1JAFA

Crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
128
structure length
128
Chain Sequence
QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cytochrome C' from Rhodocyclus Gelatinosus and Comparison with Other Cytochromes C'
pubmed rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 48
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1jafA00
1JAFA 1E83A 4CDAA 3QW0A 4NC3A 1E84A 3TOMA 4IB4A 1APCA 3IQ5A 1QQ3A 5JSLA 3QVZA 1RCPA 3FOOA 4CJGA 1NBBA 2XLOA 1YZAA 2XL6A 4ER9A 3HNKA 4CX9A 3VRCA 5JRAA 4U9EA 4N6HA 1CPQA 1E85A 2BC5A 5JS5A 4CDVA 3C63A 2XLDA 3QW1A 2YKZA 2XLHA 4CDYA 4CIPA 3DE9A 5JT4A 1CGOA 3HNLA 3M79A 2J9BA 4WGZA 2XLWA 2XM4A 4CJOA 2YL0A 1GQAA 4N4WA 2XLVA 3IQ6A 5JP7A 2YLGA 1CGNA 1BBHA 3M15A 4JKVA 3U8PA 3NMIA 1YYXA 3ZQYA 4IARA 4JE9A 1LM3B 1M6TA 3FOPA 3DE8A 1YYJA 3ZWIA 4U9DA 4IAQA 3L1MA 2YLIA 4JEBA 1E86A 3M4BA 4ULVA 4D4XA 1YZCA 5JLIA 2XLEA 1CPRA 2XL8A 4L6RA 1A7VA 5JUAA 3C62A 3M4CA 2YL7A 3ZQVA 2J8WA 3HNIA 2CCYA 3HNJA 4EIYA 2YL3A 3ZTZA 2YLDA 2YL1A 2QLAA 2XLMA 4D4NA 1QPUA 4WGYA 5AGFA 4JEAA 1EKYA 3NMKA 1MQVA 3NMJA 256BA 1S05A 3ZTMA 3QVYA 3TOLA 5B3IA 5JVEA 2XM0A
chains in the Genus database with same CATH superfamily
4P6IC 2Q9BA 1QLEC 1K04A 2IXMA 3GM3A 5FZTA 4H4KC 1VOMA 4DRHB 4YT4A 1SZIA 2OJQA 3QW0A 3EH1A 3HLZA 2UUHA 2NG1A 3RVZA 4CBEA 2Y3DA 3FHDA 3JRMO 3W2WA 2AVKA 4KBLA 1LS1A 4EKWA 1QQ3A 1RKEB 2ZXPA 5JSLA 3QVZA 2QE9A 3C18A 4DBQA 2GA0A 4CJGA 4G7HF 1O3UA 2GDCA 2HV7A 4DRIB 5KYUA 1RJ9A 4IWBA 2DYRC 1C17M 1VTMP 2WVNA 3G4ZA 2J7PD 4MVSA 2VB6A 2VCCA 4OIPF 2QUPA 2XL6A 1HE1A 2QNLA 4ER9A 1M2VB 1NLXA 1FMVA 2HKVA 3LLKA 1OW7A 4O79A 2L6FA 4U9EA 3LNRA 3U3FA 1SF8A 3CEXA 3LEOA 1E85A 1RJ9B 4W8PA 3RH3A 2HUJA 1Z5ZA 1Q0MA 2BC5A 5DQZA 1O87A 3B9QA 3SXYA 2NUTA 1YA9A 2J0WA 2HMZA 2XLDA 4U5DE 2L9JA 4XPWA 1FNTc 1JRAA 2D5RB 2A0BA 1D1BA 1T9KA 4RD9A 1WOLA 4U5HA 4CDYA 1RMVA 5JT4A 1N1CA 4CS8A 4OIOF 2IM8A 1U0BB 2FFHA 2YL0A 3TULA 1OXBA 2HV6A 2I8BA 3IQ6A 2YHSA 1TWHA 3SP1A 4E0IA 3TK0A 1JPNA 2J9WA 1D0YA 3RF3A 2YLGA 3EZIA 1G5ZA 1XZPA 3S84A 1O5HA 2MHRA 4E0HA 3BRJA 2NUPB 1OCZC 4XLNF 1LM3B 3CZ6A 4BEJA 3JTLO 2OOCA 4DXWA 3ZVRA 2P61A 3ZDLA 1B68A 3ZWIA 1WGWA 4XEVA 3U8VA 1YA7O 3B0UX 3POVA 5KYUB 1D0ZA 2EIMC 4NY3A 4YL3A 4AE4A 2KK1A 2H7VC 1TWGA 3ZC4A 2H7OA 1V54C 2KW3C 3Q7GA 2EPOA 4ULVA 4D4XA 5JLIA 5K0IA 3ZSUA 2YQYA 1LI5A 1M2VA 1QZXA 2O9XA 4G0HA 4XPXA 4ULWA 3V5ZA 2W45A 2RSEB 3RQFA 5BQIA 1VYKA 2HFIA 4CS9C 4L6RA 3M1CB 3O10A 2IXNA 4EWCA 1NZEA 1LPEA 2GAQA 3U0CA 3C62A 4BPMA 3QTHA 1EA8A 3G50A 4A2NB 1I4ZA 3WHNA 2JD3A 1MMGA 2J8WA 4J30B 2KQ9A 4JW1A 1ORJA 1TWAA 2DGJA 1V74B 2WB7A 3AG3C 1PV3A 4EBJA 1FAPB 2CNWD 1OKKD 1OW6A 3IEEA 3W8HA 4HEAJ 5COMA 2J46A 3ZTZA 1TFKB 1KU2A 2C04A 4PACA 4XTKA 1ZHTA 3AG2C 3EG9B 3LLIA 2W4BA 3UMHA 4P9FA 2R7RA 4JC7A 3U2MA 3K1IA 4N6CA 4OIQF 3AGTA 3S29A 3EQLF 2OEVA 2LCHA 4YL1A 4QI0A 2PP4A 1J8MF 5AC4A 1E2XA 4O6NA 2W9YA 3DJNB 3NMKA 1VK5A 3QZCA 2KNHA 4XEKA 4PJMA 3NMJA 3V5YA 1R4TA 3PCVA 1JPJA 3QVYA 3OWTA 5F5FA 2XS8A 2R9RB 1WN0A 4DVZA 3S0XA 5T3WA 2XM0A 1ZW2A 5L0IA 4AE4B 1JAFA 1HMDA 3JSZA 1E83A 3NKDA 5KYWA 4JTDB 1SYQA 4NC3A 2B0HA 3ASNC 1KTMA 4LDRA 4FX5A 4I3MA 4E7SA 2P7VA 3GM2A 3CQZA 4IB4A 5F28E 1H9TA 1ORYA 1Z3IX 1T01A 1ZHWA 3IQ5A 4KNWA 4W8KA 2P1AA 3FOOA 5KYNA 3C8GD 3EHNA 2Y39A 4G78A 2IYLD 4X0RA 3B0VC 2NPUA 4C7OA 1Q0FA 4G7OF 4PJLA 4PFPA 3HJCA 5A6AA 3EGDB 2Y69C 5F5HA 3U3BA 3UGPA 2J9UA 4XPYA 3RW0A 3W2VA 1A7EA 3VRCA 1VMAA 1MMDA 4DOZA 2A6EF 1CPQA 1ZW3A 4MVMA 4JJFA 1UFBA 5JS5A 2R7OA 2KYHA 2FGYA 2OQMA 3ASOC 3T4RA 3WG7C 1C03A 3QW1A 3I4UA 5AC5A 1D1AA 1TQGA 2R7SA 4EBBA 2E87A 3FAPB 1Q0DA 1K05A 3N2ZB 3K6BA 4CIPA 2X51A 4PK4A 2Y3GA 1J8YF 1FTSA 2LQGA 3GWNA 3HNLA 4RBNA 3J06A 3K66A 2CGEA 4C3DA 1H7IA 1T6QA 2EPKX 2WL8A 3AJMA 2R7UA 4IGGA 1Y6DA 3I5PA 3MFNA 4MTOA 1Z23A 4CJOA 4YT8A 5DS6A 5KYYB 1GQAA 4JZAA 2EILC 2A6HF 1V4AA 2YWAA 4XQ1A 1CGME 1MMNA 4OIRF 2Q7RA 5IY5C 3S90A 4Q5SF 5CI9A 5B1BC 1WWPA 1DOVA 1CGNA 4MS2A 1MNEA 2LSEA 4J7TA 1A0BA 3VF0A 4MVOA 4XEFA 4IARA 5E3CA 2J7PA 2CDQA 3SXMA 3FOPA 3DE8A 4Q7CA 1YYJA 2FAPB 1ZVZA 3EGXB 3KYJA 2G62A 1D0XA 1U89A 4IAQA 3L1MA 4ONSA 2YLIA 1Z6AA 3EH2A 3NKEA 4JEBA 4MVQA 2TMVP 3NYLA 3M4BA 4C3EA 1YZCA 3U9MA 4OD5A 1LI7A 2NUTB 3VAYA 5KYXB 3EG9A 3LS1A 1GM5A 4BG0A 2J0XA 2PBEA 3JSEO 3FAJA 3EGXA 4IJJA 4I44A 3F47A 1QKRA 3LAYA 1PCXA 1OR2A 3M4CA 1LE4A 1BR1A 3LNMB 3TJ6A 4YT2A 3VM6A 2QTVA 4U5BE 5L3VA 3Q6MA 1UG7A 3NRHA 3EHMA 1I4YA 4CSAC 2C03A 3B0PA 3GEIA 2R7XA 1VYIA 3TOLA 2ZPAA 4K0DA 2YL3A 2R7VA 2R7WA 4J32B 2OKUA 5L0GA 1VB5A 3MYIA 3W4YA 4FWVA 3CSKA 5KYXA 1NG1A 2A1DD 3KH2A 2HS5A 1A7DA 2DB4A 2Z15A 5B1AC 2ASRA 4BJ6A 1HE9A 2A69F 4J7YA 5FCLA 3H2UA 2KC3A 1M57C 2ZXOA 3DZAA 3LEVA 4JRZA 4JEAA 2VCAA 3UMIA 4A4AA 3PHF2 4E17A 1MQVA 3S27A 1W2WA 5EHHA 3L34A 4DBRA 4IAOA 5BQHA 3S9OA 3N24A 2AU5A 1GS9A 3KKBA 3KL4A 3NYMA 4BJTA 1JMWA 3EJNA 2LIGA 3IQCA 3IHUA 4K1OA 5JVEA 1XWJA 4C3BA 2BE5F 4BJ5A 1GGQA 3ZG1A 1YAUO 2AP3A 4CDAA 2NSGA 3IQTA 2R7TA 3KPHA 2L7AA 1E84A 1ZHYA 3R7CA 3TOMA 3DMDA 1JR8A 2I15A 4GQHA 1APCA 1R5ID 2IXPA 4JIOA 5A6JA 2OG2A 1AUEA 2QY9A 3LS0A 1EI7A 2XS1A 2ZXRA 2XXAA 4YT5A 2GFHA 4PJNA 5E2QA 2MWQA 4MW3A 4O7GA 1T6IA 3SEOA 3WODF 1M2OA 2Q00A 3OEOA 2XLOA 4JTAB 4YWQA 4WJ0A 2PX0A 5CIVA 3K33A 3SXKA 4KNVA 3FVYA 3GWLA 4N6HA 1WASA 2YRFA 3G4XA 4HE8D 4U5FE 3O55A 4O6MA 2LP4A 5COGA 2H8AA 3DD7A 3F46A 2P0NA 4JJGA 4QDLA 5A69A 4NTAA 3AQBA 4CS9A 2OJED 4U5CE 1D1CA 1BZ4A 1ZU4A 4H54A 1BR2A 2XXAB 5DVWA 3K1HA 4GYTA 3K1IC 5L0CA 3JZ0A 3GM1A 3DE9A 1CGOA 1OXKA 3M79A 1WTYA 1Y4CA 2WZGA 3W8IA 1WATA 2J9BA 2VASA 5HSWA 4QI2A 2Q4FA 2XM4A 4MVZA 3EFOA 4P9TA 4N4WA 3FXHA 2WVQA 1LE2A 3AQCA 2XLVA 3HTKC 5L0HA 2B0JA 2KSFA 1L3PA 3ABKC 3V5XA 4JURI 1BBHA 3M15A 3U8PA 3RQGA 3TQOA 3NMIA 4JCHA 5A6BA 2IBFA 3ZQYA 1HY5A 2EPMX 4O6YA 1M6TA 1OCOC 4BJ1A 5A6KA 1FFHA 3EGDA 1AEPA 2Y3BA 4HFFB 3TD7A 4DRJB 3JYHA 2VCBA 4FESA 4Q4ZF 4U9DA 1PD0A 1RXQA 3A9CA 3I5QA 3RYLA 3UNGC 3KYIA 2VC9A 1BR4A 2ZD9A 4AX2A 4NTBA 1OR3A 2ETSA 3BEHA 1YARO 5L0FA 1Z63A 3ABMC 4Z9HA 4C7OB 3C8GB 3DM5A 3NYJA 2WZFA 5D92A 4CSAA 1NU7D 1S7ZA 2J9VA 2XLEA 3DAGA 3RFYA 3HKKA 3UGOA 4NTFA 5KYYA 4IRUA 1LKXA 5KYWB 4K7BA 1A7VA 5JUAA 2W4MA 2HZ8A 1V55C 4B6IA 2OEXA 1QVXA 2YL7A 2KGOA 3ZQVA 1MNDA 1FR0A 5L3QA 4XLPF 2RD9A 3SZRA 2H7BA 1KNYA 3X2QC 3E70C 2CCYA 3HNJA 2OU6A 3EZHA 1EKYA 2YZSA 2YEVA 4WABA 2EIJC 1ORSC 3H65A 2XRHA 3AG4C 3ZIBA 4ZLCA 4JVSA 3RKOF 2NUPA 3L0IA 2QLAA 3UMKA 3B71A 5BUOA 3N0TA 4EHPA 3DJUB 1OKKA 1XZQA 4MVUA 4N06A 4CS8C 4D4NA 1QPUA 3MBGA 1YDIA 1EQ1A 5AGFA 1OW8A 2JX0A 2M64A 2MYSA 2PFDA 4I1OB 2KJGA 2DI3A 4ZLDA 3NDBB 3E9VA 3Q7LA 3DAFA 3Q6NA 2XSEA 1ZHZA 3DM9B 1FFTC 5EK0A 1VLSA 2L6GA 2LK4A 1YJGA 4CS7A 3ZTMA 3MLGA 1FMWA 1NFNA 1Q0KA 2A0UA 4NCQA 1Z7Qc 1T5OA 5L0JA 2R03A 2CNWA 3LESA 1SR2A 1TKNA 3GODA 4KC9A 1T6UA 3OA1A 1HW2A 2X0CA 4YJWA 4AL1A 4KI2A 2G3VA 1RCPA 2HSBA 2WVOA 3GEEA 3GEHA 3GANA 3JT1A 3L8JA 3T6JA 1NSGB 2Q9AA 3TJ5A 4ANJA 1NBBA 2AWCA 3AG1C 1F1MA 4XWJA 4CIHA 2R7QA 1YZAA 2IOQA 3LUTB 4GEHA 3HNKA 3UR3C 3K7DA 4CX9A 3DKAA 3US6A 2EPNA 5JRAA 1LS4A 3JYYA 2UUIA 4EUKB 1DOWA 4HFKB 2R02A 2ICWG 3DI5A 4BEMJ 1TFOB 5E33A 2EIKC 2NSFA 4MW8A 1L7CA 4JCZA 4YL0A 4CDVA 5DS5A 4RDAA 3C63A 3SNHA 1LIHA 2GWWA 1RKEA 2R25A 2XL4A 2EPLX 1Q0GA 5DLJA 2G3KA 2YKZA 3A11A 3JRTA 5BQGA 5TJ5E 3O6XA 3RQEA 3T6BA 2XLHA 4FAPB 2ZXWC 4BJ6C 1I5NA 3RIPA 1TR2A 3C8ZA 5T3TA 4F4BA 2R05A 2CW0F 2HJMA 4WGZA 2M4EA 4LDQA 2XLWA 3C8GA 3WAQA 4Z9JA 4MTFA 2OCCC 3ECSA 3S28A 5GPGB 1IZMA 1ZYRF 4DVYP 3ATPA 4LDKA 4R32A 5JP7A 3AOUA 2L6HA 3FMSA 4E18A 4Z9IA 4OD4A 2Q3TA 4JKVA 1C02A 4MVRA 3U9JA 1YYXA 1M56C 4JE9A 3T9OA 3KMIA 5B3SC 2EINC 4NQFA 1NFOA 1NU9C 3EFOB 3MYFA 1G8XA 3DWWA 3DXJF 1ZHXA 2L81A 1LVKA 1G4WR 4G7ZF 1IW7F 1MMAA 1TWCA 3LJBA 3NG1A 4YN0B 1JOGA 1HW1A 4MTGA 2F22A 2BL2A 1E86A 3AGUA 3C7JA 1OCCC 2V3CC 1PD1A 3H2VA 3V7OA 4PJJA 2Y3HA 1K40A 4LERA 5DQTA 1OCRC 3B29A 1HMOA 1CPRA 2JPUA 3ITFA 4M63A 2HJ3A 4YK5A 3T6GB 2XL8A 3X1OA 2IXOA 3L8IA 5L0DA 1RKCA 2P6VA 1YLMA 2AWYA 3ABLC 2LFDA 3VYWA 3U5SA 4JTCB 3PMRA 3SXZA 5DS4A 2HMQA 5COFA 1ZU5A 5D91A 3PDMP 5T1DB 4EBKA 3HNIA 4DJ9A 1VLTA 2D4UA 1BDJB 2LFFA 3EPVA 4EIYA 2YVKA 5CI8A 1QSPA 4BJ5C 2J45A 2A68F 5EGYA 2VH3A 1ST6A 3R2PA 4I1MA 4MNDA 4MQ9F 3U2LA 3JCUQ 3CAXA 3O39A 3RVYA 2PX3A 2YLDA 2PNOA 2CYDA 2Q9CA 2HSQA 2DYSC 2YL1A 3IPMO 4E7ZA 5A6BD 5HV9A 3MX3A 1SMYF 5E3AA 2XLMA 4AK9A 1OQCA 4AL0A 4U5EE 1U6HA 4U5GA 1YVIA 4WGYA 2LD6A 2V26A 3FDQA 3SYNA 4LLCA 1AVOB 3GORA 1G4US 2PF4E 3QMKA 4PFOA 1H6GA 256BA 1S05A 2WZLA 4LLEA 4UDVA 1A41A 4OINF 1ZZPA 1H9GA 4PR9A 4LACB 5B3IA
chains in the Genus database with same CATH topology
1JAFA 1E83A 4CDAA 3QW0A 4NC3A 1E84A 3TOMA 4IB4A 1APCA 3IQ5A 1QQ3A 5JSLA 3QVZA 1RCPA 3FOOA 4CJGA 1NBBA 2XLOA 1YZAA 2XL6A 4ER9A 3HNKA 4CX9A 3VRCA 5JRAA 4U9EA 4N6HA 1CPQA 1E85A 2BC5A 5JS5A 4CDVA 3C63A 2XLDA 3QW1A 2YKZA 2XLHA 4CDYA 4CIPA 3DE9A 5JT4A 1CGOA 3HNLA 3M79A 2J9BA 4WGZA 2XLWA 2XM4A 4CJOA 2YL0A 1GQAA 4N4WA 2XLVA 3IQ6A 5JP7A 2YLGA 1CGNA 1BBHA 3M15A 4JKVA 3U8PA 3NMIA 1YYXA 3ZQYA 4IARA 4JE9A 1LM3B 1M6TA 3FOPA 3DE8A 1YYJA 3ZWIA 4U9DA 4IAQA 3L1MA 2YLIA 4JEBA 1E86A 3M4BA 4ULVA 4D4XA 1YZCA 5JLIA 2XLEA 1CPRA 2XL8A 4L6RA 1A7VA 5JUAA 3C62A 3M4CA 2YL7A 3ZQVA 2J8WA 3HNIA 2CCYA 3HNJA 4EIYA 2YL3A 3ZTZA 2YLDA 2YL1A 2QLAA 2XLMA 4D4NA 1QPUA 4WGYA 5AGFA 4JEAA 1EKYA 3NMKA 1MQVA 3NMJA 256BA 1S05A 3ZTMA 3QVYA 3TOLA 5B3IA 5JVEA 2XM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAF A;  1E83 A;  4CDA A;  3QW0 A;  4NC3 A;  1E84 A;  3TOM A;  4IB4 A;  1APC A;  3IQ5 A;  1QQ3 A;  5JSL A;  3QVZ A;  1RCP A;  3FOO A;  4CJG A;  1NBB A;  2XLO A;  1YZA A;  2XL6 A;  4ER9 A;  3HNK A;  4CX9 A;  3VRC A;  5JRA A;  4U9E A;  4N6H A;  1CPQ A;  1E85 A;  2BC5 A;  5JS5 A;  4CDV A;  3C63 A;  2XLD A;  3QW1 A;  2YKZ A;  2XLH A;  4CDY A;  4CIP A;  3DE9 A;  5JT4 A;  1CGO A;  3HNL A;  3M79 A;  2J9B A;  4WGZ A;  2XLW A;  2XM4 A;  4CJO A;  2YL0 A;  1GQA A;  4N4W A;  2XLV A;  3IQ6 A;  5JP7 A;  2YLG A;  1CGN A;  1BBH A;  3M15 A;  4JKV A;  3U8P A;  3NMI A;  1YYX A;  3ZQY A;  4IAR A;  4JE9 A;  1LM3 B;  1M6T A;  3FOP A;  3DE8 A;  1YYJ A;  3ZWI A;  4U9D A;  4IAQ A;  3L1M A;  2YLI A;  4JEB A;  1E86 A;  3M4B A;  4ULV A;  4D4X A;  1YZC A;  5JLI A;  2XLE A;  1CPR A;  2XL8 A;  4L6R A;  1A7V A;  5JUA A;  3C62 A;  3M4C A;  2YL7 A;  3ZQV A;  2J8W A;  3HNI A;  2CCY A;  3HNJ A;  4EIY A;  2YL3 A;  3ZTZ A;  2YLD A;  2YL1 A;  2QLA A;  2XLM A;  4D4N A;  1QPU A;  4WGY A;  5AGF A;  4JEA A;  1EKY A;  3NMK A;  1MQV A;  3NMJ A;  256B A;  1S05 A;  3ZTM A;  3QVY A;  3TOL A;  5B3I A;  5JVE A;  2XM0 A; 
#chains in the Genus database with same CATH topology
 4P6I C;  2Q9B A;  1QLE C;  1K04 A;  2IXM A;  3GM3 A;  5FZT A;  4H4K C;  1VOM A;  4DRH B;  4YT4 A;  1SZI A;  2OJQ A;  3QW0 A;  3EH1 A;  3HLZ A;  2UUH A;  2NG1 A;  3RVZ A;  4CBE A;  2Y3D A;  3FHD A;  3JRM O;  3W2W A;  2AVK A;  4KBL A;  1LS1 A;  4EKW A;  1QQ3 A;  1RKE B;  2ZXP A;  5JSL A;  3QVZ A;  2QE9 A;  3C18 A;  4DBQ A;  2GA0 A;  4CJG A;  4G7H F;  1O3U A;  2GDC A;  2HV7 A;  4DRI B;  5KYU A;  1RJ9 A;  4IWB A;  2DYR C;  1C17 M;  1VTM P;  2WVN A;  3G4Z A;  2J7P D;  4MVS A;  2VB6 A;  2VCC A;  4OIP F;  2QUP A;  2XL6 A;  1HE1 A;  2QNL A;  4ER9 A;  1M2V B;  1NLX A;  1FMV A;  2HKV A;  3LLK A;  1OW7 A;  4O79 A;  2L6F A;  4U9E A;  3LNR A;  3U3F A;  1SF8 A;  3CEX A;  3LEO A;  1E85 A;  1RJ9 B;  4W8P A;  3RH3 A;  2HUJ A;  1Z5Z A;  1Q0M A;  2BC5 A;  5DQZ A;  1O87 A;  3B9Q A;  3SXY A;  2NUT A;  1YA9 A;  2J0W A;  2HMZ A;  2XLD A;  4U5D E;  2L9J A;  4XPW A;  1FNT c;  1JRA A;  2D5R B;  2A0B A;  1D1B A;  1T9K A;  4RD9 A;  1WOL A;  4U5H A;  4CDY A;  1RMV A;  5JT4 A;  1N1C A;  4CS8 A;  4OIO F;  2IM8 A;  1U0B B;  2FFH A;  2YL0 A;  3TUL A;  1OXB A;  2HV6 A;  2I8B A;  3IQ6 A;  2YHS A;  1TWH A;  3SP1 A;  4E0I A;  3TK0 A;  1JPN A;  2J9W A;  1D0Y A;  3RF3 A;  2YLG A;  3EZI A;  1G5Z A;  1XZP A;  3S84 A;  1O5H A;  2MHR A;  4E0H A;  3BRJ A;  2NUP B;  1OCZ C;  4XLN F;  1LM3 B;  3CZ6 A;  4BEJ A;  3JTL O;  2OOC A;  4DXW A;  3ZVR A;  2P61 A;  3ZDL A;  1B68 A;  3ZWI A;  1WGW A;  4XEV A;  3U8V A;  1YA7 O;  3B0U X;  3POV A;  5KYU B;  1D0Z A;  2EIM C;  4NY3 A;  4YL3 A;  4AE4 A;  2KK1 A;  2H7V C;  1TWG A;  3ZC4 A;  2H7O A;  1V54 C;  2KW3 C;  3Q7G A;  2EPO A;  4ULV A;  4D4X A;  5JLI A;  5K0I A;  3ZSU A;  2YQY A;  1LI5 A;  1M2V A;  1QZX A;  2O9X A;  4G0H A;  4XPX A;  4ULW A;  3V5Z A;  2W45 A;  2RSE B;  3RQF A;  5BQI A;  1VYK A;  2HFI A;  4CS9 C;  4L6R A;  3M1C B;  3O10 A;  2IXN A;  4EWC A;  1NZE A;  1LPE A;  2GAQ A;  3U0C A;  3C62 A;  4BPM A;  3QTH A;  1EA8 A;  3G50 A;  4A2N B;  1I4Z A;  3WHN A;  2JD3 A;  1MMG A;  2J8W A;  4J30 B;  2KQ9 A;  4JW1 A;  1ORJ A;  1TWA A;  2DGJ A;  1V74 B;  2WB7 A;  3AG3 C;  1PV3 A;  4EBJ A;  1FAP B;  2CNW D;  1OKK D;  1OW6 A;  3IEE A;  3W8H A;  4HEA J;  5COM A;  2J46 A;  3ZTZ A;  1TFK B;  1KU2 A;  2C04 A;  4PAC A;  4XTK A;  1ZHT A;  3AG2 C;  3EG9 B;  3LLI A;  2W4B A;  3UMH A;  4P9F A;  2R7R A;  4JC7 A;  3U2M A;  3K1I A;  4N6C A;  4OIQ F;  3AGT A;  3S29 A;  3EQL F;  2OEV A;  2LCH A;  4YL1 A;  4QI0 A;  2PP4 A;  1J8M F;  5AC4 A;  1E2X A;  4O6N A;  2W9Y A;  3DJN B;  3NMK A;  1VK5 A;  3QZC A;  2KNH A;  4XEK A;  4PJM A;  3NMJ A;  3V5Y A;  1R4T A;  3PCV A;  1JPJ A;  3QVY A;  3OWT A;  5F5F A;  2XS8 A;  2R9R B;  1WN0 A;  4DVZ A;  3S0X A;  5T3W A;  2XM0 A;  1ZW2 A;  5L0I A;  4AE4 B;  1JAF A;  1HMD A;  3JSZ A;  1E83 A;  3NKD A;  5KYW A;  4JTD B;  1SYQ A;  4NC3 A;  2B0H A;  3ASN C;  1KTM A;  4LDR A;  4FX5 A;  4I3M A;  4E7S A;  2P7V A;  3GM2 A;  3CQZ A;  4IB4 A;  5F28 E;  1H9T A;  1ORY A;  1Z3I X;  1T01 A;  1ZHW A;  3IQ5 A;  4KNW A;  4W8K A;  2P1A A;  3FOO A;  5KYN A;  3C8G D;  3EHN A;  2Y39 A;  4G78 A;  2IYL D;  4X0R A;  3B0V C;  2NPU A;  4C7O A;  1Q0F A;  4G7O F;  4PJL A;  4PFP A;  3HJC A;  5A6A A;  3EGD B;  2Y69 C;  5F5H A;  3U3B A;  3UGP A;  2J9U A;  4XPY A;  3RW0 A;  3W2V A;  1A7E A;  3VRC A;  1VMA A;  1MMD A;  4DOZ A;  2A6E F;  1CPQ A;  1ZW3 A;  4MVM A;  4JJF A;  1UFB A;  5JS5 A;  2R7O A;  2KYH A;  2FGY A;  2OQM A;  3ASO C;  3T4R A;  3WG7 C;  1C03 A;  3QW1 A;  3I4U A;  5AC5 A;  1D1A A;  1TQG A;  2R7S A;  4EBB A;  2E87 A;  3FAP B;  1Q0D A;  1K05 A;  3N2Z B;  3K6B A;  4CIP A;  2X51 A;  4PK4 A;  2Y3G A;  1J8Y F;  1FTS A;  2LQG A;  3GWN A;  3HNL A;  4RBN A;  3J06 A;  3K66 A;  2CGE A;  4C3D A;  1H7I A;  1T6Q A;  2EPK X;  2WL8 A;  3AJM A;  2R7U A;  4IGG A;  1Y6D A;  3I5P A;  3MFN A;  4MTO A;  1Z23 A;  4CJO A;  4YT8 A;  5DS6 A;  5KYY B;  1GQA A;  4JZA A;  2EIL C;  2A6H F;  1V4A A;  2YWA A;  4XQ1 A;  1CGM E;  1MMN A;  4OIR F;  2Q7R A;  5IY5 C;  3S90 A;  4Q5S F;  5CI9 A;  5B1B C;  1WWP A;  1DOV A;  1CGN A;  4MS2 A;  1MNE A;  2LSE A;  4J7T A;  1A0B A;  3VF0 A;  4MVO A;  4XEF A;  4IAR A;  5E3C A;  2J7P A;  2CDQ A;  3SXM A;  3FOP A;  3DE8 A;  4Q7C A;  1YYJ A;  2FAP B;  1ZVZ A;  3EGX B;  3KYJ A;  2G62 A;  1D0X A;  1U89 A;  4IAQ A;  3L1M A;  4ONS A;  2YLI A;  1Z6A A;  3EH2 A;  3NKE A;  4JEB A;  4MVQ A;  2TMV P;  3NYL A;  3M4B A;  4C3E A;  1YZC A;  3U9M A;  4OD5 A;  1LI7 A;  2NUT B;  3VAY A;  5KYX B;  3EG9 A;  3LS1 A;  1GM5 A;  4BG0 A;  2J0X A;  2PBE A;  3JSE O;  3FAJ A;  3EGX A;  4IJJ A;  4I44 A;  3F47 A;  1QKR A;  3LAY A;  1PCX A;  1OR2 A;  3M4C A;  1LE4 A;  1BR1 A;  3LNM B;  3TJ6 A;  4YT2 A;  3VM6 A;  2QTV A;  4U5B E;  5L3V A;  3Q6M A;  1UG7 A;  3NRH A;  3EHM A;  1I4Y A;  4CSA C;  2C03 A;  3B0P A;  3GEI A;  2R7X A;  1VYI A;  3TOL A;  2ZPA A;  4K0D A;  2YL3 A;  2R7V A;  2R7W A;  4J32 B;  2OKU A;  5L0G A;  1VB5 A;  3MYI A;  3W4Y A;  4FWV A;  3CSK A;  5KYX A;  1NG1 A;  2A1D D;  3KH2 A;  2HS5 A;  1A7D A;  2DB4 A;  2Z15 A;  5B1A C;  2ASR A;  4BJ6 A;  1HE9 A;  2A69 F;  4J7Y A;  5FCL A;  3H2U A;  2KC3 A;  1M57 C;  2ZXO A;  3DZA A;  3LEV A;  4JRZ A;  4JEA A;  2VCA A;  3UMI A;  4A4A A;  3PHF 2;  4E17 A;  1MQV A;  3S27 A;  1W2W A;  5EHH A;  3L34 A;  4DBR A;  4IAO A;  5BQH A;  3S9O A;  3N24 A;  2AU5 A;  1GS9 A;  3KKB A;  3KL4 A;  3NYM A;  4BJT A;  1JMW A;  3EJN A;  2LIG A;  3IQC A;  3IHU A;  4K1O A;  5JVE A;  1XWJ A;  4C3B A;  2BE5 F;  4BJ5 A;  1GGQ A;  3ZG1 A;  1YAU O;  2AP3 A;  4CDA A;  2NSG A;  3IQT A;  2R7T A;  3KPH A;  2L7A A;  1E84 A;  1ZHY A;  3R7C A;  3TOM A;  3DMD A;  1JR8 A;  2I15 A;  4GQH A;  1APC A;  1R5I D;  2IXP A;  4JIO A;  5A6J A;  2OG2 A;  1AUE A;  2QY9 A;  3LS0 A;  1EI7 A;  2XS1 A;  2ZXR A;  2XXA A;  4YT5 A;  2GFH A;  4PJN A;  5E2Q A;  2MWQ A;  4MW3 A;  4O7G A;  1T6I A;  3SEO A;  3WOD F;  1M2O A;  2Q00 A;  3OEO A;  2XLO A;  4JTA B;  4YWQ A;  4WJ0 A;  2PX0 A;  5CIV A;  3K33 A;  3SXK A;  4KNV A;  3FVY A;  3GWL A;  4N6H A;  1WAS A;  2YRF A;  3G4X A;  4HE8 D;  4U5F E;  3O55 A;  4O6M A;  2LP4 A;  5COG A;  2H8A A;  3DD7 A;  3F46 A;  2P0N A;  4JJG A;  4QDL A;  5A69 A;  4NTA A;  3AQB A;  4CS9 A;  2OJE D;  4U5C E;  1D1C A;  1BZ4 A;  1ZU4 A;  4H54 A;  1BR2 A;  2XXA B;  5DVW A;  3K1H A;  4GYT A;  3K1I C;  5L0C A;  3JZ0 A;  3GM1 A;  3DE9 A;  1CGO A;  1OXK A;  3M79 A;  1WTY A;  1Y4C A;  2WZG A;  3W8I A;  1WAT A;  2J9B A;  2VAS A;  5HSW A;  4QI2 A;  2Q4F A;  2XM4 A;  4MVZ A;  3EFO A;  4P9T A;  4N4W A;  3FXH A;  2WVQ A;  1LE2 A;  3AQC A;  2XLV A;  3HTK C;  5L0H A;  2B0J A;  2KSF A;  1L3P A;  3ABK C;  3V5X A;  4JUR I;  1BBH A;  3M15 A;  3U8P A;  3RQG A;  3TQO A;  3NMI A;  4JCH A;  5A6B A;  2IBF A;  3ZQY A;  1HY5 A;  2EPM X;  4O6Y A;  1M6T A;  1OCO C;  4BJ1 A;  5A6K A;  1FFH A;  3EGD A;  1AEP A;  2Y3B A;  4HFF B;  3TD7 A;  4DRJ B;  3JYH A;  2VCB A;  4FES A;  4Q4Z F;  4U9D A;  1PD0 A;  1RXQ A;  3A9C A;  3I5Q A;  3RYL A;  3UNG C;  3KYI A;  2VC9 A;  1BR4 A;  2ZD9 A;  4AX2 A;  4NTB A;  1OR3 A;  2ETS A;  3BEH A;  1YAR O;  5L0F A;  1Z63 A;  3ABM C;  4Z9H A;  4C7O B;  3C8G B;  3DM5 A;  3NYJ A;  2WZF A;  5D92 A;  4CSA A;  1NU7 D;  1S7Z A;  2J9V A;  2XLE A;  3DAG A;  3RFY A;  3HKK A;  3UGO A;  4NTF A;  5KYY A;  4IRU A;  1LKX A;  5KYW B;  4K7B A;  1A7V A;  5JUA A;  2W4M A;  2HZ8 A;  1V55 C;  4B6I A;  2OEX A;  1QVX A;  2YL7 A;  2KGO A;  3ZQV A;  1MND A;  1FR0 A;  5L3Q A;  4XLP F;  2RD9 A;  3SZR A;  2H7B A;  1KNY A;  3X2Q C;  3E70 C;  2CCY A;  3HNJ A;  2OU6 A;  3EZH A;  1EKY A;  2YZS A;  2YEV A;  4WAB A;  2EIJ C;  1ORS C;  3H65 A;  2XRH A;  3AG4 C;  3ZIB A;  4ZLC A;  4JVS A;  3RKO F;  2NUP A;  3L0I A;  2QLA A;  3UMK A;  3B71 A;  5BUO A;  3N0T A;  4EHP A;  3DJU B;  1OKK A;  1XZQ A;  4MVU A;  4N06 A;  4CS8 C;  4D4N A;  1QPU A;  3MBG A;  1YDI A;  1EQ1 A;  5AGF A;  1OW8 A;  2JX0 A;  2M64 A;  2MYS A;  2PFD A;  4I1O B;  2KJG A;  2DI3 A;  4ZLD A;  3NDB B;  3E9V A;  3Q7L A;  3DAF A;  3Q6N A;  2XSE A;  1ZHZ A;  3DM9 B;  1FFT C;  5EK0 A;  1VLS A;  2L6G A;  2LK4 A;  1YJG A;  4CS7 A;  3ZTM A;  3MLG A;  1FMW A;  1NFN A;  1Q0K A;  2A0U A;  4NCQ A;  1Z7Q c;  1T5O A;  5L0J A;  2R03 A;  2CNW A;  3LES A;  1SR2 A;  1TKN A;  3GOD A;  4KC9 A;  1T6U A;  3OA1 A;  1HW2 A;  2X0C A;  4YJW A;  4AL1 A;  4KI2 A;  2G3V A;  1RCP A;  2HSB A;  2WVO A;  3GEE A;  3GEH A;  3GAN A;  3JT1 A;  3L8J A;  3T6J A;  1NSG B;  2Q9A A;  3TJ5 A;  4ANJ A;  1NBB A;  2AWC A;  3AG1 C;  1F1M A;  4XWJ A;  4CIH A;  2R7Q A;  1YZA A;  2IOQ A;  3LUT B;  4GEH A;  3HNK A;  3UR3 C;  3K7D A;  4CX9 A;  3DKA A;  3US6 A;  2EPN A;  5JRA A;  1LS4 A;  3JYY A;  2UUI A;  4EUK B;  1DOW A;  4HFK B;  2R02 A;  2ICW G;  3DI5 A;  4BEM J;  1TFO B;  5E33 A;  2EIK C;  2NSF A;  4MW8 A;  1L7C A;  4JCZ A;  4YL0 A;  4CDV A;  5DS5 A;  4RDA A;  3C63 A;  3SNH A;  1LIH A;  2GWW A;  1RKE A;  2R25 A;  2XL4 A;  2EPL X;  1Q0G A;  5DLJ A;  2G3K A;  2YKZ A;  3A11 A;  3JRT A;  5BQG A;  5TJ5 E;  3O6X A;  3RQE A;  3T6B A;  2XLH A;  4FAP B;  2ZXW C;  4BJ6 C;  1I5N A;  3RIP A;  1TR2 A;  3C8Z A;  5T3T A;  4F4B A;  2R05 A;  2CW0 F;  2HJM A;  4WGZ A;  2M4E A;  4LDQ A;  2XLW A;  3C8G A;  3WAQ A;  4Z9J A;  4MTF A;  2OCC C;  3ECS A;  3S28 A;  5GPG B;  1IZM A;  1ZYR F;  4DVY P;  3ATP A;  4LDK A;  4R32 A;  5JP7 A;  3AOU A;  2L6H A;  3FMS A;  4E18 A;  4Z9I A;  4OD4 A;  2Q3T A;  4JKV A;  1C02 A;  4MVR A;  3U9J A;  1YYX A;  1M56 C;  4JE9 A;  3T9O A;  3KMI A;  5B3S C;  2EIN C;  4NQF A;  1NFO A;  1NU9 C;  3EFO B;  3MYF A;  1G8X A;  3DWW A;  3DXJ F;  1ZHX A;  2L81 A;  1LVK A;  1G4W R;  4G7Z F;  1IW7 F;  1MMA A;  1TWC A;  3LJB A;  3NG1 A;  4YN0 B;  1JOG A;  1HW1 A;  4MTG A;  2F22 A;  2BL2 A;  1E86 A;  3AGU A;  3C7J A;  1OCC C;  2V3C C;  1PD1 A;  3H2V A;  3V7O A;  4PJJ A;  2Y3H A;  1K40 A;  4LER A;  5DQT A;  1OCR C;  3B29 A;  1HMO A;  1CPR A;  2JPU A;  3ITF A;  4M63 A;  2HJ3 A;  4YK5 A;  3T6G B;  2XL8 A;  3X1O A;  2IXO A;  3L8I A;  5L0D A;  1RKC A;  2P6V A;  1YLM A;  2AWY A;  3ABL C;  2LFD A;  3VYW A;  3U5S A;  4JTC B;  3PMR A;  3SXZ A;  5DS4 A;  2HMQ A;  5COF A;  1ZU5 A;  5D91 A;  3PDM P;  5T1D B;  4EBK A;  3HNI A;  4DJ9 A;  1VLT A;  2D4U A;  1BDJ B;  2LFF A;  3EPV A;  4EIY A;  2YVK A;  5CI8 A;  1QSP A;  4BJ5 C;  2J45 A;  2A68 F;  5EGY A;  2VH3 A;  1ST6 A;  3R2P A;  4I1M A;  4MND A;  4MQ9 F;  3U2L A;  3JCU Q;  3CAX A;  3O39 A;  3RVY A;  2PX3 A;  2YLD A;  2PNO A;  2CYD A;  2Q9C A;  2HSQ A;  2DYS C;  2YL1 A;  3IPM O;  4E7Z A;  5A6B D;  5HV9 A;  3MX3 A;  1SMY F;  5E3A A;  2XLM A;  4AK9 A;  1OQC A;  4AL0 A;  4U5E E;  1U6H A;  4U5G A;  1YVI A;  4WGY A;  2LD6 A;  2V26 A;  3FDQ A;  3SYN A;  4LLC A;  1AVO B;  3GOR A;  1G4U S;  2PF4 E;  3QMK A;  4PFO A;  1H6G A;  256B A;  1S05 A;  2WZL A;  4LLE A;  4UDV A;  1A41 A;  4OIN F;  1ZZP A;  1H9G A;  4PR9 A;  4LAC B;  5B3I A; 
#chains in the Genus database with same CATH homology
 1JAF A;  1E83 A;  4CDA A;  3QW0 A;  4NC3 A;  1E84 A;  3TOM A;  4IB4 A;  1APC A;  3IQ5 A;  1QQ3 A;  5JSL A;  3QVZ A;  1RCP A;  3FOO A;  4CJG A;  1NBB A;  2XLO A;  1YZA A;  2XL6 A;  4ER9 A;  3HNK A;  4CX9 A;  3VRC A;  5JRA A;  4U9E A;  4N6H A;  1CPQ A;  1E85 A;  2BC5 A;  5JS5 A;  4CDV A;  3C63 A;  2XLD A;  3QW1 A;  2YKZ A;  2XLH A;  4CDY A;  4CIP A;  3DE9 A;  5JT4 A;  1CGO A;  3HNL A;  3M79 A;  2J9B A;  4WGZ A;  2XLW A;  2XM4 A;  4CJO A;  2YL0 A;  1GQA A;  4N4W A;  2XLV A;  3IQ6 A;  5JP7 A;  2YLG A;  1CGN A;  1BBH A;  3M15 A;  4JKV A;  3U8P A;  3NMI A;  1YYX A;  3ZQY A;  4IAR A;  4JE9 A;  1LM3 B;  1M6T A;  3FOP A;  3DE8 A;  1YYJ A;  3ZWI A;  4U9D A;  4IAQ A;  3L1M A;  2YLI A;  4JEB A;  1E86 A;  3M4B A;  4ULV A;  4D4X A;  1YZC A;  5JLI A;  2XLE A;  1CPR A;  2XL8 A;  4L6R A;  1A7V A;  5JUA A;  3C62 A;  3M4C A;  2YL7 A;  3ZQV A;  2J8W A;  3HNI A;  2CCY A;  3HNJ A;  4EIY A;  2YL3 A;  3ZTZ A;  2YLD A;  2YL1 A;  2QLA A;  2XLM A;  4D4N A;  1QPU A;  4WGY A;  5AGF A;  4JEA A;  1EKY A;  3NMK A;  1MQV A;  3NMJ A;  256B A;  1S05 A;  3ZTM A;  3QVY A;  3TOL A;  5B3I A;  5JVE A;  2XM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...