1JAFA

Crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
128
structure length
128
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cytochrome C' from Rhodocyclus Gelatinosus and Comparison with Other Cytochromes C'
pubmed rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 48
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1jafA00
3VRCA 3DE9A 1RCPA 4EIYA 5JRAA 1BBHA 3NMIA 5JSLA 4CX9A 256BA 5JS5A 4IARA 3U8PA 3QVZA 2YL7A 2J9BA 1S05A 2YL3A 3C63A 2XLDA 3QW1A 2YKZA 1CGNA 3M4CA 1E86A 1A7VA 4N4WA 1QQ3A 3M4BA 2XLOA 3DE8A 1NBBA 4U9DA 3ZWIA 2YLDA 3IQ6A 2XLVA 5AGFA 2XLMA 1E83A 2XL8A 3L1MA 1MQVA 1CGOA 4JEAA 2XM4A 3TOLA 4JKVA 4ER9A 4U9EA 3HNIA 4JE9A 3ZQVA 3ZTMA 4L6RA 2J8WA 4NC3A 3QVYA 1LM3B 2XLEA 3TOMA 3ZTZA 3FOOA 2BC5A 2XLWA 4CIPA 1YYXA 1EKYA 3NMJA 3IQ5A 3NMKA 1YZCA 4N6HA 5JT4A 4D4NA 3C62A 1M6TA 5JP7A 4CJOA 4D4XA 4IB4A 4ULVA 2CCYA 3FOPA 4CDVA 1JAFA 2YL0A 5JUAA 3HNKA 5B3IA 1CPRA 4WGYA 5JLIA 1YYJA 2YLIA 2XM0A 3QW0A 3M15A 2YLGA 2YL1A 2XLHA 4CDYA 3HNLA 1CPQA 4JEBA 1APCA 4CDAA 3HNJA 1QPUA 3ZQYA 1GQAA 4CJGA 1E84A 4IAQA 1YZAA 3M79A 2XL6A 4WGZA 2QLAA 5JVEA 1E85A
chains in the Genus database with same CATH superfamily
2A69F 4YK5A 3VRCA 1Y6DA 3KKBA 5L0HA 3EJNA 4NTBA 3V5XA 1NFNA 4LDRA 3G4XA 5L0GA 2J46A 4A4AA 5JRAA 5KYYA 1ORYA 3RKOF 2Q7RA 3S27A 1BBHA 2P1AA 2L7AA 2KJGA 2ZXWC 3ASNC 3V5ZA 3W4YA 5F28E 1W2WA 4YL3A 4CX9A 5JS5A 1K04A 3QVZA 3UNGC 4JCHA 4EUKB 2EPLX 5KYYB 1L7CA 1LE2A 1ZHWA 1C03A 3GEHA 3U8VA 4BEJA 2R9RB 2HUJA 2OG2A 5E3CA 2J9VA 2EINC 1NG1A 3JYYA 2C03A 2HMZA 3S84A 3GM3A 5A69A 1ZW3A 2Q9AA 2YKZA 1FMWA 3K7DA 4ONSA 3RFYA 1TQGA 3VYWA 1Z63A 2QUPA 5EK0A 4Q5SF 1H6GA 2CDQA 4ULWA 3JRTA 3FAJA 1Z7Qc 3JSEO 5DQTA 4RBNA 2OKUA 1WASA 2IBFA 2XXAA 2PX3A 2YLDA 3FMSA 2HV7A 3OA1A 3RH3A 2H8AA 1ORJA 1OW6A 4MS2A 4WABA 1VLSA 1LI7A 3KH2A 3T6JA 1YDIA 3LESA 3EFOB 1LE4A 3SNHA 2XXAB 3ZIBA 4JKVA 1DOVA 5DS6A 1IZMA 5CIVA 1MNDA 4J7YA 2HMQA 3M1CB 1SZIA 1YA9A 2L9JA 2J8WA 3AOUA 1GGQA 4NC3A 1B68A 2PFDA 3BEHA 4RDAA 3KMIA 3AGTA 5F5FA 3PDMP 3QVYA 2LP4A 2EIMC 1FFHA 2XLEA 3DXJF 5L3QA 2R03A 5L0FA 5L0JA 4NTAA 5KYNA 3RVZA 1A0BA 2Q9CA 1OXKA 3FOOA 1KNYA 3EHNA 4BJTA 4YT2A 2XLWA 4GQHA 3U2MA 5HV9A 1YYXA 2EPOA 2H7BA 2AWCA 4MVQA 3UGPA 1J8YF 1RMVA 5AC5A 4I3MA 1UG7A 4N6HA 1T9KA 5JP7A 3TULA 4BJ1A 4ANJA 4MW8A 2DYSC 3N24A 4DBRA 5COMA 1ZZPA 4OD4A 3LNRA 4FX5A 3RQEA 4Q4ZF 3IHUA 2W45A 4EBBA 1RKEB 3FOPA 3SXMA 2FAPB 4E7SA 2YHSA 3W2VA 5JUAA 4BJ5A 4N6CA 3T6GB 2GA0A 1V54C 2L81A 2WZGA 3HKKA 4MW3A 1LS4A 3CZ6A 2LFFA 3V5YA 5D92A 4WGYA 4G78A 5JLIA 1TWCA 1RKEA 3IQCA 4JTAB 5B1AC 2EPNA 3FDQA 2VCBA 4Q7CA 2YZSA 1MMGA 4KC9A 5TJ5E 2QNLA 3JYHA 4PFOA 1ZHTA 3TJ6A 2KNHA 4LLEA 4XPWA 3U3FA 5E2QA 4DVZA 2A68F 4XQ1A 2AP3A 1Q0MA 4P9FA 4P9TA 2L6FA 3ZSUA 4YT8A 2R7TA 3NKDA 2QY9A 1M57C 2CGEA 1CPQA 3EG9A 2NUTA 1VK5A 4CDAA 3HTKC 2W4MA 1T6QA 2LFDA 4KBLA 2A6HF 4JRZA 2D5RB 3ABLC 1WWPA 4KNVA 2HSBA 4MTFA 3RYLA 3VAYA 3S9OA 2CYDA 4OIRF 1G4US 2H7OA 4OINF 4WGZA 4JZAA 1I4YA 2PX0A 4YL0A 2NUPA 2JD3A 2LSEA 2VCCA 3T6BA 4IGGA 3VM6A 1LIHA 3AG4C 3ZG1A 1AEPA 1BZ4A 2YQYA 3B9QA 2ASRA 4EIYA 4DRIB 2DB4A 4EWCA 1K40A 5KYXA 2P0NA 1MNEA 3ECSA 5AC4A 2A0UA 5KYWB 2GDCA 1YAUO 3GEIA 3U8PA 2J7PD 3DAGA 3RIPA 1O3UA 4DBQA 3C18A 4AX2A 4K7BA 4KNWA 4U5DE 4XEFA 3EGXA 4BJ5C 5A6JA 2AU5A 3G50A 3QMKA 2AWYA 3DM5A 3C63A 3CQZA 3QZCA 3EH1A 4FWVA 4JJGA 3L34A 3RVYA 4XEKA 1MMAA 4MVSA 2OU6A 3KPHA 4MNDA 3NKEA 2IXNA 3ZC4A 1N1CA 4RD9A 4CS8A 1LI5A 2YEVA 4MTOA 1WGWA 1MMNA 3DE8A 4U9DA 5GPGB 2ZXOA 4OIQF 2XRHA 3C8GB 5A6BD 2XLVA 5AGFA 1HE1A 2Z15A 2ICWG 2OEVA 3EGDB 4U5BE 4JW1A 1ZU4A 3N2ZB 2RD9A 3L1MA 3S29A 3K1HA 1CGOA 2M64A 3WODF 4EBKA 2HZ8A 3JZ0A 4NCQA 3CAXA 3VF0A 2A1DD 4ER9A 1XWJA 2OQMA 5IY5C 4XTKA 1I5NA 1KTMA 3ZTMA 2IYLD 1OCOC 3EHMA 3O39A 1BR2A 4MVOA 1V4AA 4CS7A 2EPKX 4OD5A 1FMVA 3RF3A 4DXWA 5A6AA 2G3VA 3EZHA 4XWJA 1NU9C 3SXKA 5KYWA 4E0HA 4ZLDA 3AQCA 2XS1A 1DOWA 2W9YA 4LDQA 3L0IA 5CI8A 2J0WA 4IJJA 1D1AA 1ZVZA 4EHPA 3H65A 4Z9IA 5DLJA 2M4EA 4U5EE 1HMDA 2IXPA 2RSEB 1YZCA 1A7DA 4K1OA 1C02A 3C62A 3K66A 4HEAJ 2R7OA 4HFFB 2P7VA 1EQ1A 4LDKA 2AVKA 4D4XA 4DVYP 4AE4B 2HJMA 4PJMA 4CS9A 4ULVA 3T9OA 1VOMA 3US6A 2PF4E 2FGYA 1Q0KA 3FAPB 5F5HA 1JAFA 1FTSA 2Q9BA 3KYJA 5B1BC 2UUIA 4E7ZA 2YWAA 1OCRC 2F22A 2J7PA 2R7QA 4AK9A 2WVQA 1YYJA 1FNTc 5KYUA 1HE9A 3SYNA 2L6HA 2YLIA 4MVMA 3K1IC 4I1MA 1Q0GA 2XM0A 1ZYRF 4W8PA 3QW0A 4U5HA 3LUTB 1JPJA 3U0CA 3PMRA 1YJGA 2YVKA 1NSGB 1VMAA 2XLHA 2NG1A 4O7GA 1Z5ZA 4U5CE 5KYUB 3RQFA 1PD1A 1U6HA 1APCA 1AVOB 3HNJA 4OIPF 1T6UA 2LQGA 4QDLA 4G7ZF 3ZQYA 3POVA 4CJGA 3SP1A 3U9JA 4HFKB 1D0XA 1OCZC 1XZPA 4MQ9F 1H9GA 3U5SA 3F47A 1AUEA 2KYHA 1A41A 1OR2A 2OEXA 3MYFA 1G5ZA 2OCCC 2GWWA 4XLNF 2KQ9A 3EZIA 3X2QC 2VASA 4IRUA 1SYQA 2Y3DA 3IQTA 1Y4CA 3LS1A 1EI7A 3K6BA 4IAOA 1PV3A 1T6IA 3L8IA 4OIOF 3C8ZA 1RCPA 3SEOA 1YVIA 5BQGA 3U9MA 5B3SC 4JVSA 1HW1A 3UMKA 1JRAA 2R7WA 1A7EA 1M2VB 1SF8A 3DZAA 3GEEA 3RW0A 1SR2A 3NMIA 2EIJC 2LIGA 256BA 2CNWD 1M2OA 4IARA 3ASOC 3F46A 2YL7A 3AGUA 2J9BA 1OXBA 2R05A 3AJMA 3H2UA 1NLXA 3NYJA 3B0PA 1T01A 3ABKC 2R7SA 4JURI 5DVWA 2R02A 1D1BA 1O87A 4HE8D 2CW0F 1K05A 2DGJA 3B29A 1FR0A 1CGNA 1H7IA 1QSPA 3M4CA 2CNWA 2BE5F 3OWTA 4F4BA 2JPUA 3DM9B 1A7VA 3R7CA 2ETSA 1J8MF 4K0DA 3R2PA 1E86A 2H7VC 5CI9A 5FCLA 4MVUA 4PJJA 1ST6A 2MWQA 2IXOA 3ZWIA 4C3BA 2A6EF 4NQFA 1OCCC 3EGDA 3GANA 2QTVA 2XLMA 3E9VA 1EA8A 3NRHA 1BR4A 4X0RA 4BJ6C 4Z9HA 3TJ5A 1MQVA 2R7XA 3I4UA 2KW3C 3A9CA 3LJBA 4JEAA 2XM4A 3TOLA 3V7OA 4PK4A 4G0HA 3DJNB 3I5PA 4H4KC 1D1CA 1FFTC 1TFKB 5BQIA 1QVXA 2WB7A 4MTGA 1I4ZA 4H54A 4L6RA 4E17A 3IPMO 1U89A 2Y3GA 2BL2A 1JOGA 4O6MA 4IWBA 1E2XA 2D4UA 4W8KA 3B0UX 4U5GA 1BR1A 2VCAA 4UDVA 2J9UA 3HLZA 2OOCA 3GODA 1U0BB 2Y39A 3TOMA 1TKNA 3EQLF 3JRMO 4LACB 3S90A 3ZTZA 1NU7D 4NTFA 3K1IA 2V3CC 1QKRA 2BC5A 4NY3A 4CIPA 1LVKA 2R25A 4FAPB 3K33A 4O79A 4I1OB 4LLCA 2J45A 1WATA 1FAPB 1YARO 2B0JA 3JTLO 2X0CA 4CBEA 3NMJA 3WAQA 3W8HA 3IQ5A 3NMKA 2HKVA 2Y3BA 2UUHA 4XPXA 3Q7LA 1PD0A 2LCHA 2XSEA 3DI5A 3LS0A 3U2LA 4D4NA 5JT4A 2MHRA 3CSKA 2R7RA 2I8BA 4IB4A 1Z23A 2HFIA 1G4WR 3B0VC 1KU2A 2IM8A 3MX3A 3O6XA 4A2NB 2I15A 5DS5A 5DS4A 4C7OB 2TMVP 1XZQA 2KK1A 3LNMB 2YL0A 5T3TA 3ZDLA 4QI2A 3S0XA 3ATPA 3NYLA 1ORSC 3DD7A 3AG1C 3BRJA 3EPVA 4XPYA 1JMWA 3EH2A 1QZXA 3U3BA 4DRJB 5B3IA 1CPRA 4R32A 2O9XA 4J32B 2WZLA 3A11A 3EGXB 5EHHA 1GS9A 1ZHXA 3O55A 2GFHA 2YLGA 1V55C 2L6GA 2YL1A 3C7JA 3AQBA 3CEXA 4JTCB 5FZTA 1TWAA 4YJWA 3TQOA 5L3VA 4PR9A 3T4RA 5E3AA 4JEBA 3PHF2 4DRHB 3DKAA 3EFOA 1WTYA 4Z9JA 3GM2A 1TR2A 1QPUA 4AL0A 1GQAA 4EKWA 5HSWA 1H9TA 4BEMJ 1HMOA 1BDJB 1YZAA 2G3KA 3M79A 5A6BA 2J9WA 2XL6A 5EGYA 1NZEA 4DJ9A 4U5FE 1E85A 1V74B 1TFOB 4CS9C 3W8IA 2R7VA 3I5QA 4MVRA 3DE9A 3FVYA 1RJ9B 3WHNA 2FFHA 1O5HA 4BG0A 1E83A 3ITFA 1M56C 3AG2C 3UGOA 1IW7F 1M2VA 2NSGA 1G8XA 2KC3A 2WL8A 2ZXPA 3DJUB 4O6NA 5COGA 5JSLA 2X51A 3JSZA 3LLKA 4JTDB 4QI0A 4E18A 2WVNA 3SXZA 1VYIA 1WN0A 1D0YA 3E70C 1TWGA 4DOZA 1S05A 2YRFA 2Q00A 2YL3A 3MBGA 5JVEA 4XEVA 4PACA 4YWQA 3IEEA 2XLDA 3QW1A 2KSFA 2C04A 2HV6A 5D91A 3UR3C 3ZVRA 2NPUA 3Q6NA 1PCXA 5L0DA 3Q6MA 4G7HF 2A0BA 2Y3HA 5E33A 2VB6A 1ZHYA 4N4WA 1EKYA 4M63A 3C8GD 1QQ3A 3B71A 1RXQA 4AE4A 3M4BA 2XLOA 3RQGA 1ZHZA 4KI2A 1MMDA 1NBBA 3GWNA 4B6IA 1Q0DA 2R7UA 3IQ6A 3G4ZA 3LEVA 2EIKC 3WG7C 1ZW2A 2XL8A 4E0IA 4C3DA 4AL1A 2ZD9A 4BPMA 2WVOA 4GYTA 2V26A 2ZXRA 4WJ0A 1D0ZA 1VYKA 4U9EA 3C8GA 1WOLA 4JCZA 3HNIA 4JC7A 4JE9A 3ZQVA 2P61A 3NDBB 4PJNA 3MLGA 1OW8A 4YN0B 3GORA 3MFNA 4YT4A 3TD7A 4MVZA 1ZU5A 3LAYA 3TK0A 4I44A 2PNOA 1OQCA 2E87A 2LK4A 1JPNA 1LM3B 1LPEA 3NG1A 5K0IA 5L0IA 4CSAC 1HY5A 2WZFA 3QTHA 4LERA 1Q0FA 2XS8A 4BJ6A 4P6IC 2NSFA 1SMYF 2G62A 2Y69C 1VB5A 3SZRA 4CIHA 4G7OF 3AG3C 1YLMA 4YL1A 3LEOA 3KYIA 5A6KA 3GM1A 3Q7GA 1RJ9A 1TWHA 1VLTA 2EILC 2OJED 4PFPA 1R5ID 2XL4A 3PCVA 4XLPF 2B0HA 2Q3TA 4GEHA 5KYXB 1GM5A 3X1OA 2W4BA 1HW2A 1M6TA 4CJOA 1Z3IX 1VTMP 1OKKA 4J7TA 2DYRC 2KGOA 2PBEA 1JR8A 1NFOA 2HS5A 1C17M 3JCUQ 4EBJA 5BQHA 1OW7A 2CCYA 2P6VA 2PP4A 3KL4A 3O10A 3N0TA 2Q4FA 2IOQA 4CDVA 1UFBA 4JIOA 3HNKA 4C7OA 3ABMC 3DMDA 3DWWA 3UMHA 1R4TA 4J30B 1OR3A 1Z6AA 3H2VA 5BUOA 3OEOA 1OKKD 2HSQA 4FESA 4JJFA 4O6YA 2ZPAA 2MYSA 3DAFA 3FXHA 3LLIA 3NYMA 2HJ3A 2J0XA 2VH3A 4CS8C 3MYIA 1L3PA 1F1MA 1RKCA 2GAQA 3HJCA 5DQZA 3UMIA 4C3EA 2QE9A 3M15A 3J06A 4N06A 1T5OA 1LKXA 5T1DB 4CDYA 3FHDA 3JT1A 2VC9A 3HNLA 1S7ZA 2NUTB 2LD6A 3EG9B 4ZLCA 1LS1A 3W2WA 3S28A 2OJQA 1QLEC 3L8JA 4CSAA 5T3WA 3SXYA 2DI3A 2JX0A 4PJLA 4IAQA 1E84A 1CGME 3GWLA 2EPMX 2QLAA 5L0CA 5COFA 4YT5A 2IXMA 2NUPB 1YA7O
chains in the Genus database with same CATH topology
3VRCA 3DE9A 1RCPA 4EIYA 5JRAA 1BBHA 3NMIA 5JSLA 4CX9A 256BA 5JS5A 4IARA 3U8PA 3QVZA 2YL7A 2J9BA 1S05A 2YL3A 3C63A 2XLDA 3QW1A 2YKZA 1CGNA 3M4CA 1E86A 1A7VA 4N4WA 1QQ3A 3M4BA 2XLOA 3DE8A 1NBBA 4U9DA 3ZWIA 2YLDA 3IQ6A 2XLVA 5AGFA 2XLMA 1E83A 2XL8A 3L1MA 1MQVA 1CGOA 4JEAA 2XM4A 3TOLA 4JKVA 4ER9A 4U9EA 3HNIA 4JE9A 3ZQVA 3ZTMA 4L6RA 2J8WA 4NC3A 3QVYA 1LM3B 2XLEA 3TOMA 3ZTZA 3FOOA 2BC5A 2XLWA 4CIPA 1YYXA 1EKYA 3NMJA 3IQ5A 3NMKA 1YZCA 4N6HA 5JT4A 4D4NA 3C62A 1M6TA 5JP7A 4CJOA 4D4XA 4IB4A 4ULVA 2CCYA 3FOPA 4CDVA 1JAFA 2YL0A 5JUAA 3HNKA 5B3IA 1CPRA 4WGYA 5JLIA 1YYJA 2YLIA 2XM0A 3QW0A 3M15A 2YLGA 2YL1A 2XLHA 4CDYA 3HNLA 1CPQA 4JEBA 1APCA 4CDAA 3HNJA 1QPUA 3ZQYA 1GQAA 4CJGA 1E84A 4IAQA 1YZAA 3M79A 2XL6A 4WGZA 2QLAA 5JVEA 1E85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRC A;  3DE9 A;  1RCP A;  4EIY A;  5JRA A;  1BBH A;  3NMI A;  5JSL A;  4CX9 A;  256B A;  5JS5 A;  4IAR A;  3U8P A;  3QVZ A;  2YL7 A;  2J9B A;  1S05 A;  2YL3 A;  3C63 A;  2XLD A;  3QW1 A;  2YKZ A;  1CGN A;  3M4C A;  1E86 A;  1A7V A;  4N4W A;  1QQ3 A;  3M4B A;  2XLO A;  3DE8 A;  1NBB A;  4U9D A;  3ZWI A;  2YLD A;  3IQ6 A;  2XLV A;  5AGF A;  2XLM A;  1E83 A;  2XL8 A;  3L1M A;  1MQV A;  1CGO A;  4JEA A;  2XM4 A;  3TOL A;  4JKV A;  4ER9 A;  4U9E A;  3HNI A;  4JE9 A;  3ZQV A;  3ZTM A;  4L6R A;  2J8W A;  4NC3 A;  3QVY A;  1LM3 B;  2XLE A;  3TOM A;  3ZTZ A;  3FOO A;  2BC5 A;  2XLW A;  4CIP A;  1YYX A;  1EKY A;  3NMJ A;  3IQ5 A;  3NMK A;  1YZC A;  4N6H A;  5JT4 A;  4D4N A;  3C62 A;  1M6T A;  5JP7 A;  4CJO A;  4D4X A;  4IB4 A;  4ULV A;  2CCY A;  3FOP A;  4CDV A;  1JAF A;  2YL0 A;  5JUA A;  3HNK A;  5B3I A;  1CPR A;  4WGY A;  5JLI A;  1YYJ A;  2YLI A;  2XM0 A;  3QW0 A;  3M15 A;  2YLG A;  2YL1 A;  2XLH A;  4CDY A;  3HNL A;  1CPQ A;  4JEB A;  1APC A;  4CDA A;  3HNJ A;  1QPU A;  3ZQY A;  1GQA A;  4CJG A;  1E84 A;  4IAQ A;  1YZA A;  3M79 A;  2XL6 A;  4WGZ A;  2QLA A;  5JVE A;  1E85 A; 
#chains in the Genus database with same CATH topology
 2A69 F;  4YK5 A;  3VRC A;  1Y6D A;  3KKB A;  5L0H A;  3EJN A;  4NTB A;  3V5X A;  1NFN A;  4LDR A;  3G4X A;  5L0G A;  2J46 A;  4A4A A;  5JRA A;  5KYY A;  1ORY A;  3RKO F;  2Q7R A;  3S27 A;  1BBH A;  2P1A A;  2L7A A;  2KJG A;  2ZXW C;  3ASN C;  3V5Z A;  3W4Y A;  5F28 E;  1W2W A;  4YL3 A;  4CX9 A;  5JS5 A;  1K04 A;  3QVZ A;  3UNG C;  4JCH A;  4EUK B;  2EPL X;  5KYY B;  1L7C A;  1LE2 A;  1ZHW A;  1C03 A;  3GEH A;  3U8V A;  4BEJ A;  2R9R B;  2HUJ A;  2OG2 A;  5E3C A;  2J9V A;  2EIN C;  1NG1 A;  3JYY A;  2C03 A;  2HMZ A;  3S84 A;  3GM3 A;  5A69 A;  1ZW3 A;  2Q9A A;  2YKZ A;  1FMW A;  3K7D A;  4ONS A;  3RFY A;  1TQG A;  3VYW A;  1Z63 A;  2QUP A;  5EK0 A;  4Q5S F;  1H6G A;  2CDQ A;  4ULW A;  3JRT A;  3FAJ A;  1Z7Q c;  3JSE O;  5DQT A;  4RBN A;  2OKU A;  1WAS A;  2IBF A;  2XXA A;  2PX3 A;  2YLD A;  3FMS A;  2HV7 A;  3OA1 A;  3RH3 A;  2H8A A;  1ORJ A;  1OW6 A;  4MS2 A;  4WAB A;  1VLS A;  1LI7 A;  3KH2 A;  3T6J A;  1YDI A;  3LES A;  3EFO B;  1LE4 A;  3SNH A;  2XXA B;  3ZIB A;  4JKV A;  1DOV A;  5DS6 A;  1IZM A;  5CIV A;  1MND A;  4J7Y A;  2HMQ A;  3M1C B;  1SZI A;  1YA9 A;  2L9J A;  2J8W A;  3AOU A;  1GGQ A;  4NC3 A;  1B68 A;  2PFD A;  3BEH A;  4RDA A;  3KMI A;  3AGT A;  5F5F A;  3PDM P;  3QVY A;  2LP4 A;  2EIM C;  1FFH A;  2XLE A;  3DXJ F;  5L3Q A;  2R03 A;  5L0F A;  5L0J A;  4NTA A;  5KYN A;  3RVZ A;  1A0B A;  2Q9C A;  1OXK A;  3FOO A;  1KNY A;  3EHN A;  4BJT A;  4YT2 A;  2XLW A;  4GQH A;  3U2M A;  5HV9 A;  1YYX A;  2EPO A;  2H7B A;  2AWC A;  4MVQ A;  3UGP A;  1J8Y F;  1RMV A;  5AC5 A;  4I3M A;  1UG7 A;  4N6H A;  1T9K A;  5JP7 A;  3TUL A;  4BJ1 A;  4ANJ A;  4MW8 A;  2DYS C;  3N24 A;  4DBR A;  5COM A;  1ZZP A;  4OD4 A;  3LNR A;  4FX5 A;  3RQE A;  4Q4Z F;  3IHU A;  2W45 A;  4EBB A;  1RKE B;  3FOP A;  3SXM A;  2FAP B;  4E7S A;  2YHS A;  3W2V A;  5JUA A;  4BJ5 A;  4N6C A;  3T6G B;  2GA0 A;  1V54 C;  2L81 A;  2WZG A;  3HKK A;  4MW3 A;  1LS4 A;  3CZ6 A;  2LFF A;  3V5Y A;  5D92 A;  4WGY A;  4G78 A;  5JLI A;  1TWC A;  1RKE A;  3IQC A;  4JTA B;  5B1A C;  2EPN A;  3FDQ A;  2VCB A;  4Q7C A;  2YZS A;  1MMG A;  4KC9 A;  5TJ5 E;  2QNL A;  3JYH A;  4PFO A;  1ZHT A;  3TJ6 A;  2KNH A;  4LLE A;  4XPW A;  3U3F A;  5E2Q A;  4DVZ A;  2A68 F;  4XQ1 A;  2AP3 A;  1Q0M A;  4P9F A;  4P9T A;  2L6F A;  3ZSU A;  4YT8 A;  2R7T A;  3NKD A;  2QY9 A;  1M57 C;  2CGE A;  1CPQ A;  3EG9 A;  2NUT A;  1VK5 A;  4CDA A;  3HTK C;  2W4M A;  1T6Q A;  2LFD A;  4KBL A;  2A6H F;  4JRZ A;  2D5R B;  3ABL C;  1WWP A;  4KNV A;  2HSB A;  4MTF A;  3RYL A;  3VAY A;  3S9O A;  2CYD A;  4OIR F;  1G4U S;  2H7O A;  4OIN F;  4WGZ A;  4JZA A;  1I4Y A;  2PX0 A;  4YL0 A;  2NUP A;  2JD3 A;  2LSE A;  2VCC A;  3T6B A;  4IGG A;  3VM6 A;  1LIH A;  3AG4 C;  3ZG1 A;  1AEP A;  1BZ4 A;  2YQY A;  3B9Q A;  2ASR A;  4EIY A;  4DRI B;  2DB4 A;  4EWC A;  1K40 A;  5KYX A;  2P0N A;  1MNE A;  3ECS A;  5AC4 A;  2A0U A;  5KYW B;  2GDC A;  1YAU O;  3GEI A;  3U8P A;  2J7P D;  3DAG A;  3RIP A;  1O3U A;  4DBQ A;  3C18 A;  4AX2 A;  4K7B A;  4KNW A;  4U5D E;  4XEF A;  3EGX A;  4BJ5 C;  5A6J A;  2AU5 A;  3G50 A;  3QMK A;  2AWY A;  3DM5 A;  3C63 A;  3CQZ A;  3QZC A;  3EH1 A;  4FWV A;  4JJG A;  3L34 A;  3RVY A;  4XEK A;  1MMA A;  4MVS A;  2OU6 A;  3KPH A;  4MND A;  3NKE A;  2IXN A;  3ZC4 A;  1N1C A;  4RD9 A;  4CS8 A;  1LI5 A;  2YEV A;  4MTO A;  1WGW A;  1MMN A;  3DE8 A;  4U9D A;  5GPG B;  2ZXO A;  4OIQ F;  2XRH A;  3C8G B;  5A6B D;  2XLV A;  5AGF A;  1HE1 A;  2Z15 A;  2ICW G;  2OEV A;  3EGD B;  4U5B E;  4JW1 A;  1ZU4 A;  3N2Z B;  2RD9 A;  3L1M A;  3S29 A;  3K1H A;  1CGO A;  2M64 A;  3WOD F;  4EBK A;  2HZ8 A;  3JZ0 A;  4NCQ A;  3CAX A;  3VF0 A;  2A1D D;  4ER9 A;  1XWJ A;  2OQM A;  5IY5 C;  4XTK A;  1I5N A;  1KTM A;  3ZTM A;  2IYL D;  1OCO C;  3EHM A;  3O39 A;  1BR2 A;  4MVO A;  1V4A A;  4CS7 A;  2EPK X;  4OD5 A;  1FMV A;  3RF3 A;  4DXW A;  5A6A A;  2G3V A;  3EZH A;  4XWJ A;  1NU9 C;  3SXK A;  5KYW A;  4E0H A;  4ZLD A;  3AQC A;  2XS1 A;  1DOW A;  2W9Y A;  4LDQ A;  3L0I A;  5CI8 A;  2J0W A;  4IJJ A;  1D1A A;  1ZVZ A;  4EHP A;  3H65 A;  4Z9I A;  5DLJ A;  2M4E A;  4U5E E;  1HMD A;  2IXP A;  2RSE B;  1YZC A;  1A7D A;  4K1O A;  1C02 A;  3C62 A;  3K66 A;  4HEA J;  2R7O A;  4HFF B;  2P7V A;  1EQ1 A;  4LDK A;  2AVK A;  4D4X A;  4DVY P;  4AE4 B;  2HJM A;  4PJM A;  4CS9 A;  4ULV A;  3T9O A;  1VOM A;  3US6 A;  2PF4 E;  2FGY A;  1Q0K A;  3FAP B;  5F5H A;  1JAF A;  1FTS A;  2Q9B A;  3KYJ A;  5B1B C;  2UUI A;  4E7Z A;  2YWA A;  1OCR C;  2F22 A;  2J7P A;  2R7Q A;  4AK9 A;  2WVQ A;  1YYJ A;  1FNT c;  5KYU A;  1HE9 A;  3SYN A;  2L6H A;  2YLI A;  4MVM A;  3K1I C;  4I1M A;  1Q0G A;  2XM0 A;  1ZYR F;  4W8P A;  3QW0 A;  4U5H A;  3LUT B;  1JPJ A;  3U0C A;  3PMR A;  1YJG A;  2YVK A;  1NSG B;  1VMA A;  2XLH A;  2NG1 A;  4O7G A;  1Z5Z A;  4U5C E;  5KYU B;  3RQF A;  1PD1 A;  1U6H A;  1APC A;  1AVO B;  3HNJ A;  4OIP F;  1T6U A;  2LQG A;  4QDL A;  4G7Z F;  3ZQY A;  3POV A;  4CJG A;  3SP1 A;  3U9J A;  4HFK B;  1D0X A;  1OCZ C;  1XZP A;  4MQ9 F;  1H9G A;  3U5S A;  3F47 A;  1AUE A;  2KYH A;  1A41 A;  1OR2 A;  2OEX A;  3MYF A;  1G5Z A;  2OCC C;  2GWW A;  4XLN F;  2KQ9 A;  3EZI A;  3X2Q C;  2VAS A;  4IRU A;  1SYQ A;  2Y3D A;  3IQT A;  1Y4C A;  3LS1 A;  1EI7 A;  3K6B A;  4IAO A;  1PV3 A;  1T6I A;  3L8I A;  4OIO F;  3C8Z A;  1RCP A;  3SEO A;  1YVI A;  5BQG A;  3U9M A;  5B3S C;  4JVS A;  1HW1 A;  3UMK A;  1JRA A;  2R7W A;  1A7E A;  1M2V B;  1SF8 A;  3DZA A;  3GEE A;  3RW0 A;  1SR2 A;  3NMI A;  2EIJ C;  2LIG A;  256B A;  2CNW D;  1M2O A;  4IAR A;  3ASO C;  3F46 A;  2YL7 A;  3AGU A;  2J9B A;  1OXB A;  2R05 A;  3AJM A;  3H2U A;  1NLX A;  3NYJ A;  3B0P A;  1T01 A;  3ABK C;  2R7S A;  4JUR I;  5DVW A;  2R02 A;  1D1B A;  1O87 A;  4HE8 D;  2CW0 F;  1K05 A;  2DGJ A;  3B29 A;  1FR0 A;  1CGN A;  1H7I A;  1QSP A;  3M4C A;  2CNW A;  2BE5 F;  3OWT A;  4F4B A;  2JPU A;  3DM9 B;  1A7V A;  3R7C A;  2ETS A;  1J8M F;  4K0D A;  3R2P A;  1E86 A;  2H7V C;  5CI9 A;  5FCL A;  4MVU A;  4PJJ A;  1ST6 A;  2MWQ A;  2IXO A;  3ZWI A;  4C3B A;  2A6E F;  4NQF A;  1OCC C;  3EGD A;  3GAN A;  2QTV A;  2XLM A;  3E9V A;  1EA8 A;  3NRH A;  1BR4 A;  4X0R A;  4BJ6 C;  4Z9H A;  3TJ5 A;  1MQV A;  2R7X A;  3I4U A;  2KW3 C;  3A9C A;  3LJB A;  4JEA A;  2XM4 A;  3TOL A;  3V7O A;  4PK4 A;  4G0H A;  3DJN B;  3I5P A;  4H4K C;  1D1C A;  1FFT C;  1TFK B;  5BQI A;  1QVX A;  2WB7 A;  4MTG A;  1I4Z A;  4H54 A;  4L6R A;  4E17 A;  3IPM O;  1U89 A;  2Y3G A;  2BL2 A;  1JOG A;  4O6M A;  4IWB A;  1E2X A;  2D4U A;  4W8K A;  3B0U X;  4U5G A;  1BR1 A;  2VCA A;  4UDV A;  2J9U A;  3HLZ A;  2OOC A;  3GOD A;  1U0B B;  2Y39 A;  3TOM A;  1TKN A;  3EQL F;  3JRM O;  4LAC B;  3S90 A;  3ZTZ A;  1NU7 D;  4NTF A;  3K1I A;  2V3C C;  1QKR A;  2BC5 A;  4NY3 A;  4CIP A;  1LVK A;  2R25 A;  4FAP B;  3K33 A;  4O79 A;  4I1O B;  4LLC A;  2J45 A;  1WAT A;  1FAP B;  1YAR O;  2B0J A;  3JTL O;  2X0C A;  4CBE A;  3NMJ A;  3WAQ A;  3W8H A;  3IQ5 A;  3NMK A;  2HKV A;  2Y3B A;  2UUH A;  4XPX A;  3Q7L A;  1PD0 A;  2LCH A;  2XSE A;  3DI5 A;  3LS0 A;  3U2L A;  4D4N A;  5JT4 A;  2MHR A;  3CSK A;  2R7R A;  2I8B A;  4IB4 A;  1Z23 A;  2HFI A;  1G4W R;  3B0V C;  1KU2 A;  2IM8 A;  3MX3 A;  3O6X A;  4A2N B;  2I15 A;  5DS5 A;  5DS4 A;  4C7O B;  2TMV P;  1XZQ A;  2KK1 A;  3LNM B;  2YL0 A;  5T3T A;  3ZDL A;  4QI2 A;  3S0X A;  3ATP A;  3NYL A;  1ORS C;  3DD7 A;  3AG1 C;  3BRJ A;  3EPV A;  4XPY A;  1JMW A;  3EH2 A;  1QZX A;  3U3B A;  4DRJ B;  5B3I A;  1CPR A;  4R32 A;  2O9X A;  4J32 B;  2WZL A;  3A11 A;  3EGX B;  5EHH A;  1GS9 A;  1ZHX A;  3O55 A;  2GFH A;  2YLG A;  1V55 C;  2L6G A;  2YL1 A;  3C7J A;  3AQB A;  3CEX A;  4JTC B;  5FZT A;  1TWA A;  4YJW A;  3TQO A;  5L3V A;  4PR9 A;  3T4R A;  5E3A A;  4JEB A;  3PHF 2;  4DRH B;  3DKA A;  3EFO A;  1WTY A;  4Z9J A;  3GM2 A;  1TR2 A;  1QPU A;  4AL0 A;  1GQA A;  4EKW A;  5HSW A;  1H9T A;  4BEM J;  1HMO A;  1BDJ B;  1YZA A;  2G3K A;  3M79 A;  5A6B A;  2J9W A;  2XL6 A;  5EGY A;  1NZE A;  4DJ9 A;  4U5F E;  1E85 A;  1V74 B;  1TFO B;  4CS9 C;  3W8I A;  2R7V A;  3I5Q A;  4MVR A;  3DE9 A;  3FVY A;  1RJ9 B;  3WHN A;  2FFH A;  1O5H A;  4BG0 A;  1E83 A;  3ITF A;  1M56 C;  3AG2 C;  3UGO A;  1IW7 F;  1M2V A;  2NSG A;  1G8X A;  2KC3 A;  2WL8 A;  2ZXP A;  3DJU B;  4O6N A;  5COG A;  5JSL A;  2X51 A;  3JSZ A;  3LLK A;  4JTD B;  4QI0 A;  4E18 A;  2WVN A;  3SXZ A;  1VYI A;  1WN0 A;  1D0Y A;  3E70 C;  1TWG A;  4DOZ A;  1S05 A;  2YRF A;  2Q00 A;  2YL3 A;  3MBG A;  5JVE A;  4XEV A;  4PAC A;  4YWQ A;  3IEE A;  2XLD A;  3QW1 A;  2KSF A;  2C04 A;  2HV6 A;  5D91 A;  3UR3 C;  3ZVR A;  2NPU A;  3Q6N A;  1PCX A;  5L0D A;  3Q6M A;  4G7H F;  2A0B A;  2Y3H A;  5E33 A;  2VB6 A;  1ZHY A;  4N4W A;  1EKY A;  4M63 A;  3C8G D;  1QQ3 A;  3B71 A;  1RXQ A;  4AE4 A;  3M4B A;  2XLO A;  3RQG A;  1ZHZ A;  4KI2 A;  1MMD A;  1NBB A;  3GWN A;  4B6I A;  1Q0D A;  2R7U A;  3IQ6 A;  3G4Z A;  3LEV A;  2EIK C;  3WG7 C;  1ZW2 A;  2XL8 A;  4E0I A;  4C3D A;  4AL1 A;  2ZD9 A;  4BPM A;  2WVO A;  4GYT A;  2V26 A;  2ZXR A;  4WJ0 A;  1D0Z A;  1VYK A;  4U9E A;  3C8G A;  1WOL A;  4JCZ A;  3HNI A;  4JC7 A;  4JE9 A;  3ZQV A;  2P61 A;  3NDB B;  4PJN A;  3MLG A;  1OW8 A;  4YN0 B;  3GOR A;  3MFN A;  4YT4 A;  3TD7 A;  4MVZ A;  1ZU5 A;  3LAY A;  3TK0 A;  4I44 A;  2PNO A;  1OQC A;  2E87 A;  2LK4 A;  1JPN A;  1LM3 B;  1LPE A;  3NG1 A;  5K0I A;  5L0I A;  4CSA C;  1HY5 A;  2WZF A;  3QTH A;  4LER A;  1Q0F A;  2XS8 A;  4BJ6 A;  4P6I C;  2NSF A;  1SMY F;  2G62 A;  2Y69 C;  1VB5 A;  3SZR A;  4CIH A;  4G7O F;  3AG3 C;  1YLM A;  4YL1 A;  3LEO A;  3KYI A;  5A6K A;  3GM1 A;  3Q7G A;  1RJ9 A;  1TWH A;  1VLT A;  2EIL C;  2OJE D;  4PFP A;  1R5I D;  2XL4 A;  3PCV A;  4XLP F;  2B0H A;  2Q3T A;  4GEH A;  5KYX B;  1GM5 A;  3X1O A;  2W4B A;  1HW2 A;  1M6T A;  4CJO A;  1Z3I X;  1VTM P;  1OKK A;  4J7T A;  2DYR C;  2KGO A;  2PBE A;  1JR8 A;  1NFO A;  2HS5 A;  1C17 M;  3JCU Q;  4EBJ A;  5BQH A;  1OW7 A;  2CCY A;  2P6V A;  2PP4 A;  3KL4 A;  3O10 A;  3N0T A;  2Q4F A;  2IOQ A;  4CDV A;  1UFB A;  4JIO A;  3HNK A;  4C7O A;  3ABM C;  3DMD A;  3DWW A;  3UMH A;  1R4T A;  4J30 B;  1OR3 A;  1Z6A A;  3H2V A;  5BUO A;  3OEO A;  1OKK D;  2HSQ A;  4FES A;  4JJF A;  4O6Y A;  2ZPA A;  2MYS A;  3DAF A;  3FXH A;  3LLI A;  3NYM A;  2HJ3 A;  2J0X A;  2VH3 A;  4CS8 C;  3MYI A;  1L3P A;  1F1M A;  1RKC A;  2GAQ A;  3HJC A;  5DQZ A;  3UMI A;  4C3E A;  2QE9 A;  3M15 A;  3J06 A;  4N06 A;  1T5O A;  1LKX A;  5T1D B;  4CDY A;  3FHD A;  3JT1 A;  2VC9 A;  3HNL A;  1S7Z A;  2NUT B;  2LD6 A;  3EG9 B;  4ZLC A;  1LS1 A;  3W2W A;  3S28 A;  2OJQ A;  1QLE C;  3L8J A;  4CSA A;  5T3W A;  3SXY A;  2DI3 A;  2JX0 A;  4PJL A;  4IAQ A;  1E84 A;  1CGM E;  3GWL A;  2EPM X;  2QLA A;  5L0C A;  5COF A;  4YT5 A;  2IXM A;  2NUP B;  1YA7 O; 
#chains in the Genus database with same CATH homology
 3VRC A;  3DE9 A;  1RCP A;  4EIY A;  5JRA A;  1BBH A;  3NMI A;  5JSL A;  4CX9 A;  256B A;  5JS5 A;  4IAR A;  3U8P A;  3QVZ A;  2YL7 A;  2J9B A;  1S05 A;  2YL3 A;  3C63 A;  2XLD A;  3QW1 A;  2YKZ A;  1CGN A;  3M4C A;  1E86 A;  1A7V A;  4N4W A;  1QQ3 A;  3M4B A;  2XLO A;  3DE8 A;  1NBB A;  4U9D A;  3ZWI A;  2YLD A;  3IQ6 A;  2XLV A;  5AGF A;  2XLM A;  1E83 A;  2XL8 A;  3L1M A;  1MQV A;  1CGO A;  4JEA A;  2XM4 A;  3TOL A;  4JKV A;  4ER9 A;  4U9E A;  3HNI A;  4JE9 A;  3ZQV A;  3ZTM A;  4L6R A;  2J8W A;  4NC3 A;  3QVY A;  1LM3 B;  2XLE A;  3TOM A;  3ZTZ A;  3FOO A;  2BC5 A;  2XLW A;  4CIP A;  1YYX A;  1EKY A;  3NMJ A;  3IQ5 A;  3NMK A;  1YZC A;  4N6H A;  5JT4 A;  4D4N A;  3C62 A;  1M6T A;  5JP7 A;  4CJO A;  4D4X A;  4IB4 A;  4ULV A;  2CCY A;  3FOP A;  4CDV A;  1JAF A;  2YL0 A;  5JUA A;  3HNK A;  5B3I A;  1CPR A;  4WGY A;  5JLI A;  1YYJ A;  2YLI A;  2XM0 A;  3QW0 A;  3M15 A;  2YLG A;  2YL1 A;  2XLH A;  4CDY A;  3HNL A;  1CPQ A;  4JEB A;  1APC A;  4CDA A;  3HNJ A;  1QPU A;  3ZQY A;  1GQA A;  4CJG A;  1E84 A;  4IAQ A;  1YZA A;  3M79 A;  2XL6 A;  4WGZ A;  2QLA A;  5JVE A;  1E85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...