1JAFA

Crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
128
structure length
128
Chain Sequence
b'QFQKPGDAIEYRQSAFTLIANHFGRVAAMAQGKAPFDAKVAAENIALVSTLSKLPLTAFGPGTDKGHGTEAKPAVWSDAAGFKAAADKFAAAVDKLDAAGKTGDFAQIKAAVGETGGACKGCHDKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Crystal Structure of Cytochrome C' from Rhodocyclus Gelatinosus and Comparison with Other Cytochromes C'
pubmed rcsb
molecule tags Electron transport
total genus 48
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1jafA00
1M6TA 3M4BA 3C62A 2XLOA 3NMJA 3NMKA 4U9EA 1APCA 1QQ3A 2XLDA 3TOLA 4ULVA 3L1MA 1E84A 2XM4A 2YLGA 4JEAA 3M15A 1JAFA 4JE9A 3ZQYA 5JSLA 4L6RA 1EKYA 2BC5A 5JRAA 3M4CA 3QVYA 2XLEA 3DE9A 1RCPA 1YYXA 5JP7A 2YL0A 4N6HA 1NBBA 2XM0A 3IQ5A 3VRCA 1A7VA 2J9BA 1GQAA 3ZTZA 256BA 4WGYA 2YLIA 4IB4A 1CPQA 3DE8A 3FOPA 3HNJA 4JKVA 1QPUA 2YKZA 1BBHA 1E86A 4N4WA 3HNIA 2QLAA 2CCYA 5JS5A 2J8WA 2YL1A 3ZWIA 4D4NA 3QW1A 4IAQA 2XLVA 4CIPA 3ZQVA 3HNLA 5JT4A 3FOOA 4IARA 5JVEA 3IQ6A 4CDAA 5JUAA 1YZAA 2XLWA 4JEBA 1E85A 4NC3A 4ER9A 5JLIA 3U8PA 4CX9A 3QW0A 1MQVA 1YYJA 4CJOA 1E83A 4EIYA 5B3IA 3HNKA 2YL3A 1S05A 4WGZA 4D4XA 3QVZA 4U9DA 3ZTMA 1CGNA 3C63A 5AGFA 2XL6A 1CPRA 1LM3B 1YZCA 2YLDA 2XLHA 4CDYA 3TOMA 3NMIA 4CDVA 2XLMA 2XL8A 4CJGA 2YL7A 1CGOA 3M79A
chains in the Genus database with same CATH superfamily
1A7EA 3M4BA 3IHUA 2X51A 4PFPA 3Q6NA 4YT8A 1Z7Qc 1A41A 4JRZA 4YN0B 3X1OA 2IBFA 1MNDA 4PJLA 2L9JA 1APCA 2XLDA 4U5FE 3DAFA 3UNGC 3EHNA 1PD0A 2EPOA 1OXKA 3OEOA 3JTLO 5B1AC 3RVYA 2R7XA 2L6FA 3A11A 1E84A 1RKEA 5COGA 4FAPB 4H4KC 4NQFA 4PR9A 4BJ5A 3KPHA 1OKKA 1D1CA 3RKOF 4KNVA 2OEXA 1VB5A 1SZIA 5L0CA 3C7JA 3FXHA 3KH2A 2Y3GA 2XXAA 1RXQA 2A0BA 2P7VA 4MVQA 4CS8C 4CS8A 1J8YF 2BC5A 2EPNA 5DS4A 4CSAA 2XLEA 3DE9A 1RCPA 3ITFA 3JYHA 4EBKA 4MTOA 3ZG1A 1FR0A 4UDVA 2JX0A 2GFHA 1G4WR 1XWJA 2H7OA 2AWYA 3AGTA 2EPMX 1M57C 2Q00A 2OCCC 2HMQA 2R25A 3AJMA 2I8BA 2ZXPA 1F1MA 3BRJA 3EGXB 4MVSA 2UUHA 2XM0A 1A7VA 4XEVA 1GQAA 2H7VC 2XL4A 2YQYA 4E0HA 4G78A 4Q4ZF 3JSZA 3VF0A 3C8GB 3B71A 1WWPA 1OCRC 4ZLDA 3LEOA 4OD4A 3NDBB 2YLIA 2KGOA 3EHMA 2QNLA 3B29A 1FFTC 4KI2A 2Q7RA 3B0VC 5KYUB 4O6MA 3ASNC 1YAUO 4E7SA 2R7WA 3RIPA 2IXOA 3PCVA 1H6GA 3U9MA 3LNRA 3VM6A 3S27A 4PJMA 1V55C 1O3UA 4OIOF 1OCOC 4C7OA 4GEHA 3WAQA 3UMKA 4AL0A 2IXNA 2PBEA 1ZHTA 2HSQA 1Q0FA 3QW1A 3EGXA 4I1OB 4YL3A 1BR1A 4CIPA 3S84A 1B68A 1VLTA 2KC3A 1I5NA 3FOOA 3Q7LA 4J30B 4EHPA 1QLEC 1R5ID 3S0XA 5JUAA 5AC5A 3UGPA 2D4UA 1G5ZA 1OR2A 1WASA 3L0IA 1C17M 1ZU5A 4O6NA 5T1DB 2NSFA 5JLIA 1W2WA 5DS6A 4U5HA 1T01A 3I4UA 2YEVA 2PF4E 4CBEA 1K04A 2R7SA 1FNTc 4U5EE 4DBRA 1T6IA 2J7PD 5A6AA 4Z9HA 1MQVA 2R9RB 3L8JA 4NTFA 4PJNA 1JMWA 1ORSC 1E83A 1FAPB 3UR3C 1JRAA 4AK9A 1AVOB 1I4YA 2L7AA 2L81A 2EIKC 3H65A 3RQGA 1YDIA 2AP3A 3K1IC 4JZAA 4MQ9F 3K1IA 1S05A 3GWLA 4JJGA 1RJ9B 2CNWD 5EHHA 3KL4A 4DXWA 5L3VA 5A6BD 2A6HF 4O6YA 3EGDB 3V5YA 2XL6A 3NYMA 5A6JA 1CPRA 2NUPA 2VCAA 2NSGA 3MYFA 2R7TA 3JRMO 2QTVA 4E18A 3W4YA 3AOUA 3TOMA 4BG0A 1MMNA 2XLMA 2Y3HA 2Q9AA 3JYYA 2HV6A 2Q9BA 1ZW2A 1JR8A 4XLPF 4I1MA 2FGYA 1QSPA 2L6GA 2XL8A 1YVIA 4JTAB 1S7ZA 1SR2A 1MMAA 4MTGA 5T3TA 1WATA 4YL1A 3EH2A 4Z9IA 1G8XA 4A2NB 5L0HA 2MYSA 4XEKA 4RD9A 2PP4A 2W4MA 1RJ9A 3E70C 5F5HA 1VMAA 2H8AA 3NMJA 3RYLA 1KTMA 1L3PA 3SXKA 3ZSUA 2NG1A 2EPKX 1O87A 3EJNA 3EGDA 4U5DE 3RQEA 2WB7A 5KYXB 4XPWA 2BE5F 3TOLA 1FMWA 3W2WA 1EA8A 2XM4A 2EPLX 2HZ8A 3ABLC 3EZHA 2A1DD 1LKXA 3U2MA 3DAGA 4LDRA 5T3WA 2ICWG 1C02A 2R7VA 2R02A 3AG1C 3AQBA 3EPVA 3ZQYA 3V7OA 2UUIA 4ZLCA 3POVA 2J7PA 5JSLA 4L6RA 5CI8A 3NYLA 1V54C 2Z15A 1T9KA 4C3DA 3DXJF 2V26A 3QVYA 1JPNA 3MFNA 5E3AA 3T9OA 2V3CC 3E9VA 3K33A 4R32A 3OA1A 1PCXA 1HW2A 2YL0A 1IZMA 5F5FA 3C8ZA 1GGQA 1RMVA 3KYJA 2KJGA 4N6HA 1NBBA 1KU2A 3KYIA 2EINC 3SXYA 2OU6A 1HW1A 3UMHA 4JCZA 1HY5A 2WZGA 2CNWA 3IQTA 1YARO 5TJ5E 256BA 3T6BA 3C8GD 3MBGA 4JW1A 2J0WA 1HE1A 5KYXA 1TFKB 1WOLA 4MVUA 4IB4A 1NSGB 2PX3A 4CS7A 4MVRA 3DE8A 2E87A 3FOPA 5E33A 2Y39A 3ASOC 4BJ5C 4JKVA 5A69A 1ZHZA 2A69F 1NU9C 3T4RA 1BBHA 2A6EF 3FAPB 4FWVA 2O9XA 3IPMO 3K1HA 3L34A 2R7OA 4YL0A 1SMYF 5DQTA 3EZIA 3C18A 3R7CA 4ULWA 4IRUA 3RFYA 5A6KA 5FCLA 4PFOA 3IEEA 3GEEA 4JIOA 3EH1A 2DGJA 2XLVA 4YJWA 3W2VA 3ZQVA 5B3SC 3HNLA 5JT4A 3LESA 5BQHA 1OW8A 1Q0KA 4AE4B 3PDMP 1OCCC 3S28A 5K0IA 1WN0A 1O5HA 3ABKC 4BPMA 4OIQF 1YZAA 2QUPA 2XLWA 1E85A 3LUTB 3S90A 4DRHB 3AG4C 3U5SA 4CS9C 4CS9A 4ER9A 4HEAJ 2A0UA 3SXZA 2P61A 2YVKA 4O79A 1DOWA 1OXBA 2WVOA 1ZHYA 1D1BA 2GA0A 5AC4A 3TULA 3K6BA 1AEPA 1MMDA 4MTFA 3GEHA 1NFNA 1YJGA 2MHRA 2XRHA 4C3EA 4EIYA 1D1AA 4G7ZF 1HE9A 1M2OA 2B0HA 2JPUA 3RH3A 1T6UA 4F4BA 1TFOB 1LS1A 4IAOA 1AUEA 3U8VA 3U2LA 1OQCA 1C03A 5EK0A 4WGZA 3GANA 2NPUA 4HE8D 4XEFA 3W8HA 4P6IC 3QVZA 3SYNA 5B1BC 4ANJA 2MWQA 3DI5A 3S29A 3ZTMA 1CGNA 2GAQA 3NKDA 1TQGA 1TWHA 2PNOA 4AE4A 5L0JA 3LS0A 3C63A 4HFFB 5AGFA 3NYJA 2IYLD 3C8GA 3DWWA 3SEOA 3K7DA 3HLZA 4XQ1A 1Z3IX 4QI2A 2YZSA 2YLDA 2B0JA 2FFHA 4OINF 3X2QC 5BQIA 2LK4A 4RBNA 4KC9A 3ZC4A 4BJTA 4Q5SF 3NMIA 5KYUA 2XS1A 3GORA 5COFA 1VOMA 3ZIBA 2J9UA 4JCHA 3VAYA 1PD1A 4CJGA 4CIHA 1ZU4A 1CGOA 1IW7F 3QTHA 3TQOA 5KYWB 1QKRA 1YA9A 4O7GA 3NRHA 3SP1A 2HMZA 1V74B 1ORYA 1VYKA 4J7TA 4MNDA 1BR4A 2LFFA 3JRTA 3RW0A 3S9OA 3C62A 1VYIA 3DZAA 4U9EA 2HS5A 1H7IA 2KYHA 2YWAA 4DRJB 1QQ3A 1LI7A 1T5OA 3GWNA 3RF3A 4DVZA 3O39A 1G4US 4NTBA 4KNWA 3L1MA 1ZZPA 4EBJA 2YLGA 4K1OA 2ASRA 4U5CE 4WABA 1TWAA 3LJBA 5CIVA 2R7RA 4CSAC 3U9JA 1I4ZA 1K40A 3AQCA 1WGWA 3HKKA 4YT2A 4QDLA 4WJ0A 4EWCA 2ZPAA 4G7HF 3U0CA 2J46A 1SYQA 4NTAA 5HV9A 1D0XA 5DS5A 1LE4A 2OEVA 3CZ6A 4I3MA 5JP7A 1TKNA 1DOVA 1YYXA 3HJCA 4GYTA 4K7BA 2AWCA 2X0CA 3N0TA 5E2QA 4XPXA 1E2XA 1SF8A 1ORJA 2VCCA 2ZXRA 3I5PA 2LCHA 2HFIA 3DM9B 1HMDA 1FFHA 2IXPA 3VRCA 5KYYB 2J9BA 4AL1A 4N6CA 4W8KA 3K66A 2KQ9A 1U6HA 2BL2A 3DKAA 5BQGA 4OD5A 2Q3TA 1J8MF 3FMSA 3JZ0A 2QE9A 1Q0GA 4Z9JA 2TMVP 3U3BA 2HSBA 2OJQA 1CPQA 1LIHA 2ZD9A 4JURI 2KW3C 4YT5A 2L6HA 4BEMJ 1OW7A 4EBBA 4LLEA 1QPUA 3G4ZA 1VTMP 2YKZA 4JVSA 1EI7A 4YK5A 3PMRA 1Z5ZA 3GEIA 2M64A 2CCYA 2QLAA 3US6A 3QMKA 3O6XA 3CAXA 4BEJA 5JS5A 1VLSA 1NU7D 2J8WA 2RSEB 2YL1A 5GPGB 1XZPA 1Z23A 3GM1A 5COMA 1FMVA 5HSWA 1NZEA 3IQCA 1VK5A 1A7DA 1M2VB 3QZCA 4MW3A 5KYYA 2KK1A 4IARA 5JVEA 2PX0A 4CDAA 2DYSC 4PACA 5A6BA 3BEHA 1YLMA 1RKEB 3AG3C 4JEBA 3V5ZA 2I15A 1LS4A 1UG7A 2Y69C 1NLXA 1T6QA 3MYIA 3U8PA 4CX9A 1OCZC 3QW0A 2R7UA 2LFDA 4G7OF 1OW6A 2VCBA 5EGYA 2AVKA 5F28E 2KSFA 1ST6A 4P9FA 3DM5A 3LLKA 4CJOA 2IM8A 3O10A 4IJJA 1UFBA 3FAJA 4QI0A 5DVWA 3B0PA 2M4EA 2G62A 2P6VA 2YL3A 2G3VA 1Z6AA 1BZ4A 3GM2A 3LAYA 4D4XA 3RQFA 2CGEA 4U9DA 2P0NA 1KNYA 1M2VA 2LD6A 4C3BA 4OIRF 3WG7C 1ZHWA 3VYWA 2J9VA 2XSEA 4LLCA 2ZXWC 2EIJC 4MW8A 2VB6A 4G0HA 4K0DA 4FX5A 1YZCA 2F22A 2J0XA 1YA7O 1N1CA 1QZXA 2XLHA 4CDYA 5IY5C 5L0DA 3OWTA 2XS8A 2J45A 3J06A 5L0IA 3TK0A 3M1CB 4XWJA 4MS2A 4ONSA 1CGME 2OKUA 2AU5A 1R4TA 2A68F 1GM5A 4C7OB 4BJ6C 3ABMC 4BJ6A 4LACB 2W45A 3MX3A 3ZVRA 4JC7A 4LERA 2ZXOA 1M6TA 4J7YA 4B6IA 1WTYA 5KYNA 4HFKB 1Z63A 3FDQA 3Q6MA 2XLOA 2WVQA 2YRFA 3DJUB 3NMKA 4LDQA 4GQHA 4BJ1A 5L3QA 1U89A 1ZHXA 2LSEA 2DB4A 4JJFA 2OOCA 2WZFA 4ULVA 2LP4A 1LE2A 2Q9CA 2GDCA 3G4XA 2HJMA 3M15A 1D0YA 1JAFA 4JEAA 4JE9A 2R03A 4NY3A 4U5BE 4U5GA 4A4AA 3NKEA 3DJNB 3F46A 3SNHA 2OQMA 3DD7A 2KNHA 2P1AA 2Y3DA 4LDKA 1HMOA 3GM3A 4PJJA 3GODA 4E7ZA 1EKYA 2LIGA 5L0GA 3ECSA 5JRAA 1K05A 3EFOB 1V4AA 3JCUQ 3M4CA 1QVXA 3B9QA 1ZYRF 1XZQA 2VH3A 3KKBA 1A0BA 3ZDLA 5CI9A 3KMIA 5E3CA 3TD7A 3JSEO 3IQ5A 3ZTZA 1NFOA 2J9WA 2CW0F 1JOGA 4OIPF 3L8IA 1BR2A 3G50A 2OJED 1D0ZA 4WGYA 1M56C 2NUPB 4JTCB 4YWQA 1JPJA 3EG9B 3T6JA 4DRIB 4I44A 2GWWA 3HNJA 2G3KA 5L0FA 4AX2A 2H7BA 1LI5A 1OR3A 1NG1A 3B0UX 4DVYP 3N24A 4N4WA 3HNIA 1E86A 5FZTA 3W8IA 2PFDA 3HTKC 2OG2A 2Y3BA 4J32B 4N06A 3AG2C 4Q7CA 3EFOA 1Q0MA 1Y4CA 2ETSA 3NG1A 2FAPB 2VC9A 3R2PA 3LNMB 3LS1A 4M63A 4NCQA 1LPEA 2NUTB 3ZWIA 3PHF2 2EIMC 5KYWA 2LQGA 3SXMA 4D4NA 5D92A 1MMGA 2WVNA 1EQ1A 1FTSA 4IAQA 4KBLA 4IGGA 3FHDA 3H2VA 1L7CA 5DLJA 3IQ6A 3JT1A 3TJ6A 4YT4A 3UGOA 1ZW3A 1TR2A 2WZLA 3MLGA 4DOZA 4NC3A 1BDJB 2W9YA 3A9CA 3H2UA 1Q0DA 1LVKA 1OKKD 1TWGA 2CDQA 3N2ZB 3O55A 3EG9A 4FESA 4H54A 3T6GB 2YHSA 4X0RA 4W8PA 2CYDA 3EQLF 2C03A 4XLNF 1YYJA 2IOQA 4PK4A 3ATPA 5D91A 5DQZA 4EUKB 2D5RB 5B3IA 4XPYA 3HNKA 3U3FA 4E0IA 2JD3A 2DYRC 2NUTA 2HV7A 4RDAA 2VASA 3DMDA 2RD9A 4EKWA 3LLIA 1H9TA 1ZVZA 2W4BA 2QY9A 1GS9A 1PV3A 1RKCA 1TWCA 2R05A 2WL8A 3I5QA 3LEVA 4MVZA 4MVMA 5BUOA 4IWBA 2HJ3A 3Q7GA 2C04A 3RVZA 3WHNA 1U0BB 3TJ5A 2Q4FA 2EILC 1LM3B 2R7QA 3SZRA 1H9GA 2HKVA 3CSKA 4E17A 3UMIA 4DBQA 3AGUA 4CDVA 3CQZA 4JTDB 2XXAB 2IXMA 3CEXA 3WODF 4P9TA 3F47A 2HUJA 3FVYA 4MVOA 1Y6DA 2YL7A 1MNEA 3M79A 4DJ9A 4XTKA 3V5XA 2DI3A
chains in the Genus database with same CATH topology
1M6TA 3M4BA 3C62A 2XLOA 3NMJA 3NMKA 4U9EA 1APCA 1QQ3A 2XLDA 3TOLA 4ULVA 3L1MA 1E84A 2XM4A 2YLGA 4JEAA 3M15A 1JAFA 4JE9A 3ZQYA 5JSLA 4L6RA 1EKYA 2BC5A 5JRAA 3M4CA 3QVYA 2XLEA 3DE9A 1RCPA 1YYXA 5JP7A 2YL0A 4N6HA 1NBBA 2XM0A 3IQ5A 3VRCA 1A7VA 2J9BA 1GQAA 3ZTZA 256BA 4WGYA 2YLIA 4IB4A 1CPQA 3DE8A 3FOPA 3HNJA 4JKVA 1QPUA 2YKZA 1BBHA 1E86A 4N4WA 3HNIA 2QLAA 2CCYA 5JS5A 2J8WA 2YL1A 3ZWIA 4D4NA 3QW1A 4IAQA 2XLVA 4CIPA 3ZQVA 3HNLA 5JT4A 3FOOA 4IARA 5JVEA 3IQ6A 4CDAA 5JUAA 1YZAA 2XLWA 4JEBA 1E85A 4NC3A 4ER9A 5JLIA 3U8PA 4CX9A 3QW0A 1MQVA 1YYJA 4CJOA 1E83A 4EIYA 5B3IA 3HNKA 2YL3A 1S05A 4WGZA 4D4XA 3QVZA 4U9DA 3ZTMA 1CGNA 3C63A 5AGFA 2XL6A 1CPRA 1LM3B 1YZCA 2YLDA 2XLHA 4CDYA 3TOMA 3NMIA 4CDVA 2XLMA 2XL8A 4CJGA 2YL7A 1CGOA 3M79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6T A;  3M4B A;  3C62 A;  2XLO A;  3NMJ A;  3NMK A;  4U9E A;  1APC A;  1QQ3 A;  2XLD A;  3TOL A;  4ULV A;  3L1M A;  1E84 A;  2XM4 A;  2YLG A;  4JEA A;  3M15 A;  1JAF A;  4JE9 A;  3ZQY A;  5JSL A;  4L6R A;  1EKY A;  2BC5 A;  5JRA A;  3M4C A;  3QVY A;  2XLE A;  3DE9 A;  1RCP A;  1YYX A;  5JP7 A;  2YL0 A;  4N6H A;  1NBB A;  2XM0 A;  3IQ5 A;  3VRC A;  1A7V A;  2J9B A;  1GQA A;  3ZTZ A;  256B A;  4WGY A;  2YLI A;  4IB4 A;  1CPQ A;  3DE8 A;  3FOP A;  3HNJ A;  4JKV A;  1QPU A;  2YKZ A;  1BBH A;  1E86 A;  4N4W A;  3HNI A;  2QLA A;  2CCY A;  5JS5 A;  2J8W A;  2YL1 A;  3ZWI A;  4D4N A;  3QW1 A;  4IAQ A;  2XLV A;  4CIP A;  3ZQV A;  3HNL A;  5JT4 A;  3FOO A;  4IAR A;  5JVE A;  3IQ6 A;  4CDA A;  5JUA A;  1YZA A;  2XLW A;  4JEB A;  1E85 A;  4NC3 A;  4ER9 A;  5JLI A;  3U8P A;  4CX9 A;  3QW0 A;  1MQV A;  1YYJ A;  4CJO A;  1E83 A;  4EIY A;  5B3I A;  3HNK A;  2YL3 A;  1S05 A;  4WGZ A;  4D4X A;  3QVZ A;  4U9D A;  3ZTM A;  1CGN A;  3C63 A;  5AGF A;  2XL6 A;  1CPR A;  1LM3 B;  1YZC A;  2YLD A;  2XLH A;  4CDY A;  3TOM A;  3NMI A;  4CDV A;  2XLM A;  2XL8 A;  4CJG A;  2YL7 A;  1CGO A;  3M79 A; 
#chains in the Genus database with same CATH topology
 1A7E A;  3M4B A;  3IHU A;  2X51 A;  4PFP A;  3Q6N A;  4YT8 A;  1Z7Q c;  1A41 A;  4JRZ A;  4YN0 B;  3X1O A;  2IBF A;  1MND A;  4PJL A;  2L9J A;  1APC A;  2XLD A;  4U5F E;  3DAF A;  3UNG C;  3EHN A;  1PD0 A;  2EPO A;  1OXK A;  3OEO A;  3JTL O;  5B1A C;  3RVY A;  2R7X A;  2L6F A;  3A11 A;  1E84 A;  1RKE A;  5COG A;  4FAP B;  4H4K C;  4NQF A;  4PR9 A;  4BJ5 A;  3KPH A;  1OKK A;  1D1C A;  3RKO F;  4KNV A;  2OEX A;  1VB5 A;  1SZI A;  5L0C A;  3C7J A;  3FXH A;  3KH2 A;  2Y3G A;  2XXA A;  1RXQ A;  2A0B A;  2P7V A;  4MVQ A;  4CS8 C;  4CS8 A;  1J8Y F;  2BC5 A;  2EPN A;  5DS4 A;  4CSA A;  2XLE A;  3DE9 A;  1RCP A;  3ITF A;  3JYH A;  4EBK A;  4MTO A;  3ZG1 A;  1FR0 A;  4UDV A;  2JX0 A;  2GFH A;  1G4W R;  1XWJ A;  2H7O A;  2AWY A;  3AGT A;  2EPM X;  1M57 C;  2Q00 A;  2OCC C;  2HMQ A;  2R25 A;  3AJM A;  2I8B A;  2ZXP A;  1F1M A;  3BRJ A;  3EGX B;  4MVS A;  2UUH A;  2XM0 A;  1A7V A;  4XEV A;  1GQA A;  2H7V C;  2XL4 A;  2YQY A;  4E0H A;  4G78 A;  4Q4Z F;  3JSZ A;  3VF0 A;  3C8G B;  3B71 A;  1WWP A;  1OCR C;  4ZLD A;  3LEO A;  4OD4 A;  3NDB B;  2YLI A;  2KGO A;  3EHM A;  2QNL A;  3B29 A;  1FFT C;  4KI2 A;  2Q7R A;  3B0V C;  5KYU B;  4O6M A;  3ASN C;  1YAU O;  4E7S A;  2R7W A;  3RIP A;  2IXO A;  3PCV A;  1H6G A;  3U9M A;  3LNR A;  3VM6 A;  3S27 A;  4PJM A;  1V55 C;  1O3U A;  4OIO F;  1OCO C;  4C7O A;  4GEH A;  3WAQ A;  3UMK A;  4AL0 A;  2IXN A;  2PBE A;  1ZHT A;  2HSQ A;  1Q0F A;  3QW1 A;  3EGX A;  4I1O B;  4YL3 A;  1BR1 A;  4CIP A;  3S84 A;  1B68 A;  1VLT A;  2KC3 A;  1I5N A;  3FOO A;  3Q7L A;  4J30 B;  4EHP A;  1QLE C;  1R5I D;  3S0X A;  5JUA A;  5AC5 A;  3UGP A;  2D4U A;  1G5Z A;  1OR2 A;  1WAS A;  3L0I A;  1C17 M;  1ZU5 A;  4O6N A;  5T1D B;  2NSF A;  5JLI A;  1W2W A;  5DS6 A;  4U5H A;  1T01 A;  3I4U A;  2YEV A;  2PF4 E;  4CBE A;  1K04 A;  2R7S A;  1FNT c;  4U5E E;  4DBR A;  1T6I A;  2J7P D;  5A6A A;  4Z9H A;  1MQV A;  2R9R B;  3L8J A;  4NTF A;  4PJN A;  1JMW A;  1ORS C;  1E83 A;  1FAP B;  3UR3 C;  1JRA A;  4AK9 A;  1AVO B;  1I4Y A;  2L7A A;  2L81 A;  2EIK C;  3H65 A;  3RQG A;  1YDI A;  2AP3 A;  3K1I C;  4JZA A;  4MQ9 F;  3K1I A;  1S05 A;  3GWL A;  4JJG A;  1RJ9 B;  2CNW D;  5EHH A;  3KL4 A;  4DXW A;  5L3V A;  5A6B D;  2A6H F;  4O6Y A;  3EGD B;  3V5Y A;  2XL6 A;  3NYM A;  5A6J A;  1CPR A;  2NUP A;  2VCA A;  2NSG A;  3MYF A;  2R7T A;  3JRM O;  2QTV A;  4E18 A;  3W4Y A;  3AOU A;  3TOM A;  4BG0 A;  1MMN A;  2XLM A;  2Y3H A;  2Q9A A;  3JYY A;  2HV6 A;  2Q9B A;  1ZW2 A;  1JR8 A;  4XLP F;  4I1M A;  2FGY A;  1QSP A;  2L6G A;  2XL8 A;  1YVI A;  4JTA B;  1S7Z A;  1SR2 A;  1MMA A;  4MTG A;  5T3T A;  1WAT A;  4YL1 A;  3EH2 A;  4Z9I A;  1G8X A;  4A2N B;  5L0H A;  2MYS A;  4XEK A;  4RD9 A;  2PP4 A;  2W4M A;  1RJ9 A;  3E70 C;  5F5H A;  1VMA A;  2H8A A;  3NMJ A;  3RYL A;  1KTM A;  1L3P A;  3SXK A;  3ZSU A;  2NG1 A;  2EPK X;  1O87 A;  3EJN A;  3EGD A;  4U5D E;  3RQE A;  2WB7 A;  5KYX B;  4XPW A;  2BE5 F;  3TOL A;  1FMW A;  3W2W A;  1EA8 A;  2XM4 A;  2EPL X;  2HZ8 A;  3ABL C;  3EZH A;  2A1D D;  1LKX A;  3U2M A;  3DAG A;  4LDR A;  5T3W A;  2ICW G;  1C02 A;  2R7V A;  2R02 A;  3AG1 C;  3AQB A;  3EPV A;  3ZQY A;  3V7O A;  2UUI A;  4ZLC A;  3POV A;  2J7P A;  5JSL A;  4L6R A;  5CI8 A;  3NYL A;  1V54 C;  2Z15 A;  1T9K A;  4C3D A;  3DXJ F;  2V26 A;  3QVY A;  1JPN A;  3MFN A;  5E3A A;  3T9O A;  2V3C C;  3E9V A;  3K33 A;  4R32 A;  3OA1 A;  1PCX A;  1HW2 A;  2YL0 A;  1IZM A;  5F5F A;  3C8Z A;  1GGQ A;  1RMV A;  3KYJ A;  2KJG A;  4N6H A;  1NBB A;  1KU2 A;  3KYI A;  2EIN C;  3SXY A;  2OU6 A;  1HW1 A;  3UMH A;  4JCZ A;  1HY5 A;  2WZG A;  2CNW A;  3IQT A;  1YAR O;  5TJ5 E;  256B A;  3T6B A;  3C8G D;  3MBG A;  4JW1 A;  2J0W A;  1HE1 A;  5KYX A;  1TFK B;  1WOL A;  4MVU A;  4IB4 A;  1NSG B;  2PX3 A;  4CS7 A;  4MVR A;  3DE8 A;  2E87 A;  3FOP A;  5E33 A;  2Y39 A;  3ASO C;  4BJ5 C;  4JKV A;  5A69 A;  1ZHZ A;  2A69 F;  1NU9 C;  3T4R A;  1BBH A;  2A6E F;  3FAP B;  4FWV A;  2O9X A;  3IPM O;  3K1H A;  3L34 A;  2R7O A;  4YL0 A;  1SMY F;  5DQT A;  3EZI A;  3C18 A;  3R7C A;  4ULW A;  4IRU A;  3RFY A;  5A6K A;  5FCL A;  4PFO A;  3IEE A;  3GEE A;  4JIO A;  3EH1 A;  2DGJ A;  2XLV A;  4YJW A;  3W2V A;  3ZQV A;  5B3S C;  3HNL A;  5JT4 A;  3LES A;  5BQH A;  1OW8 A;  1Q0K A;  4AE4 B;  3PDM P;  1OCC C;  3S28 A;  5K0I A;  1WN0 A;  1O5H A;  3ABK C;  4BPM A;  4OIQ F;  1YZA A;  2QUP A;  2XLW A;  1E85 A;  3LUT B;  3S90 A;  4DRH B;  3AG4 C;  3U5S A;  4CS9 C;  4CS9 A;  4ER9 A;  4HEA J;  2A0U A;  3SXZ A;  2P61 A;  2YVK A;  4O79 A;  1DOW A;  1OXB A;  2WVO A;  1ZHY A;  1D1B A;  2GA0 A;  5AC4 A;  3TUL A;  3K6B A;  1AEP A;  1MMD A;  4MTF A;  3GEH A;  1NFN A;  1YJG A;  2MHR A;  2XRH A;  4C3E A;  4EIY A;  1D1A A;  4G7Z F;  1HE9 A;  1M2O A;  2B0H A;  2JPU A;  3RH3 A;  1T6U A;  4F4B A;  1TFO B;  1LS1 A;  4IAO A;  1AUE A;  3U8V A;  3U2L A;  1OQC A;  1C03 A;  5EK0 A;  4WGZ A;  3GAN A;  2NPU A;  4HE8 D;  4XEF A;  3W8H A;  4P6I C;  3QVZ A;  3SYN A;  5B1B C;  4ANJ A;  2MWQ A;  3DI5 A;  3S29 A;  3ZTM A;  1CGN A;  2GAQ A;  3NKD A;  1TQG A;  1TWH A;  2PNO A;  4AE4 A;  5L0J A;  3LS0 A;  3C63 A;  4HFF B;  5AGF A;  3NYJ A;  2IYL D;  3C8G A;  3DWW A;  3SEO A;  3K7D A;  3HLZ A;  4XQ1 A;  1Z3I X;  4QI2 A;  2YZS A;  2YLD A;  2B0J A;  2FFH A;  4OIN F;  3X2Q C;  5BQI A;  2LK4 A;  4RBN A;  4KC9 A;  3ZC4 A;  4BJT A;  4Q5S F;  3NMI A;  5KYU A;  2XS1 A;  3GOR A;  5COF A;  1VOM A;  3ZIB A;  2J9U A;  4JCH A;  3VAY A;  1PD1 A;  4CJG A;  4CIH A;  1ZU4 A;  1CGO A;  1IW7 F;  3QTH A;  3TQO A;  5KYW B;  1QKR A;  1YA9 A;  4O7G A;  3NRH A;  3SP1 A;  2HMZ A;  1V74 B;  1ORY A;  1VYK A;  4J7T A;  4MND A;  1BR4 A;  2LFF A;  3JRT A;  3RW0 A;  3S9O A;  3C62 A;  1VYI A;  3DZA A;  4U9E A;  2HS5 A;  1H7I A;  2KYH A;  2YWA A;  4DRJ B;  1QQ3 A;  1LI7 A;  1T5O A;  3GWN A;  3RF3 A;  4DVZ A;  3O39 A;  1G4U S;  4NTB A;  4KNW A;  3L1M A;  1ZZP A;  4EBJ A;  2YLG A;  4K1O A;  2ASR A;  4U5C E;  4WAB A;  1TWA A;  3LJB A;  5CIV A;  2R7R A;  4CSA C;  3U9J A;  1I4Z A;  1K40 A;  3AQC A;  1WGW A;  3HKK A;  4YT2 A;  4QDL A;  4WJ0 A;  4EWC A;  2ZPA A;  4G7H F;  3U0C A;  2J46 A;  1SYQ A;  4NTA A;  5HV9 A;  1D0X A;  5DS5 A;  1LE4 A;  2OEV A;  3CZ6 A;  4I3M A;  5JP7 A;  1TKN A;  1DOV A;  1YYX A;  3HJC A;  4GYT A;  4K7B A;  2AWC A;  2X0C A;  3N0T A;  5E2Q A;  4XPX A;  1E2X A;  1SF8 A;  1ORJ A;  2VCC A;  2ZXR A;  3I5P A;  2LCH A;  2HFI A;  3DM9 B;  1HMD A;  1FFH A;  2IXP A;  3VRC A;  5KYY B;  2J9B A;  4AL1 A;  4N6C A;  4W8K A;  3K66 A;  2KQ9 A;  1U6H A;  2BL2 A;  3DKA A;  5BQG A;  4OD5 A;  2Q3T A;  1J8M F;  3FMS A;  3JZ0 A;  2QE9 A;  1Q0G A;  4Z9J A;  2TMV P;  3U3B A;  2HSB A;  2OJQ A;  1CPQ A;  1LIH A;  2ZD9 A;  4JUR I;  2KW3 C;  4YT5 A;  2L6H A;  4BEM J;  1OW7 A;  4EBB A;  4LLE A;  1QPU A;  3G4Z A;  1VTM P;  2YKZ A;  4JVS A;  1EI7 A;  4YK5 A;  3PMR A;  1Z5Z A;  3GEI A;  2M64 A;  2CCY A;  2QLA A;  3US6 A;  3QMK A;  3O6X A;  3CAX A;  4BEJ A;  5JS5 A;  1VLS A;  1NU7 D;  2J8W A;  2RSE B;  2YL1 A;  5GPG B;  1XZP A;  1Z23 A;  3GM1 A;  5COM A;  1FMV A;  5HSW A;  1NZE A;  3IQC A;  1VK5 A;  1A7D A;  1M2V B;  3QZC A;  4MW3 A;  5KYY A;  2KK1 A;  4IAR A;  5JVE A;  2PX0 A;  4CDA A;  2DYS C;  4PAC A;  5A6B A;  3BEH A;  1YLM A;  1RKE B;  3AG3 C;  4JEB A;  3V5Z A;  2I15 A;  1LS4 A;  1UG7 A;  2Y69 C;  1NLX A;  1T6Q A;  3MYI A;  3U8P A;  4CX9 A;  1OCZ C;  3QW0 A;  2R7U A;  2LFD A;  4G7O F;  1OW6 A;  2VCB A;  5EGY A;  2AVK A;  5F28 E;  2KSF A;  1ST6 A;  4P9F A;  3DM5 A;  3LLK A;  4CJO A;  2IM8 A;  3O10 A;  4IJJ A;  1UFB A;  3FAJ A;  4QI0 A;  5DVW A;  3B0P A;  2M4E A;  2G62 A;  2P6V A;  2YL3 A;  2G3V A;  1Z6A A;  1BZ4 A;  3GM2 A;  3LAY A;  4D4X A;  3RQF A;  2CGE A;  4U9D A;  2P0N A;  1KNY A;  1M2V A;  2LD6 A;  4C3B A;  4OIR F;  3WG7 C;  1ZHW A;  3VYW A;  2J9V A;  2XSE A;  4LLC A;  2ZXW C;  2EIJ C;  4MW8 A;  2VB6 A;  4G0H A;  4K0D A;  4FX5 A;  1YZC A;  2F22 A;  2J0X A;  1YA7 O;  1N1C A;  1QZX A;  2XLH A;  4CDY A;  5IY5 C;  5L0D A;  3OWT A;  2XS8 A;  2J45 A;  3J06 A;  5L0I A;  3TK0 A;  3M1C B;  4XWJ A;  4MS2 A;  4ONS A;  1CGM E;  2OKU A;  2AU5 A;  1R4T A;  2A68 F;  1GM5 A;  4C7O B;  4BJ6 C;  3ABM C;  4BJ6 A;  4LAC B;  2W45 A;  3MX3 A;  3ZVR A;  4JC7 A;  4LER A;  2ZXO A;  1M6T A;  4J7Y A;  4B6I A;  1WTY A;  5KYN A;  4HFK B;  1Z63 A;  3FDQ A;  3Q6M A;  2XLO A;  2WVQ A;  2YRF A;  3DJU B;  3NMK A;  4LDQ A;  4GQH A;  4BJ1 A;  5L3Q A;  1U89 A;  1ZHX A;  2LSE A;  2DB4 A;  4JJF A;  2OOC A;  2WZF A;  4ULV A;  2LP4 A;  1LE2 A;  2Q9C A;  2GDC A;  3G4X A;  2HJM A;  3M15 A;  1D0Y A;  1JAF A;  4JEA A;  4JE9 A;  2R03 A;  4NY3 A;  4U5B E;  4U5G A;  4A4A A;  3NKE A;  3DJN B;  3F46 A;  3SNH A;  2OQM A;  3DD7 A;  2KNH A;  2P1A A;  2Y3D A;  4LDK A;  1HMO A;  3GM3 A;  4PJJ A;  3GOD A;  4E7Z A;  1EKY A;  2LIG A;  5L0G A;  3ECS A;  5JRA A;  1K05 A;  3EFO B;  1V4A A;  3JCU Q;  3M4C A;  1QVX A;  3B9Q A;  1ZYR F;  1XZQ A;  2VH3 A;  3KKB A;  1A0B A;  3ZDL A;  5CI9 A;  3KMI A;  5E3C A;  3TD7 A;  3JSE O;  3IQ5 A;  3ZTZ A;  1NFO A;  2J9W A;  2CW0 F;  1JOG A;  4OIP F;  3L8I A;  1BR2 A;  3G50 A;  2OJE D;  1D0Z A;  4WGY A;  1M56 C;  2NUP B;  4JTC B;  4YWQ A;  1JPJ A;  3EG9 B;  3T6J A;  4DRI B;  4I44 A;  2GWW A;  3HNJ A;  2G3K A;  5L0F A;  4AX2 A;  2H7B A;  1LI5 A;  1OR3 A;  1NG1 A;  3B0U X;  4DVY P;  3N24 A;  4N4W A;  3HNI A;  1E86 A;  5FZT A;  3W8I A;  2PFD A;  3HTK C;  2OG2 A;  2Y3B A;  4J32 B;  4N06 A;  3AG2 C;  4Q7C A;  3EFO A;  1Q0M A;  1Y4C A;  2ETS A;  3NG1 A;  2FAP B;  2VC9 A;  3R2P A;  3LNM B;  3LS1 A;  4M63 A;  4NCQ A;  1LPE A;  2NUT B;  3ZWI A;  3PHF 2;  2EIM C;  5KYW A;  2LQG A;  3SXM A;  4D4N A;  5D92 A;  1MMG A;  2WVN A;  1EQ1 A;  1FTS A;  4IAQ A;  4KBL A;  4IGG A;  3FHD A;  3H2V A;  1L7C A;  5DLJ A;  3IQ6 A;  3JT1 A;  3TJ6 A;  4YT4 A;  3UGO A;  1ZW3 A;  1TR2 A;  2WZL A;  3MLG A;  4DOZ A;  4NC3 A;  1BDJ B;  2W9Y A;  3A9C A;  3H2U A;  1Q0D A;  1LVK A;  1OKK D;  1TWG A;  2CDQ A;  3N2Z B;  3O55 A;  3EG9 A;  4FES A;  4H54 A;  3T6G B;  2YHS A;  4X0R A;  4W8P A;  2CYD A;  3EQL F;  2C03 A;  4XLN F;  1YYJ A;  2IOQ A;  4PK4 A;  3ATP A;  5D91 A;  5DQZ A;  4EUK B;  2D5R B;  5B3I A;  4XPY A;  3HNK A;  3U3F A;  4E0I A;  2JD3 A;  2DYR C;  2NUT A;  2HV7 A;  4RDA A;  2VAS A;  3DMD A;  2RD9 A;  4EKW A;  3LLI A;  1H9T A;  1ZVZ A;  2W4B A;  2QY9 A;  1GS9 A;  1PV3 A;  1RKC A;  1TWC A;  2R05 A;  2WL8 A;  3I5Q A;  3LEV A;  4MVZ A;  4MVM A;  5BUO A;  4IWB A;  2HJ3 A;  3Q7G A;  2C04 A;  3RVZ A;  3WHN A;  1U0B B;  3TJ5 A;  2Q4F A;  2EIL C;  1LM3 B;  2R7Q A;  3SZR A;  1H9G A;  2HKV A;  3CSK A;  4E17 A;  3UMI A;  4DBQ A;  3AGU A;  4CDV A;  3CQZ A;  4JTD B;  2XXA B;  2IXM A;  3CEX A;  3WOD F;  4P9T A;  3F47 A;  2HUJ A;  3FVY A;  4MVO A;  1Y6D A;  2YL7 A;  1MNE A;  3M79 A;  4DJ9 A;  4XTK A;  3V5X A;  2DI3 A; 
#chains in the Genus database with same CATH homology
 1M6T A;  3M4B A;  3C62 A;  2XLO A;  3NMJ A;  3NMK A;  4U9E A;  1APC A;  1QQ3 A;  2XLD A;  3TOL A;  4ULV A;  3L1M A;  1E84 A;  2XM4 A;  2YLG A;  4JEA A;  3M15 A;  1JAF A;  4JE9 A;  3ZQY A;  5JSL A;  4L6R A;  1EKY A;  2BC5 A;  5JRA A;  3M4C A;  3QVY A;  2XLE A;  3DE9 A;  1RCP A;  1YYX A;  5JP7 A;  2YL0 A;  4N6H A;  1NBB A;  2XM0 A;  3IQ5 A;  3VRC A;  1A7V A;  2J9B A;  1GQA A;  3ZTZ A;  256B A;  4WGY A;  2YLI A;  4IB4 A;  1CPQ A;  3DE8 A;  3FOP A;  3HNJ A;  4JKV A;  1QPU A;  2YKZ A;  1BBH A;  1E86 A;  4N4W A;  3HNI A;  2QLA A;  2CCY A;  5JS5 A;  2J8W A;  2YL1 A;  3ZWI A;  4D4N A;  3QW1 A;  4IAQ A;  2XLV A;  4CIP A;  3ZQV A;  3HNL A;  5JT4 A;  3FOO A;  4IAR A;  5JVE A;  3IQ6 A;  4CDA A;  5JUA A;  1YZA A;  2XLW A;  4JEB A;  1E85 A;  4NC3 A;  4ER9 A;  5JLI A;  3U8P A;  4CX9 A;  3QW0 A;  1MQV A;  1YYJ A;  4CJO A;  1E83 A;  4EIY A;  5B3I A;  3HNK A;  2YL3 A;  1S05 A;  4WGZ A;  4D4X A;  3QVZ A;  4U9D A;  3ZTM A;  1CGN A;  3C63 A;  5AGF A;  2XL6 A;  1CPR A;  1LM3 B;  1YZC A;  2YLD A;  2XLH A;  4CDY A;  3TOM A;  3NMI A;  4CDV A;  2XLM A;  2XL8 A;  4CJG A;  2YL7 A;  1CGO A;  3M79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...