3U2MA

Crystal structure of human alr mutant c142/145s
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEESAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 45
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2mA00
3TD7A 3U5SA 1OQCA 3W4YA 4LDKA 3MBGA 3GWLA 3LLIA 4E0HA 3U2MA 3TK0A 3U2LA 4E0IA 3R7CA 1JRAA 3GWNA 3LLKA 1JR8A 2HJ3A 3O55A
chains in the Genus database with same CATH superfamily
4RDAA 2WZLA 3OA1A 4HE8D 3T6JA 3GM3A 3RKOF 1C02A 1ZW2A 3QZCA 3G4ZA 2L81A 3CEXA 3TOMA 4AL0A 4DVYP 3FAPB 1M2VA 1CPRA 2ZD9A 4JTAB 3UMKA 3ZC4A 5B3IA 1M2VB 2EPOA 1Z6AA 2J8WA 3I4UA 4YK5A 3VAYA 2OJQA 3MLGA 4FX5A 2W9YA 4NY3A 4EBKA 5JT4A 3S0XA 4NTAA 5BQHA 1GM5A 3JZ0A 3KPHA 4P6IC 1GS9A 4DXWA 2R7XA 3TK0A 5HV9A 3U2LA 3LNMB 2YQYA 4CBEA 4MVOA 4FAPB 3B0VC 2IM8A 2A6EF 2XRHA 2OQMA 3DM5A 2O9XA 3C8GD 1TWCA 5DQTA 3PHF2 1BR4A 1ZHWA 2HJ3A 2R9RB 2NSFA 3EG9A 1LVKA 2EIMC 4WJ0A 3CZ6A 4PJMA 3POVA 1T6UA 4JEAA 3EG9B 3LNRA 4U5GA 1H9GA 3SNHA 3W2VA 4EBJA 2LCHA 5JVEA 1C17M 1VYKA 3TD7A 2J7PA 3JT1A 4A2NB 1VB5A 2J45A 3T6GB 2YLDA 5JS5A 2DB4A 1H9TA 2A69F 3GODA 1TFKB 2Y3HA 3WAQA 2ZXWC 1SZIA 4IWBA 5CIVA 2LD6A 1V74B 1VK5A 3W8IA 1IW7F 2GAQA 5L0IA 5KYWA 3MX3A 2Q00A 5KYWB 2J7PD 2IBFA 1ORJA 2WVNA 3IQTA 3M79A 4LLCA 3KMIA 4C3DA 1OCCC 1XZQA 4XLPF 1TWGA 4G7HF 2WZGA 3EHMA 1RJ9A 2Y3BA 2WB7A 1OKKA 4IJJA 2BC5A 5KYUA 1RJ9B 1YZCA 1AVOB 2VCBA 2XL6A 5KYUB 5A6AA 2VH3A 1TWHA 1SYQA 4JCZA 3ZIBA 5DVWA 2ZXRA 3RQFA 4RBNA 4BPMA 1PV3A 5FZTA 5DQZA 3GEEA 1QVXA 1YZAA 4LERA 3MBGA 4J30B 1VTMP 1ZHZA 3M15A 1QLEC 1GGQA 2KK1A 2PBEA 3BEHA 3ZG1A 2HS5A 1B68A 2Y3DA 1OKKD 3GWLA 1WWPA 4QI2A 2AWCA 4DBQA 4GQHA 1I5NA 2R7WA 5FCLA 2J0WA 3DM9B 2OOCA 5HSWA 2YLIA 4CDAA 4L6RA 1T5OA 4MVMA 1MMDA 1MMNA 4YL1A 2X0CA 1Z23A 2R7VA 2H7VC 3LEVA 1KTMA 1PCXA 4J32B 2Y39A 1YA7O 3V5XA 3ABMC 2M64A 5IY5C 4PFOA 2R7TA 2B0JA 4D4NA 3VYWA 2QTVA 4ZLCA 1D0YA 3JCUQ 2XS1A 3AG2C 3CQZA 4IRUA 1V54C 4YN0B 3DXJF 1TKNA 4U5FE 1RKEA 1TQGA 1ZHYA 4CJGA 1R5ID 2QE9A 1LIHA 3OWTA 1RKEB 3AQCA 5EGYA 4CS8C 4YT2A 5E3AA 2YRFA 2L9JA 1VMAA 3Q7GA 2YL0A 2P7VA 2J46A 3QW0A 3L8IA 1NSGB 2KQ9A 3IQ6A 4A4AA 2R25A 4LDRA 4QI0A 2Y3GA 1VLSA 3RYLA 3S29A 1NU7D 1OW6A 2EPMX 2CNWD 4G7ZF 3JYHA 3M4CA 1AEPA 1OW8A 3ECSA 2YL1A 4JURI 3M1CB 4IAQA 4MTFA 5AGFA 4I3MA 4DRHB 1O5HA 1V55C 3RF3A 1ZW3A 2GWWA 1OCOC 3RVZA 5A6KA 2P61A 3O10A 2G3VA 4K0DA 4CIHA 2RSEB 1FFHA 3G4XA 1HW2A 1NG1A 2L6HA 1A7VA 1Z5ZA 2VC9A 3TULA 2V26A 1H6GA 2AWYA 3LUTB 5A6BD 3LAYA 3W4YA 2A68F 2J9WA 3O39A 2YVKA 2L7AA 4N6CA 3EQLF 2CDQA 4ULVA 1QQ3A 2B0HA 1HY5A 2EPNA 2W4MA 4NCQA 4DBRA 2KSFA 4DRJB 1I4ZA 3KL4A 2NUTA 3SXMA 1M57C 3U2MA 2JD3A 3DAFA 3DWWA 4YT8A 3ASOC 2NUTB 1SF8A 5COGA 4YJWA 1QKRA 3C7JA 5GPGB 2HJMA 4I44A 1T01A 3RQGA 2WZFA 1LE2A 3TQOA 1FMVA 4MS2A 2DI3A 4KI2A 1LI7A 3TOLA 3NMJA 4BG0A 1LPEA 3LS0A 3VF0A 3HNJA 4YT5A 2KC3A 3JYYA 3EHNA 1YVIA 3W2WA 2LFDA 3RVYA 1O87A 3QVZA 4MW3A 3S28A 4AE4B 3AGTA 3RFYA 3B29A 4Z9JA 3TJ5A 5CI8A 3AG4C 4MVQA 1A0BA 4Z9HA 4JTCB 2A1DD 2MHRA 5L3VA 3IQCA 1MQVA 4MQ9F 3B0UX 3LLIA 1S7ZA 3NMKA 4MVUA 3MYIA 4AL1A 3DE8A 4JKVA 4C3EA 5L0CA 5T1DB 3QTHA 4JE9A 1E2XA 1FR0A 4MVRA 5B1AC 5DLJA 1LS4A 3ASNC 2YL3A 1U6HA 2KW3C 3AQBA 3EPVA 2HKVA 2QUPA 5T3WA 5A6JA 1JPJA 1G4WR 1DOWA 2KYHA 3SP1A 2OCCC 3IPMO 1Q0KA 2H7OA 3N0TA 3O6XA 4EKWA 2QY9A 3HTKC 2H7BA 1UFBA 4HEAJ 2EPKX 3AGUA 1CGNA 2ETSA 4H4KC 4JVSA 3DI5A 1OCZC 5D91A 4OIQF 3B71A 1U89A 3A11A 4CDVA 1OQCA 1ZU5A 3U9MA 3FAJA 2Y69C 4P9FA 4MVSA 4EBBA 5COFA 1D0ZA 3GEIA 3HLZA 1ZU4A 1BBHA 2PP4A 3JRTA 1T6IA 4W8PA 2CGEA 4E18A 2GA0A 4CS8A 2PF4E 5AC4A 4XWJA 1WASA 4LACB 2XL8A 3DD7A 3LESA 4W8KA 1Z3IX 3BRJA 2YZSA 2A0UA 4XEVA 5F5HA 3VRCA 3QW1A 3WODF 1EQ1A 1D0XA 3ABKC 3GWNA 2AVKA 4JRZA 4LDQA 4RD9A 2LP4A 3RQEA 4JTDB 5DS4A 2HZ8A 1J8MF 1C03A 3NYLA 1J8YF 4OIPF 3ZVRA 2F22A 1AUEA 1Q0DA 3FDQA 3E9VA 2GDCA 1A41A 2ZPAA 1RCPA 1WOLA 3LS1A 3I5PA 4OD4A 5CI9A 4O6NA 4PJNA 2R7OA 1H7IA 2I15A 1E83A 4CSAC 2OU6A 5F28E 2Q4FA 4U5DE 3JRMO 4OIRF 4CX9A 1HE9A 3Q6NA 4Z9IA 4C3BA 2HUJA 1M56C 3K1HA 4N6HA 3MFNA 4DJ9A 4C7OB 1XWJA 2P6VA 5E2QA 2PX0A 1PD1A 3SEOA 1G8XA 4OIOF 5COMA 4LLEA 3V7OA 1I4YA 1A7EA 2LSEA 1BDJB 3H2UA 5K0IA 3CSKA 1U0BB 3K1IC 4E7SA 1K04A 4NTFA 3PCVA 3AOUA 3U5SA 3JSEO 1M6TA 2ZXOA 2YEVA 3GM1A 5L0GA 3C63A 1BR2A 2D5RB 2XLHA 2XSEA 2OJED 3K66A 2C04A 2FGYA 2UUHA 1OR2A 3L34A 3LEOA 4LDKA 3EFOB 4XTKA 3HNIA 2G3KA 2WVQA 4O6YA 1JPNA 1PD0A 3K7DA 5EK0A 1FAPB 1APCA 4DVZA 3L0IA 4DRIB 4NTBA 5E3CA 3UNGC 1HMOA 1NFOA 1YYJA 4E0HA 1G5ZA 3FXHA 5T3TA 3ZSUA 1LE4A 2Z15A 1O3UA 3B9QA 2FAPB 4MTGA 2HSQA 4OINF 3U0CA 2I8BA 1FFTC 1JOGA 1L3PA 2P0NA 2Q3TA 4BJ1A 2L6GA 1SR2A 4IB4A 1UG7A 2NSGA 2VB6A 2XLOA 1JR8A 4XPYA 4KC9A 4QDLA 1Z7Qc 4Q5SF 4UDVA 1JMWA 4PK4A 3GORA 2CW0F 1VOMA 3B0PA 3L8JA 3O55A 2Q7RA 1RKCA 3DKAA 2XXAA 3UR3C 3N24A 1NU9C 3V5YA 1KNYA 1T6QA 2PX3A 3HJCA 1YARO 3HKKA 3V5ZA 2XXAB 2XM0A 1MNEA 2KNHA 2R7RA 1QZXA 4K7BA 2H8AA 4H54A 3ITFA 3KKBA 1E85A 5JLIA 4IAOA 4O7GA 4BEJA 3Q7LA 3ABLC 3ZTMA 2OKUA 2DYSC 4JJGA 3TJ6A 2DGJA 3HNLA 1IZMA 4BJ6C 1WTYA 1HW1A 2YHSA 1OR3A 2A6HF 1G4US 3IEEA 4ULWA 4JW1A 3EJNA 1OW7A 4J7TA 3EGDB 3KYIA 3HNKA 3LLKA 5BQGA 3NYMA 2XS8A 2WL8A 4Q7CA 2OEVA 1NBBA 2EINC 2PFDA 5JUAA 4DOZA 2XL4A 3NDBB 4AE4A 4K1OA 2J0XA 2PNOA 3UGOA 1QPUA 2Q9AA 2X51A 4HFKB 2Q9CA 2E87A 4FWVA 2IXNA 2IYLD 3PMRA 3WG7C 5KYXA 2NUPA 3S84A 1ZHXA 2EILC 2OG2A 4X0RA 4KNWA 2NUPB 5KYXB 1L7CA 1WN0A 4MTOA 1OXKA 2VASA 4CSAA 3UMHA 2XLDA 2XM4A 4N06A 3U8VA 4CS7A 4Q4ZF 1TWAA 2LK4A 3R7CA 3JTLO 5KYNA 2D4UA 1D1CA 2HMZA 4I1MA 3OEOA 2EPLX 2NG1A 1K05A 2C03A 3DJNB 1KU2A 1WGWA 2W45A 1S05A 3K33A 2G62A 4PJJA 5L3QA 3SXZA 4EIYA 3EZHA 3U3BA 1W2WA 2IXPA 5B3SC 3H2VA 3JSZA 1A7DA 5DS6A 3DE9A 1MNDA 3C8GA 1LM3B 3FMSA 4U5EE 1NFNA 3C8GB 4PFPA 1QSPA 2KGOA 2A0BA 3K1IA 4PR9A 1VLTA 4JZAA 4XEFA 2R05A 1Q0MA 3EH1A 4BJ5C 3ATPA 4CIPA 4M63A 4BJTA 5L0DA 4JIOA 2AU5A 4YL0A 3U3FA 2BL2A 3X2QC 1BZ4A 1ST6A 2LFFA 5JP7A 4PACA 4OD5A 4ANJA 4EUKB 3U8PA 4F4BA 2TMVP 2R7SA 3DJUB 3MYFA 3IHUA 3NMIA 4U9EA 4XPXA 4KBLA 5E33A 4MVZA 3RIPA 2NPUA 4R32A 3SXKA 1K40A 1HMDA 2WVOA 4MNDA 3M4BA 4NQFA 4AX2A 3FHDA 3ZTZA 2HV7A 256BA 3EGXA 1GQAA 2FFHA 4E7ZA 4ER9A 3NKEA 3Q6MA 4WGZA 3EGXB 1YYXA 3FOPA 5L0FA 2VCCA 2IOQA 3G50A 2J9UA 1ZZPA 2ICWG 3T9OA 3ZQVA 3ZWIA 4G7OF 1NZEA 3US6A 4B6IA 4IARA 3H65A 3T4RA 3C18A 4E0IA 4CS9C 2ASRA 4JC7A 4C7OA 2P1AA 1VYIA 2YWAA 4FESA 4EWCA 4N4WA 2CCYA 5D92A 2R03A 3EZIA 2VCAA 3GANA 4BJ6A 3A9CA 1CPQA 5DS5A 1Y6DA 4XPWA 3KH2A 5JSLA 2W4BA 3E70C 3R2PA 1NLXA 1CGOA 2JX0A 2Q9BA 4P9TA 3CAXA 3SYNA 4ZLDA 3EFOA 1SMYF 2R7QA 3SZRA 1OXBA 3T6BA 4O6MA 4IGGA 4G0HA 3IQ5A 1E84A 3GEHA 3J06A 1ZHTA 3PDMP 1YLMA 4U5CE 5JRAA 1M2OA 2XLVA 1EKYA 1BR1A 2HSBA 2MYSA 1V4AA 2GFHA 4XEKA 1ZYRF 3C8ZA 2J9BA 3AG1C 4YT4A 3X1OA 1FTSA 1T9KA 1Y4CA 3F46A 2OEXA 1CGME 2UUIA 5B1BC 2IXMA 4AK9A 4JJFA 3S27A 4NC3A 2EIJC 2YL7A 1YJGA 1LI5A 3DZAA 2CNWA 5BQIA 3AG3C 2HFIA 3UMIA 2ZXPA 3W8HA 2QLAA 4E17A 5AC5A 3RH3A 1LKXA 2M4EA 4J7YA 2CYDA 1YAUO 2J9VA 1N1CA 1JAFA 4KNVA 3NYJA 2XLWA 3FOOA 4WABA 3K6BA 4U5HA 1DOVA 2LIGA 3L1MA 1TR2A 2JPUA 4HFFB 2YKZA 1XZPA 4JEBA 3VM6A 3ZQYA 4G78A 4ONSA 5A6BA 4MW8A 1E86A 1Z63A 2R02A 4D4XA 2QNLA 3FVYA 4JCHA 4YL3A 3EGDA 4I1OB 2RD9A 2R7UA 3LJBA 4BJ5A 2XLEA 2MWQA 3AJMA 3QVYA 2KJGA 1D1AA 2EIKC 2HV6A 4WGYA 3U9JA 3WHNA 3F47A 1ORYA 1D1BA 5F5FA 2HMQA 4U5BE 5L0HA 1MMAA 1ZVZA 2V3CC 3NRHA 3UGPA 4O79A 3C62A 5A69A 1EA8A 3KYJA 1RMVA 4GEHA 1R4TA 2LQGA 3S90A 5EHHA 3S9OA 1LS1A 3NG1A 2YLGA 1WATA 4BEMJ 4XLNF 1F1MA 3DMDA 3NKDA 3DAGA 2XLMA 2AP3A 3QMKA 5TJ5E 2DYRC 4PJLA 4EHPA 3RW0A 1OCRC 2L6FA 1TFOB 1ORSC 4CDYA 3GM2A 4XQ1A 1Q0GA 3SXYA 3ZDLA 1JRAA 1Q0FA 2IXOA 1HE1A 3I5QA 4U9DA 4CJOA 5L0JA 5KYYA 1EI7A 3N2ZB 1MMGA 1FNTc 4GYTA 5KYYB 1RXQA 4YWQA 2BE5F 4CS9A 3EH2A 5BUOA 1YDIA 1FMWA 1YA9A
chains in the Genus database with same CATH topology
3TD7A 3U5SA 1OQCA 3W4YA 4LDKA 3MBGA 3GWLA 3LLIA 4E0HA 3U2MA 3TK0A 3U2LA 4E0IA 3R7CA 1JRAA 3GWNA 3LLKA 1JR8A 2HJ3A 3O55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD7 A;  3U5S A;  1OQC A;  3W4Y A;  4LDK A;  3MBG A;  3GWL A;  3LLI A;  4E0H A;  3U2M A;  3TK0 A;  3U2L A;  4E0I A;  3R7C A;  1JRA A;  3GWN A;  3LLK A;  1JR8 A;  2HJ3 A;  3O55 A; 
#chains in the Genus database with same CATH topology
 4RDA A;  2WZL A;  3OA1 A;  4HE8 D;  3T6J A;  3GM3 A;  3RKO F;  1C02 A;  1ZW2 A;  3QZC A;  3G4Z A;  2L81 A;  3CEX A;  3TOM A;  4AL0 A;  4DVY P;  3FAP B;  1M2V A;  1CPR A;  2ZD9 A;  4JTA B;  3UMK A;  3ZC4 A;  5B3I A;  1M2V B;  2EPO A;  1Z6A A;  2J8W A;  3I4U A;  4YK5 A;  3VAY A;  2OJQ A;  3MLG A;  4FX5 A;  2W9Y A;  4NY3 A;  4EBK A;  5JT4 A;  3S0X A;  4NTA A;  5BQH A;  1GM5 A;  3JZ0 A;  3KPH A;  4P6I C;  1GS9 A;  4DXW A;  2R7X A;  3TK0 A;  5HV9 A;  3U2L A;  3LNM B;  2YQY A;  4CBE A;  4MVO A;  4FAP B;  3B0V C;  2IM8 A;  2A6E F;  2XRH A;  2OQM A;  3DM5 A;  2O9X A;  3C8G D;  1TWC A;  5DQT A;  3PHF 2;  1BR4 A;  1ZHW A;  2HJ3 A;  2R9R B;  2NSF A;  3EG9 A;  1LVK A;  2EIM C;  4WJ0 A;  3CZ6 A;  4PJM A;  3POV A;  1T6U A;  4JEA A;  3EG9 B;  3LNR A;  4U5G A;  1H9G A;  3SNH A;  3W2V A;  4EBJ A;  2LCH A;  5JVE A;  1C17 M;  1VYK A;  3TD7 A;  2J7P A;  3JT1 A;  4A2N B;  1VB5 A;  2J45 A;  3T6G B;  2YLD A;  5JS5 A;  2DB4 A;  1H9T A;  2A69 F;  3GOD A;  1TFK B;  2Y3H A;  3WAQ A;  2ZXW C;  1SZI A;  4IWB A;  5CIV A;  2LD6 A;  1V74 B;  1VK5 A;  3W8I A;  1IW7 F;  2GAQ A;  5L0I A;  5KYW A;  3MX3 A;  2Q00 A;  5KYW B;  2J7P D;  2IBF A;  1ORJ A;  2WVN A;  3IQT A;  3M79 A;  4LLC A;  3KMI A;  4C3D A;  1OCC C;  1XZQ A;  4XLP F;  1TWG A;  4G7H F;  2WZG A;  3EHM A;  1RJ9 A;  2Y3B A;  2WB7 A;  1OKK A;  4IJJ A;  2BC5 A;  5KYU A;  1RJ9 B;  1YZC A;  1AVO B;  2VCB A;  2XL6 A;  5KYU B;  5A6A A;  2VH3 A;  1TWH A;  1SYQ A;  4JCZ A;  3ZIB A;  5DVW A;  2ZXR A;  3RQF A;  4RBN A;  4BPM A;  1PV3 A;  5FZT A;  5DQZ A;  3GEE A;  1QVX A;  1YZA A;  4LER A;  3MBG A;  4J30 B;  1VTM P;  1ZHZ A;  3M15 A;  1QLE C;  1GGQ A;  2KK1 A;  2PBE A;  3BEH A;  3ZG1 A;  2HS5 A;  1B68 A;  2Y3D A;  1OKK D;  3GWL A;  1WWP A;  4QI2 A;  2AWC A;  4DBQ A;  4GQH A;  1I5N A;  2R7W A;  5FCL A;  2J0W A;  3DM9 B;  2OOC A;  5HSW A;  2YLI A;  4CDA A;  4L6R A;  1T5O A;  4MVM A;  1MMD A;  1MMN A;  4YL1 A;  2X0C A;  1Z23 A;  2R7V A;  2H7V C;  3LEV A;  1KTM A;  1PCX A;  4J32 B;  2Y39 A;  1YA7 O;  3V5X A;  3ABM C;  2M64 A;  5IY5 C;  4PFO A;  2R7T A;  2B0J A;  4D4N A;  3VYW A;  2QTV A;  4ZLC A;  1D0Y A;  3JCU Q;  2XS1 A;  3AG2 C;  3CQZ A;  4IRU A;  1V54 C;  4YN0 B;  3DXJ F;  1TKN A;  4U5F E;  1RKE A;  1TQG A;  1ZHY A;  4CJG A;  1R5I D;  2QE9 A;  1LIH A;  3OWT A;  1RKE B;  3AQC A;  5EGY A;  4CS8 C;  4YT2 A;  5E3A A;  2YRF A;  2L9J A;  1VMA A;  3Q7G A;  2YL0 A;  2P7V A;  2J46 A;  3QW0 A;  3L8I A;  1NSG B;  2KQ9 A;  3IQ6 A;  4A4A A;  2R25 A;  4LDR A;  4QI0 A;  2Y3G A;  1VLS A;  3RYL A;  3S29 A;  1NU7 D;  1OW6 A;  2EPM X;  2CNW D;  4G7Z F;  3JYH A;  3M4C A;  1AEP A;  1OW8 A;  3ECS A;  2YL1 A;  4JUR I;  3M1C B;  4IAQ A;  4MTF A;  5AGF A;  4I3M A;  4DRH B;  1O5H A;  1V55 C;  3RF3 A;  1ZW3 A;  2GWW A;  1OCO C;  3RVZ A;  5A6K A;  2P61 A;  3O10 A;  2G3V A;  4K0D A;  4CIH A;  2RSE B;  1FFH A;  3G4X A;  1HW2 A;  1NG1 A;  2L6H A;  1A7V A;  1Z5Z A;  2VC9 A;  3TUL A;  2V26 A;  1H6G A;  2AWY A;  3LUT B;  5A6B D;  3LAY A;  3W4Y A;  2A68 F;  2J9W A;  3O39 A;  2YVK A;  2L7A A;  4N6C A;  3EQL F;  2CDQ A;  4ULV A;  1QQ3 A;  2B0H A;  1HY5 A;  2EPN A;  2W4M A;  4NCQ A;  4DBR A;  2KSF A;  4DRJ B;  1I4Z A;  3KL4 A;  2NUT A;  3SXM A;  1M57 C;  3U2M A;  2JD3 A;  3DAF A;  3DWW A;  4YT8 A;  3ASO C;  2NUT B;  1SF8 A;  5COG A;  4YJW A;  1QKR A;  3C7J A;  5GPG B;  2HJM A;  4I44 A;  1T01 A;  3RQG A;  2WZF A;  1LE2 A;  3TQO A;  1FMV A;  4MS2 A;  2DI3 A;  4KI2 A;  1LI7 A;  3TOL A;  3NMJ A;  4BG0 A;  1LPE A;  3LS0 A;  3VF0 A;  3HNJ A;  4YT5 A;  2KC3 A;  3JYY A;  3EHN A;  1YVI A;  3W2W A;  2LFD A;  3RVY A;  1O87 A;  3QVZ A;  4MW3 A;  3S28 A;  4AE4 B;  3AGT A;  3RFY A;  3B29 A;  4Z9J A;  3TJ5 A;  5CI8 A;  3AG4 C;  4MVQ A;  1A0B A;  4Z9H A;  4JTC B;  2A1D D;  2MHR A;  5L3V A;  3IQC A;  1MQV A;  4MQ9 F;  3B0U X;  3LLI A;  1S7Z A;  3NMK A;  4MVU A;  3MYI A;  4AL1 A;  3DE8 A;  4JKV A;  4C3E A;  5L0C A;  5T1D B;  3QTH A;  4JE9 A;  1E2X A;  1FR0 A;  4MVR A;  5B1A C;  5DLJ A;  1LS4 A;  3ASN C;  2YL3 A;  1U6H A;  2KW3 C;  3AQB A;  3EPV A;  2HKV A;  2QUP A;  5T3W A;  5A6J A;  1JPJ A;  1G4W R;  1DOW A;  2KYH A;  3SP1 A;  2OCC C;  3IPM O;  1Q0K A;  2H7O A;  3N0T A;  3O6X A;  4EKW A;  2QY9 A;  3HTK C;  2H7B A;  1UFB A;  4HEA J;  2EPK X;  3AGU A;  1CGN A;  2ETS A;  4H4K C;  4JVS A;  3DI5 A;  1OCZ C;  5D91 A;  4OIQ F;  3B71 A;  1U89 A;  3A11 A;  4CDV A;  1OQC A;  1ZU5 A;  3U9M A;  3FAJ A;  2Y69 C;  4P9F A;  4MVS A;  4EBB A;  5COF A;  1D0Z A;  3GEI A;  3HLZ A;  1ZU4 A;  1BBH A;  2PP4 A;  3JRT A;  1T6I A;  4W8P A;  2CGE A;  4E18 A;  2GA0 A;  4CS8 A;  2PF4 E;  5AC4 A;  4XWJ A;  1WAS A;  4LAC B;  2XL8 A;  3DD7 A;  3LES A;  4W8K A;  1Z3I X;  3BRJ A;  2YZS A;  2A0U A;  4XEV A;  5F5H A;  3VRC A;  3QW1 A;  3WOD F;  1EQ1 A;  1D0X A;  3ABK C;  3GWN A;  2AVK A;  4JRZ A;  4LDQ A;  4RD9 A;  2LP4 A;  3RQE A;  4JTD B;  5DS4 A;  2HZ8 A;  1J8M F;  1C03 A;  3NYL A;  1J8Y F;  4OIP F;  3ZVR A;  2F22 A;  1AUE A;  1Q0D A;  3FDQ A;  3E9V A;  2GDC A;  1A41 A;  2ZPA A;  1RCP A;  1WOL A;  3LS1 A;  3I5P A;  4OD4 A;  5CI9 A;  4O6N A;  4PJN A;  2R7O A;  1H7I A;  2I15 A;  1E83 A;  4CSA C;  2OU6 A;  5F28 E;  2Q4F A;  4U5D E;  3JRM O;  4OIR F;  4CX9 A;  1HE9 A;  3Q6N A;  4Z9I A;  4C3B A;  2HUJ A;  1M56 C;  3K1H A;  4N6H A;  3MFN A;  4DJ9 A;  4C7O B;  1XWJ A;  2P6V A;  5E2Q A;  2PX0 A;  1PD1 A;  3SEO A;  1G8X A;  4OIO F;  5COM A;  4LLE A;  3V7O A;  1I4Y A;  1A7E A;  2LSE A;  1BDJ B;  3H2U A;  5K0I A;  3CSK A;  1U0B B;  3K1I C;  4E7S A;  1K04 A;  4NTF A;  3PCV A;  3AOU A;  3U5S A;  3JSE O;  1M6T A;  2ZXO A;  2YEV A;  3GM1 A;  5L0G A;  3C63 A;  1BR2 A;  2D5R B;  2XLH A;  2XSE A;  2OJE D;  3K66 A;  2C04 A;  2FGY A;  2UUH A;  1OR2 A;  3L34 A;  3LEO A;  4LDK A;  3EFO B;  4XTK A;  3HNI A;  2G3K A;  2WVQ A;  4O6Y A;  1JPN A;  1PD0 A;  3K7D A;  5EK0 A;  1FAP B;  1APC A;  4DVZ A;  3L0I A;  4DRI B;  4NTB A;  5E3C A;  3UNG C;  1HMO A;  1NFO A;  1YYJ A;  4E0H A;  1G5Z A;  3FXH A;  5T3T A;  3ZSU A;  1LE4 A;  2Z15 A;  1O3U A;  3B9Q A;  2FAP B;  4MTG A;  2HSQ A;  4OIN F;  3U0C A;  2I8B A;  1FFT C;  1JOG A;  1L3P A;  2P0N A;  2Q3T A;  4BJ1 A;  2L6G A;  1SR2 A;  4IB4 A;  1UG7 A;  2NSG A;  2VB6 A;  2XLO A;  1JR8 A;  4XPY A;  4KC9 A;  4QDL A;  1Z7Q c;  4Q5S F;  4UDV A;  1JMW A;  4PK4 A;  3GOR A;  2CW0 F;  1VOM A;  3B0P A;  3L8J A;  3O55 A;  2Q7R A;  1RKC A;  3DKA A;  2XXA A;  3UR3 C;  3N24 A;  1NU9 C;  3V5Y A;  1KNY A;  1T6Q A;  2PX3 A;  3HJC A;  1YAR O;  3HKK A;  3V5Z A;  2XXA B;  2XM0 A;  1MNE A;  2KNH A;  2R7R A;  1QZX A;  4K7B A;  2H8A A;  4H54 A;  3ITF A;  3KKB A;  1E85 A;  5JLI A;  4IAO A;  4O7G A;  4BEJ A;  3Q7L A;  3ABL C;  3ZTM A;  2OKU A;  2DYS C;  4JJG A;  3TJ6 A;  2DGJ A;  3HNL A;  1IZM A;  4BJ6 C;  1WTY A;  1HW1 A;  2YHS A;  1OR3 A;  2A6H F;  1G4U S;  3IEE A;  4ULW A;  4JW1 A;  3EJN A;  1OW7 A;  4J7T A;  3EGD B;  3KYI A;  3HNK A;  3LLK A;  5BQG A;  3NYM A;  2XS8 A;  2WL8 A;  4Q7C A;  2OEV A;  1NBB A;  2EIN C;  2PFD A;  5JUA A;  4DOZ A;  2XL4 A;  3NDB B;  4AE4 A;  4K1O A;  2J0X A;  2PNO A;  3UGO A;  1QPU A;  2Q9A A;  2X51 A;  4HFK B;  2Q9C A;  2E87 A;  4FWV A;  2IXN A;  2IYL D;  3PMR A;  3WG7 C;  5KYX A;  2NUP A;  3S84 A;  1ZHX A;  2EIL C;  2OG2 A;  4X0R A;  4KNW A;  2NUP B;  5KYX B;  1L7C A;  1WN0 A;  4MTO A;  1OXK A;  2VAS A;  4CSA A;  3UMH A;  2XLD A;  2XM4 A;  4N06 A;  3U8V A;  4CS7 A;  4Q4Z F;  1TWA A;  2LK4 A;  3R7C A;  3JTL O;  5KYN A;  2D4U A;  1D1C A;  2HMZ A;  4I1M A;  3OEO A;  2EPL X;  2NG1 A;  1K05 A;  2C03 A;  3DJN B;  1KU2 A;  1WGW A;  2W45 A;  1S05 A;  3K33 A;  2G62 A;  4PJJ A;  5L3Q A;  3SXZ A;  4EIY A;  3EZH A;  3U3B A;  1W2W A;  2IXP A;  5B3S C;  3H2V A;  3JSZ A;  1A7D A;  5DS6 A;  3DE9 A;  1MND A;  3C8G A;  1LM3 B;  3FMS A;  4U5E E;  1NFN A;  3C8G B;  4PFP A;  1QSP A;  2KGO A;  2A0B A;  3K1I A;  4PR9 A;  1VLT A;  4JZA A;  4XEF A;  2R05 A;  1Q0M A;  3EH1 A;  4BJ5 C;  3ATP A;  4CIP A;  4M63 A;  4BJT A;  5L0D A;  4JIO A;  2AU5 A;  4YL0 A;  3U3F A;  2BL2 A;  3X2Q C;  1BZ4 A;  1ST6 A;  2LFF A;  5JP7 A;  4PAC A;  4OD5 A;  4ANJ A;  4EUK B;  3U8P A;  4F4B A;  2TMV P;  2R7S A;  3DJU B;  3MYF A;  3IHU A;  3NMI A;  4U9E A;  4XPX A;  4KBL A;  5E33 A;  4MVZ A;  3RIP A;  2NPU A;  4R32 A;  3SXK A;  1K40 A;  1HMD A;  2WVO A;  4MND A;  3M4B A;  4NQF A;  4AX2 A;  3FHD A;  3ZTZ A;  2HV7 A;  256B A;  3EGX A;  1GQA A;  2FFH A;  4E7Z A;  4ER9 A;  3NKE A;  3Q6M A;  4WGZ A;  3EGX B;  1YYX A;  3FOP A;  5L0F A;  2VCC A;  2IOQ A;  3G50 A;  2J9U A;  1ZZP A;  2ICW G;  3T9O A;  3ZQV A;  3ZWI A;  4G7O F;  1NZE A;  3US6 A;  4B6I A;  4IAR A;  3H65 A;  3T4R A;  3C18 A;  4E0I A;  4CS9 C;  2ASR A;  4JC7 A;  4C7O A;  2P1A A;  1VYI A;  2YWA A;  4FES A;  4EWC A;  4N4W A;  2CCY A;  5D92 A;  2R03 A;  3EZI A;  2VCA A;  3GAN A;  4BJ6 A;  3A9C A;  1CPQ A;  5DS5 A;  1Y6D A;  4XPW A;  3KH2 A;  5JSL A;  2W4B A;  3E70 C;  3R2P A;  1NLX A;  1CGO A;  2JX0 A;  2Q9B A;  4P9T A;  3CAX A;  3SYN A;  4ZLD A;  3EFO A;  1SMY F;  2R7Q A;  3SZR A;  1OXB A;  3T6B A;  4O6M A;  4IGG A;  4G0H A;  3IQ5 A;  1E84 A;  3GEH A;  3J06 A;  1ZHT A;  3PDM P;  1YLM A;  4U5C E;  5JRA A;  1M2O A;  2XLV A;  1EKY A;  1BR1 A;  2HSB A;  2MYS A;  1V4A A;  2GFH A;  4XEK A;  1ZYR F;  3C8Z A;  2J9B A;  3AG1 C;  4YT4 A;  3X1O A;  1FTS A;  1T9K A;  1Y4C A;  3F46 A;  2OEX A;  1CGM E;  2UUI A;  5B1B C;  2IXM A;  4AK9 A;  4JJF A;  3S27 A;  4NC3 A;  2EIJ C;  2YL7 A;  1YJG A;  1LI5 A;  3DZA A;  2CNW A;  5BQI A;  3AG3 C;  2HFI A;  3UMI A;  2ZXP A;  3W8H A;  2QLA A;  4E17 A;  5AC5 A;  3RH3 A;  1LKX A;  2M4E A;  4J7Y A;  2CYD A;  1YAU O;  2J9V A;  1N1C A;  1JAF A;  4KNV A;  3NYJ A;  2XLW A;  3FOO A;  4WAB A;  3K6B A;  4U5H A;  1DOV A;  2LIG A;  3L1M A;  1TR2 A;  2JPU A;  4HFF B;  2YKZ A;  1XZP A;  4JEB A;  3VM6 A;  3ZQY A;  4G78 A;  4ONS A;  5A6B A;  4MW8 A;  1E86 A;  1Z63 A;  2R02 A;  4D4X A;  2QNL A;  3FVY A;  4JCH A;  4YL3 A;  3EGD A;  4I1O B;  2RD9 A;  2R7U A;  3LJB A;  4BJ5 A;  2XLE A;  2MWQ A;  3AJM A;  3QVY A;  2KJG A;  1D1A A;  2EIK C;  2HV6 A;  4WGY A;  3U9J A;  3WHN A;  3F47 A;  1ORY A;  1D1B A;  5F5F A;  2HMQ A;  4U5B E;  5L0H A;  1MMA A;  1ZVZ A;  2V3C C;  3NRH A;  3UGP A;  4O79 A;  3C62 A;  5A69 A;  1EA8 A;  3KYJ A;  1RMV A;  4GEH A;  1R4T A;  2LQG A;  3S90 A;  5EHH A;  3S9O A;  1LS1 A;  3NG1 A;  2YLG A;  1WAT A;  4BEM J;  4XLN F;  1F1M A;  3DMD A;  3NKD A;  3DAG A;  2XLM A;  2AP3 A;  3QMK A;  5TJ5 E;  2DYR C;  4PJL A;  4EHP A;  3RW0 A;  1OCR C;  2L6F A;  1TFO B;  1ORS C;  4CDY A;  3GM2 A;  4XQ1 A;  1Q0G A;  3SXY A;  3ZDL A;  1JRA A;  1Q0F A;  2IXO A;  1HE1 A;  3I5Q A;  4U9D A;  4CJO A;  5L0J A;  5KYY A;  1EI7 A;  3N2Z B;  1MMG A;  1FNT c;  4GYT A;  5KYY B;  1RXQ A;  4YWQ A;  2BE5 F;  4CS9 A;  3EH2 A;  5BUO A;  1YDI A;  1FMW A;  1YA9 A; 
#chains in the Genus database with same CATH homology
 3TD7 A;  3U5S A;  1OQC A;  3W4Y A;  4LDK A;  3MBG A;  3GWL A;  3LLI A;  4E0H A;  3U2M A;  3TK0 A;  3U2L A;  4E0I A;  3R7C A;  1JRA A;  3GWN A;  3LLK A;  1JR8 A;  2HJ3 A;  3O55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...