3U2MA

Crystal structure of human alr mutant c142/145s
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEESAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2mA00
3U2LA 1JRAA 3TD7A 1OQCA 3GWNA 3TK0A 3GWLA 3U5SA 1JR8A 3LLKA 3O55A 3W4YA 3LLIA 4E0HA 3MBGA 2HJ3A 3U2MA 4E0IA 3R7CA 4LDKA
chains in the Genus database with same CATH superfamily
4AL1A 1JRAA 3EGDA 2HV6A 4U5CE 3U8PA 4XEKA 4I3MA 4CS9C 1M56C 4JZAA 2R7WA 1OQCA 5BUOA 3AQCA 2EPKX 3W8HA 2HFIA 4K1OA 4N4WA 5HV9A 1S05A 1HMOA 1TFKB 3JSZA 2YEVA 5L3VA 3T6JA 4C7OB 2P0NA 2HSBA 4YT4A 1Q0GA 2OJQA 1ZW3A 2XM0A 4OIOF 1MMNA 1KU2A 5DS4A 2LSEA 3M4BA 2Y3DA 4AX2A 3AGTA 4J7TA 4YT5A 4NC3A 1JAFA 2V3CC 2WZFA 4YL1A 5T1DB 4PJNA 4E18A 3QVZA 3MYFA 5DQTA 2P61A 1ZZPA 2B0HA 3DE8A 5BQGA 3X1OA 5KYUB 2EPLX 1D1AA 2P7VA 3DAFA 2EIKC 2VASA 4MVMA 4XLPF 4O6NA 5L0JA 4JIOA 3C8GD 4MVSA 1VK5A 3UMIA 3EG9B 4JKVA 4MVZA 5GPGB 4HEAJ 2HMZA 2FAPB 2I15A 2NG1A 4MVOA 3FXHA 2ICWG 4MS2A 1PCXA 4O79A 3LLKA 4AE4B 4JC7A 3OA1A 1YARO 4JW1A 3V5ZA 3HJCA 4YL3A 4YT2A 3RYLA 3LESA 2YKZA 4U9DA 2CW0F 3C62A 5D92A 2OJED 1FMWA 2EIJC 2ZXRA 3IPMO 2NSFA 4GQHA 4N6HA 5AC5A 1VYKA 2YVKA 3EGDB 3NDBB 1WWPA 2FGYA 3M4CA 3FAPB 3RQGA 3L1MA 1ORSC 1TR2A 2R25A 3MLGA 3LNRA 3N2ZB 5JP7A 1FR0A 4EIYA 1YVIA 2J0XA 3EPVA 4IARA 2WVOA 4ULWA 4JE9A 4PJMA 3QW1A 2KC3A 1L7CA 2J9BA 4J7YA 1CPQA 3DD7A 1OKKD 2XLVA 4RDAA 2C03A 3U5SA 5HSWA 2YLGA 4U5GA 2O9XA 3JT1A 3V5YA 1GGQA 2GA0A 3IQTA 3NYJA 1EI7A 1SYQA 5K0IA 2WZGA 2MWQA 2UUHA 3M1CB 4FWVA 3U8VA 3K1IC 2M64A 2NPUA 4Z9HA 2PX3A 3W4YA 2OOCA 1M2VA 1V54C 5FCLA 4LLEA 3ZTMA 4E0HA 4YK5A 2IXPA 2R03A 4Q5SF 4NTAA 4CIHA 4ULVA 2Y3BA 4E0IA 3CAXA 1D1BA 2QUPA 3I5QA 2Y69C 4XTKA 3V5XA 3ASOC 3DXJF 3K33A 3PDMP 4X0RA 2YZSA 3J06A 3NYMA 1A0BA 2DYSC 3FMSA 4BJ5A 3TULA 4OINF 2XM4A 4YJWA 2Z15A 2DYRC 4BG0A 1RJ9A 2LFDA 2OEVA 1Z3IX 1OXKA 1PD1A 1DOWA 4IAOA 4JTCB 1OCZC 4WGYA 3DAGA 3UR3C 2XXAA 1G8XA 3EZHA 4JURI 1HY5A 2HKVA 3A11A 3L34A 2H7VC 1FMVA 2QTVA 2OG2A 4XPXA 3K7DA 1OCRC 2KGOA 1CGNA 3EH1A 4XEFA 2Q3TA 2A0BA 3ATPA 2R02A 5CI8A 4CDAA 4ER9A 3B9QA 3EQLF 4QDLA 2YLDA 3RH3A 4CS7A 4FX5A 3T6BA 4O6YA 2G62A 4ANJA 5JRAA 1L3PA 5EHHA 3F47A 4XQ1A 1VMAA 3LEOA 3JSEO 3LAYA 2LQGA 1QQ3A 4EBBA 4U5BE 2R05A 3O39A 1M2VB 4U5DE 2DI3A 1PD0A 1G4US 4YT8A 1C02A 2LD6A 3FHDA 3JCUQ 5EK0A 3MFNA 5FZTA 4DBQA 2L9JA 4H54A 2X51A 2KQ9A 1YAUO 2XLHA 3KL4A 4PJLA 4BPMA 1ZHXA 3OWTA 3AG1C 3MBGA 4L6RA 2L6FA 256BA 3QMKA 4DJ9A 3GM2A 3U3BA 3C8ZA 2X0CA 1C17M 1E83A 2HS5A 4NY3A 3HNKA 3EJNA 1PV3A 3NMKA 1D0YA 1LE4A 1MQVA 1T9KA 1QLEC 5B3IA 4XPYA 2B0JA 2W4MA 3FAJA 1RJ9B 2XL4A 3IQ5A 2XL8A 3SXYA 2XS8A 4MTFA 2WB7A 3RVYA 1U0BB 4Z9JA 1VTMP 2F22A 3L0IA 3HNJA 1D0XA 3UMHA 3X2QC 1JMWA 4IB4A 1AVOB 1ZYRF 1O3UA 4LDQA 5JT4A 2XXAB 3V7OA 4YWQA 4CJOA 2IYLD 3RKOF 4QI2A 1N1CA 1NZEA 1VYIA 1LI5A 2J46A 1SZIA 2OEXA 3O10A 5KYXA 2H7BA 5L0CA 3GEHA 2Q4FA 2H7OA 1HE1A 4QI0A 3DKAA 4Q7CA 2V26A 2Q00A 5BQHA 1ZW2A 4HE8D 4NTFA 2Q7RA 3U2MA 1RKCA 4CDVA 3U2LA 5L3QA 1BR1A 1OXBA 3IHUA 1RKEA 5KYNA 3S0XA 3ABMC 3ABKC 4CDYA 3U0CA 4WABA 1Q0FA 3PCVA 2A6EF 3US6A 1FFHA 1TFOB 4NTBA 4MVRA 1HW1A 5A6KA 4I1OB 2FFHA 1OR3A 1VOMA 2W4BA 3E9VA 2WVNA 5JLIA 1O87A 2EINC 1ZHWA 1YDIA 4FESA 2A6HF 3H65A 5L0DA 4LERA 2PNOA 1D0ZA 2AU5A 4HFFB 3T4RA 2TMVP 3NKDA 2GDCA 5L0GA 3RF3A 5A6JA 3MYIA 1XZQA 3DZAA 1VLSA 2KW3C 2HV7A 2PBEA 2OU6A 2VC9A 4W8KA 2R9RB 3SZRA 1GQAA 3Q7LA 4CSAC 4PACA 2P6VA 3VRCA 1EKYA 4PR9A 2CNWA 4IRUA 1E85A 1CPRA 1S7ZA 2HMQA 2KJGA 4JCHA 4OD5A 1J8MF 2EIMC 3ASNC 4LDRA 4P9FA 1YYXA 3K1IA 4RBNA 3SEOA 3ZVRA 2XLDA 3L8JA 4BJ6C 5AGFA 5KYWA 1BZ4A 1G4WR 5E3CA 2R7RA 2IXOA 2XLWA 5CI9A 4EUKB 5CIVA 3RIPA 3SYNA 1M2OA 5EGYA 2YL3A 2EPOA 2LP4A 2YQYA 2ZD9A 2IXNA 2I8BA 3GORA 4XLNF 2PP4A 5DLJA 5KYXB 2AWYA 2J0WA 4PFOA 4W8PA 2LCHA 3TOLA 5T3WA 2CGEA 3DJUB 4A4AA 1YA7O 3UGPA 2WL8A 1EQ1A 1HW2A 1Z6AA 2Q9AA 1A7VA 1GM5A 2KSFA 3HLZA 1T6UA 2CYDA 4I1MA 4LACB 2LFFA 3FOPA 3W8IA 4E17A 1RKEB 3AOUA 4G7ZF 2IXMA 3EGXA 3B29A 2ASRA 2CDQA 2QY9A 4MW8A 4MQ9F 4E7ZA 2R7SA 2XSEA 2L7AA 3EHNA 1UFBA 3SP1A 5KYYB 2R7OA 4MNDA 3TOMA 3QW0A 1QSPA 3A9CA 3GWNA 5L0FA 4LLCA 3DJNB 3VAYA 4EKWA 2DB4A 4RD9A 1QPUA 2VB6A 4CX9A 3LNMB 4XEVA 2Y3HA 4P9TA 3SXMA 1VLTA 3TQOA 3U9MA 5BQIA 3M79A 5DS5A 3FOOA 4WJ0A 4PFPA 3VF0A 2OCCC 1SMYF 4FAPB 1CGOA 1QKRA 1YLMA 4MTOA 3S27A 1WGWA 1LE2A 2VCAA 5F5FA 2HSQA 3U9JA 3IQCA 3BEHA 5A6BA 5DVWA 2QE9A 3UGOA 2R7XA 1NG1A 4JTDB 3WAQA 1BR2A 2JX0A 4DOZA 1KTMA 1NFOA 4BJTA 2J7PA 4OIPF 4WGZA 4J32B 3NMIA 1TKNA 5KYWB 3ABLC 4LDKA 1LS1A 1T01A 3B71A 3B0VC 2A0UA 3TD7A 3QZCA 3ZQVA 2XS1A 2YWAA 4MW3A 1RCPA 1LIHA 1R5ID 4ONSA 3ZQYA 5AC4A 2YHSA 3GEIA 2J9VA 3LS0A 1BBHA 1U89A 3CQZA 3SXKA 4NCQA 4GYTA 4E7SA 4IAQA 1YJGA 2QLAA 1MMGA 1WASA 4M63A 5E33A 3M15A 2NUPB 2GAQA 4NQFA 2OQMA 4KNWA 2YL0A 1DOVA 3AGUA 1MNDA 3EGXB 2KK1A 3EHMA 1OR2A 2VCCA 3ZC4A 3IQ6A 1Z23A 2DGJA 3AJMA 3NKEA 2XLEA 3QTHA 2G3KA 2VCBA 2HJ3A 2RSEB 3S9OA 1ORJA 3WHNA 1EA8A 4D4NA 3C18A 1AEPA 2EILC 2JPUA 1IZMA 4N6CA 5A6AA 3B0PA 1HMDA 1H9GA 4J30B 5IY5C 2PX0A 1SR2A 1H9TA 4O6MA 4EBKA 1RXQA 2XL6A 3G50A 3ITFA 4EBJA 2ZXWC 2IOQA 4JEBA 1ZHTA 3EH2A 1CGME 3GANA 2J8WA 3S84A 1ZHZA 3N24A 3FDQA 2YLIA 1K05A 1BDJB 2R7QA 4N06A 3GEEA 4P6IC 4PK4A 3S29A 3VM6A 2ZXPA 1MMDA 4IGGA 4OD4A 4BEMJ 1QVXA 3SXZA 4MVUA 4DRHB 3LLIA 2MYSA 1JPNA 2J45A 3DM9B 2ZXOA 5B3SC 1QZXA 2BC5A 2IBFA 1A7EA 2M4EA 1NFNA 3DMDA 2GWWA 2W45A 1OCOC 1NSGB 2J9UA 4DRIB 1H6GA 4CJGA 1TWHA 4JEAA 5D91A 4UDVA 4G7HF 3NRHA 5DQZA 1K04A 1Z5ZA 2MHRA 4DVYP 2EPNA 4DVZA 2KYHA 1WATA 3E70C 3PMRA 4C3BA 1MNEA 2LIGA 3DM5A 3T9OA 1LS4A 1FAPB 3HNLA 2CNWD 3GODA 4ZLCA 4U5FE 2AP3A 2UUIA 5F28E 2BE5F 2ZPAA 5L0HA 4CS8C 1A41A 3ZSUA 3F46A 4MVQA 1J8YF 3KPHA 1D1CA 3LUTB 3ZTZA 4CSAA 1O5HA 2AWCA 1BR4A 2WZLA 3S28A 2YL1A 4U5EE 3KYJA 3AQBA 3N0TA 4Z9IA 3TJ5A 4KNVA 1YZCA 3C63A 4MTGA 4BJ6A 2L81A 4D4XA 3BRJA 1FNTc 1YA9A 3KKBA 1T5OA 1OW7A 2A69F 5E2QA 1M57C 3EZIA 1C03A 1FFTC 1ZHYA 2LK4A 3GM1A 4JVSA 1V4AA 4XWJA 3JYYA 3I5PA 5TJ5E 5L0IA 2Q9CA 1W2WA 1ORYA 3JZ0A 4Q4ZF 5A69A 1SF8A 5JS5A 3EFOA 4C3DA 4BJ1A 4H4KC 4U9EA 5T3TA 1OCCC 5B1AC 1I4YA 2GFHA 3ZIBA 1RMVA 2YRFA 2NUTA 1ST6A 1LKXA 3KH2A 3UNGC 1OW8A 4G78A 1YZAA 2A1DD 3AG4C 2C04A 1I4ZA 5B1BC 2PFDA 3SNHA 2NUPA 1E84A 3CEXA 3NMJA 5A6BD 3LEVA 2G3VA 4AL0A 1NLXA 2Q9BA 3C8GA 4CIPA 5JVEA 1VB5A 1JOGA 1ZU4A 2J7PD 1UG7A 3CZ6A 4JCZA 4G7OF 2XRHA 3T6GB 4B6IA 3NG1A 3TK0A 4DBRA 1Y4CA 1TWCA 3G4ZA 1AUEA 1WOLA 2RD9A 3G4XA 3FVYA 1Q0DA 3LS1A 1FTSA 4U5HA 1A7DA 1V55C 2A68F 2XLMA 1KNYA 5COFA 1JR8A 3JRTA 2QNLA 4F4BA 3S90A 3JRMO 3UMKA 1LI7A 1XWJA 3O55A 1I5NA 5JSLA 1Z63A 4ZLDA 2E87A 3K1HA 5F5HA 5JUAA 3VYWA 3KMIA 4JJFA 1LPEA 2R7UA 3W2WA 2EPMX 2HUJA 1T6IA 3PHF2 3B0UX 2KNHA 4JJGA 2L6GA 3EFOB 1OKKA 2W9YA 4KC9A 1NU7D 3POVA 2HZ8A 1Q0MA 2P1AA 1H7IA 2Y3GA 3RQFA 3JYHA 2D4UA 1WN0A 2H8AA 3I4UA 3KYIA 1ZU5A 3HTKC 3U3FA 1APCA 1M6TA 3RQEA 2NUTB 3AG3C 1NU9C 3ZG1A 4AK9A 3AG2C 4GEHA 3RW0A 1IW7F 2L6HA 3O6XA 3R2PA 1LVKA 4KBLA 2D5RB 1GS9A 4BEJA 4CBEA 1TQGA 3OEOA 2Y39A 2XLOA 4G0HA 2IM8A 4DXWA 4JRZA 2WVQA 4DRJB 3Q7GA 3ECSA 2R7TA 2OKUA 3GM3A 3HKKA 1B68A 4BJ5C 4IJJA 4EWCA 4OIQF 3C8GB 3WG7C 4K0DA 1Y6DA 3DE9A 4C7OA 5E3AA 5DS6A 1E2XA 4EHPA 2J9WA 2NSGA 3JTLO 1F1MA 2JD3A 3WODF 4IWBA 1YYJA 2BL2A 1T6QA 3R7CA 4XPWA 3ZWIA 4OIRF 2HJMA 3TJ6A 1HE9A 2YL7A 3IEEA 3QVYA 2PF4E 4PJJA 5KYYA 2AVKA 4A2NB 3LJBA 1JPJA 1U6HA 3GWLA 4YL0A 5KYUA 1WTYA 3L8IA 1TWGA 1Z7Qc 3RVZA 3MX3A 1G5ZA 4JTAB 1K40A 3DWWA 3DI5A 1TWAA 3EG9A 4YN0B 2R7VA 5COMA 4CS9A 3C7JA 1NBBA 2VH3A 3NYLA 3Q6MA 3W2VA 3K66A 1OW6A 2CCYA 1XZPA 1V74B 2ETSA 5COGA 3HNIA 4K7BA 4AE4A 4C3EA 4I44A 1E86A 1MMAA 4HFKB 4O7GA 3H2UA 4KI2A 3H2VA 3RFYA 1Q0KA 3CSKA 4R32A 3ZDLA 1R4TA 4CS8A 3Q6NA 3K6BA 1ZVZA 1LM3B
chains in the Genus database with same CATH topology
3U2LA 1JRAA 3TD7A 1OQCA 3GWNA 3TK0A 3GWLA 3U5SA 1JR8A 3LLKA 3O55A 3W4YA 3LLIA 4E0HA 3MBGA 2HJ3A 3U2MA 4E0IA 3R7CA 4LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2L A;  1JRA A;  3TD7 A;  1OQC A;  3GWN A;  3TK0 A;  3GWL A;  3U5S A;  1JR8 A;  3LLK A;  3O55 A;  3W4Y A;  3LLI A;  4E0H A;  3MBG A;  2HJ3 A;  3U2M A;  4E0I A;  3R7C A;  4LDK A; 
#chains in the Genus database with same CATH topology
 4AL1 A;  1JRA A;  3EGD A;  2HV6 A;  4U5C E;  3U8P A;  4XEK A;  4I3M A;  4CS9 C;  1M56 C;  4JZA A;  2R7W A;  1OQC A;  5BUO A;  3AQC A;  2EPK X;  3W8H A;  2HFI A;  4K1O A;  4N4W A;  5HV9 A;  1S05 A;  1HMO A;  1TFK B;  3JSZ A;  2YEV A;  5L3V A;  3T6J A;  4C7O B;  2P0N A;  2HSB A;  4YT4 A;  1Q0G A;  2OJQ A;  1ZW3 A;  2XM0 A;  4OIO F;  1MMN A;  1KU2 A;  5DS4 A;  2LSE A;  3M4B A;  2Y3D A;  4AX2 A;  3AGT A;  4J7T A;  4YT5 A;  4NC3 A;  1JAF A;  2V3C C;  2WZF A;  4YL1 A;  5T1D B;  4PJN A;  4E18 A;  3QVZ A;  3MYF A;  5DQT A;  2P61 A;  1ZZP A;  2B0H A;  3DE8 A;  5BQG A;  3X1O A;  5KYU B;  2EPL X;  1D1A A;  2P7V A;  3DAF A;  2EIK C;  2VAS A;  4MVM A;  4XLP F;  4O6N A;  5L0J A;  4JIO A;  3C8G D;  4MVS A;  1VK5 A;  3UMI A;  3EG9 B;  4JKV A;  4MVZ A;  5GPG B;  4HEA J;  2HMZ A;  2FAP B;  2I15 A;  2NG1 A;  4MVO A;  3FXH A;  2ICW G;  4MS2 A;  1PCX A;  4O79 A;  3LLK A;  4AE4 B;  4JC7 A;  3OA1 A;  1YAR O;  4JW1 A;  3V5Z A;  3HJC A;  4YL3 A;  4YT2 A;  3RYL A;  3LES A;  2YKZ A;  4U9D A;  2CW0 F;  3C62 A;  5D92 A;  2OJE D;  1FMW A;  2EIJ C;  2ZXR A;  3IPM O;  2NSF A;  4GQH A;  4N6H A;  5AC5 A;  1VYK A;  2YVK A;  3EGD B;  3NDB B;  1WWP A;  2FGY A;  3M4C A;  3FAP B;  3RQG A;  3L1M A;  1ORS C;  1TR2 A;  2R25 A;  3MLG A;  3LNR A;  3N2Z B;  5JP7 A;  1FR0 A;  4EIY A;  1YVI A;  2J0X A;  3EPV A;  4IAR A;  2WVO A;  4ULW A;  4JE9 A;  4PJM A;  3QW1 A;  2KC3 A;  1L7C A;  2J9B A;  4J7Y A;  1CPQ A;  3DD7 A;  1OKK D;  2XLV A;  4RDA A;  2C03 A;  3U5S A;  5HSW A;  2YLG A;  4U5G A;  2O9X A;  3JT1 A;  3V5Y A;  1GGQ A;  2GA0 A;  3IQT A;  3NYJ A;  1EI7 A;  1SYQ A;  5K0I A;  2WZG A;  2MWQ A;  2UUH A;  3M1C B;  4FWV A;  3U8V A;  3K1I C;  2M64 A;  2NPU A;  4Z9H A;  2PX3 A;  3W4Y A;  2OOC A;  1M2V A;  1V54 C;  5FCL A;  4LLE A;  3ZTM A;  4E0H A;  4YK5 A;  2IXP A;  2R03 A;  4Q5S F;  4NTA A;  4CIH A;  4ULV A;  2Y3B A;  4E0I A;  3CAX A;  1D1B A;  2QUP A;  3I5Q A;  2Y69 C;  4XTK A;  3V5X A;  3ASO C;  3DXJ F;  3K33 A;  3PDM P;  4X0R A;  2YZS A;  3J06 A;  3NYM A;  1A0B A;  2DYS C;  3FMS A;  4BJ5 A;  3TUL A;  4OIN F;  2XM4 A;  4YJW A;  2Z15 A;  2DYR C;  4BG0 A;  1RJ9 A;  2LFD A;  2OEV A;  1Z3I X;  1OXK A;  1PD1 A;  1DOW A;  4IAO A;  4JTC B;  1OCZ C;  4WGY A;  3DAG A;  3UR3 C;  2XXA A;  1G8X A;  3EZH A;  4JUR I;  1HY5 A;  2HKV A;  3A11 A;  3L34 A;  2H7V C;  1FMV A;  2QTV A;  2OG2 A;  4XPX A;  3K7D A;  1OCR C;  2KGO A;  1CGN A;  3EH1 A;  4XEF A;  2Q3T A;  2A0B A;  3ATP A;  2R02 A;  5CI8 A;  4CDA A;  4ER9 A;  3B9Q A;  3EQL F;  4QDL A;  2YLD A;  3RH3 A;  4CS7 A;  4FX5 A;  3T6B A;  4O6Y A;  2G62 A;  4ANJ A;  5JRA A;  1L3P A;  5EHH A;  3F47 A;  4XQ1 A;  1VMA A;  3LEO A;  3JSE O;  3LAY A;  2LQG A;  1QQ3 A;  4EBB A;  4U5B E;  2R05 A;  3O39 A;  1M2V B;  4U5D E;  2DI3 A;  1PD0 A;  1G4U S;  4YT8 A;  1C02 A;  2LD6 A;  3FHD A;  3JCU Q;  5EK0 A;  3MFN A;  5FZT A;  4DBQ A;  2L9J A;  4H54 A;  2X51 A;  2KQ9 A;  1YAU O;  2XLH A;  3KL4 A;  4PJL A;  4BPM A;  1ZHX A;  3OWT A;  3AG1 C;  3MBG A;  4L6R A;  2L6F A;  256B A;  3QMK A;  4DJ9 A;  3GM2 A;  3U3B A;  3C8Z A;  2X0C A;  1C17 M;  1E83 A;  2HS5 A;  4NY3 A;  3HNK A;  3EJN A;  1PV3 A;  3NMK A;  1D0Y A;  1LE4 A;  1MQV A;  1T9K A;  1QLE C;  5B3I A;  4XPY A;  2B0J A;  2W4M A;  3FAJ A;  1RJ9 B;  2XL4 A;  3IQ5 A;  2XL8 A;  3SXY A;  2XS8 A;  4MTF A;  2WB7 A;  3RVY A;  1U0B B;  4Z9J A;  1VTM P;  2F22 A;  3L0I A;  3HNJ A;  1D0X A;  3UMH A;  3X2Q C;  1JMW A;  4IB4 A;  1AVO B;  1ZYR F;  1O3U A;  4LDQ A;  5JT4 A;  2XXA B;  3V7O A;  4YWQ A;  4CJO A;  2IYL D;  3RKO F;  4QI2 A;  1N1C A;  1NZE A;  1VYI A;  1LI5 A;  2J46 A;  1SZI A;  2OEX A;  3O10 A;  5KYX A;  2H7B A;  5L0C A;  3GEH A;  2Q4F A;  2H7O A;  1HE1 A;  4QI0 A;  3DKA A;  4Q7C A;  2V26 A;  2Q00 A;  5BQH A;  1ZW2 A;  4HE8 D;  4NTF A;  2Q7R A;  3U2M A;  1RKC A;  4CDV A;  3U2L A;  5L3Q A;  1BR1 A;  1OXB A;  3IHU A;  1RKE A;  5KYN A;  3S0X A;  3ABM C;  3ABK C;  4CDY A;  3U0C A;  4WAB A;  1Q0F A;  3PCV A;  2A6E F;  3US6 A;  1FFH A;  1TFO B;  4NTB A;  4MVR A;  1HW1 A;  5A6K A;  4I1O B;  2FFH A;  1OR3 A;  1VOM A;  2W4B A;  3E9V A;  2WVN A;  5JLI A;  1O87 A;  2EIN C;  1ZHW A;  1YDI A;  4FES A;  2A6H F;  3H65 A;  5L0D A;  4LER A;  2PNO A;  1D0Z A;  2AU5 A;  4HFF B;  3T4R A;  2TMV P;  3NKD A;  2GDC A;  5L0G A;  3RF3 A;  5A6J A;  3MYI A;  1XZQ A;  3DZA A;  1VLS A;  2KW3 C;  2HV7 A;  2PBE A;  2OU6 A;  2VC9 A;  4W8K A;  2R9R B;  3SZR A;  1GQA A;  3Q7L A;  4CSA C;  4PAC A;  2P6V A;  3VRC A;  1EKY A;  4PR9 A;  2CNW A;  4IRU A;  1E85 A;  1CPR A;  1S7Z A;  2HMQ A;  2KJG A;  4JCH A;  4OD5 A;  1J8M F;  2EIM C;  3ASN C;  4LDR A;  4P9F A;  1YYX A;  3K1I A;  4RBN A;  3SEO A;  3ZVR A;  2XLD A;  3L8J A;  4BJ6 C;  5AGF A;  5KYW A;  1BZ4 A;  1G4W R;  5E3C A;  2R7R A;  2IXO A;  2XLW A;  5CI9 A;  4EUK B;  5CIV A;  3RIP A;  3SYN A;  1M2O A;  5EGY A;  2YL3 A;  2EPO A;  2LP4 A;  2YQY A;  2ZD9 A;  2IXN A;  2I8B A;  3GOR A;  4XLN F;  2PP4 A;  5DLJ A;  5KYX B;  2AWY A;  2J0W A;  4PFO A;  4W8P A;  2LCH A;  3TOL A;  5T3W A;  2CGE A;  3DJU B;  4A4A A;  1YA7 O;  3UGP A;  2WL8 A;  1EQ1 A;  1HW2 A;  1Z6A A;  2Q9A A;  1A7V A;  1GM5 A;  2KSF A;  3HLZ A;  1T6U A;  2CYD A;  4I1M A;  4LAC B;  2LFF A;  3FOP A;  3W8I A;  4E17 A;  1RKE B;  3AOU A;  4G7Z F;  2IXM A;  3EGX A;  3B29 A;  2ASR A;  2CDQ A;  2QY9 A;  4MW8 A;  4MQ9 F;  4E7Z A;  2R7S A;  2XSE A;  2L7A A;  3EHN A;  1UFB A;  3SP1 A;  5KYY B;  2R7O A;  4MND A;  3TOM A;  3QW0 A;  1QSP A;  3A9C A;  3GWN A;  5L0F A;  4LLC A;  3DJN B;  3VAY A;  4EKW A;  2DB4 A;  4RD9 A;  1QPU A;  2VB6 A;  4CX9 A;  3LNM B;  4XEV A;  2Y3H A;  4P9T A;  3SXM A;  1VLT A;  3TQO A;  3U9M A;  5BQI A;  3M79 A;  5DS5 A;  3FOO A;  4WJ0 A;  4PFP A;  3VF0 A;  2OCC C;  1SMY F;  4FAP B;  1CGO A;  1QKR A;  1YLM A;  4MTO A;  3S27 A;  1WGW A;  1LE2 A;  2VCA A;  5F5F A;  2HSQ A;  3U9J A;  3IQC A;  3BEH A;  5A6B A;  5DVW A;  2QE9 A;  3UGO A;  2R7X A;  1NG1 A;  4JTD B;  3WAQ A;  1BR2 A;  2JX0 A;  4DOZ A;  1KTM A;  1NFO A;  4BJT A;  2J7P A;  4OIP F;  4WGZ A;  4J32 B;  3NMI A;  1TKN A;  5KYW B;  3ABL C;  4LDK A;  1LS1 A;  1T01 A;  3B71 A;  3B0V C;  2A0U A;  3TD7 A;  3QZC A;  3ZQV A;  2XS1 A;  2YWA A;  4MW3 A;  1RCP A;  1LIH A;  1R5I D;  4ONS A;  3ZQY A;  5AC4 A;  2YHS A;  3GEI A;  2J9V A;  3LS0 A;  1BBH A;  1U89 A;  3CQZ A;  3SXK A;  4NCQ A;  4GYT A;  4E7S A;  4IAQ A;  1YJG A;  2QLA A;  1MMG A;  1WAS A;  4M63 A;  5E33 A;  3M15 A;  2NUP B;  2GAQ A;  4NQF A;  2OQM A;  4KNW A;  2YL0 A;  1DOV A;  3AGU A;  1MND A;  3EGX B;  2KK1 A;  3EHM A;  1OR2 A;  2VCC A;  3ZC4 A;  3IQ6 A;  1Z23 A;  2DGJ A;  3AJM A;  3NKE A;  2XLE A;  3QTH A;  2G3K A;  2VCB A;  2HJ3 A;  2RSE B;  3S9O A;  1ORJ A;  3WHN A;  1EA8 A;  4D4N A;  3C18 A;  1AEP A;  2EIL C;  2JPU A;  1IZM A;  4N6C A;  5A6A A;  3B0P A;  1HMD A;  1H9G A;  4J30 B;  5IY5 C;  2PX0 A;  1SR2 A;  1H9T A;  4O6M A;  4EBK A;  1RXQ A;  2XL6 A;  3G50 A;  3ITF A;  4EBJ A;  2ZXW C;  2IOQ A;  4JEB A;  1ZHT A;  3EH2 A;  1CGM E;  3GAN A;  2J8W A;  3S84 A;  1ZHZ A;  3N24 A;  3FDQ A;  2YLI A;  1K05 A;  1BDJ B;  2R7Q A;  4N06 A;  3GEE A;  4P6I C;  4PK4 A;  3S29 A;  3VM6 A;  2ZXP A;  1MMD A;  4IGG A;  4OD4 A;  4BEM J;  1QVX A;  3SXZ A;  4MVU A;  4DRH B;  3LLI A;  2MYS A;  1JPN A;  2J45 A;  3DM9 B;  2ZXO A;  5B3S C;  1QZX A;  2BC5 A;  2IBF A;  1A7E A;  2M4E A;  1NFN A;  3DMD A;  2GWW A;  2W45 A;  1OCO C;  1NSG B;  2J9U A;  4DRI B;  1H6G A;  4CJG A;  1TWH A;  4JEA A;  5D91 A;  4UDV A;  4G7H F;  3NRH A;  5DQZ A;  1K04 A;  1Z5Z A;  2MHR A;  4DVY P;  2EPN A;  4DVZ A;  2KYH A;  1WAT A;  3E70 C;  3PMR A;  4C3B A;  1MNE A;  2LIG A;  3DM5 A;  3T9O A;  1LS4 A;  1FAP B;  3HNL A;  2CNW D;  3GOD A;  4ZLC A;  4U5F E;  2AP3 A;  2UUI A;  5F28 E;  2BE5 F;  2ZPA A;  5L0H A;  4CS8 C;  1A41 A;  3ZSU A;  3F46 A;  4MVQ A;  1J8Y F;  3KPH A;  1D1C A;  3LUT B;  3ZTZ A;  4CSA A;  1O5H A;  2AWC A;  1BR4 A;  2WZL A;  3S28 A;  2YL1 A;  4U5E E;  3KYJ A;  3AQB A;  3N0T A;  4Z9I A;  3TJ5 A;  4KNV A;  1YZC A;  3C63 A;  4MTG A;  4BJ6 A;  2L81 A;  4D4X A;  3BRJ A;  1FNT c;  1YA9 A;  3KKB A;  1T5O A;  1OW7 A;  2A69 F;  5E2Q A;  1M57 C;  3EZI A;  1C03 A;  1FFT C;  1ZHY A;  2LK4 A;  3GM1 A;  4JVS A;  1V4A A;  4XWJ A;  3JYY A;  3I5P A;  5TJ5 E;  5L0I A;  2Q9C A;  1W2W A;  1ORY A;  3JZ0 A;  4Q4Z F;  5A69 A;  1SF8 A;  5JS5 A;  3EFO A;  4C3D A;  4BJ1 A;  4H4K C;  4U9E A;  5T3T A;  1OCC C;  5B1A C;  1I4Y A;  2GFH A;  3ZIB A;  1RMV A;  2YRF A;  2NUT A;  1ST6 A;  1LKX A;  3KH2 A;  3UNG C;  1OW8 A;  4G78 A;  1YZA A;  2A1D D;  3AG4 C;  2C04 A;  1I4Z A;  5B1B C;  2PFD A;  3SNH A;  2NUP A;  1E84 A;  3CEX A;  3NMJ A;  5A6B D;  3LEV A;  2G3V A;  4AL0 A;  1NLX A;  2Q9B A;  3C8G A;  4CIP A;  5JVE A;  1VB5 A;  1JOG A;  1ZU4 A;  2J7P D;  1UG7 A;  3CZ6 A;  4JCZ A;  4G7O F;  2XRH A;  3T6G B;  4B6I A;  3NG1 A;  3TK0 A;  4DBR A;  1Y4C A;  1TWC A;  3G4Z A;  1AUE A;  1WOL A;  2RD9 A;  3G4X A;  3FVY A;  1Q0D A;  3LS1 A;  1FTS A;  4U5H A;  1A7D A;  1V55 C;  2A68 F;  2XLM A;  1KNY A;  5COF A;  1JR8 A;  3JRT A;  2QNL A;  4F4B A;  3S90 A;  3JRM O;  3UMK A;  1LI7 A;  1XWJ A;  3O55 A;  1I5N A;  5JSL A;  1Z63 A;  4ZLD A;  2E87 A;  3K1H A;  5F5H A;  5JUA A;  3VYW A;  3KMI A;  4JJF A;  1LPE A;  2R7U A;  3W2W A;  2EPM X;  2HUJ A;  1T6I A;  3PHF 2;  3B0U X;  2KNH A;  4JJG A;  2L6G A;  3EFO B;  1OKK A;  2W9Y A;  4KC9 A;  1NU7 D;  3POV A;  2HZ8 A;  1Q0M A;  2P1A A;  1H7I A;  2Y3G A;  3RQF A;  3JYH A;  2D4U A;  1WN0 A;  2H8A A;  3I4U A;  3KYI A;  1ZU5 A;  3HTK C;  3U3F A;  1APC A;  1M6T A;  3RQE A;  2NUT B;  3AG3 C;  1NU9 C;  3ZG1 A;  4AK9 A;  3AG2 C;  4GEH A;  3RW0 A;  1IW7 F;  2L6H A;  3O6X A;  3R2P A;  1LVK A;  4KBL A;  2D5R B;  1GS9 A;  4BEJ A;  4CBE A;  1TQG A;  3OEO A;  2Y39 A;  2XLO A;  4G0H A;  2IM8 A;  4DXW A;  4JRZ A;  2WVQ A;  4DRJ B;  3Q7G A;  3ECS A;  2R7T A;  2OKU A;  3GM3 A;  3HKK A;  1B68 A;  4BJ5 C;  4IJJ A;  4EWC A;  4OIQ F;  3C8G B;  3WG7 C;  4K0D A;  1Y6D A;  3DE9 A;  4C7O A;  5E3A A;  5DS6 A;  1E2X A;  4EHP A;  2J9W A;  2NSG A;  3JTL O;  1F1M A;  2JD3 A;  3WOD F;  4IWB A;  1YYJ A;  2BL2 A;  1T6Q A;  3R7C A;  4XPW A;  3ZWI A;  4OIR F;  2HJM A;  3TJ6 A;  1HE9 A;  2YL7 A;  3IEE A;  3QVY A;  2PF4 E;  4PJJ A;  5KYY A;  2AVK A;  4A2N B;  3LJB A;  1JPJ A;  1U6H A;  3GWL A;  4YL0 A;  5KYU A;  1WTY A;  3L8I A;  1TWG A;  1Z7Q c;  3RVZ A;  3MX3 A;  1G5Z A;  4JTA B;  1K40 A;  3DWW A;  3DI5 A;  1TWA A;  3EG9 A;  4YN0 B;  2R7V A;  5COM A;  4CS9 A;  3C7J A;  1NBB A;  2VH3 A;  3NYL A;  3Q6M A;  3W2V A;  3K66 A;  1OW6 A;  2CCY A;  1XZP A;  1V74 B;  2ETS A;  5COG A;  3HNI A;  4K7B A;  4AE4 A;  4C3E A;  4I44 A;  1E86 A;  1MMA A;  4HFK B;  4O7G A;  3H2U A;  4KI2 A;  3H2V A;  3RFY A;  1Q0K A;  3CSK A;  4R32 A;  3ZDL A;  1R4T A;  4CS8 A;  3Q6N A;  3K6B A;  1ZVZ A;  1LM3 B; 
#chains in the Genus database with same CATH homology
 3U2L A;  1JRA A;  3TD7 A;  1OQC A;  3GWN A;  3TK0 A;  3GWL A;  3U5S A;  1JR8 A;  3LLK A;  3O55 A;  3W4Y A;  3LLI A;  4E0H A;  3MBG A;  2HJ3 A;  3U2M A;  4E0I A;  3R7C A;  4LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...