4D4XA

Nitrosyl complex of the d121i variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHIAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4xA00
1CPRA 1YZAA 2XLWA 4N6HA 4IB4A 2YKZA 1YZCA 3TOLA 4CDYA 3TOMA 4CJOA 3ZQYA 2YL0A 3HNIA 4NC3A 2XLEA 1QQ3A 4L6RA 3HNLA 3NMJA 3M15A 3QW0A 1E83A 2XLDA 3DE8A 2XL8A 5JUAA 3IQ5A 2YL7A 3M4BA 3C62A 2XLMA 4D4XA 4N4WA 5JT4A 1YYJA 1A7VA 5AGFA 3FOOA 1YYXA 2CCYA 3ZQVA 1MQVA 4CDVA 2YLDA 3HNJA 3IQ6A 4ER9A 1E86A 1LM3B 1E85A 4IARA 2QLAA 5JP7A 1QPUA 2YLIA 3FOPA 4IAQA 4CIPA 3NMIA 3QVYA 256BA 1M6TA 2XL6A 1NBBA 2YL1A 2XM4A 4WGZA 4D4NA 2XLOA 5JS5A 2XM0A 3L1MA 4JEBA 5JLIA 3ZTMA 1GQAA 3QW1A 1EKYA 5JSLA 5B3IA 1JAFA 1RCPA 3C63A 1BBHA 4U9DA 3QVZA 3M4CA 3NMKA 4CX9A 2YL3A 1CPQA 2XLHA 1S05A 2J8WA 4JEAA 3VRCA 5JRAA 4EIYA 3ZWIA 3M79A 5JVEA 1E84A 3ZTZA 1CGNA 2YLGA 3U8PA 4CJGA 4WGYA 4ULVA 4JE9A 1APCA 4JKVA 2XLVA 3DE9A 4U9EA 3HNKA 1CGOA 4CDAA 2J9BA 2BC5A
chains in the Genus database with same CATH superfamily
3R7CA 1LI5A 4JJGA 4J7YA 3UMHA 1YZCA 4FWVA 1WASA 3DD7A 4CJOA 4DRHB 3DMDA 3VAYA 3ZQYA 4P6IC 2LD6A 1LS1A 4J30B 3FXHA 4M63A 4DJ9A 2R7WA 1D1AA 4O79A 2Q7RA 2MWQA 3EZIA 2UUIA 2HV7A 3RVYA 1LIHA 4XPXA 5BUOA 1L3PA 3U9MA 3CSKA 3LS0A 1VTMP 4OINF 4XEVA 1NFNA 2R7QA 5F5FA 2E87A 5JRAA 4W8KA 3NMJA 1O5HA 3Q7LA 1ZHZA 2G3KA 4P9FA 1K04A 4HE8D 4Q7CA 4W8PA 3T4RA 4BG0A 2Y39A 4JC7A 4EHPA 3KPHA 3DE8A 1V55C 1TWAA 2AP3A 2EPNA 2J0WA 2R9RB 4XLPF 1BR4A 2KNHA 5DQTA 4BPMA 3W8HA 3DWWA 1FNTc 1NFOA 3AG1C 4Z9HA 1UG7A 2YL7A 4PJNA 3RYLA 3S27A 5D91A 3SEOA 1HW2A 1EQ1A 1GGQA 1I5NA 2HZ8A 1ORYA 1WWPA 2XLMA 1GS9A 2YQYA 4N6CA 3A11A 5EGYA 5AGFA 5JT4A 1RJ9B 1MMNA 4Q4ZF 2NUTA 4MS2A 1ZW2A 2CCYA 4DRIB 1U0BB 4C3EA 3RQGA 1NLXA 1JPNA 2Q9AA 2YLDA 3IQ6A 4YT4A 1OKKD 4U5HA 3TK0A 1R5ID 1A0BA 4MTOA 1M2VB 3AJMA 3NKEA 3B0UX 1Z63A 3KL4A 4G78A 2OG2A 5KYYB 4E7ZA 5KYUB 4IARA 2GDCA 2QLAA 1YVIA 2P61A 2LFFA 2BE5F 5TJ5E 3SXYA 3BEHA 1QPUA 3H65A 4PJMA 1JOGA 4OIQF 4AX2A 1NSGB 3GWNA 2VB6A 1V4AA 4E0IA 2D4UA 3ZIBA 3O39A 1KU2A 2XL4A 4K7BA 1MMGA 1OR3A 4KBLA 2EILC 1F1MA 1G5ZA 3I4UA 2YL1A 3K6BA 3ZVRA 3EG9B 5DQZA 2HJMA 1YAUO 2B0JA 1C03A 1TWGA 2XLOA 2XM0A 3FDQA 3L1MA 3TJ5A 4GYTA 3GEHA 1ZHYA 3NYLA 1M57C 2J9VA 1ZVZA 5A6KA 2LP4A 4F4BA 4LDQA 3AQBA 1EKYA 4I1OB 3LEOA 5F28E 5E33A 2CNWD 1ORSC 2H7VC 1H9GA 1L7CA 4JCZA 2IM8A 2IYLD 3JZ0A 3MFNA 1OCRC 3MYFA 5T3TA 2A69F 3EQLF 2B0HA 4PR9A 2GFHA 2CYDA 2IXOA 3AOUA 2L9JA 3V5ZA 1H9TA 5CI9A 2J46A 3FHDA 1OW8A 2H8AA 3KMIA 3T6BA 5A6BD 1N1CA 1VMAA 3RIPA 4PJJA 1OXBA 3AG4C 3T9OA 3B29A 1S05A 1SR2A 2A1DD 3O10A 2PF4E 2YRFA 3EGDA 3GEEA 3OEOA 4JEAA 5E2QA 3ZDLA 3K7DA 2H7OA 5JVEA 2W4MA 3ZTZA 2BL2A 1PCXA 1CGNA 2Y3HA 2YLGA 3ASNC 3U8PA 3S9OA 1I4ZA 1BR1A 1LS4A 4KNVA 4LERA 4WGYA 3FAJA 3PCVA 3EZHA 3GANA 4RBNA 1KNYA 3DKAA 1FFTC 2OEVA 4JKVA 1APCA 1OW6A 1OKKA 3HKKA 4LDRA 2OCCC 2XLVA 4JZAA 4O6MA 1K40A 1LI7A 1UFBA 2JX0A 4MW3A 4MTFA 5CI8A 2X0CA 4AK9A 5L3VA 4AL1A 3TULA 1CGOA 2R03A 2WVNA 1CPRA 1YZAA 3CZ6A 1D1CA 1M2VA 3NDBB 4O7GA 3TOLA 3G50A 5DVWA 3TOMA 2HUJA 4MW8A 4CS8A 4OD4A 3WAQA 4XPYA 2DGJA 1ZU4A 5A69A 3HNIA 3LJBA 1KTMA 5DS4A 4IAOA 2HJ3A 4CIHA 3Q6MA 2VH3A 4G7OF 4L6RA 2VASA 1YA9A 4HFKB 2YEVA 1T6UA 4NTFA 1T5OA 5L0CA 4YL3A 2XS8A 3G4XA 1E83A 3K1HA 2R7XA 1SMYF 3EG9A 4H54A 4LLEA 5B3SC 4G7HF 2CNWA 3AGTA 3TJ6A 2GWWA 3TQOA 2XSEA 1V74B 3B71A 4BJ1A 5HSWA 2QY9A 2R7RA 4EBBA 3N0TA 4YT8A 4JTCB 2DB4A 3FAPB 4N06A 3U3FA 4H4KC 3UMKA 3DJUB 4N4WA 3ZSUA 3B0VC 3DAFA 4DBRA 2DYRC 3V7OA 1W2WA 1I4YA 3ZQVA 1MQVA 5COMA 4XWJA 4CDVA 3EGXA 5DS6A 5A6BA 3HNJA 1VK5A 3LUTB 2LQGA 3LNMB 4JW1A 3SXZA 3J06A 2Q4FA 2VCAA 1FTSA 3JT1A 2OOCA 2HV6A 5KYWA 4U5GA 2HFIA 5JP7A 1ZZPA 1Q0FA 3DJNB 4BJ5A 2EINC 3EGDB 1T01A 3S29A 3IPMO 4AE4A 2VCBA 3W2VA 3WG7C 2A68F 2WZLA 1D0XA 1LKXA 4KI2A 4Z9JA 3E9VA 3US6A 4E17A 5L0FA 4UDVA 2R7VA 1QSPA 1B68A 2WZFA 3B9QA 3G4ZA 1T6QA 1M6TA 2XL6A 4BEJA 2EIJC 1OXKA 4XEFA 3DAGA 1YDIA 3W2WA 1E2XA 1O87A 1D0YA 3L8JA 3I5PA 3U9JA 1S7ZA 2XS1A 2ZXWC 3MBGA 4WGZA 3VF0A 5EK0A 2YHSA 3E70C 4JEBA 1JPJA 2CW0F 2J45A 2J9WA 4U5FE 5JLIA 3UGPA 1Q0MA 3GEIA 3O55A 3JRMO 3LLIA 2XXAB 2WL8A 3AG3C 3EH2A 2ZD9A 4J32B 4LLCA 4YL0A 3GM2A 1JR8A 2LCHA 5JSLA 2YVKA 4LDKA 4MVUA 3K1IC 1PD1A 4OIRF 2R7UA 4O6YA 1A7EA 2UUHA 2KSFA 4CSAA 1TFOB 5CIVA 4PACA 5IY5C 1Y4CA 1BBHA 2R7OA 3SYNA 2C04A 2LIGA 1SZIA 3LEVA 3C8GD 3KYJA 1AEPA 4JVSA 1ZHWA 3BRJA 3DM5A 3CEXA 3EJNA 3NMKA 4NCQA 4PFPA 1MMAA 3VRCA 1Z6AA 1FMVA 4JURI 4E18A 4EIYA 3ZWIA 1EA8A 2EIKC 3M79A 1TWHA 2J9UA 1BDJB 2EPLX 4GQHA 4P9TA 3W8IA 4U5BE 1HE9A 1NU7D 2QTVA 2HS5A 2AVKA 1TWCA 5DS5A 1ZW3A 2AWYA 2G62A 3LS1A 4QI2A 1LPEA 4XLNF 3LNRA 4JE9A 3U0CA 3EGXB 2IXPA 2NUPA 4U9EA 5K0IA 3L8IA 4XPWA 1T6IA 2W45A 4ANJA 1IZMA 4BJ6A 4WJ0A 1TKNA 2F22A 4CS9A 4E7SA 3ABLC 4ULWA 5KYWB 2XLWA 3B0PA 3NRHA 4IB4A 1AUEA 4N6HA 4U5CE 2V26A 1H6GA 1FAPB 1HY5A 1U89A 2Y3DA 3UNGC 1K05A 4AE4B 3U5SA 2R02A 1QZXA 5F5HA 1IW7F 1D0ZA 3GWLA 4AL0A 1OCCC 4NC3A 1OR2A 4Z9IA 5BQHA 2D5RB 1QQ3A 5AC4A 2Y69C 2ZPAA 3H2UA 5A6JA 4YN0B 3FMSA 4XEKA 2PBEA 1JRAA 3L0IA 2EPOA 3VYWA 4IRUA 4HEAJ 4JTDB 2XLDA 3ATPA 3JYYA 4I44A 2XL8A 5GPGB 1QLEC 4CBEA 4A4AA 4MTGA 2JD3A 1YLMA 5JUAA 1ZHTA 3IQ5A 3U2LA 4Q5SF 1EI7A 4DVZA 2A0UA 2CDQA 2Y3GA 3C62A 1LE2A 3M1CB 4FX5A 4NY3A 2XXAA 4D4XA 2HSBA 2J0XA 3FOOA 3W4YA 1YYXA 2NSGA 4HFFB 3N24A 4RD9A 3V5YA 4CS9C 1Z3IX 4MVQA 5KYXB 4E0HA 4MNDA 3RKOF 2KGOA 3C8GA 3MX3A 3IHUA 4ER9A 4NQFA 3UR3C 4MVOA 3DXJF 1YARO 3I5QA 2ZXOA 1XZPA 4NTAA 2AWCA 2WVQA 3PMRA 1E86A 4DBQA 3DI5A 4MVSA 1OCZC 2P7VA 2MYSA 3CQZA 3OA1A 4EKWA 5HV9A 1CGME 1Z7Qc 1YA7O 4OIOF 3FOPA 3WHNA 4BEMJ 3GM3A 2KK1A 3SXMA 3DZAA 1AVOB 3F46A 2R25A 3K66A 256BA 2ETSA 2OJQA 4GEHA 3U3BA 2J7PD 4B6IA 2QE9A 4ZLCA 3GODA 1XZQA 5T3WA 2A0BA 1G4US 2HSQA 2VC9A 3S90A 1A7DA 1O3UA 3EHNA 3C7JA 1VB5A 2DYSC 2NUPB 5JS5A 1NU9C 5AC5A 2V3CC 3OWTA 3EPVA 3AGUA 2ICWG 4BJTA 1Q0KA 2IBFA 4DVYP 2R7TA 2QUPA 3QW1A 5E3CA 1M2OA 1JAFA 4JJFA 1VLTA 2I8BA 2QNLA 5A6AA 3ZC4A 2O9XA 4RDAA 3RF3A 1WTYA 2KJGA 4CS8C 4JIOA 3T6GB 1JMWA 4I1MA 1M56C 3S28A 1QKRA 3N2ZB 2OQMA 2PFDA 2XRHA 5COFA 1HE1A 1J8YF 3K1IA 3QZCA 3SZRA 1RKEB 5COGA 1FR0A 1V54C 3JSZA 3M4CA 1GM5A 3Q7GA 5B1AC 3SXKA 3CAXA 2XLHA 1TQGA 3KKBA 1SYQA 3RQEA 1E84A 2WVOA 2Y3BA 4EBKA 2FGYA 3QTHA 3PHF2 4CJGA 1HW1A 4EUKB 4U5EE 1G4WR 4ULVA 2Q9BA 1FFHA 4I3MA 5L0JA 3GM1A 1SF8A 4EBJA 1Q0DA 2M64A 3C18A 4IWBA 4EWCA 3DE9A 2C03A 2L7AA 2PP4A 2PX0A 3ABKC 4K1OA 3C8GB 4PFOA 1PD0A 2EPMX 2IXMA 3HNKA 4OD5A 5KYXA 3POVA 5B3IA 2J9BA 5D92A 4O6NA 4YWQA 1Z5ZA 2ASRA 2H7BA 5DLJA 2YKZA 3RQFA 2Q00A 2NSFA 1BR2A 4CDYA 4LACB 3T6JA 2WB7A 3UMIA 2LSEA 5L0GA 2YL0A 1VYKA 1RKCA 4C7OA 2W4BA 1HMDA 4OIPF 1D1BA 2J7PA 4BJ5C 4A2NB 4YT2A 3EHMA 2XLEA 4QI0A 1MMDA 4XQ1A 3ZG1A 1R4TA 2EPKX 2FFHA 2HMZA 3NKDA 4J7TA 4U5DE 1WOLA 1Y6DA 3DM9B 4JRZA 2PNOA 3HNLA 2A6EF 2ZXRA 3RFYA 3X2QC 3M15A 3AQCA 5L0DA 2W9YA 2CGEA 3QW0A 4ONSA 2FAPB 2PX3A 1DOWA 4FESA 2AU5A 4MVRA 2P0NA 3LLKA 4KC9A 2P1AA 4G7ZF 1DOVA 3IQTA 1ORJA 3R2PA 3U8VA 1RXQA 1ZYRF 3NYJA 2Z15A 1OW7A 1TR2A 2IXNA 3S0XA 3M4BA 5T1DB 1RMVA 2LFDA 2YZSA 1HMOA 2HMQA 2L6FA 3UGOA 4X0RA 3QMKA 4PJLA 2EIMC 1A7VA 1YYJA 3X1OA 4C3DA 4MVZA 4JCHA 2IOQA 3ASOC 4IJJA 3EFOA 3RVZA 2GAQA 1NG1A 3S84A 4CSAC 1TFKB 2OEXA 4WABA 3TD7A 3EH1A 3K33A 2JPUA 1LM3B 1E85A 3RW0A 4PK4A 3KYIA 4ZLDA 5FCLA 3SNHA 1RKEA 3HJCA 1LVKA 4YL1A 2NG1A 1OCOC 2M4EA 2OKUA 3ITFA 2YLIA 3VM6A 2KW3C 3JCUQ 5EHHA 5L0HA 4IAQA 4YJWA 1C02A 5B1BC 1QVXA 3NMIA 3V5XA 3QVYA 2OU6A 3SP1A 4CIPA 1G8XA 3MYIA 3A9CA 4DOZA 1MNDA 5FZTA 3HLZA 3IEEA 3JTLO 3LESA 3NG1A 4QDLA 4K0DA 2LK4A 3FVYA 4XTKA 3HTKC 4R32A 1NBBA 4CS7A 3IQCA 3JRTA 2XM4A 2DI3A 1NZEA 4D4NA 1U6HA 3L34A 4NTBA 2Q9CA 2P6VA 4FAPB 1FMWA 1ZHXA 2G3VA 2NPUA 4DRJB 3H2VA 2KQ9A 1OQCA 1VYIA 2MHRA 5E3AA 3ZTMA 1GQAA 4BJ6C 4MVMA 3ECSA 4JTAB 4YK5A 2NUTB 2WZGA 1RCPA 3KH2A 1T9KA 2A6HF 1YJGA 2YWAA 1J8MF 1RJ9A 3C63A 1Q0GA 3Q6NA 4KNWA 1LE4A 3JSEO 3U2MA 4C7OB 2R7SA 1BZ4A 4U9DA 3LAYA 3MLGA 2GA0A 3O6XA 1C17M 1A41A 1WATA 3QVZA 5KYNA 2TMVP 1ST6A 1VLSA 2X51A 2ZXPA 1VOMA 3C8ZA 4YT5A 4DXWA 4CX9A 5KYYA 2KYHA 2YL3A 5L3QA 5KYUA 5BQGA 1CPQA 3AG2C 3NYMA 3RH3A 4IGGA 1WN0A 2J8WA 1WGWA 3JYHA 1Z23A 3ABMC 1H7IA 3PDMP 1XWJA 1PV3A 3F47A 5L0IA 2L81A 2KC3A 2VCCA 2HKVA 1ZU5A 2R05A 2RSEB 2Q3TA 3EFOB 2I15A 1MNEA 2OJED 3WODF 4C3BA 2L6HA 2RD9A 2L6GA 3GORA 4CDAA 5BQIA 2BC5A 4MQ9F 4G0HA
chains in the Genus database with same CATH topology
1CPRA 1YZAA 2XLWA 4N6HA 4IB4A 2YKZA 1YZCA 3TOLA 4CDYA 3TOMA 4CJOA 3ZQYA 2YL0A 3HNIA 4NC3A 2XLEA 1QQ3A 4L6RA 3HNLA 3NMJA 3M15A 3QW0A 1E83A 2XLDA 3DE8A 2XL8A 5JUAA 3IQ5A 2YL7A 3M4BA 3C62A 2XLMA 4D4XA 4N4WA 5JT4A 1YYJA 1A7VA 5AGFA 3FOOA 1YYXA 2CCYA 3ZQVA 1MQVA 4CDVA 2YLDA 3HNJA 3IQ6A 4ER9A 1E86A 1LM3B 1E85A 4IARA 2QLAA 5JP7A 1QPUA 2YLIA 3FOPA 4IAQA 4CIPA 3NMIA 3QVYA 256BA 1M6TA 2XL6A 1NBBA 2YL1A 2XM4A 4WGZA 4D4NA 2XLOA 5JS5A 2XM0A 3L1MA 4JEBA 5JLIA 3ZTMA 1GQAA 3QW1A 1EKYA 5JSLA 5B3IA 1JAFA 1RCPA 3C63A 1BBHA 4U9DA 3QVZA 3M4CA 3NMKA 4CX9A 2YL3A 1CPQA 2XLHA 1S05A 2J8WA 4JEAA 3VRCA 5JRAA 4EIYA 3ZWIA 3M79A 5JVEA 1E84A 3ZTZA 1CGNA 2YLGA 3U8PA 4CJGA 4WGYA 4ULVA 4JE9A 1APCA 4JKVA 2XLVA 3DE9A 4U9EA 3HNKA 1CGOA 4CDAA 2J9BA 2BC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  1YZA A;  2XLW A;  4N6H A;  4IB4 A;  2YKZ A;  1YZC A;  3TOL A;  4CDY A;  3TOM A;  4CJO A;  3ZQY A;  2YL0 A;  3HNI A;  4NC3 A;  2XLE A;  1QQ3 A;  4L6R A;  3HNL A;  3NMJ A;  3M15 A;  3QW0 A;  1E83 A;  2XLD A;  3DE8 A;  2XL8 A;  5JUA A;  3IQ5 A;  2YL7 A;  3M4B A;  3C62 A;  2XLM A;  4D4X A;  4N4W A;  5JT4 A;  1YYJ A;  1A7V A;  5AGF A;  3FOO A;  1YYX A;  2CCY A;  3ZQV A;  1MQV A;  4CDV A;  2YLD A;  3HNJ A;  3IQ6 A;  4ER9 A;  1E86 A;  1LM3 B;  1E85 A;  4IAR A;  2QLA A;  5JP7 A;  1QPU A;  2YLI A;  3FOP A;  4IAQ A;  4CIP A;  3NMI A;  3QVY A;  256B A;  1M6T A;  2XL6 A;  1NBB A;  2YL1 A;  2XM4 A;  4WGZ A;  4D4N A;  2XLO A;  5JS5 A;  2XM0 A;  3L1M A;  4JEB A;  5JLI A;  3ZTM A;  1GQA A;  3QW1 A;  1EKY A;  5JSL A;  5B3I A;  1JAF A;  1RCP A;  3C63 A;  1BBH A;  4U9D A;  3QVZ A;  3M4C A;  3NMK A;  4CX9 A;  2YL3 A;  1CPQ A;  2XLH A;  1S05 A;  2J8W A;  4JEA A;  3VRC A;  5JRA A;  4EIY A;  3ZWI A;  3M79 A;  5JVE A;  1E84 A;  3ZTZ A;  1CGN A;  2YLG A;  3U8P A;  4CJG A;  4WGY A;  4ULV A;  4JE9 A;  1APC A;  4JKV A;  2XLV A;  3DE9 A;  4U9E A;  3HNK A;  1CGO A;  4CDA A;  2J9B A;  2BC5 A; 
#chains in the Genus database with same CATH topology
 3R7C A;  1LI5 A;  4JJG A;  4J7Y A;  3UMH A;  1YZC A;  4FWV A;  1WAS A;  3DD7 A;  4CJO A;  4DRH B;  3DMD A;  3VAY A;  3ZQY A;  4P6I C;  2LD6 A;  1LS1 A;  4J30 B;  3FXH A;  4M63 A;  4DJ9 A;  2R7W A;  1D1A A;  4O79 A;  2Q7R A;  2MWQ A;  3EZI A;  2UUI A;  2HV7 A;  3RVY A;  1LIH A;  4XPX A;  5BUO A;  1L3P A;  3U9M A;  3CSK A;  3LS0 A;  1VTM P;  4OIN F;  4XEV A;  1NFN A;  2R7Q A;  5F5F A;  2E87 A;  5JRA A;  4W8K A;  3NMJ A;  1O5H A;  3Q7L A;  1ZHZ A;  2G3K A;  4P9F A;  1K04 A;  4HE8 D;  4Q7C A;  4W8P A;  3T4R A;  4BG0 A;  2Y39 A;  4JC7 A;  4EHP A;  3KPH A;  3DE8 A;  1V55 C;  1TWA A;  2AP3 A;  2EPN A;  2J0W A;  2R9R B;  4XLP F;  1BR4 A;  2KNH A;  5DQT A;  4BPM A;  3W8H A;  3DWW A;  1FNT c;  1NFO A;  3AG1 C;  4Z9H A;  1UG7 A;  2YL7 A;  4PJN A;  3RYL A;  3S27 A;  5D91 A;  3SEO A;  1HW2 A;  1EQ1 A;  1GGQ A;  1I5N A;  2HZ8 A;  1ORY A;  1WWP A;  2XLM A;  1GS9 A;  2YQY A;  4N6C A;  3A11 A;  5EGY A;  5AGF A;  5JT4 A;  1RJ9 B;  1MMN A;  4Q4Z F;  2NUT A;  4MS2 A;  1ZW2 A;  2CCY A;  4DRI B;  1U0B B;  4C3E A;  3RQG A;  1NLX A;  1JPN A;  2Q9A A;  2YLD A;  3IQ6 A;  4YT4 A;  1OKK D;  4U5H A;  3TK0 A;  1R5I D;  1A0B A;  4MTO A;  1M2V B;  3AJM A;  3NKE A;  3B0U X;  1Z63 A;  3KL4 A;  4G78 A;  2OG2 A;  5KYY B;  4E7Z A;  5KYU B;  4IAR A;  2GDC A;  2QLA A;  1YVI A;  2P61 A;  2LFF A;  2BE5 F;  5TJ5 E;  3SXY A;  3BEH A;  1QPU A;  3H65 A;  4PJM A;  1JOG A;  4OIQ F;  4AX2 A;  1NSG B;  3GWN A;  2VB6 A;  1V4A A;  4E0I A;  2D4U A;  3ZIB A;  3O39 A;  1KU2 A;  2XL4 A;  4K7B A;  1MMG A;  1OR3 A;  4KBL A;  2EIL C;  1F1M A;  1G5Z A;  3I4U A;  2YL1 A;  3K6B A;  3ZVR A;  3EG9 B;  5DQZ A;  2HJM A;  1YAU O;  2B0J A;  1C03 A;  1TWG A;  2XLO A;  2XM0 A;  3FDQ A;  3L1M A;  3TJ5 A;  4GYT A;  3GEH A;  1ZHY A;  3NYL A;  1M57 C;  2J9V A;  1ZVZ A;  5A6K A;  2LP4 A;  4F4B A;  4LDQ A;  3AQB A;  1EKY A;  4I1O B;  3LEO A;  5F28 E;  5E33 A;  2CNW D;  1ORS C;  2H7V C;  1H9G A;  1L7C A;  4JCZ A;  2IM8 A;  2IYL D;  3JZ0 A;  3MFN A;  1OCR C;  3MYF A;  5T3T A;  2A69 F;  3EQL F;  2B0H A;  4PR9 A;  2GFH A;  2CYD A;  2IXO A;  3AOU A;  2L9J A;  3V5Z A;  1H9T A;  5CI9 A;  2J46 A;  3FHD A;  1OW8 A;  2H8A A;  3KMI A;  3T6B A;  5A6B D;  1N1C A;  1VMA A;  3RIP A;  4PJJ A;  1OXB A;  3AG4 C;  3T9O A;  3B29 A;  1S05 A;  1SR2 A;  2A1D D;  3O10 A;  2PF4 E;  2YRF A;  3EGD A;  3GEE A;  3OEO A;  4JEA A;  5E2Q A;  3ZDL A;  3K7D A;  2H7O A;  5JVE A;  2W4M A;  3ZTZ A;  2BL2 A;  1PCX A;  1CGN A;  2Y3H A;  2YLG A;  3ASN C;  3U8P A;  3S9O A;  1I4Z A;  1BR1 A;  1LS4 A;  4KNV A;  4LER A;  4WGY A;  3FAJ A;  3PCV A;  3EZH A;  3GAN A;  4RBN A;  1KNY A;  3DKA A;  1FFT C;  2OEV A;  4JKV A;  1APC A;  1OW6 A;  1OKK A;  3HKK A;  4LDR A;  2OCC C;  2XLV A;  4JZA A;  4O6M A;  1K40 A;  1LI7 A;  1UFB A;  2JX0 A;  4MW3 A;  4MTF A;  5CI8 A;  2X0C A;  4AK9 A;  5L3V A;  4AL1 A;  3TUL A;  1CGO A;  2R03 A;  2WVN A;  1CPR A;  1YZA A;  3CZ6 A;  1D1C A;  1M2V A;  3NDB B;  4O7G A;  3TOL A;  3G50 A;  5DVW A;  3TOM A;  2HUJ A;  4MW8 A;  4CS8 A;  4OD4 A;  3WAQ A;  4XPY A;  2DGJ A;  1ZU4 A;  5A69 A;  3HNI A;  3LJB A;  1KTM A;  5DS4 A;  4IAO A;  2HJ3 A;  4CIH A;  3Q6M A;  2VH3 A;  4G7O F;  4L6R A;  2VAS A;  1YA9 A;  4HFK B;  2YEV A;  1T6U A;  4NTF A;  1T5O A;  5L0C A;  4YL3 A;  2XS8 A;  3G4X A;  1E83 A;  3K1H A;  2R7X A;  1SMY F;  3EG9 A;  4H54 A;  4LLE A;  5B3S C;  4G7H F;  2CNW A;  3AGT A;  3TJ6 A;  2GWW A;  3TQO A;  2XSE A;  1V74 B;  3B71 A;  4BJ1 A;  5HSW A;  2QY9 A;  2R7R A;  4EBB A;  3N0T A;  4YT8 A;  4JTC B;  2DB4 A;  3FAP B;  4N06 A;  3U3F A;  4H4K C;  3UMK A;  3DJU B;  4N4W A;  3ZSU A;  3B0V C;  3DAF A;  4DBR A;  2DYR C;  3V7O A;  1W2W A;  1I4Y A;  3ZQV A;  1MQV A;  5COM A;  4XWJ A;  4CDV A;  3EGX A;  5DS6 A;  5A6B A;  3HNJ A;  1VK5 A;  3LUT B;  2LQG A;  3LNM B;  4JW1 A;  3SXZ A;  3J06 A;  2Q4F A;  2VCA A;  1FTS A;  3JT1 A;  2OOC A;  2HV6 A;  5KYW A;  4U5G A;  2HFI A;  5JP7 A;  1ZZP A;  1Q0F A;  3DJN B;  4BJ5 A;  2EIN C;  3EGD B;  1T01 A;  3S29 A;  3IPM O;  4AE4 A;  2VCB A;  3W2V A;  3WG7 C;  2A68 F;  2WZL A;  1D0X A;  1LKX A;  4KI2 A;  4Z9J A;  3E9V A;  3US6 A;  4E17 A;  5L0F A;  4UDV A;  2R7V A;  1QSP A;  1B68 A;  2WZF A;  3B9Q A;  3G4Z A;  1T6Q A;  1M6T A;  2XL6 A;  4BEJ A;  2EIJ C;  1OXK A;  4XEF A;  3DAG A;  1YDI A;  3W2W A;  1E2X A;  1O87 A;  1D0Y A;  3L8J A;  3I5P A;  3U9J A;  1S7Z A;  2XS1 A;  2ZXW C;  3MBG A;  4WGZ A;  3VF0 A;  5EK0 A;  2YHS A;  3E70 C;  4JEB A;  1JPJ A;  2CW0 F;  2J45 A;  2J9W A;  4U5F E;  5JLI A;  3UGP A;  1Q0M A;  3GEI A;  3O55 A;  3JRM O;  3LLI A;  2XXA B;  2WL8 A;  3AG3 C;  3EH2 A;  2ZD9 A;  4J32 B;  4LLC A;  4YL0 A;  3GM2 A;  1JR8 A;  2LCH A;  5JSL A;  2YVK A;  4LDK A;  4MVU A;  3K1I C;  1PD1 A;  4OIR F;  2R7U A;  4O6Y A;  1A7E A;  2UUH A;  2KSF A;  4CSA A;  1TFO B;  5CIV A;  4PAC A;  5IY5 C;  1Y4C A;  1BBH A;  2R7O A;  3SYN A;  2C04 A;  2LIG A;  1SZI A;  3LEV A;  3C8G D;  3KYJ A;  1AEP A;  4JVS A;  1ZHW A;  3BRJ A;  3DM5 A;  3CEX A;  3EJN A;  3NMK A;  4NCQ A;  4PFP A;  1MMA A;  3VRC A;  1Z6A A;  1FMV A;  4JUR I;  4E18 A;  4EIY A;  3ZWI A;  1EA8 A;  2EIK C;  3M79 A;  1TWH A;  2J9U A;  1BDJ B;  2EPL X;  4GQH A;  4P9T A;  3W8I A;  4U5B E;  1HE9 A;  1NU7 D;  2QTV A;  2HS5 A;  2AVK A;  1TWC A;  5DS5 A;  1ZW3 A;  2AWY A;  2G62 A;  3LS1 A;  4QI2 A;  1LPE A;  4XLN F;  3LNR A;  4JE9 A;  3U0C A;  3EGX B;  2IXP A;  2NUP A;  4U9E A;  5K0I A;  3L8I A;  4XPW A;  1T6I A;  2W45 A;  4ANJ A;  1IZM A;  4BJ6 A;  4WJ0 A;  1TKN A;  2F22 A;  4CS9 A;  4E7S A;  3ABL C;  4ULW A;  5KYW B;  2XLW A;  3B0P A;  3NRH A;  4IB4 A;  1AUE A;  4N6H A;  4U5C E;  2V26 A;  1H6G A;  1FAP B;  1HY5 A;  1U89 A;  2Y3D A;  3UNG C;  1K05 A;  4AE4 B;  3U5S A;  2R02 A;  1QZX A;  5F5H A;  1IW7 F;  1D0Z A;  3GWL A;  4AL0 A;  1OCC C;  4NC3 A;  1OR2 A;  4Z9I A;  5BQH A;  2D5R B;  1QQ3 A;  5AC4 A;  2Y69 C;  2ZPA A;  3H2U A;  5A6J A;  4YN0 B;  3FMS A;  4XEK A;  2PBE A;  1JRA A;  3L0I A;  2EPO A;  3VYW A;  4IRU A;  4HEA J;  4JTD B;  2XLD A;  3ATP A;  3JYY A;  4I44 A;  2XL8 A;  5GPG B;  1QLE C;  4CBE A;  4A4A A;  4MTG A;  2JD3 A;  1YLM A;  5JUA A;  1ZHT A;  3IQ5 A;  3U2L A;  4Q5S F;  1EI7 A;  4DVZ A;  2A0U A;  2CDQ A;  2Y3G A;  3C62 A;  1LE2 A;  3M1C B;  4FX5 A;  4NY3 A;  2XXA A;  4D4X A;  2HSB A;  2J0X A;  3FOO A;  3W4Y A;  1YYX A;  2NSG A;  4HFF B;  3N24 A;  4RD9 A;  3V5Y A;  4CS9 C;  1Z3I X;  4MVQ A;  5KYX B;  4E0H A;  4MND A;  3RKO F;  2KGO A;  3C8G A;  3MX3 A;  3IHU A;  4ER9 A;  4NQF A;  3UR3 C;  4MVO A;  3DXJ F;  1YAR O;  3I5Q A;  2ZXO A;  1XZP A;  4NTA A;  2AWC A;  2WVQ A;  3PMR A;  1E86 A;  4DBQ A;  3DI5 A;  4MVS A;  1OCZ C;  2P7V A;  2MYS A;  3CQZ A;  3OA1 A;  4EKW A;  5HV9 A;  1CGM E;  1Z7Q c;  1YA7 O;  4OIO F;  3FOP A;  3WHN A;  4BEM J;  3GM3 A;  2KK1 A;  3SXM A;  3DZA A;  1AVO B;  3F46 A;  2R25 A;  3K66 A;  256B A;  2ETS A;  2OJQ A;  4GEH A;  3U3B A;  2J7P D;  4B6I A;  2QE9 A;  4ZLC A;  3GOD A;  1XZQ A;  5T3W A;  2A0B A;  1G4U S;  2HSQ A;  2VC9 A;  3S90 A;  1A7D A;  1O3U A;  3EHN A;  3C7J A;  1VB5 A;  2DYS C;  2NUP B;  5JS5 A;  1NU9 C;  5AC5 A;  2V3C C;  3OWT A;  3EPV A;  3AGU A;  2ICW G;  4BJT A;  1Q0K A;  2IBF A;  4DVY P;  2R7T A;  2QUP A;  3QW1 A;  5E3C A;  1M2O A;  1JAF A;  4JJF A;  1VLT A;  2I8B A;  2QNL A;  5A6A A;  3ZC4 A;  2O9X A;  4RDA A;  3RF3 A;  1WTY A;  2KJG A;  4CS8 C;  4JIO A;  3T6G B;  1JMW A;  4I1M A;  1M56 C;  3S28 A;  1QKR A;  3N2Z B;  2OQM A;  2PFD A;  2XRH A;  5COF A;  1HE1 A;  1J8Y F;  3K1I A;  3QZC A;  3SZR A;  1RKE B;  5COG A;  1FR0 A;  1V54 C;  3JSZ A;  3M4C A;  1GM5 A;  3Q7G A;  5B1A C;  3SXK A;  3CAX A;  2XLH A;  1TQG A;  3KKB A;  1SYQ A;  3RQE A;  1E84 A;  2WVO A;  2Y3B A;  4EBK A;  2FGY A;  3QTH A;  3PHF 2;  4CJG A;  1HW1 A;  4EUK B;  4U5E E;  1G4W R;  4ULV A;  2Q9B A;  1FFH A;  4I3M A;  5L0J A;  3GM1 A;  1SF8 A;  4EBJ A;  1Q0D A;  2M64 A;  3C18 A;  4IWB A;  4EWC A;  3DE9 A;  2C03 A;  2L7A A;  2PP4 A;  2PX0 A;  3ABK C;  4K1O A;  3C8G B;  4PFO A;  1PD0 A;  2EPM X;  2IXM A;  3HNK A;  4OD5 A;  5KYX A;  3POV A;  5B3I A;  2J9B A;  5D92 A;  4O6N A;  4YWQ A;  1Z5Z A;  2ASR A;  2H7B A;  5DLJ A;  2YKZ A;  3RQF A;  2Q00 A;  2NSF A;  1BR2 A;  4CDY A;  4LAC B;  3T6J A;  2WB7 A;  3UMI A;  2LSE A;  5L0G A;  2YL0 A;  1VYK A;  1RKC A;  4C7O A;  2W4B A;  1HMD A;  4OIP F;  1D1B A;  2J7P A;  4BJ5 C;  4A2N B;  4YT2 A;  3EHM A;  2XLE A;  4QI0 A;  1MMD A;  4XQ1 A;  3ZG1 A;  1R4T A;  2EPK X;  2FFH A;  2HMZ A;  3NKD A;  4J7T A;  4U5D E;  1WOL A;  1Y6D A;  3DM9 B;  4JRZ A;  2PNO A;  3HNL A;  2A6E F;  2ZXR A;  3RFY A;  3X2Q C;  3M15 A;  3AQC A;  5L0D A;  2W9Y A;  2CGE A;  3QW0 A;  4ONS A;  2FAP B;  2PX3 A;  1DOW A;  4FES A;  2AU5 A;  4MVR A;  2P0N A;  3LLK A;  4KC9 A;  2P1A A;  4G7Z F;  1DOV A;  3IQT A;  1ORJ A;  3R2P A;  3U8V A;  1RXQ A;  1ZYR F;  3NYJ A;  2Z15 A;  1OW7 A;  1TR2 A;  2IXN A;  3S0X A;  3M4B A;  5T1D B;  1RMV A;  2LFD A;  2YZS A;  1HMO A;  2HMQ A;  2L6F A;  3UGO A;  4X0R A;  3QMK A;  4PJL A;  2EIM C;  1A7V A;  1YYJ A;  3X1O A;  4C3D A;  4MVZ A;  4JCH A;  2IOQ A;  3ASO C;  4IJJ A;  3EFO A;  3RVZ A;  2GAQ A;  1NG1 A;  3S84 A;  4CSA C;  1TFK B;  2OEX A;  4WAB A;  3TD7 A;  3EH1 A;  3K33 A;  2JPU A;  1LM3 B;  1E85 A;  3RW0 A;  4PK4 A;  3KYI A;  4ZLD A;  5FCL A;  3SNH A;  1RKE A;  3HJC A;  1LVK A;  4YL1 A;  2NG1 A;  1OCO C;  2M4E A;  2OKU A;  3ITF A;  2YLI A;  3VM6 A;  2KW3 C;  3JCU Q;  5EHH A;  5L0H A;  4IAQ A;  4YJW A;  1C02 A;  5B1B C;  1QVX A;  3NMI A;  3V5X A;  3QVY A;  2OU6 A;  3SP1 A;  4CIP A;  1G8X A;  3MYI A;  3A9C A;  4DOZ A;  1MND A;  5FZT A;  3HLZ A;  3IEE A;  3JTL O;  3LES A;  3NG1 A;  4QDL A;  4K0D A;  2LK4 A;  3FVY A;  4XTK A;  3HTK C;  4R32 A;  1NBB A;  4CS7 A;  3IQC A;  3JRT A;  2XM4 A;  2DI3 A;  1NZE A;  4D4N A;  1U6H A;  3L34 A;  4NTB A;  2Q9C A;  2P6V A;  4FAP B;  1FMW A;  1ZHX A;  2G3V A;  2NPU A;  4DRJ B;  3H2V A;  2KQ9 A;  1OQC A;  1VYI A;  2MHR A;  5E3A A;  3ZTM A;  1GQA A;  4BJ6 C;  4MVM A;  3ECS A;  4JTA B;  4YK5 A;  2NUT B;  2WZG A;  1RCP A;  3KH2 A;  1T9K A;  2A6H F;  1YJG A;  2YWA A;  1J8M F;  1RJ9 A;  3C63 A;  1Q0G A;  3Q6N A;  4KNW A;  1LE4 A;  3JSE O;  3U2M A;  4C7O B;  2R7S A;  1BZ4 A;  4U9D A;  3LAY A;  3MLG A;  2GA0 A;  3O6X A;  1C17 M;  1A41 A;  1WAT A;  3QVZ A;  5KYN A;  2TMV P;  1ST6 A;  1VLS A;  2X51 A;  2ZXP A;  1VOM A;  3C8Z A;  4YT5 A;  4DXW A;  4CX9 A;  5KYY A;  2KYH A;  2YL3 A;  5L3Q A;  5KYU A;  5BQG A;  1CPQ A;  3AG2 C;  3NYM A;  3RH3 A;  4IGG A;  1WN0 A;  2J8W A;  1WGW A;  3JYH A;  1Z23 A;  3ABM C;  1H7I A;  3PDM P;  1XWJ A;  1PV3 A;  3F47 A;  5L0I A;  2L81 A;  2KC3 A;  2VCC A;  2HKV A;  1ZU5 A;  2R05 A;  2RSE B;  2Q3T A;  3EFO B;  2I15 A;  1MNE A;  2OJE D;  3WOD F;  4C3B A;  2L6H A;  2RD9 A;  2L6G A;  3GOR A;  4CDA A;  5BQI A;  2BC5 A;  4MQ9 F;  4G0H A; 
#chains in the Genus database with same CATH homology
 1CPR A;  1YZA A;  2XLW A;  4N6H A;  4IB4 A;  2YKZ A;  1YZC A;  3TOL A;  4CDY A;  3TOM A;  4CJO A;  3ZQY A;  2YL0 A;  3HNI A;  4NC3 A;  2XLE A;  1QQ3 A;  4L6R A;  3HNL A;  3NMJ A;  3M15 A;  3QW0 A;  1E83 A;  2XLD A;  3DE8 A;  2XL8 A;  5JUA A;  3IQ5 A;  2YL7 A;  3M4B A;  3C62 A;  2XLM A;  4D4X A;  4N4W A;  5JT4 A;  1YYJ A;  1A7V A;  5AGF A;  3FOO A;  1YYX A;  2CCY A;  3ZQV A;  1MQV A;  4CDV A;  2YLD A;  3HNJ A;  3IQ6 A;  4ER9 A;  1E86 A;  1LM3 B;  1E85 A;  4IAR A;  2QLA A;  5JP7 A;  1QPU A;  2YLI A;  3FOP A;  4IAQ A;  4CIP A;  3NMI A;  3QVY A;  256B A;  1M6T A;  2XL6 A;  1NBB A;  2YL1 A;  2XM4 A;  4WGZ A;  4D4N A;  2XLO A;  5JS5 A;  2XM0 A;  3L1M A;  4JEB A;  5JLI A;  3ZTM A;  1GQA A;  3QW1 A;  1EKY A;  5JSL A;  5B3I A;  1JAF A;  1RCP A;  3C63 A;  1BBH A;  4U9D A;  3QVZ A;  3M4C A;  3NMK A;  4CX9 A;  2YL3 A;  1CPQ A;  2XLH A;  1S05 A;  2J8W A;  4JEA A;  3VRC A;  5JRA A;  4EIY A;  3ZWI A;  3M79 A;  5JVE A;  1E84 A;  3ZTZ A;  1CGN A;  2YLG A;  3U8P A;  4CJG A;  4WGY A;  4ULV A;  4JE9 A;  1APC A;  4JKV A;  2XLV A;  3DE9 A;  4U9E A;  3HNK A;  1CGO A;  4CDA A;  2J9B A;  2BC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...