1JAFA

Crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
128
structure length
128
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cytochrome C' from Rhodocyclus Gelatinosus and Comparison with Other Cytochromes C'
pubmed rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 48
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1jafA00
2XLOA 3QVYA 1YZAA 5JRAA 1E84A 4CDVA 4WGZA 5JUAA 2YL7A 1GQAA 2XLMA 3IQ5A 3TOMA 1LM3B 5B3IA 1A7VA 4CDYA 3HNKA 4CJGA 1CPRA 2XLVA 2YLDA 2XLWA 1CPQA 3HNLA 4D4NA 4N6HA 2YLIA 4JEAA 2XM0A 4JKVA 3ZTZA 4L6RA 3M79A 3QW0A 3FOPA 4U9EA 4ULVA 5JT4A 4IAQA 3C62A 5JS5A 2BC5A 1NBBA 1S05A 4U9DA 2XL6A 1APCA 1E83A 1QPUA 1QQ3A 256BA 2J9BA 3ZQYA 5JSLA 3QVZA 4IARA 4CDAA 4N4WA 2YL3A 3IQ6A 3NMIA 2XL8A 3ZTMA 5AGFA 1YYXA 3DE9A 5JLIA 4CJOA 1BBHA 3M15A 4JE9A 3VRCA 1CGOA 3NMJA 4EIYA 1E86A 3ZWIA 3C63A 2CCYA 3M4BA 3ZQVA 2QLAA 2XLEA 2YL0A 3FOOA 5JVEA 1YYJA 3HNJA 2XLHA 1CGNA 4CIPA 3HNIA 1MQVA 1YZCA 4WGYA 1JAFA 3L1MA 2XM4A 1M6TA 4NC3A 4D4XA 3DE8A 5JP7A 1EKYA 2YKZA 4CX9A 3TOLA 3QW1A 3U8PA 3NMKA 1E85A 2YLGA 2YL1A 3M4CA 4JEBA 2J8WA 2XLDA 4ER9A 4IB4A 1RCPA
chains in the Genus database with same CATH superfamily
1YZAA 4NTBA 2HMZA 5JRAA 1E84A 1UFBA 4WGZA 2P6VA 4JC7A 4DBRA 2EIKC 5JUAA 3EFOB 4OIRF 1GQAA 3RQEA 5FZTA 4QDLA 4MTGA 2HFIA 4GYTA 3TOMA 5B3IA 1NFNA 2LFDA 1HW2A 2IYLD 1K40A 1ZVZA 4GEHA 4MVRA 4O6MA 2R02A 2KW3C 2OG2A 2R25A 1N1CA 1ORYA 3NKDA 4P9TA 4U5CE 3AG2C 4ZLCA 2FFHA 2W4BA 3EZHA 1GGQA 4MVMA 2HZ8A 2YWAA 3V5ZA 5CIVA 4IWBA 3B71A 4Z9IA 3FMSA 3SZRA 2IXMA 2ZXRA 3EG9B 1Q0GA 2HSQA 3GM2A 4JKVA 5L0JA 2ZXPA 1C03A 3EGXB 4PFPA 3RQGA 3PHF2 3EGDA 3POVA 3OEOA 4C7OA 5AC4A 3QW0A 3ZIBA 1PD0A 2YZSA 3K1IC 4JJGA 2Q9AA 1WATA 4E7SA 1U0BB 5L0IA 3U3BA 3QZCA 4YL3A 5T3TA 4PR9A 1KTMA 1L3PA 1OXBA 1QQ3A 2KJGA 1B68A 1FFHA 3CZ6A 4Q4ZF 1ZHXA 1QLEC 1D1CA 1VYKA 2P0NA 3ZQYA 4CBEA 1Q0DA 4J7YA 3T6JA 3N2ZB 4EBJA 1TFOB 4MNDA 1ZZPA 5DQTA 3V5XA 4DOZA 4MW3A 5A6BA 3LLIA 4JTCB 2XXAA 4JW1A 1JRAA 2YL3A 1LPEA 2VH3A 4CJGA 1T6QA 3LAYA 3GODA 4DRHB 1H6GA 4OIQF 3ECSA 5A6JA 2PF4E 3EH2A 3NYLA 4PJLA 3OWTA 4NTFA 1SZIA 3SYNA 3U8VA 2OOCA 3O6XA 4LACB 4BJ6A 2Q3TA 5L3QA 4NY3A 3CAXA 3L34A 4XEKA 3TJ5A 1LIHA 5L0FA 3C18A 2YQYA 1TWGA 2M4EA 3R2PA 1O3UA 1CGOA 1H9TA 1XZQA 4N06A 3TULA 3NMJA 4JJFA 2WZLA 1Z6AA 1TKNA 3O10A 4OIPF 3JRTA 2AVKA 3C63A 2WVOA 3CSKA 3QTHA 1SF8A 2ETSA 5IY5C 2PP4A 5L0CA 5DS6A 3WAQA 2I15A 5E2QA 2YL0A 3FOOA 4F4BA 3S29A 1BDJB 2DB4A 2R9RB 4LDRA 3U3FA 2FGYA 4AE4A 1RMVA 4I3MA 3HNJA 1JMWA 3W8IA 4Z9HA 1BZ4A 1V74B 3AG4C 5DLJA 2WL8A 2ZD9A 4E18A 3M1CB 3RIPA 5KYYB 2HV7A 2TMVP 3HNIA 2H7VC 3MFNA 5E3CA 1U6HA 4WGYA 4MTFA 4OD4A 5A69A 1JPJA 1OQCA 1ZHZA 3AG3C 3WG7C 1OKKA 2XM4A 4NC3A 3CEXA 5GPGB 1JPNA 2UUIA 2EPKX 2NUTA 4K7BA 3RFYA 1AEPA 3I5QA 1MMDA 2EIMC 2FAPB 2Y3GA 4O79A 5CI8A 1WTYA 4YK5A 3SXKA 3TOLA 4BJ5A 2R7SA 4I44A 1QKRA 2HV6A 1RKEB 1HMDA 5A6BD 3QW1A 2X51A 2D4UA 3FXHA 1OKKD 2Q9BA 4E17A 1FNTc 3R7CA 4PFOA 3EHMA 1Z7Qc 2KSFA 4UDVA 3LS1A 1V54C 1G4US 4ONSA 3SNHA 3TD7A 2MWQA 1ZW3A 4ZLDA 1RJ9A 5KYWB 2R7XA 3VF0A 2KGOA 3BRJA 4W8PA 4DRIB 2XS8A 2NSFA 3DAFA 4ER9A 4IB4A 5TJ5E 2BL2A 4MVUA 3QVYA 4YWQA 4JCHA 3DM9B 5FCLA 3DXJF 3C7JA 1RKCA 1OW8A 2YL7A 4MVQA 2AU5A 3IQ5A 1WWPA 1A41A 1R5ID 2A6HF 3HNKA 1RKEA 1FMWA 1CPRA 4ANJA 2XLWA 4G7ZF 3NDBB 1LE4A 2W45A 4EHPA 1VLSA 1S7ZA 1YLMA 1FMVA 2NUPA 3U9JA 5DS4A 1M56C 4D4NA 4C7OB 2OEXA 3MYFA 3S0XA 4W8KA 4E7ZA 4EWCA 1Z63A 2QTVA 2XM0A 3ZTZA 1ZHTA 5F28E 3SP1A 4C3BA 3S9OA 4E0HA 3FOPA 3DJUB 4U9EA 4P6IC 3MX3A 4BJ5C 4XLPF 1OR3A 1LI7A 1G4WR 4PJMA 4CSAC 4JIOA 3RVYA 5JS5A 3B0VC 4O6NA 5B1BC 2NUPB 3KYIA 4U9DA 2V26A 1HW1A 2XL6A 1E83A 1SYQA 256BA 2GFHA 5DQZA 2C03A 2HKVA 2L6FA 2L9JA 2ZPAA 2OJQA 4YJWA 3K33A 4IAOA 1OCOC 4CDAA 3ZG1A 1YDIA 2EILC 4N4WA 1F1MA 3T4RA 3T6BA 5EK0A 3B0UX 4J32B 1YVIA 2Y69C 4KNWA 1BR2A 3IQ6A 3LS0A 1GS9A 2DI3A 2QY9A 1LI5A 1PCXA 2KQ9A 2HJ3A 4CS7A 4MVZA 2CW0F 2G3VA 2B0HA 3GORA 2Q4FA 3HKKA 4G7HF 1TQGA 3DD7A 5AC5A 1YYXA 3DZAA 4BJ6C 4RD9A 1BBHA 3C8ZA 1OW7A 2HSBA 2JD3A 2Y3BA 4XEFA 3S27A 1G8XA 4YT5A 4G0HA 2Q7RA 1RXQA 2IXPA 3VYWA 3KKBA 2R7OA 3LESA 3ZWIA 2R7TA 3EH1A 1UG7A 3BEHA 3L8IA 4OIOF 3ITFA 4GQHA 3EPVA 3KYJA 3HLZA 2IXNA 1NU9C 1SR2A 4BEJA 4CIHA 1E2XA 2KNHA 2CDQA 5B3SC 1YYJA 2G62A 3MBGA 4U5FE 2JPUA 3JCUQ 4NQFA 3TQOA 2V3CC 2LQGA 1MNEA 1O5HA 1CGNA 3H2VA 1V4AA 3C8GB 3IPMO 1ZHYA 3KPHA 3IHUA 4O7GA 1TFKB 3I5PA 4AE4B 1MQVA 1ZU4A 3KL4A 4P9FA 4YN0B 1VMAA 1GM5A 2OEVA 4KBLA 5L0DA 3UMHA 5DS5A 3UR3C 3X1OA 2IOQA 1OCZC 4D4XA 3DE8A 3C8GD 2WZGA 2VC9A 4BG0A 3IQTA 2Y3DA 2YKZA 3EJNA 4U5HA 4WJ0A 4CX9A 2YEVA 3Q6MA 2A1DD 1ORSC 4U5EE 3U9MA 1M2VB 2L81A 1XWJA 3ASNC 2P61A 2W9YA 3GEEA 2J46A 1OCCC 1ZW2A 5E33A 3SXZA 4OINF 4LERA 4NTAA 4Q7CA 4BJ1A 5L0HA 3JYHA 2CNWD 2DYRC 3PCVA 2IBFA 4XLNF 5KYNA 2KC3A 1DOWA 3LNRA 5T1DB 2OKUA 1LKXA 3TJ6A 2LK4A 4DJ9A 2J8WA 3RYLA 2A68F 2XLDA 1T5OA 3T9OA 3E70C 3NYMA 1OXKA 3T6GB 4C3EA 1TWHA 3Q7GA 3RQFA 1VYIA 1WGWA 1VK5A 2GDCA 2XLOA 1WOLA 4YL1A 3U2LA 4CDVA 1EI7A 1J8YF 1LVKA 4XPYA 5F5FA 2QUPA 4HE8D 4YT8A 2P1AA 3U2MA 2Q00A 2PFDA 4H54A 1LM3B 1A7VA 4CDYA 5BUOA 3S90A 3AQBA 3DI5A 2XLVA 3VAYA 4EBKA 1D0ZA 3JRMO 2OCCC 3S28A 3K66A 2EPNA 1FFTC 3HNLA 2XSEA 1BR1A 4CS9C 4N6HA 3HTKC 2YLIA 1T9KA 5CI9A 3FAJA 4U5BE 2ICWG 4JEAA 5F5HA 1M2VA 4FWVA 2Y3HA 4L6RA 3ZC4A 3M79A 2EPOA 2B0JA 4LLCA 3J06A 2H7OA 4ULVA 3ABMC 4KI2A 3C62A 4DVZA 3JT1A 4I1MA 2MYSA 2VCCA 4U5GA 4QI0A 3LUTB 1APCA 2D5RB 3A11A 5D91A 4R32A 1VTMP 2HMQA 2AWYA 3SXYA 1T6IA 4X0RA 2J9BA 2WB7A 1D1BA 4JRZA 3KMIA 4IARA 2XL4A 3AGUA 2Y39A 4BPMA 2H8AA 3F47A 4CS8C 1VOMA 1I4ZA 1VLTA 3H2UA 2HS5A 3A9CA 4CSAA 3G50A 5KYUA 1NZEA 2WZFA 2L6HA 2MHRA 1I5NA 2WVQA 3NMIA 3K7DA 2OQMA 4K1OA 3US6A 4PACA 2X0CA 4JURI 4AL1A 1KU2A 3JTLO 2J0WA 1QSPA 5KYYA 3ZTMA 4YT2A 4A2NB 2P7VA 3NG1A 1NFOA 2HJMA 1TWAA 1NU7D 4KNVA 3UGOA 3DAGA 1Q0MA 4E0IA 1YARO 2L7AA 1Z3IX 3M15A 5A6KA 3VRCA 1FAPB 5COMA 3EZIA 5B1AC 2H7BA 4A4AA 3W4YA 1E86A 1IZMA 1HE1A 2CCYA 2EPMX 4HFKB 4XPWA 3M4BA 3ZQVA 3IQCA 1Q0FA 2QLAA 2XLEA 4PK4A 2LFFA 4EUKB 1H7IA 4AK9A 5BQIA 2J0XA 2BE5F 3Q7LA 1CGME 2JX0A 2XLHA 2WVNA 3UMKA 1NSGB 1AUEA 4DXWA 5BQHA 2ASRA 1YZCA 1KNYA 3N24A 1G5ZA 4LDQA 4JTAB 4MS2A 5K0IA 3MLGA 3V7OA 2EPLX 3H65A 4G7OF 4G78A 5JP7A 1ZHWA 3AOUA 1JR8A 1DOVA 5EHHA 4LDKA 1Z23A 1MMAA 1D1AA 3DM5A 1I4YA 3EG9A 1K05A 4MTOA 3UGPA 3PMRA 2CYDA 2PBEA 1ZU5A 2A69F 1R4TA 2J9WA 3NYJA 1M2OA 1U89A 2PX0A 3ABKC 4NCQA 1YA7O 2Q9CA 1FR0A 5KYXA 3ASOC 4JCZA 1HE9A 3EFOA 4N6CA 4JTDB 3SXMA 4J30B 3V5YA 2R7VA 1ST6A 2YL1A 3NRHA 2O9XA 4JEBA 3WHNA 4K0DA 4I1OB 5BQGA 2NUTB 1C02A 2A0BA 2QE9A 3UNGC 4DRJB 3PDMP 3ZSUA 2M64A 3RH3A 1OR2A 3Q6NA 3X2QC 4EKWA 3RF3A 3JZ0A 5T3WA 3WODF 1YA9A 1IW7F 1HMOA 2R05A 2R7QA 2XLMA 3FDQA 4LLEA 3SEOA 2LP4A 3W2WA 2R7WA 1O87A 2CGEA 3LJBA 4DVYP 3K1IA 1BR4A 1T01A 2LCHA 2LD6A 2QNLA 2YHSA 3G4XA 4JZAA 4M63A 2YLDA 3ABLC 3DWWA 4MW8A 5L0GA 4IGGA 4RBNA 1CPQA 3JSEO 4Q5SF 4WABA 2VASA 3FHDA 3TK0A 1QVXA 4FESA 2G3KA 4CS9A 1MMNA 3AG1C 1EQ1A 4IJJA 1L7CA 3GANA 4J7TA 5KYWA 1NG1A 5E3AA 5HSWA 4YT4A 3U0CA 4XEVA 2OU6A 3E9VA 1VB5A 2F22A 3GEHA 3K1HA 4FAPB 5JT4A 3JSZA 4IAQA 2GA0A 3K6BA 2BC5A 2DGJA 3DMDA 1NBBA 1OCRC 1LE2A 1S05A 1LS4A 1A7EA 2J9UA 4MQ9F 1M57C 4HEAJ 1QPUA 2OJED 1K04A 1WN0A 3GM3A 4ULWA 2GWWA 1OW6A 2AWCA 1YJGA 5JSLA 3QVZA 2NSGA 1WASA 1A0BA 4JVSA 3L0IA 3ATPA 3FAPB 4MVOA 1H9GA 2XRHA 3AJMA 5D92A 4AX2A 2RD9A 2R7RA 4IRUA 2CNWA 2XS1A 3JYYA 3O39A 2GAQA 3GWLA 3G4ZA 4YL0A 3HJCA 1MMGA 1NLXA 2NPUA 3GWNA 3L8JA 4H4KC 1JOGA 3RVZA 3S84A 4XTKA 3ZVRA 5EGYA 4Z9JA 2PNOA 2J7PA 3AQCA 1Z5ZA 2XL8A 4PJJA 4XQ1A 5DVWA 3I4UA 4XPXA 1AVOB 3W2VA 5AGFA 5COFA 1SMYF 3DE9A 2DYSC 5JLIA 5KYXB 3C8GA 4CJOA 1PV3A 3LLKA 4JE9A 2IM8A 3CQZA 4CS8A 1XZPA 3O55A 5A6AA 4DBQA 1ORJA 3AGTA 4EIYA 3FVYA 3EGDB 1C17M 3KH2A 2I8BA 1FTSA 2W4MA 3EHNA 2IXOA 2RSEB 2A6EF 2C04A 3B29A 4MVSA 3DKAA 4O6YA 2NG1A 5COGA 5HV9A 2LSEA 1RJ9B 2KYHA 4HFFB 2R7UA 1TWCA 2KK1A 4BJTA 5JVEA 3NKEA 1ZYRF 1YAUO 1V55C 2R03A 2VCBA 4QI2A 2AP3A 2ZXOA 4CIPA 2LIGA 3OA1A 1J8MF 2A0UA 2L6GA 3LEOA 1W2WA 1A7DA 1JAFA 2J7PD 3U5SA 1PD1A 3UMIA 1D0XA 3ZDLA 5L3VA 3L1MA 4FX5A 4U5DE 4EBBA 2XXAB 3B0PA 1M6TA 1MNDA 1EA8A 4BEMJ 2VCAA 3W8HA 4B6IA 1EKYA 5KYUB 2UUHA 3F46A 2J9VA 4AL0A 4PJNA 3EGXA 1TR2A 2HUJA 2YRFA 1Y6DA 4OD5A 3LNMB 2YVKA 4XWJA 3GM1A 2EINC 1D0YA 3U8PA 3IEEA 3RW0A 3DJNB 1T6UA 3MYIA 3NMKA 4KC9A 1HY5A 3EQLF 2PX3A 2ZXWC 3LEVA 1E85A 2YLGA 3GEIA 2EIJC 3RKOF 3QMKA 1QZXA 2E87A 3M4CA 2Z15A 3N0TA 2J45A 1LS1A 1Y4CA 3VM6A 2VB6A 4C3DA 1Q0KA 3B9QA 4RDAA 1RCPA
chains in the Genus database with same CATH topology
2XLOA 3QVYA 1YZAA 5JRAA 1E84A 4CDVA 4WGZA 5JUAA 2YL7A 1GQAA 2XLMA 3IQ5A 3TOMA 1LM3B 5B3IA 1A7VA 4CDYA 3HNKA 4CJGA 1CPRA 2XLVA 2YLDA 2XLWA 1CPQA 3HNLA 4D4NA 4N6HA 2YLIA 4JEAA 2XM0A 4JKVA 3ZTZA 4L6RA 3M79A 3QW0A 3FOPA 4U9EA 4ULVA 5JT4A 4IAQA 3C62A 5JS5A 2BC5A 1NBBA 1S05A 4U9DA 2XL6A 1APCA 1E83A 1QPUA 1QQ3A 256BA 2J9BA 3ZQYA 5JSLA 3QVZA 4IARA 4CDAA 4N4WA 2YL3A 3IQ6A 3NMIA 2XL8A 3ZTMA 5AGFA 1YYXA 3DE9A 5JLIA 4CJOA 1BBHA 3M15A 4JE9A 3VRCA 1CGOA 3NMJA 4EIYA 1E86A 3ZWIA 3C63A 2CCYA 3M4BA 3ZQVA 2QLAA 2XLEA 2YL0A 3FOOA 5JVEA 1YYJA 3HNJA 2XLHA 1CGNA 4CIPA 3HNIA 1MQVA 1YZCA 4WGYA 1JAFA 3L1MA 2XM4A 1M6TA 4NC3A 4D4XA 3DE8A 5JP7A 1EKYA 2YKZA 4CX9A 3TOLA 3QW1A 3U8PA 3NMKA 1E85A 2YLGA 2YL1A 3M4CA 4JEBA 2J8WA 2XLDA 4ER9A 4IB4A 1RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLO A;  3QVY A;  1YZA A;  5JRA A;  1E84 A;  4CDV A;  4WGZ A;  5JUA A;  2YL7 A;  1GQA A;  2XLM A;  3IQ5 A;  3TOM A;  1LM3 B;  5B3I A;  1A7V A;  4CDY A;  3HNK A;  4CJG A;  1CPR A;  2XLV A;  2YLD A;  2XLW A;  1CPQ A;  3HNL A;  4D4N A;  4N6H A;  2YLI A;  4JEA A;  2XM0 A;  4JKV A;  3ZTZ A;  4L6R A;  3M79 A;  3QW0 A;  3FOP A;  4U9E A;  4ULV A;  5JT4 A;  4IAQ A;  3C62 A;  5JS5 A;  2BC5 A;  1NBB A;  1S05 A;  4U9D A;  2XL6 A;  1APC A;  1E83 A;  1QPU A;  1QQ3 A;  256B A;  2J9B A;  3ZQY A;  5JSL A;  3QVZ A;  4IAR A;  4CDA A;  4N4W A;  2YL3 A;  3IQ6 A;  3NMI A;  2XL8 A;  3ZTM A;  5AGF A;  1YYX A;  3DE9 A;  5JLI A;  4CJO A;  1BBH A;  3M15 A;  4JE9 A;  3VRC A;  1CGO A;  3NMJ A;  4EIY A;  1E86 A;  3ZWI A;  3C63 A;  2CCY A;  3M4B A;  3ZQV A;  2QLA A;  2XLE A;  2YL0 A;  3FOO A;  5JVE A;  1YYJ A;  3HNJ A;  2XLH A;  1CGN A;  4CIP A;  3HNI A;  1MQV A;  1YZC A;  4WGY A;  1JAF A;  3L1M A;  2XM4 A;  1M6T A;  4NC3 A;  4D4X A;  3DE8 A;  5JP7 A;  1EKY A;  2YKZ A;  4CX9 A;  3TOL A;  3QW1 A;  3U8P A;  3NMK A;  1E85 A;  2YLG A;  2YL1 A;  3M4C A;  4JEB A;  2J8W A;  2XLD A;  4ER9 A;  4IB4 A;  1RCP A; 
#chains in the Genus database with same CATH topology
 1YZA A;  4NTB A;  2HMZ A;  5JRA A;  1E84 A;  1UFB A;  4WGZ A;  2P6V A;  4JC7 A;  4DBR A;  2EIK C;  5JUA A;  3EFO B;  4OIR F;  1GQA A;  3RQE A;  5FZT A;  4QDL A;  4MTG A;  2HFI A;  4GYT A;  3TOM A;  5B3I A;  1NFN A;  2LFD A;  1HW2 A;  2IYL D;  1K40 A;  1ZVZ A;  4GEH A;  4MVR A;  4O6M A;  2R02 A;  2KW3 C;  2OG2 A;  2R25 A;  1N1C A;  1ORY A;  3NKD A;  4P9T A;  4U5C E;  3AG2 C;  4ZLC A;  2FFH A;  2W4B A;  3EZH A;  1GGQ A;  4MVM A;  2HZ8 A;  2YWA A;  3V5Z A;  5CIV A;  4IWB A;  3B71 A;  4Z9I A;  3FMS A;  3SZR A;  2IXM A;  2ZXR A;  3EG9 B;  1Q0G A;  2HSQ A;  3GM2 A;  4JKV A;  5L0J A;  2ZXP A;  1C03 A;  3EGX B;  4PFP A;  3RQG A;  3PHF 2;  3EGD A;  3POV A;  3OEO A;  4C7O A;  5AC4 A;  3QW0 A;  3ZIB A;  1PD0 A;  2YZS A;  3K1I C;  4JJG A;  2Q9A A;  1WAT A;  4E7S A;  1U0B B;  5L0I A;  3U3B A;  3QZC A;  4YL3 A;  5T3T A;  4PR9 A;  1KTM A;  1L3P A;  1OXB A;  1QQ3 A;  2KJG A;  1B68 A;  1FFH A;  3CZ6 A;  4Q4Z F;  1ZHX A;  1QLE C;  1D1C A;  1VYK A;  2P0N A;  3ZQY A;  4CBE A;  1Q0D A;  4J7Y A;  3T6J A;  3N2Z B;  4EBJ A;  1TFO B;  4MND A;  1ZZP A;  5DQT A;  3V5X A;  4DOZ A;  4MW3 A;  5A6B A;  3LLI A;  4JTC B;  2XXA A;  4JW1 A;  1JRA A;  2YL3 A;  1LPE A;  2VH3 A;  4CJG A;  1T6Q A;  3LAY A;  3GOD A;  4DRH B;  1H6G A;  4OIQ F;  3ECS A;  5A6J A;  2PF4 E;  3EH2 A;  3NYL A;  4PJL A;  3OWT A;  4NTF A;  1SZI A;  3SYN A;  3U8V A;  2OOC A;  3O6X A;  4LAC B;  4BJ6 A;  2Q3T A;  5L3Q A;  4NY3 A;  3CAX A;  3L34 A;  4XEK A;  3TJ5 A;  1LIH A;  5L0F A;  3C18 A;  2YQY A;  1TWG A;  2M4E A;  3R2P A;  1O3U A;  1CGO A;  1H9T A;  1XZQ A;  4N06 A;  3TUL A;  3NMJ A;  4JJF A;  2WZL A;  1Z6A A;  1TKN A;  3O10 A;  4OIP F;  3JRT A;  2AVK A;  3C63 A;  2WVO A;  3CSK A;  3QTH A;  1SF8 A;  2ETS A;  5IY5 C;  2PP4 A;  5L0C A;  5DS6 A;  3WAQ A;  2I15 A;  5E2Q A;  2YL0 A;  3FOO A;  4F4B A;  3S29 A;  1BDJ B;  2DB4 A;  2R9R B;  4LDR A;  3U3F A;  2FGY A;  4AE4 A;  1RMV A;  4I3M A;  3HNJ A;  1JMW A;  3W8I A;  4Z9H A;  1BZ4 A;  1V74 B;  3AG4 C;  5DLJ A;  2WL8 A;  2ZD9 A;  4E18 A;  3M1C B;  3RIP A;  5KYY B;  2HV7 A;  2TMV P;  3HNI A;  2H7V C;  3MFN A;  5E3C A;  1U6H A;  4WGY A;  4MTF A;  4OD4 A;  5A69 A;  1JPJ A;  1OQC A;  1ZHZ A;  3AG3 C;  3WG7 C;  1OKK A;  2XM4 A;  4NC3 A;  3CEX A;  5GPG B;  1JPN A;  2UUI A;  2EPK X;  2NUT A;  4K7B A;  3RFY A;  1AEP A;  3I5Q A;  1MMD A;  2EIM C;  2FAP B;  2Y3G A;  4O79 A;  5CI8 A;  1WTY A;  4YK5 A;  3SXK A;  3TOL A;  4BJ5 A;  2R7S A;  4I44 A;  1QKR A;  2HV6 A;  1RKE B;  1HMD A;  5A6B D;  3QW1 A;  2X51 A;  2D4U A;  3FXH A;  1OKK D;  2Q9B A;  4E17 A;  1FNT c;  3R7C A;  4PFO A;  3EHM A;  1Z7Q c;  2KSF A;  4UDV A;  3LS1 A;  1V54 C;  1G4U S;  4ONS A;  3SNH A;  3TD7 A;  2MWQ A;  1ZW3 A;  4ZLD A;  1RJ9 A;  5KYW B;  2R7X A;  3VF0 A;  2KGO A;  3BRJ A;  4W8P A;  4DRI B;  2XS8 A;  2NSF A;  3DAF A;  4ER9 A;  4IB4 A;  5TJ5 E;  2BL2 A;  4MVU A;  3QVY A;  4YWQ A;  4JCH A;  3DM9 B;  5FCL A;  3DXJ F;  3C7J A;  1RKC A;  1OW8 A;  2YL7 A;  4MVQ A;  2AU5 A;  3IQ5 A;  1WWP A;  1A41 A;  1R5I D;  2A6H F;  3HNK A;  1RKE A;  1FMW A;  1CPR A;  4ANJ A;  2XLW A;  4G7Z F;  3NDB B;  1LE4 A;  2W45 A;  4EHP A;  1VLS A;  1S7Z A;  1YLM A;  1FMV A;  2NUP A;  3U9J A;  5DS4 A;  1M56 C;  4D4N A;  4C7O B;  2OEX A;  3MYF A;  3S0X A;  4W8K A;  4E7Z A;  4EWC A;  1Z63 A;  2QTV A;  2XM0 A;  3ZTZ A;  1ZHT A;  5F28 E;  3SP1 A;  4C3B A;  3S9O A;  4E0H A;  3FOP A;  3DJU B;  4U9E A;  4P6I C;  3MX3 A;  4BJ5 C;  4XLP F;  1OR3 A;  1LI7 A;  1G4W R;  4PJM A;  4CSA C;  4JIO A;  3RVY A;  5JS5 A;  3B0V C;  4O6N A;  5B1B C;  2NUP B;  3KYI A;  4U9D A;  2V26 A;  1HW1 A;  2XL6 A;  1E83 A;  1SYQ A;  256B A;  2GFH A;  5DQZ A;  2C03 A;  2HKV A;  2L6F A;  2L9J A;  2ZPA A;  2OJQ A;  4YJW A;  3K33 A;  4IAO A;  1OCO C;  4CDA A;  3ZG1 A;  1YDI A;  2EIL C;  4N4W A;  1F1M A;  3T4R A;  3T6B A;  5EK0 A;  3B0U X;  4J32 B;  1YVI A;  2Y69 C;  4KNW A;  1BR2 A;  3IQ6 A;  3LS0 A;  1GS9 A;  2DI3 A;  2QY9 A;  1LI5 A;  1PCX A;  2KQ9 A;  2HJ3 A;  4CS7 A;  4MVZ A;  2CW0 F;  2G3V A;  2B0H A;  3GOR A;  2Q4F A;  3HKK A;  4G7H F;  1TQG A;  3DD7 A;  5AC5 A;  1YYX A;  3DZA A;  4BJ6 C;  4RD9 A;  1BBH A;  3C8Z A;  1OW7 A;  2HSB A;  2JD3 A;  2Y3B A;  4XEF A;  3S27 A;  1G8X A;  4YT5 A;  4G0H A;  2Q7R A;  1RXQ A;  2IXP A;  3VYW A;  3KKB A;  2R7O A;  3LES A;  3ZWI A;  2R7T A;  3EH1 A;  1UG7 A;  3BEH A;  3L8I A;  4OIO F;  3ITF A;  4GQH A;  3EPV A;  3KYJ A;  3HLZ A;  2IXN A;  1NU9 C;  1SR2 A;  4BEJ A;  4CIH A;  1E2X A;  2KNH A;  2CDQ A;  5B3S C;  1YYJ A;  2G62 A;  3MBG A;  4U5F E;  2JPU A;  3JCU Q;  4NQF A;  3TQO A;  2V3C C;  2LQG A;  1MNE A;  1O5H A;  1CGN A;  3H2V A;  1V4A A;  3C8G B;  3IPM O;  1ZHY A;  3KPH A;  3IHU A;  4O7G A;  1TFK B;  3I5P A;  4AE4 B;  1MQV A;  1ZU4 A;  3KL4 A;  4P9F A;  4YN0 B;  1VMA A;  1GM5 A;  2OEV A;  4KBL A;  5L0D A;  3UMH A;  5DS5 A;  3UR3 C;  3X1O A;  2IOQ A;  1OCZ C;  4D4X A;  3DE8 A;  3C8G D;  2WZG A;  2VC9 A;  4BG0 A;  3IQT A;  2Y3D A;  2YKZ A;  3EJN A;  4U5H A;  4WJ0 A;  4CX9 A;  2YEV A;  3Q6M A;  2A1D D;  1ORS C;  4U5E E;  3U9M A;  1M2V B;  2L81 A;  1XWJ A;  3ASN C;  2P61 A;  2W9Y A;  3GEE A;  2J46 A;  1OCC C;  1ZW2 A;  5E33 A;  3SXZ A;  4OIN F;  4LER A;  4NTA A;  4Q7C A;  4BJ1 A;  5L0H A;  3JYH A;  2CNW D;  2DYR C;  3PCV A;  2IBF A;  4XLN F;  5KYN A;  2KC3 A;  1DOW A;  3LNR A;  5T1D B;  2OKU A;  1LKX A;  3TJ6 A;  2LK4 A;  4DJ9 A;  2J8W A;  3RYL A;  2A68 F;  2XLD A;  1T5O A;  3T9O A;  3E70 C;  3NYM A;  1OXK A;  3T6G B;  4C3E A;  1TWH A;  3Q7G A;  3RQF A;  1VYI A;  1WGW A;  1VK5 A;  2GDC A;  2XLO A;  1WOL A;  4YL1 A;  3U2L A;  4CDV A;  1EI7 A;  1J8Y F;  1LVK A;  4XPY A;  5F5F A;  2QUP A;  4HE8 D;  4YT8 A;  2P1A A;  3U2M A;  2Q00 A;  2PFD A;  4H54 A;  1LM3 B;  1A7V A;  4CDY A;  5BUO A;  3S90 A;  3AQB A;  3DI5 A;  2XLV A;  3VAY A;  4EBK A;  1D0Z A;  3JRM O;  2OCC C;  3S28 A;  3K66 A;  2EPN A;  1FFT C;  3HNL A;  2XSE A;  1BR1 A;  4CS9 C;  4N6H A;  3HTK C;  2YLI A;  1T9K A;  5CI9 A;  3FAJ A;  4U5B E;  2ICW G;  4JEA A;  5F5H A;  1M2V A;  4FWV A;  2Y3H A;  4L6R A;  3ZC4 A;  3M79 A;  2EPO A;  2B0J A;  4LLC A;  3J06 A;  2H7O A;  4ULV A;  3ABM C;  4KI2 A;  3C62 A;  4DVZ A;  3JT1 A;  4I1M A;  2MYS A;  2VCC A;  4U5G A;  4QI0 A;  3LUT B;  1APC A;  2D5R B;  3A11 A;  5D91 A;  4R32 A;  1VTM P;  2HMQ A;  2AWY A;  3SXY A;  1T6I A;  4X0R A;  2J9B A;  2WB7 A;  1D1B A;  4JRZ A;  3KMI A;  4IAR A;  2XL4 A;  3AGU A;  2Y39 A;  4BPM A;  2H8A A;  3F47 A;  4CS8 C;  1VOM A;  1I4Z A;  1VLT A;  3H2U A;  2HS5 A;  3A9C A;  4CSA A;  3G50 A;  5KYU A;  1NZE A;  2WZF A;  2L6H A;  2MHR A;  1I5N A;  2WVQ A;  3NMI A;  3K7D A;  2OQM A;  4K1O A;  3US6 A;  4PAC A;  2X0C A;  4JUR I;  4AL1 A;  1KU2 A;  3JTL O;  2J0W A;  1QSP A;  5KYY A;  3ZTM A;  4YT2 A;  4A2N B;  2P7V A;  3NG1 A;  1NFO A;  2HJM A;  1TWA A;  1NU7 D;  4KNV A;  3UGO A;  3DAG A;  1Q0M A;  4E0I A;  1YAR O;  2L7A A;  1Z3I X;  3M15 A;  5A6K A;  3VRC A;  1FAP B;  5COM A;  3EZI A;  5B1A C;  2H7B A;  4A4A A;  3W4Y A;  1E86 A;  1IZM A;  1HE1 A;  2CCY A;  2EPM X;  4HFK B;  4XPW A;  3M4B A;  3ZQV A;  3IQC A;  1Q0F A;  2QLA A;  2XLE A;  4PK4 A;  2LFF A;  4EUK B;  1H7I A;  4AK9 A;  5BQI A;  2J0X A;  2BE5 F;  3Q7L A;  1CGM E;  2JX0 A;  2XLH A;  2WVN A;  3UMK A;  1NSG B;  1AUE A;  4DXW A;  5BQH A;  2ASR A;  1YZC A;  1KNY A;  3N24 A;  1G5Z A;  4LDQ A;  4JTA B;  4MS2 A;  5K0I A;  3MLG A;  3V7O A;  2EPL X;  3H65 A;  4G7O F;  4G78 A;  5JP7 A;  1ZHW A;  3AOU A;  1JR8 A;  1DOV A;  5EHH A;  4LDK A;  1Z23 A;  1MMA A;  1D1A A;  3DM5 A;  1I4Y A;  3EG9 A;  1K05 A;  4MTO A;  3UGP A;  3PMR A;  2CYD A;  2PBE A;  1ZU5 A;  2A69 F;  1R4T A;  2J9W A;  3NYJ A;  1M2O A;  1U89 A;  2PX0 A;  3ABK C;  4NCQ A;  1YA7 O;  2Q9C A;  1FR0 A;  5KYX A;  3ASO C;  4JCZ A;  1HE9 A;  3EFO A;  4N6C A;  4JTD B;  3SXM A;  4J30 B;  3V5Y A;  2R7V A;  1ST6 A;  2YL1 A;  3NRH A;  2O9X A;  4JEB A;  3WHN A;  4K0D A;  4I1O B;  5BQG A;  2NUT B;  1C02 A;  2A0B A;  2QE9 A;  3UNG C;  4DRJ B;  3PDM P;  3ZSU A;  2M64 A;  3RH3 A;  1OR2 A;  3Q6N A;  3X2Q C;  4EKW A;  3RF3 A;  3JZ0 A;  5T3W A;  3WOD F;  1YA9 A;  1IW7 F;  1HMO A;  2R05 A;  2R7Q A;  2XLM A;  3FDQ A;  4LLE A;  3SEO A;  2LP4 A;  3W2W A;  2R7W A;  1O87 A;  2CGE A;  3LJB A;  4DVY P;  3K1I A;  1BR4 A;  1T01 A;  2LCH A;  2LD6 A;  2QNL A;  2YHS A;  3G4X A;  4JZA A;  4M63 A;  2YLD A;  3ABL C;  3DWW A;  4MW8 A;  5L0G A;  4IGG A;  4RBN A;  1CPQ A;  3JSE O;  4Q5S F;  4WAB A;  2VAS A;  3FHD A;  3TK0 A;  1QVX A;  4FES A;  2G3K A;  4CS9 A;  1MMN A;  3AG1 C;  1EQ1 A;  4IJJ A;  1L7C A;  3GAN A;  4J7T A;  5KYW A;  1NG1 A;  5E3A A;  5HSW A;  4YT4 A;  3U0C A;  4XEV A;  2OU6 A;  3E9V A;  1VB5 A;  2F22 A;  3GEH A;  3K1H A;  4FAP B;  5JT4 A;  3JSZ A;  4IAQ A;  2GA0 A;  3K6B A;  2BC5 A;  2DGJ A;  3DMD A;  1NBB A;  1OCR C;  1LE2 A;  1S05 A;  1LS4 A;  1A7E A;  2J9U A;  4MQ9 F;  1M57 C;  4HEA J;  1QPU A;  2OJE D;  1K04 A;  1WN0 A;  3GM3 A;  4ULW A;  2GWW A;  1OW6 A;  2AWC A;  1YJG A;  5JSL A;  3QVZ A;  2NSG A;  1WAS A;  1A0B A;  4JVS A;  3L0I A;  3ATP A;  3FAP B;  4MVO A;  1H9G A;  2XRH A;  3AJM A;  5D92 A;  4AX2 A;  2RD9 A;  2R7R A;  4IRU A;  2CNW A;  2XS1 A;  3JYY A;  3O39 A;  2GAQ A;  3GWL A;  3G4Z A;  4YL0 A;  3HJC A;  1MMG A;  1NLX A;  2NPU A;  3GWN A;  3L8J A;  4H4K C;  1JOG A;  3RVZ A;  3S84 A;  4XTK A;  3ZVR A;  5EGY A;  4Z9J A;  2PNO A;  2J7P A;  3AQC A;  1Z5Z A;  2XL8 A;  4PJJ A;  4XQ1 A;  5DVW A;  3I4U A;  4XPX A;  1AVO B;  3W2V A;  5AGF A;  5COF A;  1SMY F;  3DE9 A;  2DYS C;  5JLI A;  5KYX B;  3C8G A;  4CJO A;  1PV3 A;  3LLK A;  4JE9 A;  2IM8 A;  3CQZ A;  4CS8 A;  1XZP A;  3O55 A;  5A6A A;  4DBQ A;  1ORJ A;  3AGT A;  4EIY A;  3FVY A;  3EGD B;  1C17 M;  3KH2 A;  2I8B A;  1FTS A;  2W4M A;  3EHN A;  2IXO A;  2RSE B;  2A6E F;  2C04 A;  3B29 A;  4MVS A;  3DKA A;  4O6Y A;  2NG1 A;  5COG A;  5HV9 A;  2LSE A;  1RJ9 B;  2KYH A;  4HFF B;  2R7U A;  1TWC A;  2KK1 A;  4BJT A;  5JVE A;  3NKE A;  1ZYR F;  1YAU O;  1V55 C;  2R03 A;  2VCB A;  4QI2 A;  2AP3 A;  2ZXO A;  4CIP A;  2LIG A;  3OA1 A;  1J8M F;  2A0U A;  2L6G A;  3LEO A;  1W2W A;  1A7D A;  1JAF A;  2J7P D;  3U5S A;  1PD1 A;  3UMI A;  1D0X A;  3ZDL A;  5L3V A;  3L1M A;  4FX5 A;  4U5D E;  4EBB A;  2XXA B;  3B0P A;  1M6T A;  1MND A;  1EA8 A;  4BEM J;  2VCA A;  3W8H A;  4B6I A;  1EKY A;  5KYU B;  2UUH A;  3F46 A;  2J9V A;  4AL0 A;  4PJN A;  3EGX A;  1TR2 A;  2HUJ A;  2YRF A;  1Y6D A;  4OD5 A;  3LNM B;  2YVK A;  4XWJ A;  3GM1 A;  2EIN C;  1D0Y A;  3U8P A;  3IEE A;  3RW0 A;  3DJN B;  1T6U A;  3MYI A;  3NMK A;  4KC9 A;  1HY5 A;  3EQL F;  2PX3 A;  2ZXW C;  3LEV A;  1E85 A;  2YLG A;  3GEI A;  2EIJ C;  3RKO F;  3QMK A;  1QZX A;  2E87 A;  3M4C A;  2Z15 A;  3N0T A;  2J45 A;  1LS1 A;  1Y4C A;  3VM6 A;  2VB6 A;  4C3D A;  1Q0K A;  3B9Q A;  4RDA A;  1RCP A; 
#chains in the Genus database with same CATH homology
 2XLO A;  3QVY A;  1YZA A;  5JRA A;  1E84 A;  4CDV A;  4WGZ A;  5JUA A;  2YL7 A;  1GQA A;  2XLM A;  3IQ5 A;  3TOM A;  1LM3 B;  5B3I A;  1A7V A;  4CDY A;  3HNK A;  4CJG A;  1CPR A;  2XLV A;  2YLD A;  2XLW A;  1CPQ A;  3HNL A;  4D4N A;  4N6H A;  2YLI A;  4JEA A;  2XM0 A;  4JKV A;  3ZTZ A;  4L6R A;  3M79 A;  3QW0 A;  3FOP A;  4U9E A;  4ULV A;  5JT4 A;  4IAQ A;  3C62 A;  5JS5 A;  2BC5 A;  1NBB A;  1S05 A;  4U9D A;  2XL6 A;  1APC A;  1E83 A;  1QPU A;  1QQ3 A;  256B A;  2J9B A;  3ZQY A;  5JSL A;  3QVZ A;  4IAR A;  4CDA A;  4N4W A;  2YL3 A;  3IQ6 A;  3NMI A;  2XL8 A;  3ZTM A;  5AGF A;  1YYX A;  3DE9 A;  5JLI A;  4CJO A;  1BBH A;  3M15 A;  4JE9 A;  3VRC A;  1CGO A;  3NMJ A;  4EIY A;  1E86 A;  3ZWI A;  3C63 A;  2CCY A;  3M4B A;  3ZQV A;  2QLA A;  2XLE A;  2YL0 A;  3FOO A;  5JVE A;  1YYJ A;  3HNJ A;  2XLH A;  1CGN A;  4CIP A;  3HNI A;  1MQV A;  1YZC A;  4WGY A;  1JAF A;  3L1M A;  2XM4 A;  1M6T A;  4NC3 A;  4D4X A;  3DE8 A;  5JP7 A;  1EKY A;  2YKZ A;  4CX9 A;  3TOL A;  3QW1 A;  3U8P A;  3NMK A;  1E85 A;  2YLG A;  2YL1 A;  3M4C A;  4JEB A;  2J8W A;  2XLD A;  4ER9 A;  4IB4 A;  1RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...