3U2MA

Crystal structure of human alr mutant c142/145s
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
b'FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEESAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 45
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2mA00
1JR8A 3W4YA 4E0IA 3TD7A 3TK0A 4LDKA 3LLIA 3MBGA 3R7CA 1OQCA 1JRAA 2HJ3A 4E0HA 3LLKA 3U2LA 3GWLA 3U5SA 3U2MA 3O55A 3GWNA
chains in the Genus database with same CATH superfamily
1NFNA 4PJJA 3PCVA 4H54A 2G3VA 1HY5A 3T6BA 3NMIA 1SMYF 3CQZA 3H2UA 3OA1A 4MVMA 4U5EE 1E85A 4CJOA 3QVZA 2P7VA 2QTVA 4MS2A 1EKYA 5KYYB 3L8JA 2DYRC 2E87A 1LI5A 2Y3DA 1OCZC 2IYLD 3K7DA 5D91A 1EI7A 1SR2A 2XLWA 3DJUB 3N0TA 3JTLO 3LNRA 3EGXA 3VF0A 1JRAA 2A1DD 3I5PA 3KL4A 4U5GA 3RVZA 1WN0A 4FWVA 3SNHA 5IY5C 4AE4B 4CBEA 3AGUA 1PD0A 4BJ6A 1AEPA 1EA8A 4YJWA 3POVA 1M6TA 5DLJA 1MQVA 1T6IA 3DE9A 3NMKA 3EH1A 2PF4E 5CI8A 4CIPA 2XXAB 3HTKC 2Q9BA 2HKVA 1GGQA 3C8GB 1UG7A 2XLDA 1TWCA 3TJ6A 2DYSC 4PK4A 4EBBA 4CSAC 4PFOA 1I4YA 3GM1A 3UNGC 1VLTA 4K0DA 1Q0DA 4BJ6C 3JT1A 3RYLA 1M57C 3JSEO 4JVSA 1TWAA 4OIRF 2XLOA 3ZQVA 2XM0A 2UUIA 1ZYRF 3ASOC 3LEOA 3LUTB 4P9FA 5JRAA 2TMVP 2B0JA 4JEBA 2FGYA 5COMA 5DQZA 3RFYA 3RH3A 4EIYA 1B68A 4YT5A 5DS6A 3QVYA 1QVXA 3NG1A 3DM5A 3C8ZA 1I5NA 3JYYA 5AGFA 2A69F 2JX0A 4EHPA 3DXJF 5K0IA 3RW0A 4LLEA 4JCHA 3SXYA 4EBKA 5AC4A 2R7SA 1D1CA 5FCLA 2JPUA 3IEEA 1BR4A 2R7UA 2Z15A 2KW3C 2R7TA 2Q9AA 2EIKC 3L8IA 3CAXA 3C18A 2XLHA 1ST6A 2WL8A 1IW7F 2R05A 3AG4C 4O6MA 5E3AA 4B6IA 3S84A 1NFOA 4KI2A 2CW0F 1BZ4A 1M2VB 1Q0MA 2PBEA 5KYXB 2ICWG 2KNHA 3AJMA 3HKKA 4H4KC 3LS0A 5T3WA 5TJ5E 3W8IA 4Q5SF 3K1IA 4QI2A 2OOCA 4CX9A 3IQCA 5EK0A 3JRTA 2NG1A 3WAQA 3ZIBA 2IXNA 2Q4FA 3HJCA 3HNJA 2NUTA 3EQLF 3OEOA 3GORA 2YLIA 2O9XA 2OJQA 5B1AC 3VYWA 3WODF 5L0JA 5T3TA 1N1CA 2OJED 1LE4A 4WGYA 1MMGA 2ZXOA 2J9WA 1FAPB 2VCCA 4N06A 4BEMJ 4DJ9A 2R7XA 4KBLA 4PJNA 3LEVA 3C62A 3HNKA 4G7ZF 3K6BA 4QI0A 3SXMA 3B71A 1XWJA 3S9OA 5BQHA 5L0GA 4XTKA 4E7SA 3CSKA 1MMDA 4JCZA 4ER9A 2R7VA 4KNWA 2IM8A 4CS7A 4HFFB 4G0HA 4G78A 3ZSUA 5CIVA 2W9YA 1HMDA 4MW3A 2R7RA 4HEAJ 4E0HA 4PFPA 1G5ZA 2L9JA 3LLKA 5BUOA 2KK1A 2XS8A 1A41A 1RXQA 2HZ8A 2J0WA 2GA0A 3EGDA 2LP4A 3ABMC 4YT2A 3SYNA 4LDQA 4NTAA 1O3UA 3S0XA 1H7IA 3QZCA 4J30B 2R7WA 1S05A 4AK9A 2HV6A 3EFOB 3B0PA 2I15A 1Z6AA 4IAOA 2LFDA 4GEHA 2J8WA 3ABLC 4WABA 2Q9CA 4JTDB 4C3EA 1YZAA 1XZQA 3W2WA 4XEKA 1OCRC 2R25A 2VCAA 4O7GA 4BJ5A 2CYDA 3US6A 1RKEB 4FAPB 4Z9JA 1HW1A 3GODA 1Z7Qc 1LM3B 3L34A 3AQBA 4MQ9F 1Q0KA 2ASRA 4JRZA 3ZTMA 1ORYA 1SF8A 3W2VA 1VYKA 1GM5A 4A2NB 3M4BA 2WZFA 4AL0A 1QLEC 3I5QA 3IQ6A 5L0IA 4W8PA 3C8GD 4O6NA 4JIOA 2J9UA 3UGPA 4R32A 1FMWA 2ZXPA 2YKZA 3TULA 1V4AA 3UMKA 1JR8A 3MYFA 1OW6A 1U89A 1D0YA 1K05A 2GWWA 5FZTA 1YJGA 1CGNA 2H8AA 4G7OF 1VB5A 1E2XA 3LJBA 5E3CA 4CS8A 4E18A 4N4WA 3MBGA 1YARO 4D4NA 3FAJA 1LIHA 1ZW3A 3VAYA 3DE8A 1CPQA 1DOWA 3A9CA 3RF3A 5L0DA 4YL1A 3U2LA 3NMJA 3FMSA 4JTCB 4IARA 4BJ1A 1H6GA 1LKXA 4Z9HA 4NCQA 2HMZA 3M1CB 1JAFA 2Q7RA 3SZRA 3H65A 4MTFA 1PCXA 2WVOA 4W8KA 3EG9A 3DAGA 2V3CC 2OEVA 3VM6A 3J06A 5KYWB 2XRHA 2A0UA 2D5RB 2L81A 2OU6A 4NTFA 4NTBA 4O6YA 3EHNA 3HNLA 4XEVA 1GQAA 4DBQA 5E33A 3NYJA 1QPUA 2YWAA 3ECSA 3U3FA 4DRHB 2WVQA 1VMAA 4O79A 1R4TA 2YVKA 4MVQA 4OD5A 3GEIA 2CGEA 1UFBA 2EIJC 2BC5A 2ZPAA 3B9QA 1FNTc 5F5FA 2NUPA 1T6UA 3RQFA 1Z63A 2YL1A 2HFIA 3ZTZA 1E83A 1WTYA 2OCCC 1YVIA 2DB4A 3L0IA 4YK5A 3SP1A 3DAFA 1LVKA 4JJFA 1C03A 3KPHA 3V7OA 3H2VA 1L3PA 3M79A 3NKEA 2OG2A 1J8YF 1WWPA 1BR2A 1OXBA 3DI5A 3GWNA 4PJMA 4QDLA 1QKRA 5COFA 1H9TA 3DM9B 1QZXA 3ASNC 4XPXA 1D1BA 4CS9A 1FR0A 2R9RB 2IXPA 4MVOA 4CIHA 1TWHA 1GS9A 1T5OA 2R02A 1G4WR 4MW8A 4YT4A 4LDKA 2KGOA 1NSGB 1U6HA 1LPEA 2OQMA 3I4UA 2J45A 2HS5A 2WZGA 4U9EA 1AVOB 1WOLA 1HE1A 3F46A 1APCA 4IWBA 1VK5A 4Q4ZF 1V74B 3RKOF 4BPMA 1TQGA 2ZD9A 3EHMA 1OQCA 3LAYA 5A6AA 1JPJA 1YYXA 2AVKA 3U8VA 3GEHA 3KH2A 4DXWA 1K04A 2BL2A 3DKAA 3RVYA 3S27A 2VB6A 1Y6DA 4NC3A 2EIMC 2YLDA 3FDQA 4N6CA 4AE4A 3U3BA 1ZU4A 4LACB 4C7OB 3O55A 4RBNA 4JURI 1LS4A 5JSLA 1F1MA 1V54C 2FFHA 4MVUA 2X0CA 4HE8D 2XXAA 1O87A 2QNLA 2YQYA 3DWWA 1A7VA 1ZZPA 4LLCA 1T9KA 4N6HA 2IBFA 3W4YA 3C8GA 3AOUA 1ZHTA 2X51A 4E17A 4D4XA 4EBJA 5L3QA 1SZIA 1YA7O 2W4MA 3KYIA 1BBHA 1BDJB 3C63A 2EILC 2PX0A 2QE9A 3JYHA 3T4RA 3ZDLA 2XLVA 3QTHA 3N2ZB 1VLSA 2G62A 1NZEA 2YHSA 3ABKC 3DMDA 1XZPA 2Y3BA 3GEEA 2MYSA 2W4BA 2IOQA 2IXOA 3K33A 2HV7A 4YL0A 1U0BB 2HSQA 3DZAA 3AG3C 1ORSC 5B3SC 4KNVA 4EKWA 4A4AA 2VC9A 3GM3A 2PNOA 1RCPA 2RD9A 1CGOA 5A6BD 4JW1A 3TOMA 1RKCA 1D1AA 4E0IA 4LDRA 4YT8A 3G4XA 4K7BA 1A7EA 3EGXB 2LSEA 3Q7GA 2L6FA 4XEFA 2OEXA 3NYLA 3FOOA 3ATPA 4DOZA 2BE5F 1M2OA 1YLMA 3F47A 1C17M 5DQTA 3IQTA 1PD1A 1OW8A 4J7TA 3WHNA 2C03A 3UMIA 1WASA 4MVSA 2Q00A 3FOPA 2J9BA 3EJNA 1C02A 2Y3HA 2YL0A 4JE9A 4IGGA 3N24A 3U0CA 5HSWA 4G7HF 5KYXA 3CZ6A 1ORJA 5L0FA 1H9GA 1G8XA 2J9VA 3MYIA 1CPRA 2Y39A 3EZIA 4I3MA 5A6KA 5COGA 2HUJA 2KYHA 4JC7A 2Y3GA 2WVNA 1LE2A 1ZW2A 2XL4A 3KMIA 4E7ZA 5DS5A 1KNYA 1QSPA 4CDVA 4JJGA 4DVYP 2LIGA 1K40A 1JPNA 1OW7A 2H7VC 3CEXA 1T6QA 1Y4CA 4FX5A 2DGJA 4YN0B 3GANA 3NKDA 5E2QA 1Z3IX 2I8BA 3NYMA 4ANJA 4P6IC 3KYJA 1TKNA 2HJ3A 5A6JA 4XQ1A 3T9OA 2KC3A 5F28E 3U8PA 5CI9A 1OCOC 4Z9IA 4XPYA 3EPVA 2H7BA 2QLAA 1OCCC 1TFOB 1HE9A 3K66A 4U5DE 2YZSA 2OKUA 2JD3A 3U5SA 3ITFA 1NU9C 3SEOA 2QUPA 4HFKB 3L1MA 4LERA 1YA9A 2AP3A 2RSEB 1D0ZA 4JZAA 1AUEA 2QY9A 3QW0A 2NPUA 5BQGA 3X1OA 3QMKA 4DBRA 2EPNA 4PJLA 1R5ID 1ZHYA 2KQ9A 3KKBA 2L7AA 1G4US 2CDQA 3A11A 3EFOA 4M63A 2CNWA 2P0NA 2XS1A 2R7QA 3AQCA 5EGYA 1M56C 1KTMA 2XM4A 1V55C 2AU5A 2EPLX 1DOVA 1MMNA 2WB7A 2R03A 3O10A 3JSZA 3FAPB 1JMWA 3K1IC 1EQ1A 3GM2A 2EPMX 2YL3A 1ZVZA 2NUTB 2CCYA 3FXHA 2LCHA 1TWGA 5AC5A 1FFTC 2YRFA 1RKEA 2M4EA 4EUKB 3Q7LA 1Z23A 1RJ9A 2NSGA 2F22A 2G3KA 3Q6NA 5KYUA 5HV9A 4I1OB 3T6GB 3E70C 1OKKD 3MFNA 3O39A 2GAQA 1RMVA 4MTGA 3G50A 1Q0GA 4ZLCA 3HNIA 3BRJA 3RIPA 5L0HA 3FHDA 1VOMA 2A6EF 2HMQA 2UUHA 1NBBA 3RQEA 4U5HA 2A6HF 4IJJA 1TR2A 2Q3TA 3T6JA 5KYNA 4OD4A 1PV3A 3NDBB 1E86A 2XSEA 1JOGA 2VASA 3AG1C 3ZG1A 1WATA 3LLIA 4XWJA 3V5YA 2J0XA 5A6BA 3C7JA 1OR2A 1A0BA 3O6XA 3IPMO 3PMRA 2A0BA 4ULVA 3R7CA 2HSBA 5KYYA 4KC9A 3S29A 2IXMA 2LD6A 3EGDB 1CGME 4DRIB 3ZC4A 4C3BA 4JEAA 3M15A 4I1MA 3W8HA 5GPGB 4DVZA 4X0RA 1W2WA 1MNDA 1ZHZA 2M64A 3SXZA 3B29A 1Q0FA 4XPWA 3MX3A 4F4BA 5JUAA 1S7ZA 2J7PA 3IQ5A 3NRHA 2GFHA 2C04A 4P9TA 4J32B 4U5FE 2AWYA 4AL1A 3OWTA 5A69A 5L0CA 2V26A 4ZLDA 3FVYA 4BJTA 2CNWD 4MNDA 2Y69C 2XLMA 5L3VA 2XLEA 2KSFA 4K1OA 3X2QC 2PP4A 2ZXRA 4U5BE 2W45A 3TD7A 5KYWA 1MNEA 1ZU5A 4PACA 4U9DA 4ULWA 4XLNF 2L6GA 3U9MA 4BJ5C 4WGZA 3VRCA 2FAPB 4YWQA 4CSAA 4MVZA 4UDVA 3JZ0A 3MLGA 3DD7A 3S28A 2R7OA 3Q6MA 5JVEA 1TFKB 3ZWIA 2EPOA 2MWQA 4YL3A 3WG7C 1SYQA 256BA 2PX3A 2EPKX 5JS5A 1OR3A 3RQGA 2LQGA 5T1DB 1O5HA 2ZXWC 2L6HA 4FESA 5JP7A 5DS4A 4OIQF 1E84A 4IRUA 5JT4A 1D0XA 3LESA 3BEHA 4MTOA 4U5CE 3LS1A 4IAQA 4ONSA 3M4CA 1OXKA 4PR9A 3K1HA 5JLIA 2VH3A 2YLGA 4L6RA 1ZHWA 3U9JA 1VTMP 1IZMA 4CS8C 1YAUO 5D92A 2NSFA 3SXKA 4CDAA 3S90A 3B0VC 3JRMO 1Z5ZA 3TQOA 4CDYA 3UMHA 2VCBA 2XL6A 5EHHA 1A7DA 3QW1A 3EZHA 4J7YA 4XLPF 2LFFA 2J46A 2J7PD 4BG0A 3GWLA 4OIPF 5B3IA 2WZLA 1MMAA 2P1AA 3EG9B 4JKVA 4RD9A 3V5XA 3E9VA 3ZQYA 4GYTA 4IB4A 2LK4A 1M2VA 2XL8A 3TJ5A 1FFHA 1HW2A 3ZVRA 4C3DA 4GQHA 3AG2C 1QQ3A 3B0UX 4NY3A 2YEVA 3G4ZA 4OIOF 2P61A 1NLXA 3JCUQ 1KU2A 3DJNB 2PFDA 2GDCA 2H7OA 3PDMP 4CJGA 4EWCA 4C7OA 1OKKA 4MVRA 5DVWA 2D4UA 2DI3A 1I4ZA 3V5ZA 1LI7A 1YDIA 2HJMA 3TK0A 1BR1A 3LNMB 4DRJB 4BEJA 2EINC 2MHRA 1LS1A 2A68F 1YZCA 2NUPB 3HLZA 4NQFA 4RDAA 2P6VA 3R2PA 4OINF 1FTSA 5KYUB 1RJ9B 1ZHXA 3IHUA 4Q7CA 1HMOA 3UGOA 1NG1A 2YL7A 1NU7D 4AX2A 5BQIA 1WGWA 1T01A 3EH2A 5B1BC 4WJ0A 3TOLA 4JTAB 3UR3C 2AWCA 2ETSA 5F5HA 1J8MF 1FMVA 1L7CA 1YYJA 3AGTA 4I44A 3U2MA 3PHF2 1VYIA 4CS9C 2KJGA 2B0HA
chains in the Genus database with same CATH topology
1JR8A 3W4YA 4E0IA 3TD7A 3TK0A 4LDKA 3LLIA 3MBGA 3R7CA 1OQCA 1JRAA 2HJ3A 4E0HA 3LLKA 3U2LA 3GWLA 3U5SA 3U2MA 3O55A 3GWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR8 A;  3W4Y A;  4E0I A;  3TD7 A;  3TK0 A;  4LDK A;  3LLI A;  3MBG A;  3R7C A;  1OQC A;  1JRA A;  2HJ3 A;  4E0H A;  3LLK A;  3U2L A;  3GWL A;  3U5S A;  3U2M A;  3O55 A;  3GWN A; 
#chains in the Genus database with same CATH topology
 1NFN A;  4PJJ A;  3PCV A;  4H54 A;  2G3V A;  1HY5 A;  3T6B A;  3NMI A;  1SMY F;  3CQZ A;  3H2U A;  3OA1 A;  4MVM A;  4U5E E;  1E85 A;  4CJO A;  3QVZ A;  2P7V A;  2QTV A;  4MS2 A;  1EKY A;  5KYY B;  3L8J A;  2DYR C;  2E87 A;  1LI5 A;  2Y3D A;  1OCZ C;  2IYL D;  3K7D A;  5D91 A;  1EI7 A;  1SR2 A;  2XLW A;  3DJU B;  3N0T A;  3JTL O;  3LNR A;  3EGX A;  3VF0 A;  1JRA A;  2A1D D;  3I5P A;  3KL4 A;  4U5G A;  3RVZ A;  1WN0 A;  4FWV A;  3SNH A;  5IY5 C;  4AE4 B;  4CBE A;  3AGU A;  1PD0 A;  4BJ6 A;  1AEP A;  1EA8 A;  4YJW A;  3POV A;  1M6T A;  5DLJ A;  1MQV A;  1T6I A;  3DE9 A;  3NMK A;  3EH1 A;  2PF4 E;  5CI8 A;  4CIP A;  2XXA B;  3HTK C;  2Q9B A;  2HKV A;  1GGQ A;  3C8G B;  1UG7 A;  2XLD A;  1TWC A;  3TJ6 A;  2DYS C;  4PK4 A;  4EBB A;  4CSA C;  4PFO A;  1I4Y A;  3GM1 A;  3UNG C;  1VLT A;  4K0D A;  1Q0D A;  4BJ6 C;  3JT1 A;  3RYL A;  1M57 C;  3JSE O;  4JVS A;  1TWA A;  4OIR F;  2XLO A;  3ZQV A;  2XM0 A;  2UUI A;  1ZYR F;  3ASO C;  3LEO A;  3LUT B;  4P9F A;  5JRA A;  2TMV P;  2B0J A;  4JEB A;  2FGY A;  5COM A;  5DQZ A;  3RFY A;  3RH3 A;  4EIY A;  1B68 A;  4YT5 A;  5DS6 A;  3QVY A;  1QVX A;  3NG1 A;  3DM5 A;  3C8Z A;  1I5N A;  3JYY A;  5AGF A;  2A69 F;  2JX0 A;  4EHP A;  3DXJ F;  5K0I A;  3RW0 A;  4LLE A;  4JCH A;  3SXY A;  4EBK A;  5AC4 A;  2R7S A;  1D1C A;  5FCL A;  2JPU A;  3IEE A;  1BR4 A;  2R7U A;  2Z15 A;  2KW3 C;  2R7T A;  2Q9A A;  2EIK C;  3L8I A;  3CAX A;  3C18 A;  2XLH A;  1ST6 A;  2WL8 A;  1IW7 F;  2R05 A;  3AG4 C;  4O6M A;  5E3A A;  4B6I A;  3S84 A;  1NFO A;  4KI2 A;  2CW0 F;  1BZ4 A;  1M2V B;  1Q0M A;  2PBE A;  5KYX B;  2ICW G;  2KNH A;  3AJM A;  3HKK A;  4H4K C;  3LS0 A;  5T3W A;  5TJ5 E;  3W8I A;  4Q5S F;  3K1I A;  4QI2 A;  2OOC A;  4CX9 A;  3IQC A;  5EK0 A;  3JRT A;  2NG1 A;  3WAQ A;  3ZIB A;  2IXN A;  2Q4F A;  3HJC A;  3HNJ A;  2NUT A;  3EQL F;  3OEO A;  3GOR A;  2YLI A;  2O9X A;  2OJQ A;  5B1A C;  3VYW A;  3WOD F;  5L0J A;  5T3T A;  1N1C A;  2OJE D;  1LE4 A;  4WGY A;  1MMG A;  2ZXO A;  2J9W A;  1FAP B;  2VCC A;  4N06 A;  4BEM J;  4DJ9 A;  2R7X A;  4KBL A;  4PJN A;  3LEV A;  3C62 A;  3HNK A;  4G7Z F;  3K6B A;  4QI0 A;  3SXM A;  3B71 A;  1XWJ A;  3S9O A;  5BQH A;  5L0G A;  4XTK A;  4E7S A;  3CSK A;  1MMD A;  4JCZ A;  4ER9 A;  2R7V A;  4KNW A;  2IM8 A;  4CS7 A;  4HFF B;  4G0H A;  4G78 A;  3ZSU A;  5CIV A;  2W9Y A;  1HMD A;  4MW3 A;  2R7R A;  4HEA J;  4E0H A;  4PFP A;  1G5Z A;  2L9J A;  3LLK A;  5BUO A;  2KK1 A;  2XS8 A;  1A41 A;  1RXQ A;  2HZ8 A;  2J0W A;  2GA0 A;  3EGD A;  2LP4 A;  3ABM C;  4YT2 A;  3SYN A;  4LDQ A;  4NTA A;  1O3U A;  3S0X A;  1H7I A;  3QZC A;  4J30 B;  2R7W A;  1S05 A;  4AK9 A;  2HV6 A;  3EFO B;  3B0P A;  2I15 A;  1Z6A A;  4IAO A;  2LFD A;  4GEH A;  2J8W A;  3ABL C;  4WAB A;  2Q9C A;  4JTD B;  4C3E A;  1YZA A;  1XZQ A;  3W2W A;  4XEK A;  1OCR C;  2R25 A;  2VCA A;  4O7G A;  4BJ5 A;  2CYD A;  3US6 A;  1RKE B;  4FAP B;  4Z9J A;  1HW1 A;  3GOD A;  1Z7Q c;  1LM3 B;  3L34 A;  3AQB A;  4MQ9 F;  1Q0K A;  2ASR A;  4JRZ A;  3ZTM A;  1ORY A;  1SF8 A;  3W2V A;  1VYK A;  1GM5 A;  4A2N B;  3M4B A;  2WZF A;  4AL0 A;  1QLE C;  3I5Q A;  3IQ6 A;  5L0I A;  4W8P A;  3C8G D;  4O6N A;  4JIO A;  2J9U A;  3UGP A;  4R32 A;  1FMW A;  2ZXP A;  2YKZ A;  3TUL A;  1V4A A;  3UMK A;  1JR8 A;  3MYF A;  1OW6 A;  1U89 A;  1D0Y A;  1K05 A;  2GWW A;  5FZT A;  1YJG A;  1CGN A;  2H8A A;  4G7O F;  1VB5 A;  1E2X A;  3LJB A;  5E3C A;  4CS8 A;  4E18 A;  4N4W A;  3MBG A;  1YAR O;  4D4N A;  3FAJ A;  1LIH A;  1ZW3 A;  3VAY A;  3DE8 A;  1CPQ A;  1DOW A;  3A9C A;  3RF3 A;  5L0D A;  4YL1 A;  3U2L A;  3NMJ A;  3FMS A;  4JTC B;  4IAR A;  4BJ1 A;  1H6G A;  1LKX A;  4Z9H A;  4NCQ A;  2HMZ A;  3M1C B;  1JAF A;  2Q7R A;  3SZR A;  3H65 A;  4MTF A;  1PCX A;  2WVO A;  4W8K A;  3EG9 A;  3DAG A;  2V3C C;  2OEV A;  3VM6 A;  3J06 A;  5KYW B;  2XRH A;  2A0U A;  2D5R B;  2L81 A;  2OU6 A;  4NTF A;  4NTB A;  4O6Y A;  3EHN A;  3HNL A;  4XEV A;  1GQA A;  4DBQ A;  5E33 A;  3NYJ A;  1QPU A;  2YWA A;  3ECS A;  3U3F A;  4DRH B;  2WVQ A;  1VMA A;  4O79 A;  1R4T A;  2YVK A;  4MVQ A;  4OD5 A;  3GEI A;  2CGE A;  1UFB A;  2EIJ C;  2BC5 A;  2ZPA A;  3B9Q A;  1FNT c;  5F5F A;  2NUP A;  1T6U A;  3RQF A;  1Z63 A;  2YL1 A;  2HFI A;  3ZTZ A;  1E83 A;  1WTY A;  2OCC C;  1YVI A;  2DB4 A;  3L0I A;  4YK5 A;  3SP1 A;  3DAF A;  1LVK A;  4JJF A;  1C03 A;  3KPH A;  3V7O A;  3H2V A;  1L3P A;  3M79 A;  3NKE A;  2OG2 A;  1J8Y F;  1WWP A;  1BR2 A;  1OXB A;  3DI5 A;  3GWN A;  4PJM A;  4QDL A;  1QKR A;  5COF A;  1H9T A;  3DM9 B;  1QZX A;  3ASN C;  4XPX A;  1D1B A;  4CS9 A;  1FR0 A;  2R9R B;  2IXP A;  4MVO A;  4CIH A;  1TWH A;  1GS9 A;  1T5O A;  2R02 A;  1G4W R;  4MW8 A;  4YT4 A;  4LDK A;  2KGO A;  1NSG B;  1U6H A;  1LPE A;  2OQM A;  3I4U A;  2J45 A;  2HS5 A;  2WZG A;  4U9E A;  1AVO B;  1WOL A;  1HE1 A;  3F46 A;  1APC A;  4IWB A;  1VK5 A;  4Q4Z F;  1V74 B;  3RKO F;  4BPM A;  1TQG A;  2ZD9 A;  3EHM A;  1OQC A;  3LAY A;  5A6A A;  1JPJ A;  1YYX A;  2AVK A;  3U8V A;  3GEH A;  3KH2 A;  4DXW A;  1K04 A;  2BL2 A;  3DKA A;  3RVY A;  3S27 A;  2VB6 A;  1Y6D A;  4NC3 A;  2EIM C;  2YLD A;  3FDQ A;  4N6C A;  4AE4 A;  3U3B A;  1ZU4 A;  4LAC B;  4C7O B;  3O55 A;  4RBN A;  4JUR I;  1LS4 A;  5JSL A;  1F1M A;  1V54 C;  2FFH A;  4MVU A;  2X0C A;  4HE8 D;  2XXA A;  1O87 A;  2QNL A;  2YQY A;  3DWW A;  1A7V A;  1ZZP A;  4LLC A;  1T9K A;  4N6H A;  2IBF A;  3W4Y A;  3C8G A;  3AOU A;  1ZHT A;  2X51 A;  4E17 A;  4D4X A;  4EBJ A;  5L3Q A;  1SZI A;  1YA7 O;  2W4M A;  3KYI A;  1BBH A;  1BDJ B;  3C63 A;  2EIL C;  2PX0 A;  2QE9 A;  3JYH A;  3T4R A;  3ZDL A;  2XLV A;  3QTH A;  3N2Z B;  1VLS A;  2G62 A;  1NZE A;  2YHS A;  3ABK C;  3DMD A;  1XZP A;  2Y3B A;  3GEE A;  2MYS A;  2W4B A;  2IOQ A;  2IXO A;  3K33 A;  2HV7 A;  4YL0 A;  1U0B B;  2HSQ A;  3DZA A;  3AG3 C;  1ORS C;  5B3S C;  4KNV A;  4EKW A;  4A4A A;  2VC9 A;  3GM3 A;  2PNO A;  1RCP A;  2RD9 A;  1CGO A;  5A6B D;  4JW1 A;  3TOM A;  1RKC A;  1D1A A;  4E0I A;  4LDR A;  4YT8 A;  3G4X A;  4K7B A;  1A7E A;  3EGX B;  2LSE A;  3Q7G A;  2L6F A;  4XEF A;  2OEX A;  3NYL A;  3FOO A;  3ATP A;  4DOZ A;  2BE5 F;  1M2O A;  1YLM A;  3F47 A;  1C17 M;  5DQT A;  3IQT A;  1PD1 A;  1OW8 A;  4J7T A;  3WHN A;  2C03 A;  3UMI A;  1WAS A;  4MVS A;  2Q00 A;  3FOP A;  2J9B A;  3EJN A;  1C02 A;  2Y3H A;  2YL0 A;  4JE9 A;  4IGG A;  3N24 A;  3U0C A;  5HSW A;  4G7H F;  5KYX A;  3CZ6 A;  1ORJ A;  5L0F A;  1H9G A;  1G8X A;  2J9V A;  3MYI A;  1CPR A;  2Y39 A;  3EZI A;  4I3M A;  5A6K A;  5COG A;  2HUJ A;  2KYH A;  4JC7 A;  2Y3G A;  2WVN A;  1LE2 A;  1ZW2 A;  2XL4 A;  3KMI A;  4E7Z A;  5DS5 A;  1KNY A;  1QSP A;  4CDV A;  4JJG A;  4DVY P;  2LIG A;  1K40 A;  1JPN A;  1OW7 A;  2H7V C;  3CEX A;  1T6Q A;  1Y4C A;  4FX5 A;  2DGJ A;  4YN0 B;  3GAN A;  3NKD A;  5E2Q A;  1Z3I X;  2I8B A;  3NYM A;  4ANJ A;  4P6I C;  3KYJ A;  1TKN A;  2HJ3 A;  5A6J A;  4XQ1 A;  3T9O A;  2KC3 A;  5F28 E;  3U8P A;  5CI9 A;  1OCO C;  4Z9I A;  4XPY A;  3EPV A;  2H7B A;  2QLA A;  1OCC C;  1TFO B;  1HE9 A;  3K66 A;  4U5D E;  2YZS A;  2OKU A;  2JD3 A;  3U5S A;  3ITF A;  1NU9 C;  3SEO A;  2QUP A;  4HFK B;  3L1M A;  4LER A;  1YA9 A;  2AP3 A;  2RSE B;  1D0Z A;  4JZA A;  1AUE A;  2QY9 A;  3QW0 A;  2NPU A;  5BQG A;  3X1O A;  3QMK A;  4DBR A;  2EPN A;  4PJL A;  1R5I D;  1ZHY A;  2KQ9 A;  3KKB A;  2L7A A;  1G4U S;  2CDQ A;  3A11 A;  3EFO A;  4M63 A;  2CNW A;  2P0N A;  2XS1 A;  2R7Q A;  3AQC A;  5EGY A;  1M56 C;  1KTM A;  2XM4 A;  1V55 C;  2AU5 A;  2EPL X;  1DOV A;  1MMN A;  2WB7 A;  2R03 A;  3O10 A;  3JSZ A;  3FAP B;  1JMW A;  3K1I C;  1EQ1 A;  3GM2 A;  2EPM X;  2YL3 A;  1ZVZ A;  2NUT B;  2CCY A;  3FXH A;  2LCH A;  1TWG A;  5AC5 A;  1FFT C;  2YRF A;  1RKE A;  2M4E A;  4EUK B;  3Q7L A;  1Z23 A;  1RJ9 A;  2NSG A;  2F22 A;  2G3K A;  3Q6N A;  5KYU A;  5HV9 A;  4I1O B;  3T6G B;  3E70 C;  1OKK D;  3MFN A;  3O39 A;  2GAQ A;  1RMV A;  4MTG A;  3G50 A;  1Q0G A;  4ZLC A;  3HNI A;  3BRJ A;  3RIP A;  5L0H A;  3FHD A;  1VOM A;  2A6E F;  2HMQ A;  2UUH A;  1NBB A;  3RQE A;  4U5H A;  2A6H F;  4IJJ A;  1TR2 A;  2Q3T A;  3T6J A;  5KYN A;  4OD4 A;  1PV3 A;  3NDB B;  1E86 A;  2XSE A;  1JOG A;  2VAS A;  3AG1 C;  3ZG1 A;  1WAT A;  3LLI A;  4XWJ A;  3V5Y A;  2J0X A;  5A6B A;  3C7J A;  1OR2 A;  1A0B A;  3O6X A;  3IPM O;  3PMR A;  2A0B A;  4ULV A;  3R7C A;  2HSB A;  5KYY A;  4KC9 A;  3S29 A;  2IXM A;  2LD6 A;  3EGD B;  1CGM E;  4DRI B;  3ZC4 A;  4C3B A;  4JEA A;  3M15 A;  4I1M A;  3W8H A;  5GPG B;  4DVZ A;  4X0R A;  1W2W A;  1MND A;  1ZHZ A;  2M64 A;  3SXZ A;  3B29 A;  1Q0F A;  4XPW A;  3MX3 A;  4F4B A;  5JUA A;  1S7Z A;  2J7P A;  3IQ5 A;  3NRH A;  2GFH A;  2C04 A;  4P9T A;  4J32 B;  4U5F E;  2AWY A;  4AL1 A;  3OWT A;  5A69 A;  5L0C A;  2V26 A;  4ZLD A;  3FVY A;  4BJT A;  2CNW D;  4MND A;  2Y69 C;  2XLM A;  5L3V A;  2XLE A;  2KSF A;  4K1O A;  3X2Q C;  2PP4 A;  2ZXR A;  4U5B E;  2W45 A;  3TD7 A;  5KYW A;  1MNE A;  1ZU5 A;  4PAC A;  4U9D A;  4ULW A;  4XLN F;  2L6G A;  3U9M A;  4BJ5 C;  4WGZ A;  3VRC A;  2FAP B;  4YWQ A;  4CSA A;  4MVZ A;  4UDV A;  3JZ0 A;  3MLG A;  3DD7 A;  3S28 A;  2R7O A;  3Q6M A;  5JVE A;  1TFK B;  3ZWI A;  2EPO A;  2MWQ A;  4YL3 A;  3WG7 C;  1SYQ A;  256B A;  2PX3 A;  2EPK X;  5JS5 A;  1OR3 A;  3RQG A;  2LQG A;  5T1D B;  1O5H A;  2ZXW C;  2L6H A;  4FES A;  5JP7 A;  5DS4 A;  4OIQ F;  1E84 A;  4IRU A;  5JT4 A;  1D0X A;  3LES A;  3BEH A;  4MTO A;  4U5C E;  3LS1 A;  4IAQ A;  4ONS A;  3M4C A;  1OXK A;  4PR9 A;  3K1H A;  5JLI A;  2VH3 A;  2YLG A;  4L6R A;  1ZHW A;  3U9J A;  1VTM P;  1IZM A;  4CS8 C;  1YAU O;  5D92 A;  2NSF A;  3SXK A;  4CDA A;  3S90 A;  3B0V C;  3JRM O;  1Z5Z A;  3TQO A;  4CDY A;  3UMH A;  2VCB A;  2XL6 A;  5EHH A;  1A7D A;  3QW1 A;  3EZH A;  4J7Y A;  4XLP F;  2LFF A;  2J46 A;  2J7P D;  4BG0 A;  3GWL A;  4OIP F;  5B3I A;  2WZL A;  1MMA A;  2P1A A;  3EG9 B;  4JKV A;  4RD9 A;  3V5X A;  3E9V A;  3ZQY A;  4GYT A;  4IB4 A;  2LK4 A;  1M2V A;  2XL8 A;  3TJ5 A;  1FFH A;  1HW2 A;  3ZVR A;  4C3D A;  4GQH A;  3AG2 C;  1QQ3 A;  3B0U X;  4NY3 A;  2YEV A;  3G4Z A;  4OIO F;  2P61 A;  1NLX A;  3JCU Q;  1KU2 A;  3DJN B;  2PFD A;  2GDC A;  2H7O A;  3PDM P;  4CJG A;  4EWC A;  4C7O A;  1OKK A;  4MVR A;  5DVW A;  2D4U A;  2DI3 A;  1I4Z A;  3V5Z A;  1LI7 A;  1YDI A;  2HJM A;  3TK0 A;  1BR1 A;  3LNM B;  4DRJ B;  4BEJ A;  2EIN C;  2MHR A;  1LS1 A;  2A68 F;  1YZC A;  2NUP B;  3HLZ A;  4NQF A;  4RDA A;  2P6V A;  3R2P A;  4OIN F;  1FTS A;  5KYU B;  1RJ9 B;  1ZHX A;  3IHU A;  4Q7C A;  1HMO A;  3UGO A;  1NG1 A;  2YL7 A;  1NU7 D;  4AX2 A;  5BQI A;  1WGW A;  1T01 A;  3EH2 A;  5B1B C;  4WJ0 A;  3TOL A;  4JTA B;  3UR3 C;  2AWC A;  2ETS A;  5F5H A;  1J8M F;  1FMV A;  1L7C A;  1YYJ A;  3AGT A;  4I44 A;  3U2M A;  3PHF 2;  1VYI A;  4CS9 C;  2KJG A;  2B0H A; 
#chains in the Genus database with same CATH homology
 1JR8 A;  3W4Y A;  4E0I A;  3TD7 A;  3TK0 A;  4LDK A;  3LLI A;  3MBG A;  3R7C A;  1OQC A;  1JRA A;  2HJ3 A;  4E0H A;  3LLK A;  3U2L A;  3GWL A;  3U5S A;  3U2M A;  3O55 A;  3GWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...