1JAFA

Crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
128
structure length
128
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Crystal Structure of Cytochrome C' from Rhodocyclus Gelatinosus and Comparison with Other Cytochromes C'
pubmed rcsb
total genus 48
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1jafA00
1APCA 2XLMA 3M79A 1E84A 3NMIA 3DE9A 2YKZA 5JUAA 3HNJA 4CDVA 2XLEA 2YLDA 1YYJA 2XL8A 4IAQA 2YL0A 3IQ6A 2XLVA 4NC3A 4JKVA 4WGZA 3ZTZA 2YLIA 4IB4A 1E86A 2YL7A 1RCPA 3QVZA 4CDYA 3VRCA 1S05A 3TOMA 5JS5A 1GQAA 2XM4A 3FOPA 1A7VA 2XLHA 5JRAA 3M4CA 3ZTMA 3DE8A 2XLDA 3NMKA 5JSLA 4CIPA 2YLGA 1BBHA 3U8PA 4JE9A 1YZAA 4D4NA 2J9BA 5JLIA 4L6RA 3NMJA 4CJGA 1CPQA 1YZCA 4U9DA 4WGYA 4N4WA 2XM0A 3QVYA 3M4BA 2YL3A 4ER9A 1E85A 1YYXA 3L1MA 4U9EA 1JAFA 1EKYA 3ZWIA 2YL1A 1QQ3A 4IARA 5B3IA 4ULVA 3HNKA 5JP7A 3HNIA 2J8WA 256BA 4CX9A 3QW0A 2XL6A 3C63A 1MQVA 1CGNA 3C62A 4EIYA 1NBBA 4D4XA 1LM3B 4JEBA 2XLWA 3ZQVA 3M15A 2XLOA 4N6HA 3ZQYA 3IQ5A 1QPUA 1M6TA 3HNLA 4CDAA 2CCYA 3TOLA 1E83A 2BC5A 4JEAA 5AGFA 4CJOA 3QW1A 2QLAA 5JT4A 5JVEA 1CPRA 1CGOA 3FOOA
chains in the Genus database with same CATH superfamily
3UMHA 2W45A 1J8YF 3RYLA 2ZXWC 1MMAA 4JTAB 4FAPB 4YT2A 2QY9A 5BQIA 4YJWA 5CI8A 2XXAA 2Y3HA 4QI0A 2AP3A 3HNJA 4PJJA 4CS9A 4EBJA 3BRJA 2OCCC 3G4ZA 4FX5A 4LLCA 4JVSA 2EPMX 1OCRC 2PBEA 4G7OF 3IQ6A 3OWTA 1GS9A 2V26A 5B3SC 4WABA 3S90A 3DAGA 4MQ9F 4PJNA 2WZGA 5CI9A 1OR2A 4WGZA 4YT5A 1PD0A 4Q5SF 2LIGA 2R05A 2YLIA 3C8GA 3S29A 1E86A 2EINC 4EKWA 1IZMA 3W8IA 5A6AA 1FNTc 4CDYA 2HKVA 3WG7C 3J06A 4JC7A 3TOMA 4MTFA 3U0CA 2LFDA 1Q0DA 3X1OA 3U5SA 3AJMA 4KBLA 3UR3C 2VH3A 4OINF 4LACB 1WTYA 1TFOB 2ASRA 1H7IA 2XM4A 3EGXB 1U89A 5KYWB 3H65A 2BE5F 2R7RA 3M4CA 1O87A 3DE8A 2G3VA 1ORYA 1ZW2A 2R25A 2Y3DA 4U5DE 2HJMA 5FZTA 3SXMA 4C3BA 3H2UA 2YLGA 3TULA 3PCVA 3AG4C 2LK4A 3BEHA 4MVSA 2G3KA 1KU2A 2Y3BA 4JE9A 4M63A 3U8PA 4AK9A 4LLEA 1QLEC 4D4NA 2KNHA 5EHHA 3RFYA 2HMQA 3EG9A 1ZVZA 2I8BA 1WASA 2Q9CA 3KL4A 4N6CA 3V5YA 4KNVA 4BJ6A 3O39A 1RJ9B 1VOMA 3UMKA 4DRIB 1I4ZA 1CPQA 2Z15A 5KYYA 1ZYRF 2KYHA 4W8KA 4U9DA 3B0VC 1LI5A 2LCHA 4P9FA 1OCCC 3S0XA 2W9YA 3M4BA 4BEMJ 4CSAA 4C3DA 2UUIA 2LD6A 4NTBA 2PNOA 3FXHA 4CS8C 2M4EA 1NFNA 3HLZA 1OQCA 2OKUA 3Q7GA 4U9EA 2R7UA 4DBQA 1I5NA 3RVZA 3DZAA 2J0XA 2VB6A 1HE9A 2M64A 2ZXPA 5DS4A 2YHSA 3MYFA 2NUTB 5DQTA 2GDCA 3TJ5A 4ULVA 4PFPA 3V5XA 3K1IC 4KNWA 4MS2A 5JP7A 2Y3GA 3KMIA 4OIOF 3HNIA 2OOCA 256BA 2UUHA 3FAPB 2Q9BA 3K33A 3NG1A 2R7OA 3QW0A 4WJ0A 1OKKD 2JD3A 4RD9A 4E0HA 5DS5A 4E18A 3T6BA 2IBFA 5KYXB 1CGNA 3IQCA 1YAUO 3IEEA 2J0WA 2IXNA 2WVNA 3IPMO 4IAOA 1LM3B 3ASOC 3RKOF 3ZQVA 2J9VA 2XLWA 3EJNA 4JJGA 3ZIBA 3EH2A 4G7HF 2PP4A 1MMDA 1PCXA 3ZQYA 2EIKC 3IQ5A 4A2NB 5KYUB 2OG2A 1FR0A 2A0UA 4XQ1A 3JSEO 3LJBA 3LEVA 3JRMO 4YT8A 5D91A 2C04A 2QUPA 4PJLA 2CNWD 1ORJA 3ZSUA 1ZZPA 3GORA 1V54C 2FGYA 1PV3A 1OCZC 4EBBA 1O5HA 2OU6A 1V74B 4I44A 4YL0A 1FAPB 4Z9IA 3SXYA 3T4RA 1OKKA 3VF0A 1YVIA 2KQ9A 3EZIA 3SNHA 5JT4A 3UNGC 4EHPA 4C3EA 3UGPA 3JT1A 2CW0F 1JR8A 1CGOA 2HV6A 3AG2C 3KH2A 3B29A 1FFTC 3AG3C 3M79A 4IJJA 1LVKA 4N06A 1MNEA 3GM2A 5EK0A 3NMIA 4I1MA 4O79A 3RVYA 1H6GA 4E17A 2H7VC 5HSWA 5JUAA 1HMOA 1TQGA 3KKBA 3CAXA 2J7PD 2H7OA 2WL8A 2XXAB 1ZHYA 2AWCA 2KK1A 1HMDA 2VC9A 4FESA 5DLJA 2YL0A 1EI7A 1YDIA 4HFFB 3V5ZA 3O55A 1RXQA 2CNWA 3O6XA 2XLVA 5E3AA 3UGOA 3OEOA 4ANJA 1AVOB 2IOQA 1BR1A 3ZTZA 2R7WA 1F1MA 2Q3TA 4DJ9A 1MNDA 1BR2A 2EPOA 5L0FA 2YL7A 3DD7A 2WB7A 3R7CA 5KYNA 4J30B 3QVZA 2Q00A 1EQ1A 1S05A 5JS5A 3X2QC 3C8GB 4B6IA 2R7VA 3POVA 2PFDA 5AC4A 4JW1A 3JYYA 3UMIA 1A7VA 2OJED 3DKAA 3ZTMA 4A4AA 5L0JA 3F46A 4BPMA 4P9TA 2J7PA 2MHRA 3SXZA 4OIPF 4MW8A 5F28E 3NMKA 5JSLA 4AL0A 4CIPA 1D1CA 2IXOA 5COFA 4OD4A 4QDLA 5TJ5E 1YLMA 2VCCA 1RKCA 2AU5A 4JJFA 4U5CE 5L0IA 4MVQA 3DM5A 4E7SA 2J9BA 2D5RB 1M2VA 3IQTA 4KC9A 3S84A 3U8VA 2HZ8A 1WOLA 4AL1A 4DBRA 2ZD9A 2AVKA 3DMDA 1YZCA 3EG9B 3R2PA 2R7SA 4CX9A 2L9JA 2A6HF 2R7TA 1OW8A 3CQZA 3U3BA 2X0CA 2XM0A 4PJMA 4MNDA 1LS4A 2YL3A 4GYTA 2QTVA 2ICWG 3QTHA 5KYYB 3SEOA 3NKEA 1YYXA 3FAJA 3A9CA 1D0YA 1A7DA 3O10A 4XPYA 5D92A 4LDKA 4NQFA 3T9OA 1T5OA 3ZWIA 1C03A 4HE8D 4HEAJ 1EKYA 1U0BB 3Q6NA 5T3TA 3U2LA 1FMVA 1BDJB 3K7DA 3NRHA 3W2WA 2Q4FA 3CEXA 1ST6A 2DB4A 2XL4A 5K0IA 4P6IC 3ECSA 4U5FE 4BJTA 4DRJB 4K1OA 1Q0FA 1SZIA 3I5PA 3SZRA 3ITFA 2XL6A 3ABKC 2DI3A 5BQHA 2Y39A 1Q0MA 1OCOC 1NBBA 1DOVA 3EZHA 4H4KC 3U9MA 1OW7A 3PHF2 5E3CA 5L0HA 5T1DB 3I4UA 4BJ6C 2XLOA 4BG0A 1VTMP 1QPUA 4I1OB 1C17M 1EA8A 2RD9A 3GEHA 4FWVA 1NLXA 1W2WA 3RF3A 3T6JA 2V3CC 1H9GA 2GFHA 2NUPA 4CDAA 1G4WR 2NSGA 2LP4A 4CSAC 1ZU4A 1JMWA 2B0HA 2X51A 4JEAA 1FFHA 4PFOA 2QE9A 3C7JA 2AWYA 3MBGA 5AGFA 4YK5A 5E33A 3VAYA 4CJOA 2DYRC 1WWPA 3JRTA 1SR2A 4XEVA 3VM6A 1WGWA 3EFOA 3NYLA 3FDQA 1G8XA 3HTKC 3RH3A 2Q9AA 4YT4A 3AOUA 3PDMP 2HJ3A 3DE9A 5COMA 4AE4B 1VYKA 1Z63A 3AGUA 1WN0A 3NYMA 1RKEB 1TWCA 2HSQA 4CDVA 1RMVA 3GWLA 3W2VA 1OW6A 2P6VA 2IYLD 2XLEA 2HMZA 1YYJA 2XL8A 3EGDB 2W4MA 2XRHA 5A6BA 1YARO 4NC3A 3I5QA 1BZ4A 4YL1A 4JRZA 2R7QA 4JKVA 4U5GA 4YWQA 4Z9JA 4OD5A 1RJ9A 5A6JA 5L0GA 3MLGA 1NFOA 2EPKX 3G50A 4IB4A 1Q0KA 4O6YA 4XEFA 1RCPA 3RQFA 1XWJA 3VRCA 2ZPAA 2Q7RA 3AQCA 4CS7A 4J7TA 1GQAA 1J8MF 1OXBA 3C18A 4G78A 3C8ZA 1Z7Qc 1I4YA 2H8AA 3FOPA 3TK0A 4KI2A 3K6BA 3GM3A 2R03A 5JRAA 5L3VA 4DRHB 3VYWA 2J45A 3EQLF 3FHDA 1NSGB 3JYHA 1KTMA 3E9VA 2G62A 3V7OA 2L81A 3U3FA 4J7YA 3QMKA 4MVZA 5CIVA 3QZCA 2YQYA 4XPXA 1NU9C 2P1AA 3DXJF 1YA9A 5F5FA 1M57C 4RDAA 4Z9HA 2OJQA 3U2MA 1BBHA 2TMVP 3EPVA 2A0BA 4MW3A 5GPGB 2LFFA 3US6A 4BJ5C 3FMSA 1YZAA 1JPNA 3L0IA 4JTDB 4NCQA 2KJGA 4XWJA 3W8HA 4AX2A 5KYXA 1XZPA 2PX3A 2ETSA 4E7ZA 5L3QA 3EHNA 2ZXOA 1GGQA 4L6RA 4DVZA 1MMGA 2HSBA 4HFKB 3N0TA 4DXWA 4CJGA 4NTAA 2IXMA 3F47A 3HKKA 2LSEA 2W4BA 4W8PA 2KC3A 1MMNA 4U5BE 1TWGA 2NG1A 1L3PA 3QVYA 3AQBA 2MYSA 1QVXA 1V4AA 2JPUA 3M1CB 1E85A 4XPWA 4EBKA 1D0XA 5DS6A 3EHMA 4ULWA 5FCLA 1YA7O 3DI5A 2KSFA 1LKXA 4ZLCA 1NZEA 4PACA 1QQ3A 2P0NA 4O7GA 3NYJA 4JURI 5B3IA 3ATPA 3K1HA 2CGEA 1U6HA 1G5ZA 2E87A 3SP1A 3JSZA 1SMYF 1ZHWA 3L8IA 2J8WA 2Y69C 4CS9C 3LAYA 4G0HA 2L6FA 3MYIA 3Q6MA 1SF8A 3N24A 3ASNC 4X0RA 2H7BA 1HY5A 3LEOA 5BUOA 3C62A 4EIYA 2HS5A 2I15A 1Q0GA 1XZQA 4BJ1A 3LS0A 1QKRA 5COGA 1T6IA 5EGYA 1Z23A 5T3WA 3LS1A 3WAQA 2XS8A 1K04A 3WHNA 3MFNA 5F5HA 3B0PA 1HE1A 4OIQF 3S27A 2A68F 4O6NA 2OEVA 1OR3A 3CSKA 3B9QA 5A69A 4C7OA 1Z3IX 1A7EA 3TD7A 3HNLA 2P7VA 3KYJA 4U5HA 2OQMA 1H9TA 3GWNA 3L34A 2BL2A 2XSEA 4H54A 4R32A 3TOLA 1E83A 1Z6AA 3LLKA 4J32B 2NUPB 4F4BA 2B0JA 2VCAA 1VK5A 3RQGA 3QW1A 2VASA 1IW7F 1FMWA 2QLAA 4JCZA 4O6MA 1Y6DA 3SYNA 3LNMB 2O9XA 1BR4A 2YEVA 4BEJA 1CPRA 2VCBA 4Q7CA 3FOOA 1APCA 3ZDLA 4PK4A 4U5EE 2XLMA 1E84A 3EFOB 4ZLDA 4Q4ZF 1LI7A 1B68A 1ORSC 3KYIA 1PD1A 3GEEA 2YKZA 3A11A 3IHUA 3TQOA 2FFHA 4K0DA 4LDQA 4PR9A 3U9JA 3WODF 3GODA 2KW3C 3S28A 4YL3A 1CGME 2YLDA 1TWAA 1V55C 4IAQA 4MVRA 2YZSA 4JCHA 1VB5A 1T6UA 1R5ID 1GM5A 2DGJA 2YRFA 1ZHTA 1AUEA 2EPNA 2GA0A 5L0CA 5A6BD 3DWWA 3GEIA 3GANA 4OIRF 5B1BC 2QNLA 3SXKA 4MTOA 4NTFA 2HV7A 4CS8A 1ZU5A 3PMRA 3H2VA 3EGXA 5KYWA 5A6KA 4XLNF 2R7XA 2D4UA 2WVQA 4NY3A 1NG1A 1Y4CA 2A1DD 2XLHA 3K66A 3K1IA 2MWQA 3S9OA 4MVOA 2EIMC 3ZC4A 2J9UA 3JCUQ 5HV9A 1A41A 2XLDA 1FTSA 1M56C 3DAFA 4MTGA 1JOGA 2GWWA 5E2QA 2EIJC 3LLIA 2IM8A 4IWBA 2RSEB 3ZVRA 1NU7D 3FVYA 1QSPA 3GM1A 1A0BA 3NKDA 5JLIA 3DJNB 1JRAA 4XEKA 2J46A 3NMJA 1VLTA 1ZW3A 3RQEA 3DM9B 1OXKA 4MVMA 1E2XA 1LE4A 1VMAA 3N2ZB 1T6QA 1WATA 2HUJA 2L6HA 3LNRA 4N4WA 4WGYA 3ABMC 4E0IA 2WZLA 4GQHA 2J9WA 1UFBA 4XTKA 4ER9A 1S7ZA 3JZ0A 1JPJA 3L1MA 4YN0B 4K7BA 1Z5ZA 4CBEA 2P61A 2DYSC 1VLSA 2OEXA 2YWAA 4LDRA 2NUTA 1JAFA 2A69F 2WVOA 3B71A 3L8JA 2YL1A 3AGTA 3TJ6A 1K40A 3T6GB 2PX0A 4DOZA 2NSFA 4IARA 4JZAA 2ZXRA 4IGGA 3W4YA 3DJUB 4CIHA 3ZG1A 1KNYA 1T9KA 3E70C 3OA1A 3HNKA 2CDQA 1C02A 4IRUA 2C03A 1K05A 1ZHZA 1N1CA 3CZ6A 3C63A 1LE2A 1MQVA 3ABLC 4DVYP 3NDBB 4AE4A 1TFKB 3EH1A 4JTCB 1M2OA 1QZXA 1RKEA 1AEPA 2EILC 1M2VB 1R4TA 2NPUA 1D1AA 1D0ZA 2KGOA 2XS1A 1YJGA 5BQGA 3RIPA 4BJ5A 3G4XA 1UG7A 1TWHA 4GEHA 4JIOA 2EPLX 4D4XA 1SYQA 2WZFA 5KYUA 4JEBA 5L0DA 3AG1C 3EGDA 4G7ZF 1LPEA 5B1AC 3M15A 3JTLO 2R9RB 1HW2A 1VYIA 4N6HA 4EUKB 3MX3A 3HJCA 2PF4E 1DOWA 2HFIA 2FAPB 3Q7LA 4LERA 3LESA 5DQZA 1M6TA 4I3MA 4RBNA 1T01A 3LUTB 4XLPF 3KPHA 3RW0A 3B0UX 1LS1A 4ONSA 4QI2A 2CCYA 2IXPA 5IY5C 1HW1A 1L7CA 2BC5A 2JX0A 2F22A 4MVUA 4C7OB 2GAQA 1TR2A 2CYDA 4EWCA 2L7AA 5AC5A 1D1BA 5DVWA 1LIHA 3C8GD 2A6EF 1G4US 5JVEA 2L6GA 2R02A 4UDVA 2YVKA 1ZHXA 1O3UA 2LQGA 1TKNA
chains in the Genus database with same CATH topology
1APCA 2XLMA 3M79A 1E84A 3NMIA 3DE9A 2YKZA 5JUAA 3HNJA 4CDVA 2XLEA 2YLDA 1YYJA 2XL8A 4IAQA 2YL0A 3IQ6A 2XLVA 4NC3A 4JKVA 4WGZA 3ZTZA 2YLIA 4IB4A 1E86A 2YL7A 1RCPA 3QVZA 4CDYA 3VRCA 1S05A 3TOMA 5JS5A 1GQAA 2XM4A 3FOPA 1A7VA 2XLHA 5JRAA 3M4CA 3ZTMA 3DE8A 2XLDA 3NMKA 5JSLA 4CIPA 2YLGA 1BBHA 3U8PA 4JE9A 1YZAA 4D4NA 2J9BA 5JLIA 4L6RA 3NMJA 4CJGA 1CPQA 1YZCA 4U9DA 4WGYA 4N4WA 2XM0A 3QVYA 3M4BA 2YL3A 4ER9A 1E85A 1YYXA 3L1MA 4U9EA 1JAFA 1EKYA 3ZWIA 2YL1A 1QQ3A 4IARA 5B3IA 4ULVA 3HNKA 5JP7A 3HNIA 2J8WA 256BA 4CX9A 3QW0A 2XL6A 3C63A 1MQVA 1CGNA 3C62A 4EIYA 1NBBA 4D4XA 1LM3B 4JEBA 2XLWA 3ZQVA 3M15A 2XLOA 4N6HA 3ZQYA 3IQ5A 1QPUA 1M6TA 3HNLA 4CDAA 2CCYA 3TOLA 1E83A 2BC5A 4JEAA 5AGFA 4CJOA 3QW1A 2QLAA 5JT4A 5JVEA 1CPRA 1CGOA 3FOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1APC A;  2XLM A;  3M79 A;  1E84 A;  3NMI A;  3DE9 A;  2YKZ A;  5JUA A;  3HNJ A;  4CDV A;  2XLE A;  2YLD A;  1YYJ A;  2XL8 A;  4IAQ A;  2YL0 A;  3IQ6 A;  2XLV A;  4NC3 A;  4JKV A;  4WGZ A;  3ZTZ A;  2YLI A;  4IB4 A;  1E86 A;  2YL7 A;  1RCP A;  3QVZ A;  4CDY A;  3VRC A;  1S05 A;  3TOM A;  5JS5 A;  1GQA A;  2XM4 A;  3FOP A;  1A7V A;  2XLH A;  5JRA A;  3M4C A;  3ZTM A;  3DE8 A;  2XLD A;  3NMK A;  5JSL A;  4CIP A;  2YLG A;  1BBH A;  3U8P A;  4JE9 A;  1YZA A;  4D4N A;  2J9B A;  5JLI A;  4L6R A;  3NMJ A;  4CJG A;  1CPQ A;  1YZC A;  4U9D A;  4WGY A;  4N4W A;  2XM0 A;  3QVY A;  3M4B A;  2YL3 A;  4ER9 A;  1E85 A;  1YYX A;  3L1M A;  4U9E A;  1JAF A;  1EKY A;  3ZWI A;  2YL1 A;  1QQ3 A;  4IAR A;  5B3I A;  4ULV A;  3HNK A;  5JP7 A;  3HNI A;  2J8W A;  256B A;  4CX9 A;  3QW0 A;  2XL6 A;  3C63 A;  1MQV A;  1CGN A;  3C62 A;  4EIY A;  1NBB A;  4D4X A;  1LM3 B;  4JEB A;  2XLW A;  3ZQV A;  3M15 A;  2XLO A;  4N6H A;  3ZQY A;  3IQ5 A;  1QPU A;  1M6T A;  3HNL A;  4CDA A;  2CCY A;  3TOL A;  1E83 A;  2BC5 A;  4JEA A;  5AGF A;  4CJO A;  3QW1 A;  2QLA A;  5JT4 A;  5JVE A;  1CPR A;  1CGO A;  3FOO A; 
#chains in the Genus database with same CATH topology
 3UMH A;  2W45 A;  1J8Y F;  3RYL A;  2ZXW C;  1MMA A;  4JTA B;  4FAP B;  4YT2 A;  2QY9 A;  5BQI A;  4YJW A;  5CI8 A;  2XXA A;  2Y3H A;  4QI0 A;  2AP3 A;  3HNJ A;  4PJJ A;  4CS9 A;  4EBJ A;  3BRJ A;  2OCC C;  3G4Z A;  4FX5 A;  4LLC A;  4JVS A;  2EPM X;  1OCR C;  2PBE A;  4G7O F;  3IQ6 A;  3OWT A;  1GS9 A;  2V26 A;  5B3S C;  4WAB A;  3S90 A;  3DAG A;  4MQ9 F;  4PJN A;  2WZG A;  5CI9 A;  1OR2 A;  4WGZ A;  4YT5 A;  1PD0 A;  4Q5S F;  2LIG A;  2R05 A;  2YLI A;  3C8G A;  3S29 A;  1E86 A;  2EIN C;  4EKW A;  1IZM A;  3W8I A;  5A6A A;  1FNT c;  4CDY A;  2HKV A;  3WG7 C;  3J06 A;  4JC7 A;  3TOM A;  4MTF A;  3U0C A;  2LFD A;  1Q0D A;  3X1O A;  3U5S A;  3AJM A;  4KBL A;  3UR3 C;  2VH3 A;  4OIN F;  4LAC B;  1WTY A;  1TFO B;  2ASR A;  1H7I A;  2XM4 A;  3EGX B;  1U89 A;  5KYW B;  3H65 A;  2BE5 F;  2R7R A;  3M4C A;  1O87 A;  3DE8 A;  2G3V A;  1ORY A;  1ZW2 A;  2R25 A;  2Y3D A;  4U5D E;  2HJM A;  5FZT A;  3SXM A;  4C3B A;  3H2U A;  2YLG A;  3TUL A;  3PCV A;  3AG4 C;  2LK4 A;  3BEH A;  4MVS A;  2G3K A;  1KU2 A;  2Y3B A;  4JE9 A;  4M63 A;  3U8P A;  4AK9 A;  4LLE A;  1QLE C;  4D4N A;  2KNH A;  5EHH A;  3RFY A;  2HMQ A;  3EG9 A;  1ZVZ A;  2I8B A;  1WAS A;  2Q9C A;  3KL4 A;  4N6C A;  3V5Y A;  4KNV A;  4BJ6 A;  3O39 A;  1RJ9 B;  1VOM A;  3UMK A;  4DRI B;  1I4Z A;  1CPQ A;  2Z15 A;  5KYY A;  1ZYR F;  2KYH A;  4W8K A;  4U9D A;  3B0V C;  1LI5 A;  2LCH A;  4P9F A;  1OCC C;  3S0X A;  2W9Y A;  3M4B A;  4BEM J;  4CSA A;  4C3D A;  2UUI A;  2LD6 A;  4NTB A;  2PNO A;  3FXH A;  4CS8 C;  2M4E A;  1NFN A;  3HLZ A;  1OQC A;  2OKU A;  3Q7G A;  4U9E A;  2R7U A;  4DBQ A;  1I5N A;  3RVZ A;  3DZA A;  2J0X A;  2VB6 A;  1HE9 A;  2M64 A;  2ZXP A;  5DS4 A;  2YHS A;  3MYF A;  2NUT B;  5DQT A;  2GDC A;  3TJ5 A;  4ULV A;  4PFP A;  3V5X A;  3K1I C;  4KNW A;  4MS2 A;  5JP7 A;  2Y3G A;  3KMI A;  4OIO F;  3HNI A;  2OOC A;  256B A;  2UUH A;  3FAP B;  2Q9B A;  3K33 A;  3NG1 A;  2R7O A;  3QW0 A;  4WJ0 A;  1OKK D;  2JD3 A;  4RD9 A;  4E0H A;  5DS5 A;  4E18 A;  3T6B A;  2IBF A;  5KYX B;  1CGN A;  3IQC A;  1YAU O;  3IEE A;  2J0W A;  2IXN A;  2WVN A;  3IPM O;  4IAO A;  1LM3 B;  3ASO C;  3RKO F;  3ZQV A;  2J9V A;  2XLW A;  3EJN A;  4JJG A;  3ZIB A;  3EH2 A;  4G7H F;  2PP4 A;  1MMD A;  1PCX A;  3ZQY A;  2EIK C;  3IQ5 A;  4A2N B;  5KYU B;  2OG2 A;  1FR0 A;  2A0U A;  4XQ1 A;  3JSE O;  3LJB A;  3LEV A;  3JRM O;  4YT8 A;  5D91 A;  2C04 A;  2QUP A;  4PJL A;  2CNW D;  1ORJ A;  3ZSU A;  1ZZP A;  3GOR A;  1V54 C;  2FGY A;  1PV3 A;  1OCZ C;  4EBB A;  1O5H A;  2OU6 A;  1V74 B;  4I44 A;  4YL0 A;  1FAP B;  4Z9I A;  3SXY A;  3T4R A;  1OKK A;  3VF0 A;  1YVI A;  2KQ9 A;  3EZI A;  3SNH A;  5JT4 A;  3UNG C;  4EHP A;  4C3E A;  3UGP A;  3JT1 A;  2CW0 F;  1JR8 A;  1CGO A;  2HV6 A;  3AG2 C;  3KH2 A;  3B29 A;  1FFT C;  3AG3 C;  3M79 A;  4IJJ A;  1LVK A;  4N06 A;  1MNE A;  3GM2 A;  5EK0 A;  3NMI A;  4I1M A;  4O79 A;  3RVY A;  1H6G A;  4E17 A;  2H7V C;  5HSW A;  5JUA A;  1HMO A;  1TQG A;  3KKB A;  3CAX A;  2J7P D;  2H7O A;  2WL8 A;  2XXA B;  1ZHY A;  2AWC A;  2KK1 A;  1HMD A;  2VC9 A;  4FES A;  5DLJ A;  2YL0 A;  1EI7 A;  1YDI A;  4HFF B;  3V5Z A;  3O55 A;  1RXQ A;  2CNW A;  3O6X A;  2XLV A;  5E3A A;  3UGO A;  3OEO A;  4ANJ A;  1AVO B;  2IOQ A;  1BR1 A;  3ZTZ A;  2R7W A;  1F1M A;  2Q3T A;  4DJ9 A;  1MND A;  1BR2 A;  2EPO A;  5L0F A;  2YL7 A;  3DD7 A;  2WB7 A;  3R7C A;  5KYN A;  4J30 B;  3QVZ A;  2Q00 A;  1EQ1 A;  1S05 A;  5JS5 A;  3X2Q C;  3C8G B;  4B6I A;  2R7V A;  3POV A;  2PFD A;  5AC4 A;  4JW1 A;  3JYY A;  3UMI A;  1A7V A;  2OJE D;  3DKA A;  3ZTM A;  4A4A A;  5L0J A;  3F46 A;  4BPM A;  4P9T A;  2J7P A;  2MHR A;  3SXZ A;  4OIP F;  4MW8 A;  5F28 E;  3NMK A;  5JSL A;  4AL0 A;  4CIP A;  1D1C A;  2IXO A;  5COF A;  4OD4 A;  4QDL A;  5TJ5 E;  1YLM A;  2VCC A;  1RKC A;  2AU5 A;  4JJF A;  4U5C E;  5L0I A;  4MVQ A;  3DM5 A;  4E7S A;  2J9B A;  2D5R B;  1M2V A;  3IQT A;  4KC9 A;  3S84 A;  3U8V A;  2HZ8 A;  1WOL A;  4AL1 A;  4DBR A;  2ZD9 A;  2AVK A;  3DMD A;  1YZC A;  3EG9 B;  3R2P A;  2R7S A;  4CX9 A;  2L9J A;  2A6H F;  2R7T A;  1OW8 A;  3CQZ A;  3U3B A;  2X0C A;  2XM0 A;  4PJM A;  4MND A;  1LS4 A;  2YL3 A;  4GYT A;  2QTV A;  2ICW G;  3QTH A;  5KYY B;  3SEO A;  3NKE A;  1YYX A;  3FAJ A;  3A9C A;  1D0Y A;  1A7D A;  3O10 A;  4XPY A;  5D92 A;  4LDK A;  4NQF A;  3T9O A;  1T5O A;  3ZWI A;  1C03 A;  4HE8 D;  4HEA J;  1EKY A;  1U0B B;  3Q6N A;  5T3T A;  3U2L A;  1FMV A;  1BDJ B;  3K7D A;  3NRH A;  3W2W A;  2Q4F A;  3CEX A;  1ST6 A;  2DB4 A;  2XL4 A;  5K0I A;  4P6I C;  3ECS A;  4U5F E;  4BJT A;  4DRJ B;  4K1O A;  1Q0F A;  1SZI A;  3I5P A;  3SZR A;  3ITF A;  2XL6 A;  3ABK C;  2DI3 A;  5BQH A;  2Y39 A;  1Q0M A;  1OCO C;  1NBB A;  1DOV A;  3EZH A;  4H4K C;  3U9M A;  1OW7 A;  3PHF 2;  5E3C A;  5L0H A;  5T1D B;  3I4U A;  4BJ6 C;  2XLO A;  4BG0 A;  1VTM P;  1QPU A;  4I1O B;  1C17 M;  1EA8 A;  2RD9 A;  3GEH A;  4FWV A;  1NLX A;  1W2W A;  3RF3 A;  3T6J A;  2V3C C;  1H9G A;  2GFH A;  2NUP A;  4CDA A;  1G4W R;  2NSG A;  2LP4 A;  4CSA C;  1ZU4 A;  1JMW A;  2B0H A;  2X51 A;  4JEA A;  1FFH A;  4PFO A;  2QE9 A;  3C7J A;  2AWY A;  3MBG A;  5AGF A;  4YK5 A;  5E33 A;  3VAY A;  4CJO A;  2DYR C;  1WWP A;  3JRT A;  1SR2 A;  4XEV A;  3VM6 A;  1WGW A;  3EFO A;  3NYL A;  3FDQ A;  1G8X A;  3HTK C;  3RH3 A;  2Q9A A;  4YT4 A;  3AOU A;  3PDM P;  2HJ3 A;  3DE9 A;  5COM A;  4AE4 B;  1VYK A;  1Z63 A;  3AGU A;  1WN0 A;  3NYM A;  1RKE B;  1TWC A;  2HSQ A;  4CDV A;  1RMV A;  3GWL A;  3W2V A;  1OW6 A;  2P6V A;  2IYL D;  2XLE A;  2HMZ A;  1YYJ A;  2XL8 A;  3EGD B;  2W4M A;  2XRH A;  5A6B A;  1YAR O;  4NC3 A;  3I5Q A;  1BZ4 A;  4YL1 A;  4JRZ A;  2R7Q A;  4JKV A;  4U5G A;  4YWQ A;  4Z9J A;  4OD5 A;  1RJ9 A;  5A6J A;  5L0G A;  3MLG A;  1NFO A;  2EPK X;  3G50 A;  4IB4 A;  1Q0K A;  4O6Y A;  4XEF A;  1RCP A;  3RQF A;  1XWJ A;  3VRC A;  2ZPA A;  2Q7R A;  3AQC A;  4CS7 A;  4J7T A;  1GQA A;  1J8M F;  1OXB A;  3C18 A;  4G78 A;  3C8Z A;  1Z7Q c;  1I4Y A;  2H8A A;  3FOP A;  3TK0 A;  4KI2 A;  3K6B A;  3GM3 A;  2R03 A;  5JRA A;  5L3V A;  4DRH B;  3VYW A;  2J45 A;  3EQL F;  3FHD A;  1NSG B;  3JYH A;  1KTM A;  3E9V A;  2G62 A;  3V7O A;  2L81 A;  3U3F A;  4J7Y A;  3QMK A;  4MVZ A;  5CIV A;  3QZC A;  2YQY A;  4XPX A;  1NU9 C;  2P1A A;  3DXJ F;  1YA9 A;  5F5F A;  1M57 C;  4RDA A;  4Z9H A;  2OJQ A;  3U2M A;  1BBH A;  2TMV P;  3EPV A;  2A0B A;  4MW3 A;  5GPG B;  2LFF A;  3US6 A;  4BJ5 C;  3FMS A;  1YZA A;  1JPN A;  3L0I A;  4JTD B;  4NCQ A;  2KJG A;  4XWJ A;  3W8H A;  4AX2 A;  5KYX A;  1XZP A;  2PX3 A;  2ETS A;  4E7Z A;  5L3Q A;  3EHN A;  2ZXO A;  1GGQ A;  4L6R A;  4DVZ A;  1MMG A;  2HSB A;  4HFK B;  3N0T A;  4DXW A;  4CJG A;  4NTA A;  2IXM A;  3F47 A;  3HKK A;  2LSE A;  2W4B A;  4W8P A;  2KC3 A;  1MMN A;  4U5B E;  1TWG A;  2NG1 A;  1L3P A;  3QVY A;  3AQB A;  2MYS A;  1QVX A;  1V4A A;  2JPU A;  3M1C B;  1E85 A;  4XPW A;  4EBK A;  1D0X A;  5DS6 A;  3EHM A;  4ULW A;  5FCL A;  1YA7 O;  3DI5 A;  2KSF A;  1LKX A;  4ZLC A;  1NZE A;  4PAC A;  1QQ3 A;  2P0N A;  4O7G A;  3NYJ A;  4JUR I;  5B3I A;  3ATP A;  3K1H A;  2CGE A;  1U6H A;  1G5Z A;  2E87 A;  3SP1 A;  3JSZ A;  1SMY F;  1ZHW A;  3L8I A;  2J8W A;  2Y69 C;  4CS9 C;  3LAY A;  4G0H A;  2L6F A;  3MYI A;  3Q6M A;  1SF8 A;  3N24 A;  3ASN C;  4X0R A;  2H7B A;  1HY5 A;  3LEO A;  5BUO A;  3C62 A;  4EIY A;  2HS5 A;  2I15 A;  1Q0G A;  1XZQ A;  4BJ1 A;  3LS0 A;  1QKR A;  5COG A;  1T6I A;  5EGY A;  1Z23 A;  5T3W A;  3LS1 A;  3WAQ A;  2XS8 A;  1K04 A;  3WHN A;  3MFN A;  5F5H A;  3B0P A;  1HE1 A;  4OIQ F;  3S27 A;  2A68 F;  4O6N A;  2OEV A;  1OR3 A;  3CSK A;  3B9Q A;  5A69 A;  4C7O A;  1Z3I X;  1A7E A;  3TD7 A;  3HNL A;  2P7V A;  3KYJ A;  4U5H A;  2OQM A;  1H9T A;  3GWN A;  3L34 A;  2BL2 A;  2XSE A;  4H54 A;  4R32 A;  3TOL A;  1E83 A;  1Z6A A;  3LLK A;  4J32 B;  2NUP B;  4F4B A;  2B0J A;  2VCA A;  1VK5 A;  3RQG A;  3QW1 A;  2VAS A;  1IW7 F;  1FMW A;  2QLA A;  4JCZ A;  4O6M A;  1Y6D A;  3SYN A;  3LNM B;  2O9X A;  1BR4 A;  2YEV A;  4BEJ A;  1CPR A;  2VCB A;  4Q7C A;  3FOO A;  1APC A;  3ZDL A;  4PK4 A;  4U5E E;  2XLM A;  1E84 A;  3EFO B;  4ZLD A;  4Q4Z F;  1LI7 A;  1B68 A;  1ORS C;  3KYI A;  1PD1 A;  3GEE A;  2YKZ A;  3A11 A;  3IHU A;  3TQO A;  2FFH A;  4K0D A;  4LDQ A;  4PR9 A;  3U9J A;  3WOD F;  3GOD A;  2KW3 C;  3S28 A;  4YL3 A;  1CGM E;  2YLD A;  1TWA A;  1V55 C;  4IAQ A;  4MVR A;  2YZS A;  4JCH A;  1VB5 A;  1T6U A;  1R5I D;  1GM5 A;  2DGJ A;  2YRF A;  1ZHT A;  1AUE A;  2EPN A;  2GA0 A;  5L0C A;  5A6B D;  3DWW A;  3GEI A;  3GAN A;  4OIR F;  5B1B C;  2QNL A;  3SXK A;  4MTO A;  4NTF A;  2HV7 A;  4CS8 A;  1ZU5 A;  3PMR A;  3H2V A;  3EGX A;  5KYW A;  5A6K A;  4XLN F;  2R7X A;  2D4U A;  2WVQ A;  4NY3 A;  1NG1 A;  1Y4C A;  2A1D D;  2XLH A;  3K66 A;  3K1I A;  2MWQ A;  3S9O A;  4MVO A;  2EIM C;  3ZC4 A;  2J9U A;  3JCU Q;  5HV9 A;  1A41 A;  2XLD A;  1FTS A;  1M56 C;  3DAF A;  4MTG A;  1JOG A;  2GWW A;  5E2Q A;  2EIJ C;  3LLI A;  2IM8 A;  4IWB A;  2RSE B;  3ZVR A;  1NU7 D;  3FVY A;  1QSP A;  3GM1 A;  1A0B A;  3NKD A;  5JLI A;  3DJN B;  1JRA A;  4XEK A;  2J46 A;  3NMJ A;  1VLT A;  1ZW3 A;  3RQE A;  3DM9 B;  1OXK A;  4MVM A;  1E2X A;  1LE4 A;  1VMA A;  3N2Z B;  1T6Q A;  1WAT A;  2HUJ A;  2L6H A;  3LNR A;  4N4W A;  4WGY A;  3ABM C;  4E0I A;  2WZL A;  4GQH A;  2J9W A;  1UFB A;  4XTK A;  4ER9 A;  1S7Z A;  3JZ0 A;  1JPJ A;  3L1M A;  4YN0 B;  4K7B A;  1Z5Z A;  4CBE A;  2P61 A;  2DYS C;  1VLS A;  2OEX A;  2YWA A;  4LDR A;  2NUT A;  1JAF A;  2A69 F;  2WVO A;  3B71 A;  3L8J A;  2YL1 A;  3AGT A;  3TJ6 A;  1K40 A;  3T6G B;  2PX0 A;  4DOZ A;  2NSF A;  4IAR A;  4JZA A;  2ZXR A;  4IGG A;  3W4Y A;  3DJU B;  4CIH A;  3ZG1 A;  1KNY A;  1T9K A;  3E70 C;  3OA1 A;  3HNK A;  2CDQ A;  1C02 A;  4IRU A;  2C03 A;  1K05 A;  1ZHZ A;  1N1C A;  3CZ6 A;  3C63 A;  1LE2 A;  1MQV A;  3ABL C;  4DVY P;  3NDB B;  4AE4 A;  1TFK B;  3EH1 A;  4JTC B;  1M2O A;  1QZX A;  1RKE A;  1AEP A;  2EIL C;  1M2V B;  1R4T A;  2NPU A;  1D1A A;  1D0Z A;  2KGO A;  2XS1 A;  1YJG A;  5BQG A;  3RIP A;  4BJ5 A;  3G4X A;  1UG7 A;  1TWH A;  4GEH A;  4JIO A;  2EPL X;  4D4X A;  1SYQ A;  2WZF A;  5KYU A;  4JEB A;  5L0D A;  3AG1 C;  3EGD A;  4G7Z F;  1LPE A;  5B1A C;  3M15 A;  3JTL O;  2R9R B;  1HW2 A;  1VYI A;  4N6H A;  4EUK B;  3MX3 A;  3HJC A;  2PF4 E;  1DOW A;  2HFI A;  2FAP B;  3Q7L A;  4LER A;  3LES A;  5DQZ A;  1M6T A;  4I3M A;  4RBN A;  1T01 A;  3LUT B;  4XLP F;  3KPH A;  3RW0 A;  3B0U X;  1LS1 A;  4ONS A;  4QI2 A;  2CCY A;  2IXP A;  5IY5 C;  1HW1 A;  1L7C A;  2BC5 A;  2JX0 A;  2F22 A;  4MVU A;  4C7O B;  2GAQ A;  1TR2 A;  2CYD A;  4EWC A;  2L7A A;  5AC5 A;  1D1B A;  5DVW A;  1LIH A;  3C8G D;  2A6E F;  1G4U S;  5JVE A;  2L6G A;  2R02 A;  4UDV A;  2YVK A;  1ZHX A;  1O3U A;  2LQG A;  1TKN A; 
#chains in the Genus database with same CATH homology
 1APC A;  2XLM A;  3M79 A;  1E84 A;  3NMI A;  3DE9 A;  2YKZ A;  5JUA A;  3HNJ A;  4CDV A;  2XLE A;  2YLD A;  1YYJ A;  2XL8 A;  4IAQ A;  2YL0 A;  3IQ6 A;  2XLV A;  4NC3 A;  4JKV A;  4WGZ A;  3ZTZ A;  2YLI A;  4IB4 A;  1E86 A;  2YL7 A;  1RCP A;  3QVZ A;  4CDY A;  3VRC A;  1S05 A;  3TOM A;  5JS5 A;  1GQA A;  2XM4 A;  3FOP A;  1A7V A;  2XLH A;  5JRA A;  3M4C A;  3ZTM A;  3DE8 A;  2XLD A;  3NMK A;  5JSL A;  4CIP A;  2YLG A;  1BBH A;  3U8P A;  4JE9 A;  1YZA A;  4D4N A;  2J9B A;  5JLI A;  4L6R A;  3NMJ A;  4CJG A;  1CPQ A;  1YZC A;  4U9D A;  4WGY A;  4N4W A;  2XM0 A;  3QVY A;  3M4B A;  2YL3 A;  4ER9 A;  1E85 A;  1YYX A;  3L1M A;  4U9E A;  1JAF A;  1EKY A;  3ZWI A;  2YL1 A;  1QQ3 A;  4IAR A;  5B3I A;  4ULV A;  3HNK A;  5JP7 A;  3HNI A;  2J8W A;  256B A;  4CX9 A;  3QW0 A;  2XL6 A;  3C63 A;  1MQV A;  1CGN A;  3C62 A;  4EIY A;  1NBB A;  4D4X A;  1LM3 B;  4JEB A;  2XLW A;  3ZQV A;  3M15 A;  2XLO A;  4N6H A;  3ZQY A;  3IQ5 A;  1QPU A;  1M6T A;  3HNL A;  4CDA A;  2CCY A;  3TOL A;  1E83 A;  2BC5 A;  4JEA A;  5AGF A;  4CJO A;  3QW1 A;  2QLA A;  5JT4 A;  5JVE A;  1CPR A;  1CGO A;  3FOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...