A;  3GEH A;  1KNY A;  2EPK X;  4C3E A;  2A1D D;  2J46 A;  3JSE O;  2Q3T A;  1UFB A;  2XLW A;  3MYF A;  4Z9I A;  3RIP A;  2J9W A;  3EHM A;  4JCH A;  5IY5 C;  4CSA A;  4CS8 C;  1MMD A;  3C18 A;  2KK1 A;  2KYH A;  4EHP A;  1V74 B;  2R7Q A;  3RF3 A;  4CS9 C;  5L0C A;  5L0J A;  3MFN A;  4M63 A;  1MMA A;  3GWL A;  2J0X A;  4LER A;  3EFO B;  2X0C A;  2WZG A;  3WAQ A;  4AE4 B;  3IQT A;  1YA9 A;  5DS6 A;  2ZXW C;  1EI7 A;  1L3P A;  2HV7 A;  2YZS A;  2ZXP A;  4DRJ B;  2QY9 A;  4EBK A;  2BL2 A;  3L0I A;  2R7V A;  3DI5 A;  1C03 A;  256B A;  3NYL A;  2GA0 A;  4OD4 A;  4AL1 A;  3HKK A;  4LLE A;  4MW8 A;  3AQB A;  4MVM A;  4JTD B;  5A6B A;  4F4B A;  3QTH A;  4BJ1 A;  2XXA A;  3DD7 A;  1U0B B;  3CQZ A;  5JS5 A;  1NLX A;  2PFD A;  2Q9B A;  2L6F A;  3EH2 A;  4WGZ A;  3UMH A;  1JMW A;  5KYU B;  1QQ3 A;  1YYJ A;  4FX5 A;  3UNG C;  1OW8 A;  5HSW A;  3IHU A;  2CYD A;  1UG7 A;  2CNW A;  3F46 A;  2IOQ A;  4JZA A;  3NKE A;  1F1M A;  4XEF A;  5L0G A;  2XL6 A;  4CJO A;  3EGD B;  3N2Z B;  2Y69 C;  1FNT c;  1QLE C;  2AWC A;  4GQH A;  3S84 A;  1C17 M;  2J7P A;  1WAT A;  2BC5 A;  3ASO C;  3C62 A;  2I15 A;  4JJF A;  4YK5 A;  2HJ3 A;  1RKE A;  3WG7 C;  4EKW A;  1I4Z A;  4IAQ A;  3QW1 A;  1I4Y A;  5EK0 A;  1VMA A;  4HFF B;  3K6B A;  1NSG B;  3HNJ A;  3PDM P;  1SYQ A;  4YL3 A;  1U89 A;  2XL8 A;  1FAP B;  1OCR C;  4NY3 A;  1TFO B;  2OU6 A;  2LD6 A;  1EA8 A;  3ABL C;  3OA1 A;  4O7G A;  3NG1 A;  3IQC A;  2XSE A;  4ONS A;  1Y4C A;  4ZLC A;  4MVS A;  3O6X A;  3G4Z A;  1T6I A;  3H2V A;  2NUT B;  3LEO A;  1BR2 A;  5E3C A;  5KYU A;  2P6V A;  3ZQV A;  2Y3B A;  3U8P A;  4BJT A;  3DJN B;  3LEV A;  4U9D A;  5CI9 A;  1ZHZ A;  2LK4 A;  1N1C A;  3NMI A;  4HFK B;  4LDR A;  5T3W A;  3T4R A;  3RFY A;  4PJN A;  3WHN A;  2PBE A;  4H54 A;  4E0H A;  2R7S A;  2EPO A;  3DKA A;  1M6T A;  1MQV A;  3TJ5 A;  4BEM J;  4WAB A;  3FMS A;  4JUR I;  2YVK A;  2GFH A;  2PP4 A;  5KYX A;  2LQG A;  3B0V C;  1FFT C;  1HW2 A;  1ZW3 A;  4C3D A;  2YL1 A;  3E70 C;  4N06 A;  4O6N A;  3UR3 C;  2V3C C;  2E87 A;  3EPV A;  5BQI A;  2BE5 F;  2DGJ A;  4KI2 A;  2WVQ A;  1YDI A;  2XLH A;  4PFO A;  1LVK A;  4XPW A;  1VB5 A;  4YT8 A;  3QMK A;  1SF8 A;  2J45 A;  1GQA A;  4ULW A;  1LKX A;  5FZT A;  1NZE A;  2VCB A;  2IYL D;  2WL8 A;  2YKZ A;  4YT5 A;  3ZTZ A;  3W4Y A;  2VH3 A;  5L3V A;  2CGE A;  1D0Z A;  2ETS A;  3UGO A;  3DE9 A;  1QVX A;  2IBF A;  1OCO C;  2LSE A;  4G7H F;  1L7C A;  4JIO A;  2OOC A;  2NUP B;  4RDA A;  3TQO A;  4BG0 A;  1VYI A;  3LJB A;  4XWJ A;  5T3T A;  5DQT A;  3IPM O;  3L1M A;  1EQ1 A;  2L9J A;  1APC A;  2R02 A;  1K04 A;  1S7Z A;  2A6E F;  4IB4 A;  3NYJ A;  2UUI A;  1M2V B; 
#chains in the Genus database with same CATH homology
 4NC3 A;  2YL3 A;  3FOP A;  3QW0 A;  4CDA A;  4JEB A;  4D4X A;  1YZA A;  3M4B A;  3ZTM A;  1CPQ A;  2XLW A;  3ZWI A;  1CPR A;  3FOO A;  4ER9 A;  4CDV A;  3HNK A;  3TOL A;  4ULV A;  3IQ6 A;  256B A;  3C63 A;  1YYX A;  2YLD A;  4L6R A;  5JS5 A;  4WGZ A;  1BBH A;  1YYJ A;  1QQ3 A;  5JRA A;  2YLI A;  1E84 A;  4EIY A;  5JSL A;  1JAF A;  1S05 A;  5JP7 A;  1EKY A;  4CDY A;  3HNL A;  1E85 A;  4U9E A;  2XL6 A;  4CJO A;  5JLI A;  3M15 A;  2XM0 A;  2BC5 A;  3C62 A;  1E83 A;  5JT4 A;  4N4W A;  4IAQ A;  3QW1 A;  3HNJ A;  3QVY A;  2XL8 A;  2YL7 A;  3IQ5 A;  5B3I A;  3M4C A;  3TOM A;  2XLO A;  5AGF A;  1CGO A;  2XM4 A;  1A7V A;  5JVE A;  1RCP A;  1NBB A;  2J9B A;  3ZQV A;  2XLD A;  2CCY A;  2YL0 A;  3HNI A;  3U8P A;  4U9D A;  3NMI A;  3DE8 A;  2YLG A;  1MQV A;  1M6T A;  2XLM A;  3VRC A;  4N6H A;  3NMJ A;  4WGY A;  4IAR A;  4D4N A;  2YL1 A;  1LM3 B;  4CX9 A;  3QVZ A;  2XLH A;  4JEA A;  1GQA A;  1E86 A;  3ZTZ A;  2YKZ A;  4JKV A;  5JUA A;  1QPU A;  4CIP A;  2XLV A;  2QLA A;  3DE9 A;  4CJG A;  1CGN A;  1YZC A;  4JE9 A;  3L1M A;  3M79 A;  2J8W A;  2XLE A;  1APC A;  4IB4 A;  3NMK A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...