1YZCA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) with the n- and a part of the c-terminal helices unfolded
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTGRAGNQKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords edesigned apo-cytochrome b562
publication title A protein folding pathway with multiple folding intermediates at atomic resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yzcA01
5B3IA 2XLMA 3M15A 3NMJA 4CX9A 2YLIA 1NBBA 1MQVA 2J8WA 3ZWIA 3TOLA 4JKVA 5JSLA 3QW0A 2YKZA 1CGNA 4U9EA 3HNIA 3HNKA 4EIYA 4IB4A 2XL6A 5JRAA 2XLDA 1E84A 3IQ6A 2YLGA 5JS5A 4D4NA 1QPUA 5JVEA 2CCYA 4L6RA 2YL1A 1A7VA 2J9BA 3IQ5A 256BA 1QQ3A 4CJGA 1E83A 3VRCA 4D4XA 3NMIA 4JEAA 3TOMA 3ZQYA 5JT4A 3FOOA 3C63A 2YL7A 4WGYA 4ULVA 2XM4A 4IAQA 3DE9A 1BBHA 3QW1A 5AGFA 2XM0A 1RCPA 1E85A 3M4CA 4CIPA 5JP7A 3ZTZA 1CPQA 5JLIA 1LM3B 4NC3A 1GQAA 5JUAA 4N6HA 2BC5A 1JAFA 1E86A 1CGOA 3M4BA 3M79A 3ZTMA 4CDVA 4ER9A 1APCA 3HNJA 3ZQVA 3QVYA 4WGZA 1YZAA 2QLAA 2XLWA 2XL8A 1S05A 4JE9A 1YYXA 2XLVA 4CDYA 3C62A 2YLDA 4CJOA 3U8PA 4CDAA 4JEBA 3FOPA 1CPRA 2YL0A 3L1MA 1M6TA 3QVZA 1YYJA 4U9DA 3HNLA 2XLEA 2XLHA 2YL3A 1YZCA 3DE8A 1EKYA 4N4WA 2XLOA 3NMKA 4IARA
chains in the Genus database with same CATH superfamily
4JTCB 4BJ6A 1Y6DA 3B0UX 1O87A 1JR8A 5BUOA 2L7AA 1Z63A 1VYKA 4EKWA 2ICWG 2ZXRA 5D91A 2X51A 1LS4A 1OW7A 3FMSA 2C04A 3RQEA 3SEOA 2GA0A 3KYIA 3O10A 4DJ9A 1VTMP 4CBEA 2P7VA 3ZIBA 3C8GA 1V54C 4PJLA 5KYNA 1Z23A 2J8WA 5IY5C 5KYYA 2PNOA 4XWJA 5T3WA 5JSLA 2R7WA 4AE4B 1TWCA 2ZXWC 2YKZA 1AEPA 4PFPA 4LDQA 5B1AC 5BQHA 1RMVA 4JJFA 3CZ6A 5A6KA 4DBRA 3HNKA 4K1OA 3FDQA 5DVWA 1FAPB 2Q00A 2IXNA 5BQGA 4IB4A 4ONSA 3SP1A 2WB7A 4W8PA 3T9OA 2HSBA 3AJMA 3SYNA 3ZVRA 3OA1A 4P9FA 1RKEA 1GM5A 5D92A 1E84A 1W2WA 3Q7GA 4LDKA 4N06A 2YLGA 3UGPA 4G7HF 2CGEA 3U8VA 2MHRA 2HMQA 3EGXB 4U5BE 4BJ5A 3IEEA 2ASRA 3V5YA 2IBFA 3KPHA 2R05A 2YZSA 1A7VA 4PR9A 3MX3A 4YK5A 2L6FA 3LS1A 4O6YA 2J9BA 2KK1A 2KC3A 1Q0GA 4FESA 4YL3A 4XPYA 256BA 3KH2A 3GORA 1WATA 4PFOA 5A69A 4ULWA 5DS4A 1ZHTA 4MQ9F 4JCZA 1C03A 1FFTC 3LS0A 3EGDB 4MVQA 3ZQYA 1M56C 2J9VA 5COFA 5L0HA 3K66A 1Y4CA 2A0BA 1LI5A 3ASOC 4WGYA 3S29A 4D4NA 2R7UA 3SXZA 4IAQA 4MTGA 3ECSA 2Q3TA 1ZW2A 3HTKC 1HW1A 2IOQA 5COGA 5L0FA 4IAOA 2XM0A 4O79A 4I1OB 3M4CA 4MS2A 4GQHA 3T6JA 2M4EA 3H2VA 4ANJA 1TR2A 1MNEA 2CDQA 2WVNA 4FAPB 5JP7A 3EG9B 1TFOB 3JSEO 3N2ZB 1DOWA 3JRMO 3IQTA 1CPQA 1NZEA 3GEEA 2J0XA 4MTOA 4CIHA 1H9TA 3X2QC 1GQAA 3O39A 1YA9A 1ZHZA 2R03A 1G5ZA 1UG7A 3WAQA 1JAFA 1NLXA 2NPUA 3RQFA 4JW1A 3QTHA 3J06A 3WHNA 4ZLDA 1G4WR 3L8JA 1VB5A 4CDVA 3BEHA 3ZQVA 4W8KA 2JX0A 3ZC4A 3K7DA 3EGXA 2H7VC 1YZAA 2QLAA 2OOCA 5T3TA 2XXAB 4MW8A 4AL0A 2LCHA 5DS6A 3B0PA 2XLWA 2XL8A 4IWBA 1FNTc 3B0VC 4O6MA 3S90A 3F47A 3W4YA 2EINC 4JE9A 3PMRA 2KSFA 1YYXA 2XLVA 1RJ9B 3B9QA 1ZVZA 3CSKA 4E18A 1T5OA 2E87A 2YWAA 4JVSA 3EFOA 4CJOA 1FR0A 1YAUO 3B71A 5EK0A 4C7OB 2A68F 3EPVA 1QSPA 5A6BD 2J9UA 3L1MA 4BPMA 4DBQA 1O5HA 3U0CA 4P9TA 2YHSA 5L0IA 2IXMA 4RDAA 2XLEA 5B1BC 3UMIA 4JTDB 3LEVA 2VC9A 3LEOA 3C7JA 3K1IA 4MVSA 3SXKA 3DE8A 2BE5F 2P61A 1EKYA 3L0IA 2EPMX 4WJ0A 2OKUA 2G3KA 3QZCA 3C8GB 2R7RA 3K6BA 3T4RA 3AG3C 5B3IA 3JRTA 2W45A 2XLMA 3M15A 2Q7RA 3S9OA 3U5SA 1QVXA 3W2VA 4GYTA 4R32A 2KYHA 3RVYA 1QLEC 4LACB 4MW3A 4CSAA 3C8GD 4CS9A 1OCRC 4CX9A 4DOZA 1NFNA 3LESA 1NBBA 5DS5A 4I3MA 1MQVA 1NG1A 3A9CA 1MMNA 4NCQA 4OINF 1YLMA 1T6UA 4J30B 2IXPA 2PF4E 4Z9IA 2IM8A 4C3EA 1CGNA 1BR2A 1JPJA 1RKEB 1IZMA 1SR2A 1LS1A 4U9EA 3ZDLA 4AX2A 3N24A 3T6GB 4AK9A 4XEKA 3PDMP 3DAGA 1EQ1A 4EBKA 4EIYA 1OCCC 2QY9A 2HV6A 2XL6A 2YRFA 1J8YF 4KBLA 4JRZA 1OXBA 2LK4A 5JRAA 2OEXA 2WVQA 2YQYA 1TFKB 5COMA 1VLSA 3K1HA 1ZZPA 2XLDA 3NRHA 5A6JA 3IQ6A 1FMVA 3DMDA 4KC9A 2JD3A 3G4ZA 2OQMA 3LNRA 4JJGA 3JTLO 4CS8A 5JVEA 4U5HA 4L6RA 1B68A 4U5DE 1OKKA 2Y39A 3K1IC 3TQOA 1JOGA 2OU6A 3DXJF 1D0ZA 1QKRA 1A41A 1EI7A 2XL4A 3UMHA 1G4US 1E83A 1JRAA 3NMIA 2L81A 1MMDA 1IW7F 5KYUA 3FOOA 3X1OA 5A6AA 3H65A 2W4MA 2YL7A 5HSWA 1ZHXA 2MYSA 3MLGA 2XM4A 2Y69C 2W4BA 1MNDA 3RW0A 1OR2A 1T9KA 2NUPA 2J45A 2OG2A 1MMGA 2OEVA 4CS9C 1E85A 4CSAC 4XLPF 3S0XA 2Z15A 3DD7A 3JSZA 2UUHA 1BR1A 4MVZA 2HSQA 5CI9A 4BJTA 2W9YA 3NKDA 2M64A 2BC5A 4DXWA 4ZLCA 1HMOA 3TK0A 4MNDA 4O7GA 2B0HA 1AUEA 3ZTMA 1E2XA 5K0IA 1APCA 3E9VA 1S7ZA 2D4UA 3EFOB 2CYDA 1I4YA 4OIOF 4PACA 2P0NA 2R9RB 4HFKB 3N0TA 2A69F 2H7OA 2NG1A 4OIRF 4KNVA 4BJ1A 1T01A 3U3FA 1ZU4A 4DRIB 4DVYP 3H2UA 1ORSC 2HV7A 3GANA 2FGYA 5L3QA 3FHDA 5E33A 1HW2A 3Q7LA 3AGTA 2YLDA 4CS8C 2R7TA 2H8AA 3U8PA 5KYXA 4IRUA 1YA7O 4JEBA 2LFDA 3RFYA 5BQIA 4EBJA 1Q0FA 2XSEA 3G4XA 3LAYA 3US6A 1K04A 1SYQA 4MVRA 1ZHYA 2NSGA 4IGGA 4XEFA 4YT5A 5L0DA 2V3CC 2XRHA 2Y3DA 3GODA 2YL3A 3R2PA 1YZCA 4A2NB 3TD7A 4EHPA 1KTMA 3W8IA 4E0HA 4N4WA 2WVOA 2AWYA 4KNWA 3Q6MA 4HFFB 5E3CA 1RKCA 3SXYA 4Q5SF 2P1AA 2Y3BA 2JPUA 4QI0A 5TJ5E 2HMZA 3HKKA 3AG1C 4YN0B 4I1MA 3TJ6A 4DVZA 3NMJA 2R02A 3HLZA 4YT2A 3NYJA 1WGWA 2OJQA 1ZHWA 3CQZA 4U5FE 1ZU5A 4HEAJ 1D0XA 3JT1A 1BZ4A 2G62A 1VYIA 2HUJA 2EIKC 3ZWIA 3TOLA 2HZ8A 4JKVA 5FZTA 3QW0A 2HFIA 1R5ID 1BR4A 3ASNC 3O6XA 3EZIA 1H9GA 1FMWA 1YVIA 2VCCA 4NY3A 1C02A 2EPNA 2GFHA 4H4KC 3FAPB 4BEJA 2OCCC 2YEVA 3NYMA 3RF3A 3C18A 4JIOA 1WTYA 4E7SA 3IQCA 4RBNA 2PP4A 1EA8A 2R7XA 1D1AA 3V5XA 2J7PA 5HV9A 3GEHA 3I4UA 4NTFA 2J46A 5AC5A 1G8XA 2I15A 2KQ9A 3U9JA 1HMDA 3BRJA 1YDIA 4XPWA 2QE9A 2CCYA 1OKKD 2AU5A 3R7CA 5DQTA 5KYUB 2OJED 2QUPA 2YL1A 2QNLA 5EHHA 1SMYF 1V4AA 1VOMA 2A6HF 1WOLA 1I4ZA 1DOVA 5DQZA 4CJGA 3RYLA 2NUPB 2O9XA 2EIJC 3VM6A 4DRJB 4N6CA 4QDLA 2R7OA 3UMKA 4YT4A 3NDBB 3VAYA 5JT4A 3F46A 5T1DB 3C63A 1HY5A 1U6HA 1ZYRF 3ITFA 2LQGA 2EPOA 2R7VA 3VF0A 2ETSA 4EUKB 1PD1A 4ULVA 5E2QA 3SXMA 3V5ZA 4E17A 1F1MA 2CNWA 3QW1A 3L8IA 5AGFA 3W8HA 1RCPA 1NU7D 4J7TA 2NUTA 2DYRC 5CIVA 2WZGA 4Q4ZF 2EPLX 2KW3C 4HE8D 4PJMA 4CIPA 3O55A 4JCHA 3UR3C 2LP4A 3ZG1A 3Q6NA 3S28A 1Q0DA 5JLIA 2RD9A 2KGOA 3ABLC 2R7QA 3AQCA 1KU2A 1RXQA 3B29A 4NC3A 4NTBA 3C8ZA 1VK5A 4N6HA 2Y3HA 4NQFA 1KNYA 1GS9A 4PK4A 4BG0A 4OD5A 2CW0F 5EGYA 3ABMC 2VH3A 3AG2C 1CGOA 1JPNA 1TKNA 2DB4A 2PBEA 3MYIA 3RQGA 5B3SC 3KMIA 3M79A 4Z9JA 2EILC 3U2MA 4ER9A 4YL1A 3U3BA 4YWQA 1SF8A 2HKVA 2IYLD 5E3AA 1T6QA 4WGZA 5KYXB 2X0CA 1OCOC 1LPEA 5KYWA 1Q0MA 4Q7CA 1SZIA 3E70C 4PJNA 5L0GA 1U89A 1S05A 2BL2A 3CEXA 2I8BA 3FXHA 4CDYA 1LIHA 4XQ1A 3CAXA 3VYWA 1K40A 1WWPA 1XZPA 1VLTA 3C62A 1U0BB 1Q0KA 1OCZC 4H54A 3JZ0A 4LLEA 1TWGA 1J8MF 4BEMJ 3AQBA 3FOPA 3EHNA 2YL0A 1M6TA 3TULA 1K05A 2GDCA 3NKEA 4OD4A 2L9JA 2QTVA 4U9DA 3RVZA 4EWCA 3HNLA 2RSEB 3AG4C 3GM3A 4JC7A 2J0WA 4G7ZF 3NG1A 2P6VA 3EJNA 3M1CB 3I5PA 1M2VA 5DLJA 2D5RB 4LDRA 4RD9A 1CGME 1NFOA 1LE2A 3KYJA 1TQGA 2C03A 3DZAA 1L3PA 3FVYA 1M2OA 2AP3A 3AGUA 3EH2A 3DKAA 3U2LA 3V7OA 2F22A 3JCUQ 4XPXA 2WL8A 3EH1A 4YT8A 4O6NA 3UGOA 4AL1A 4J32B 2TMVP 2WZLA 4XTKA 1AVOB 2DGJA 2YLIA 4I44A 4JURI 4A4AA 3S84A 2ZXPA 1LVKA 3G50A 4WABA 2IXOA 2LSEA 1V55C 1NSGB 2B0JA 4C3DA 3RKOF 1M57C 2Q9AA 1PCXA 5L0CA 2VCAA 3EQLF 5F5HA 4U5CE 1ST6A 3MYFA 2LIGA 4CS7A 2J9WA 4U5EE 2EIMC 1YJGA 3HNIA 3UNGC 2ZD9A 4BJ6C 1JMWA 2A0UA 4OIPF 4G78A 4E7ZA 2AWCA 2XS1A 3GM2A 2J7PD 3LLIA 1GGQA 4AE4A 3DJNB 3DM5A 3NYLA 2EPKX 1D1BA 5F5FA 5L0JA 2GWWA 2MWQA 4E0IA 5JS5A 3HJCA 1UFBA 1OW8A 3OEOA 4X0RA 2KNHA 3MFNA 1QPUA 5F28E 2Q9BA 2A6EF 3SZRA 2G3VA 1PD0A 5FCLA 4XEVA 1YARO 3GEIA 4MVMA 3IQ5A 3EHMA 1QQ3A 4EBBA 3MBGA 3VRCA 4FX5A 4D4XA 1MMAA 2NUTB 2VCBA 2PX3A 2Y3GA 4JEAA 2AVKA 3TOMA 1ORYA 1N1CA 2H7BA 3PHF2 1Z7Qc 2NSFA 3L34A 1WASA 3A11A 1T6IA 4P6IC 3DI5A 4G0HA 4UDVA 2CNWD 4LLCA 2LFFA 2Q9CA 1D1CA 3DE9A 1VMAA 4KI2A 1LKXA 1BBHA 2WZFA 4M63A 3WODF 2VB6A 5CI8A 2FFHA 1A7EA 1FTSA 3EGDA 1I5NA 3OWTA 1O3UA 4YL0A 4BJ5C 3IHUA 3U9MA 4GEHA 2UUIA 3EZHA 1LI7A 3ZTZA 2FAPB 2LD6A 5GPGB 1OXKA 1LM3B 1TWAA 1PV3A 1Z3IX 3LLKA 4XLNF 3RIPA 5JUAA 3GWLA 5KYWB 2PX0A 3DAFA 1LE4A 3ABKC 1H7IA 1HE1A 4K0DA 1C17M 2HJMA 2KJGA 3AOUA 2L6GA 3JYHA 4MVUA 4C3BA 1E86A 4G7OF 4K7BA 2R25A 3GWNA 3M4BA 2VASA 4OIQF 2HS5A 3DJUB 3EG9A 4MVOA 3W2WA 3HNJA 3K33A 1H6GA 1NU9C 2V26A 3QVYA 3I5QA 1OR3A 4LERA 1QZXA 4B6IA 1OW6A 1D0YA 3TJ5A 2GAQA 3LUTB 3SNHA 1FFHA 5AC4A 5KYYB 1V74B 2DYSC 2ZXOA 3ATPA 3DM9B 3RH3A 3IPMO 2A1DD 4DRHB 1Z6AA 5L3VA 1R4TA 4PJJA 4QI2A 2Q4FA 4MTFA 3S27A 2PFDA 3LJBA 1M2VB 4J7YA 4Z9HA 3ZSUA 1ORJA 2L6HA 2ZPAA 2DI3A 4CDAA 3T6BA 2XXAA 2YVKA 1CPRA 1Z5ZA 1TWHA 4F4BA 1OQCA 3KL4A 3QVZA 1ZW3A 4JZAA 3WG7C 1YYJA 3KKBA 5A6BA 3FAJA 1A0BA 1RJ9A 3DWWA 1BDJB 4IJJA 2XLHA 3QMKA 4NTAA 4U5GA 4JTAB 3JYYA 1L7CA 2R7SA 2XLOA 1A7DA 3NMKA 4C7OA 4YJWA 1WN0A 1XWJA 2HJ3A 3PCVA 4IARA 3POVA 4FWVA 3GM1A 1HE9A 2XS8A 3LNMB 1XZQA
chains in the Genus database with same CATH topology
5B3IA 2XLMA 3M15A 3NMJA 4CX9A 2YLIA 1NBBA 1MQVA 2J8WA 3ZWIA 3TOLA 4JKVA 5JSLA 3QW0A 2YKZA 1CGNA 4U9EA 3HNIA 3HNKA 4EIYA 4IB4A 2XL6A 5JRAA 2XLDA 1E84A 3IQ6A 2YLGA 5JS5A 4D4NA 1QPUA 5JVEA 2CCYA 4L6RA 2YL1A 1A7VA 2J9BA 3IQ5A 256BA 1QQ3A 4CJGA 1E83A 3VRCA 4D4XA 3NMIA 4JEAA 3TOMA 3ZQYA 5JT4A 3FOOA 3C63A 2YL7A 4WGYA 4ULVA 2XM4A 4IAQA 3DE9A 1BBHA 3QW1A 5AGFA 2XM0A 1RCPA 1E85A 3M4CA 4CIPA 5JP7A 3ZTZA 1CPQA 5JLIA 1LM3B 4NC3A 1GQAA 5JUAA 4N6HA 2BC5A 1JAFA 1E86A 1CGOA 3M4BA 3M79A 3ZTMA 4CDVA 4ER9A 1APCA 3HNJA 3ZQVA 3QVYA 4WGZA 1YZAA 2QLAA 2XLWA 2XL8A 1S05A 4JE9A 1YYXA 2XLVA 4CDYA 3C62A 2YLDA 4CJOA 3U8PA 4CDAA 4JEBA 3FOPA 1CPRA 2YL0A 3L1MA 1M6TA 3QVZA 1YYJA 4U9DA 3HNLA 2XLEA 2XLHA 2YL3A 1YZCA 3DE8A 1EKYA 4N4WA 2XLOA 3NMKA 4IARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  2XLM A;  3M15 A;  3NMJ A;  4CX9 A;  2YLI A;  1NBB A;  1MQV A;  2J8W A;  3ZWI A;  3TOL A;  4JKV A;  5JSL A;  3QW0 A;  2YKZ A;  1CGN A;  4U9E A;  3HNI A;  3HNK A;  4EIY A;  4IB4 A;  2XL6 A;  5JRA A;  2XLD A;  1E84 A;  3IQ6 A;  2YLG A;  5JS5 A;  4D4N A;  1QPU A;  5JVE A;  2CCY A;  4L6R A;  2YL1 A;  1A7V A;  2J9B A;  3IQ5 A;  256B A;  1QQ3 A;  4CJG A;  1E83 A;  3VRC A;  4D4X A;  3NMI A;  4JEA A;  3TOM A;  3ZQY A;  5JT4 A;  3FOO A;  3C63 A;  2YL7 A;  4WGY A;  4ULV A;  2XM4 A;  4IAQ A;  3DE9 A;  1BBH A;  3QW1 A;  5AGF A;  2XM0 A;  1RCP A;  1E85 A;  3M4C A;  4CIP A;  5JP7 A;  3ZTZ A;  1CPQ A;  5JLI A;  1LM3 B;  4NC3 A;  1GQA A;  5JUA A;  4N6H A;  2BC5 A;  1JAF A;  1E86 A;  1CGO A;  3M4B A;  3M79 A;  3ZTM A;  4CDV A;  4ER9 A;  1APC A;  3HNJ A;  3ZQV A;  3QVY A;  4WGZ A;  1YZA A;  2QLA A;  2XLW A;  2XL8 A;  1S05 A;  4JE9 A;  1YYX A;  2XLV A;  4CDY A;  3C62 A;  2YLD A;  4CJO A;  3U8P A;  4CDA A;  4JEB A;  3FOP A;  1CPR A;  2YL0 A;  3L1M A;  1M6T A;  3QVZ A;  1YYJ A;  4U9D A;  3HNL A;  2XLE A;  2XLH A;  2YL3 A;  1YZC A;  3DE8 A;  1EKY A;  4N4W A;  2XLO A;  3NMK A;  4IAR A; 
#chains in the Genus database with same CATH topology
 4JTC B;  4BJ6 A;  1Y6D A;  3B0U X;  1O87 A;  1JR8 A;  5BUO A;  2L7A A;  1Z63 A;  1VYK A;  4EKW A;  2ICW G;  2ZXR A;  5D91 A;  2X51 A;  1LS4 A;  1OW7 A;  3FMS A;  2C04 A;  3RQE A;  3SEO A;  2GA0 A;  3KYI A;  3O10 A;  4DJ9 A;  1VTM P;  4CBE A;  2P7V A;  3ZIB A;  3C8G A;  1V54 C;  4PJL A;  5KYN A;  1Z23 A;  2J8W A;  5IY5 C;  5KYY A;  2PNO A;  4XWJ A;  5T3W A;  5JSL A;  2R7W A;  4AE4 B;  1TWC A;  2ZXW C;  2YKZ A;  1AEP A;  4PFP A;  4LDQ A;  5B1A C;  5BQH A;  1RMV A;  4JJF A;  3CZ6 A;  5A6K A;  4DBR A;  3HNK A;  4K1O A;  3FDQ A;  5DVW A;  1FAP B;  2Q00 A;  2IXN A;  5BQG A;  4IB4 A;  4ONS A;  3SP1 A;  2WB7 A;  4W8P A;  3T9O A;  2HSB A;  3AJM A;  3SYN A;  3ZVR A;  3OA1 A;  4P9F A;  1RKE A;  1GM5 A;  5D92 A;  1E84 A;  1W2W A;  3Q7G A;  4LDK A;  4N06 A;  2YLG A;  3UGP A;  4G7H F;  2CGE A;  3U8V A;  2MHR A;  2HMQ A;  3EGX B;  4U5B E;  4BJ5 A;  3IEE A;  2ASR A;  3V5Y A;  2IBF A;  3KPH A;  2R05 A;  2YZS A;  1A7V A;  4PR9 A;  3MX3 A;  4YK5 A;  2L6F A;  3LS1 A;  4O6Y A;  2J9B A;  2KK1 A;  2KC3 A;  1Q0G A;  4FES A;  4YL3 A;  4XPY A;  256B A;  3KH2 A;  3GOR A;  1WAT A;  4PFO A;  5A69 A;  4ULW A;  5DS4 A;  1ZHT A;  4MQ9 F;  4JCZ A;  1C03 A;  1FFT C;  3LS0 A;  3EGD B;  4MVQ A;  3ZQY A;  1M56 C;  2J9V A;  5COF A;  5L0H A;  3K66 A;  1Y4C A;  2A0B A;  1LI5 A;  3ASO C;  4WGY A;  3S29 A;  4D4N A;  2R7U A;  3SXZ A;  4IAQ A;  4MTG A;  3ECS A;  2Q3T A;  1ZW2 A;  3HTK C;  1HW1 A;  2IOQ A;  5COG A;  5L0F A;  4IAO A;  2XM0 A;  4O79 A;  4I1O B;  3M4C A;  4MS2 A;  4GQH A;  3T6J A;  2M4E A;  3H2V A;  4ANJ A;  1TR2 A;  1MNE A;  2CDQ A;  2WVN A;  4FAP B;  5JP7 A;  3EG9 B;  1TFO B;  3JSE O;  3N2Z B;  1DOW A;  3JRM O;  3IQT A;  1CPQ A;  1NZE A;  3GEE A;  2J0X A;  4MTO A;  4CIH A;  1H9T A;  3X2Q C;  1GQA A;  3O39 A;  1YA9 A;  1ZHZ A;  2R03 A;  1G5Z A;  1UG7 A;  3WAQ A;  1JAF A;  1NLX A;  2NPU A;  3RQF A;  4JW1 A;  3QTH A;  3J06 A;  3WHN A;  4ZLD A;  1G4W R;  3L8J A;  1VB5 A;  4CDV A;  3BEH A;  3ZQV A;  4W8K A;  2JX0 A;  3ZC4 A;  3K7D A;  3EGX A;  2H7V C;  1YZA A;  2QLA A;  2OOC A;  5T3T A;  2XXA B;  4MW8 A;  4AL0 A;  2LCH A;  5DS6 A;  3B0P A;  2XLW A;  2XL8 A;  4IWB A;  1FNT c;  3B0V C;  4O6M A;  3S90 A;  3F47 A;  3W4Y A;  2EIN C;  4JE9 A;  3PMR A;  2KSF A;  1YYX A;  2XLV A;  1RJ9 B;  3B9Q A;  1ZVZ A;  3CSK A;  4E18 A;  1T5O A;  2E87 A;  2YWA A;  4JVS A;  3EFO A;  4CJO A;  1FR0 A;  1YAU O;  3B71 A;  5EK0 A;  4C7O B;  2A68 F;  3EPV A;  1QSP A;  5A6B D;  2J9U A;  3L1M A;  4BPM A;  4DBQ A;  1O5H A;  3U0C A;  4P9T A;  2YHS A;  5L0I A;  2IXM A;  4RDA A;  2XLE A;  5B1B C;  3UMI A;  4JTD B;  3LEV A;  2VC9 A;  3LEO A;  3C7J A;  3K1I A;  4MVS A;  3SXK A;  3DE8 A;  2BE5 F;  2P61 A;  1EKY A;  3L0I A;  2EPM X;  4WJ0 A;  2OKU A;  2G3K A;  3QZC A;  3C8G B;  2R7R A;  3K6B A;  3T4R A;  3AG3 C;  5B3I A;  3JRT A;  2W45 A;  2XLM A;  3M15 A;  2Q7R A;  3S9O A;  3U5S A;  1QVX A;  3W2V A;  4GYT A;  4R32 A;  2KYH A;  3RVY A;  1QLE C;  4LAC B;  4MW3 A;  4CSA A;  3C8G D;  4CS9 A;  1OCR C;  4CX9 A;  4DOZ A;  1NFN A;  3LES A;  1NBB A;  5DS5 A;  4I3M A;  1MQV A;  1NG1 A;  3A9C A;  1MMN A;  4NCQ A;  4OIN F;  1YLM A;  1T6U A;  4J30 B;  2IXP A;  2PF4 E;  4Z9I A;  2IM8 A;  4C3E A;  1CGN A;  1BR2 A;  1JPJ A;  1RKE B;  1IZM A;  1SR2 A;  1LS1 A;  4U9E A;  3ZDL A;  4AX2 A;  3N24 A;  3T6G B;  4AK9 A;  4XEK A;  3PDM P;  3DAG A;  1EQ1 A;  4EBK A;  4EIY A;  1OCC C;  2QY9 A;  2HV6 A;  2XL6 A;  2YRF A;  1J8Y F;  4KBL A;  4JRZ A;  1OXB A;  2LK4 A;  5JRA A;  2OEX A;  2WVQ A;  2YQY A;  1TFK B;  5COM A;  1VLS A;  3K1H A;  1ZZP A;  2XLD A;  3NRH A;  5A6J A;  3IQ6 A;  1FMV A;  3DMD A;  4KC9 A;  2JD3 A;  3G4Z A;  2OQM A;  3LNR A;  4JJG A;  3JTL O;  4CS8 A;  5JVE A;  4U5H A;  4L6R A;  1B68 A;  4U5D E;  1OKK A;  2Y39 A;  3K1I C;  3TQO A;  1JOG A;  2OU6 A;  3DXJ F;  1D0Z A;  1QKR A;  1A41 A;  1EI7 A;  2XL4 A;  3UMH A;  1G4U S;  1E83 A;  1JRA A;  3NMI A;  2L81 A;  1MMD A;  1IW7 F;  5KYU A;  3FOO A;  3X1O A;  5A6A A;  3H65 A;  2W4M A;  2YL7 A;  5HSW A;  1ZHX A;  2MYS A;  3MLG A;  2XM4 A;  2Y69 C;  2W4B A;  1MND A;  3RW0 A;  1OR2 A;  1T9K A;  2NUP A;  2J45 A;  2OG2 A;  1MMG A;  2OEV A;  4CS9 C;  1E85 A;  4CSA C;  4XLP F;  3S0X A;  2Z15 A;  3DD7 A;  3JSZ A;  2UUH A;  1BR1 A;  4MVZ A;  2HSQ A;  5CI9 A;  4BJT A;  2W9Y A;  3NKD A;  2M64 A;  2BC5 A;  4DXW A;  4ZLC A;  1HMO A;  3TK0 A;  4MND A;  4O7G A;  2B0H A;  1AUE A;  3ZTM A;  1E2X A;  5K0I A;  1APC A;  3E9V A;  1S7Z A;  2D4U A;  3EFO B;  2CYD A;  1I4Y A;  4OIO F;  4PAC A;  2P0N A;  2R9R B;  4HFK B;  3N0T A;  2A69 F;  2H7O A;  2NG1 A;  4OIR F;  4KNV A;  4BJ1 A;  1T01 A;  3U3F A;  1ZU4 A;  4DRI B;  4DVY P;  3H2U A;  1ORS C;  2HV7 A;  3GAN A;  2FGY A;  5L3Q A;  3FHD A;  5E33 A;  1HW2 A;  3Q7L A;  3AGT A;  2YLD A;  4CS8 C;  2R7T A;  2H8A A;  3U8P A;  5KYX A;  4IRU A;  1YA7 O;  4JEB A;  2LFD A;  3RFY A;  5BQI A;  4EBJ A;  1Q0F A;  2XSE A;  3G4X A;  3LAY A;  3US6 A;  1K04 A;  1SYQ A;  4MVR A;  1ZHY A;  2NSG A;  4IGG A;  4XEF A;  4YT5 A;  5L0D A;  2V3C C;  2XRH A;  2Y3D A;  3GOD A;  2YL3 A;  3R2P A;  1YZC A;  4A2N B;  3TD7 A;  4EHP A;  1KTM A;  3W8I A;  4E0H A;  4N4W A;  2WVO A;  2AWY A;  4KNW A;  3Q6M A;  4HFF B;  5E3C A;  1RKC A;  3SXY A;  4Q5S F;  2P1A A;  2Y3B A;  2JPU A;  4QI0 A;  5TJ5 E;  2HMZ A;  3HKK A;  3AG1 C;  4YN0 B;  4I1M A;  3TJ6 A;  4DVZ A;  3NMJ A;  2R02 A;  3HLZ A;  4YT2 A;  3NYJ A;  1WGW A;  2OJQ A;  1ZHW A;  3CQZ A;  4U5F E;  1ZU5 A;  4HEA J;  1D0X A;  3JT1 A;  1BZ4 A;  2G62 A;  1VYI A;  2HUJ A;  2EIK C;  3ZWI A;  3TOL A;  2HZ8 A;  4JKV A;  5FZT A;  3QW0 A;  2HFI A;  1R5I D;  1BR4 A;  3ASN C;  3O6X A;  3EZI A;  1H9G A;  1FMW A;  1YVI A;  2VCC A;  4NY3 A;  1C02 A;  2EPN A;  2GFH A;  4H4K C;  3FAP B;  4BEJ A;  2OCC C;  2YEV A;  3NYM A;  3RF3 A;  3C18 A;  4JIO A;  1WTY A;  4E7S A;  3IQC A;  4RBN A;  2PP4 A;  1EA8 A;  2R7X A;  1D1A A;  3V5X A;  2J7P A;  5HV9 A;  3GEH A;  3I4U A;  4NTF A;  2J46 A;  5AC5 A;  1G8X A;  2I15 A;  2KQ9 A;  3U9J A;  1HMD A;  3BRJ A;  1YDI A;  4XPW A;  2QE9 A;  2CCY A;  1OKK D;  2AU5 A;  3R7C A;  5DQT A;  5KYU B;  2OJE D;  2QUP A;  2YL1 A;  2QNL A;  5EHH A;  1SMY F;  1V4A A;  1VOM A;  2A6H F;  1WOL A;  1I4Z A;  1DOV A;  5DQZ A;  4CJG A;  3RYL A;  2NUP B;  2O9X A;  2EIJ C;  3VM6 A;  4DRJ B;  4N6C A;  4QDL A;  2R7O A;  3UMK A;  4YT4 A;  3NDB B;  3VAY A;  5JT4 A;  3F46 A;  5T1D B;  3C63 A;  1HY5 A;  1U6H A;  1ZYR F;  3ITF A;  2LQG A;  2EPO A;  2R7V A;  3VF0 A;  2ETS A;  4EUK B;  1PD1 A;  4ULV A;  5E2Q A;  3SXM A;  3V5Z A;  4E17 A;  1F1M A;  2CNW A;  3QW1 A;  3L8I A;  5AGF A;  3W8H A;  1RCP A;  1NU7 D;  4J7T A;  2NUT A;  2DYR C;  5CIV A;  2WZG A;  4Q4Z F;  2EPL X;  2KW3 C;  4HE8 D;  4PJM A;  4CIP A;  3O55 A;  4JCH A;  3UR3 C;  2LP4 A;  3ZG1 A;  3Q6N A;  3S28 A;  1Q0D A;  5JLI A;  2RD9 A;  2KGO A;  3ABL C;  2R7Q A;  3AQC A;  1KU2 A;  1RXQ A;  3B29 A;  4NC3 A;  4NTB A;  3C8Z A;  1VK5 A;  4N6H A;  2Y3H A;  4NQF A;  1KNY A;  1GS9 A;  4PK4 A;  4BG0 A;  4OD5 A;  2CW0 F;  5EGY A;  3ABM C;  2VH3 A;  3AG2 C;  1CGO A;  1JPN A;  1TKN A;  2DB4 A;  2PBE A;  3MYI A;  3RQG A;  5B3S C;  3KMI A;  3M79 A;  4Z9J A;  2EIL C;  3U2M A;  4ER9 A;  4YL1 A;  3U3B A;  4YWQ A;  1SF8 A;  2HKV A;  2IYL D;  5E3A A;  1T6Q A;  4WGZ A;  5KYX B;  2X0C A;  1OCO C;  1LPE A;  5KYW A;  1Q0M A;  4Q7C A;  1SZI A;  3E70 C;  4PJN A;  5L0G A;  1U89 A;  1S05 A;  2BL2 A;  3CEX A;  2I8B A;  3FXH A;  4CDY A;  1LIH A;  4XQ1 A;  3CAX A;  3VYW A;  1K40 A;  1WWP A;  1XZP A;  1VLT A;  3C62 A;  1U0B B;  1Q0K A;  1OCZ C;  4H54 A;  3JZ0 A;  4LLE A;  1TWG A;  1J8M F;  4BEM J;  3AQB A;  3FOP A;  3EHN A;  2YL0 A;  1M6T A;  3TUL A;  1K05 A;  2GDC A;  3NKE A;  4OD4 A;  2L9J A;  2QTV A;  4U9D A;  3RVZ A;  4EWC A;  3HNL A;  2RSE B;  3AG4 C;  3GM3 A;  4JC7 A;  2J0W A;  4G7Z F;  3NG1 A;  2P6V A;  3EJN A;  3M1C B;  3I5P A;  1M2V A;  5DLJ A;  2D5R B;  4LDR A;  4RD9 A;  1CGM E;  1NFO A;  1LE2 A;  3KYJ A;  1TQG A;  2C03 A;  3DZA A;  1L3P A;  3FVY A;  1M2O A;  2AP3 A;  3AGU A;  3EH2 A;  3DKA A;  3U2L A;  3V7O A;  2F22 A;  3JCU Q;  4XPX A;  2WL8 A;  3EH1 A;  4YT8 A;  4O6N A;  3UGO A;  4AL1 A;  4J32 B;  2TMV P;  2WZL A;  4XTK A;  1AVO B;  2DGJ A;  2YLI A;  4I44 A;  4JUR I;  4A4A A;  3S84 A;  2ZXP A;  1LVK A;  3G50 A;  4WAB A;  2IXO A;  2LSE A;  1V55 C;  1NSG B;  2B0J A;  4C3D A;  3RKO F;  1M57 C;  2Q9A A;  1PCX A;  5L0C A;  2VCA A;  3EQL F;  5F5H A;  4U5C E;  1ST6 A;  3MYF A;  2LIG A;  4CS7 A;  2J9W A;  4U5E E;  2EIM C;  1YJG A;  3HNI A;  3UNG C;  2ZD9 A;  4BJ6 C;  1JMW A;  2A0U A;  4OIP F;  4G78 A;  4E7Z A;  2AWC A;  2XS1 A;  3GM2 A;  2J7P D;  3LLI A;  1GGQ A;  4AE4 A;  3DJN B;  3DM5 A;  3NYL A;  2EPK X;  1D1B A;  5F5F A;  5L0J A;  2GWW A;  2MWQ A;  4E0I A;  5JS5 A;  3HJC A;  1UFB A;  1OW8 A;  3OEO A;  4X0R A;  2KNH A;  3MFN A;  1QPU A;  5F28 E;  2Q9B A;  2A6E F;  3SZR A;  2G3V A;  1PD0 A;  5FCL A;  4XEV A;  1YAR O;  3GEI A;  4MVM A;  3IQ5 A;  3EHM A;  1QQ3 A;  4EBB A;  3MBG A;  3VRC A;  4FX5 A;  4D4X A;  1MMA A;  2NUT B;  2VCB A;  2PX3 A;  2Y3G A;  4JEA A;  2AVK A;  3TOM A;  1ORY A;  1N1C A;  2H7B A;  3PHF 2;  1Z7Q c;  2NSF A;  3L34 A;  1WAS A;  3A11 A;  1T6I A;  4P6I C;  3DI5 A;  4G0H A;  4UDV A;  2CNW D;  4LLC A;  2LFF A;  2Q9C A;  1D1C A;  3DE9 A;  1VMA A;  4KI2 A;  1LKX A;  1BBH A;  2WZF A;  4M63 A;  3WOD F;  2VB6 A;  5CI8 A;  2FFH A;  1A7E A;  1FTS A;  3EGD A;  1I5N A;  3OWT A;  1O3U A;  4YL0 A;  4BJ5 C;  3IHU A;  3U9M A;  4GEH A;  2UUI A;  3EZH A;  1LI7 A;  3ZTZ A;  2FAP B;  2LD6 A;  5GPG B;  1OXK A;  1LM3 B;  1TWA A;  1PV3 A;  1Z3I X;  3LLK A;  4XLN F;  3RIP A;  5JUA A;  3GWL A;  5KYW B;  2PX0 A;  3DAF A;  1LE4 A;  3ABK C;  1H7I A;  1HE1 A;  4K0D A;  1C17 M;  2HJM A;  2KJG A;  3AOU A;  2L6G A;  3JYH A;  4MVU A;  4C3B A;  1E86 A;  4G7O F;  4K7B A;  2R25 A;  3GWN A;  3M4B A;  2VAS A;  4OIQ F;  2HS5 A;  3DJU B;  3EG9 A;  4MVO A;  3W2W A;  3HNJ A;  3K33 A;  1H6G A;  1NU9 C;  2V26 A;  3QVY A;  3I5Q A;  1OR3 A;  4LER A;  1QZX A;  4B6I A;  1OW6 A;  1D0Y A;  3TJ5 A;  2GAQ A;  3LUT B;  3SNH A;  1FFH A;  5AC4 A;  5KYY B;  1V74 B;  2DYS C;  2ZXO A;  3ATP A;  3DM9 B;  3RH3 A;  3IPM O;  2A1D D;  4DRH B;  1Z6A A;  5L3V A;  1R4T A;  4PJJ A;  4QI2 A;  2Q4F A;  4MTF A;  3S27 A;  2PFD A;  3LJB A;  1M2V B;  4J7Y A;  4Z9H A;  3ZSU A;  1ORJ A;  2L6H A;  2ZPA A;  2DI3 A;  4CDA A;  3T6B A;  2XXA A;  2YVK A;  1CPR A;  1Z5Z A;  1TWH A;  4F4B A;  1OQC A;  3KL4 A;  3QVZ A;  1ZW3 A;  4JZA A;  3WG7 C;  1YYJ A;  3KKB A;  5A6B A;  3FAJ A;  1A0B A;  1RJ9 A;  3DWW A;  1BDJ B;  4IJJ A;  2XLH A;  3QMK A;  4NTA A;  4U5G A;  4JTA B;  3JYY A;  1L7C A;  2R7S A;  2XLO A;  1A7D A;  3NMK A;  4C7O A;  4YJW A;  1WN0 A;  1XWJ A;  2HJ3 A;  3PCV A;  4IAR A;  3POV A;  4FWV A;  3GM1 A;  1HE9 A;  2XS8 A;  3LNM B;  1XZQ A; 
#chains in the Genus database with same CATH homology
 5B3I A;  2XLM A;  3M15 A;  3NMJ A;  4CX9 A;  2YLI A;  1NBB A;  1MQV A;  2J8W A;  3ZWI A;  3TOL A;  4JKV A;  5JSL A;  3QW0 A;  2YKZ A;  1CGN A;  4U9E A;  3HNI A;  3HNK A;  4EIY A;  4IB4 A;  2XL6 A;  5JRA A;  2XLD A;  1E84 A;  3IQ6 A;  2YLG A;  5JS5 A;  4D4N A;  1QPU A;  5JVE A;  2CCY A;  4L6R A;  2YL1 A;  1A7V A;  2J9B A;  3IQ5 A;  256B A;  1QQ3 A;  4CJG A;  1E83 A;  3VRC A;  4D4X A;  3NMI A;  4JEA A;  3TOM A;  3ZQY A;  5JT4 A;  3FOO A;  3C63 A;  2YL7 A;  4WGY A;  4ULV A;  2XM4 A;  4IAQ A;  3DE9 A;  1BBH A;  3QW1 A;  5AGF A;  2XM0 A;  1RCP A;  1E85 A;  3M4C A;  4CIP A;  5JP7 A;  3ZTZ A;  1CPQ A;  5JLI A;  1LM3 B;  4NC3 A;  1GQA A;  5JUA A;  4N6H A;  2BC5 A;  1JAF A;  1E86 A;  1CGO A;  3M4B A;  3M79 A;  3ZTM A;  4CDV A;  4ER9 A;  1APC A;  3HNJ A;  3ZQV A;  3QVY A;  4WGZ A;  1YZA A;  2QLA A;  2XLW A;  2XL8 A;  1S05 A;  4JE9 A;  1YYX A;  2XLV A;  4CDY A;  3C62 A;  2YLD A;  4CJO A;  3U8P A;  4CDA A;  4JEB A;  3FOP A;  1CPR A;  2YL0 A;  3L1M A;  1M6T A;  3QVZ A;  1YYJ A;  4U9D A;  3HNL A;  2XLE A;  2XLH A;  2YL3 A;  1YZC A;  3DE8 A;  1EKY A;  4N4W A;  2XLO A;  3NMK A;  4IAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...