1YZCA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) with the n- and a part of the c-terminal helices unfolded
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTGRAGNQKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords edesigned apo-cytochrome b562
publication title A protein folding pathway with multiple folding intermediates at atomic resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yzcA01
4WGZA 5JT4A 3NMIA 1CPQA 5JRAA 3QVYA 2YLGA 4JEAA 2YL0A 2XLHA 3ZWIA 1E84A 3U8PA 5JSLA 3M4CA 3L1MA 3HNKA 3DE8A 1E86A 3ZQVA 5JLIA 1E85A 3M4BA 4D4XA 4CIPA 1A7VA 3C63A 1GQAA 2XLEA 3FOPA 1EKYA 1S05A 4IARA 4IAQA 3TOLA 3ZTMA 1CGNA 1MQVA 4NC3A 2BC5A 4N6HA 4U9DA 3HNLA 3HNIA 3DE9A 1LM3B 3NMKA 4CDVA 3M15A 4JKVA 3QVZA 4L6RA 3IQ5A 3FOOA 1JAFA 4ER9A 1RCPA 2YKZA 5AGFA 2YL7A 1YZCA 2CCYA 2XM4A 3QW1A 2J9BA 5B3IA 4CX9A 1YYJA 1M6TA 4U9EA 4CJOA 4ULVA 4N4WA 1NBBA 2XLWA 1QPUA 1CPRA 4D4NA 2YL3A 4CDAA 1CGOA 4JEBA 2XLDA 5JS5A 3QW0A 5JUAA 3HNJA 2YLDA 3TOMA 4WGYA 3NMJA 4IB4A 1YZAA 1QQ3A 1APCA 5JP7A 2XLMA 3ZQYA 1E83A 3C62A 4JE9A 1BBHA 2J8WA 4EIYA 3ZTZA 2XLOA 4CJGA 5JVEA 3IQ6A 3M79A 2XLVA 2YLIA 256BA 2QLAA 3VRCA 4CDYA 2XL6A 2XM0A 2XL8A 1YYXA 2YL1A
chains in the Genus database with same CATH superfamily
2YRFA 4GYTA 2YQYA 3MYIA 3NMIA 4K7BA 5T1DB 3U9MA 3RIPA 2QE9A 1EQ1A 4QI2A 1K40A 4JEAA 1FNTc 2WL8A 3U8PA 2DYSC 2MYSA 4WJ0A 2WZLA 5COGA 3SXKA 4DRIB 3HNKA 1Q0KA 3KL4A 3IEEA 4RDAA 4U5DE 2WVOA 1E86A 1E85A 2PBEA 3SNHA 4CIPA 3NG1A 3C63A 3S0XA 1T5OA 1VYIA 3KKBA 2J0WA 3ITFA 3TOLA 3EFOB 3EHMA 1CGNA 2EPOA 2IM8A 2LSEA 1M2VA 1ZHZA 2FGYA 2Y39A 1Z5ZA 4IGGA 4NC3A 1C02A 5DQTA 4ZLDA 3LEVA 3DI5A 1WWPA 3J06A 2KW3C 4K0DA 4U9DA 2IXPA 3ZC4A 1QKRA 3HNLA 3HNIA 2Q7RA 4EBBA 1K05A 3N2ZB 3KPHA 4CIHA 1ZHYA 1NG1A 3M15A 2LD6A 2H7OA 3R2PA 4G78A 4JKVA 4G7ZF 5KYWB 3UGOA 3IQ5A 1Y4CA 4JTDB 3W4YA 2OJQA 5A69A 3WAQA 3FOOA 3DJNB 5F28E 5B3SC 5KYXA 1JAFA 4KBLA 4UDVA 1W2WA 3S90A 2R25A 3EG9A 3O55A 1QZXA 3JCUQ 1I4YA 1FAPB 1R4TA 2WB7A 4N06A 1LE4A 4CS8A 1TR2A 2LCHA 1LPEA 2XM4A 4JJGA 1OR3A 4MVZA 4LLCA 4DBRA 1H9GA 4I44A 2ZPAA 4AE4B 4BJTA 2OQMA 4C7OB 2J9BA 2KQ9A 1JMWA 3JZ0A 4P9FA 3U3FA 1YYJA 3SYNA 5CIVA 1FR0A 4HE8D 1RKEB 4DRJB 1WGWA 3LNMB 1J8YF 4EBKA 1IW7F 2R03A 4ULVA 5A6AA 1HMDA 2BL2A 2IXOA 3KH2A 2J46A 4MW8A 3L34A 3KYJA 2QY9A 4P6IC 5L0GA 2R7TA 1QPUA 1L3PA 1B68A 1OW8A 1OCOC 2GFHA 5COMA 2MHRA 4FWVA 4MVRA 1CGOA 5HSWA 1IZMA 1NFOA 2IBFA 4JCHA 2L81A 1M57C 3RQEA 3QW0A 1ZW3A 1HW1A 1BR2A 2HSBA 2J9UA 1O5HA 2YEVA 4JZAA 2LFFA 3CZ6A 3LESA 3MFNA 3FAJA 1BR4A 1NLXA 4OIOF 4PFOA 5F5FA 3SZRA 2IXNA 2KJGA 3AQCA 2HV7A 4LDQA 1TWGA 2YVKA 1U0BB 2C03A 3EGDA 3FDQA 2XS1A 4BJ6C 4OIRF 1ORSC 2W4BA 5L0JA 4EKWA 1APCA 3T6JA 4G7OF 5L0DA 3ZQYA 1ZU4A 2JPUA 5GPGB 1A41A 3C62A 1MMGA 2I15A 1V74B 1ORYA 3ASOC 3LAYA 4MTGA 1GM5A 1WATA 2Q9CA 3ZTZA 1HE1A 5TJ5E 2P61A 4FESA 3V7OA 4B6IA 2WZGA 2AWYA 3DAGA 3KYIA 3I5QA 1Q0MA 2IXMA 1YLMA 1T6IA 1H7IA 4I3MA 2DYRC 2R7OA 2XM0A 2J7PD 2XXAB 3OEOA 2PFDA 5DS4A 1YYXA 2PP4A 2ZXRA 1NZEA 5KYNA 1U89A 1I4ZA 3AG4C 5E33A 5BQGA 3TQOA 1QLEC 3U2LA 2YL1A 3JT1A 4J30B 4WABA 4C3BA 5HV9A 2V3CC 5JT4A 3Q7GA 4CS9C 4QDLA 3GWLA 1UG7A 1LI5A 3EH2A 4XPYA 1YAUO 1SR2A 2L6GA 3POVA 1VOMA 2CNWD 4YL0A 3EPVA 4XEKA 1WN0A 1HY5A 4OD4A 5JSLA 2VC9A 2P0NA 2GAQA 3GM3A 4O6MA 2R9RB 1YDIA 3CSKA 4MTFA 2IOQA 4DXWA 5L3QA 1D1AA 2HFIA 2Y3DA 5DS6A 3RQFA 3JRMO 3M4BA 4YL3A 1N1CA 1RKCA 2W4MA 3U8VA 3VF0A 2XLEA 2VCAA 3FOPA 3C8GA 1SMYF 1YJGA 2EILC 4CS7A 1S05A 4IARA 1TWHA 3RF3A 5BUOA 2PF4E 3EZHA 1MQVA 3LEOA 5E3AA 4BEMJ 1G5ZA 2A68F 3AOUA 2BC5A 4N6HA 3QMKA 4BJ5A 5AC5A 1Q0DA 1U6HA 2GDCA 3UGPA 1ZHWA 2R02A 2W45A 4A4AA 5FCLA 5KYUB 4MQ9F 3TULA 4MVQA 3CQZA 2G3KA 3L0IA 3NMKA 3F47A 4DVZA 3LLKA 3HKKA 4L6RA 5DQZA 3UMKA 4JTCB 3SXZA 3R7CA 3DXJF 3PMRA 3IPMO 2YKZA 2ETSA 2X0CA 1OXBA 2A6EF 3NKDA 1JPJA 1NU7D 3H65A 1JRAA 2WVNA 3Q6MA 1YZCA 2OEXA 4JTAB 5K0IA 1H9TA 5EK0A 1E2XA 1TWAA 3VYWA 1G8XA 2ASRA 4G7HF 4RD9A 1KU2A 2C04A 3TJ5A 2YZSA 1Z6AA 2RSEB 4IAOA 2HJMA 3FAPB 4U5CE 5B1AC 2KNHA 5A6BD 2J0XA 3ZSUA 1FMVA 4E0HA 2R7QA 2MWQA 5BQHA 1M2VB 3B29A 4I1MA 3TJ6A 1OCCC 2DGJA 4N4WA 3K1IA 4JRZA 4U5HA 3T4RA 5JLIA 4XLNF 1O3UA 4O6NA 2A69F 4Z9IA 5F5HA 1MMDA 4D4NA 2YL3A 4O79A 3SP1A 1T6QA 4PACA 4CDAA 4JEBA 4AL1A 2QTVA 3DD7A 1OR2A 4JJFA 1ST6A 4YT2A 3EH1A 5KYXB 4H4KC 1K04A 2LK4A 3GM2A 5JUAA 1AUEA 4Q5SF 1A7EA 3EG9B 1KNYA 5T3WA 3LS1A 4E18A 3G4ZA 1VMAA 3TK0A 4EUKB 5EHHA 2R7WA 3K66A 3US6A 3OA1A 3UMIA 2HS5A 2PX0A 4BEJA 3JSZA 2UUHA 3TOMA 1LE2A 1VLTA 2D4UA 2D5RB 1JOGA 3NKEA 1PV3A 4WGYA 3U0CA 3G4XA 4W8KA 2M4EA 4F4BA 1D1BA 1WTYA 2HV6A 2FAPB 5D92A 4JE9A 3X1OA 2J9WA 4CSAC 2ZXWC 1BBHA 2ZXPA 4JURI 1PCXA 1M56C 3GODA 4PFPA 2XXAA 4KNVA 2XLOA 4CJGA 3DM9B 1ZVZA 4XEVA 3U5SA 4YN0B 3RKOF 5DS5A 2RD9A 4GEHA 3M79A 4ONSA 1G4WR 4KI2A 2OEVA 4PJNA 1D1CA 2ZXOA 3LS0A 4YT5A 2XL6A 3K1HA 3GWNA 3ECSA 5KYYA 2LP4A 3I5PA 2XL4A 1M2OA 1ZZPA 1Q0GA 3K33A 3O10A 1D0YA 2CDQA 1NU9C 3EGDB 5IY5C 3V5XA 4WGZA 1LS1A 3A11A 1ORJA 5E2QA 2NUTA 3A9CA 4U5EE 2F22A 3QVYA 5JRAA 1YARO 2H8AA 2NSGA 2YLGA 2YL0A 2FFHA 3N0TA 5B1BC 3ZWIA 4XWJA 4EHPA 5L0IA 4YL1A 2AVKA 2J9VA 4MNDA 1E84A 4OIPF 2HKVA 2EINC 4XQ1A 2Q9AA 3JYHA 3M4CA 3ASNC 1BDJB 2W9YA 3EHNA 3EGXA 3FXHA 3L1MA 1YVIA 4IWBA 1NFNA 4C3DA 3ZQVA 3DZAA 2OG2A 4U5GA 4XEFA 4BPMA 4HFKB 1A7VA 1GQAA 2Y3BA 3GEIA 3C7JA 4EBJA 4FAPB 1EKYA 1FFHA 4MVOA 3EQLF 4IAQA 3ABKC 4LDRA 4O6YA 5T3TA 3S84A 2B0JA 2H7BA 1JPNA 2WVQA 3QZCA 3B0PA 3AGTA 5DVWA 1LI7A 4AL0A 1V55C 4Z9JA 2J7PA 1FFTC 1VYKA 5A6JA 1LM3B 2Y3GA 1RXQA 1Y6DA 2R7RA 1PD1A 2PNOA 2E87A 3JSEO 4ZLCA 1DOVA 2M64A 3IQCA 4BJ5C 3JRTA 4J32B 2YWAA 1GS9A 1RCPA 3S9OA 1T6UA 2Q4FA 4JIOA 2YL7A 3LUTB 2HSQA 3B71A 2CNWA 2HMZA 2VB6A 3NYLA 2CCYA 4LACB 3LNRA 3K6BA 2EPNA 4I1OB 1CGME 3DM5A 4MVMA 1YA7O 4ANJA 3C8ZA 1A0BA 1OKKD 1HMOA 3ABMC 3C8GB 3MX3A 2YHSA 4NTBA 4JVSA 1HW2A 2BE5F 3AG3C 3FVYA 5B3IA 1VLSA 1WASA 2EPKX 3AG2C 3FHDA 4A2NB 4CX9A 3NRHA 4E0IA 1L7CA 1RJ9A 4NY3A 1J8MF 3H2UA 4U9EA 5L0CA 2OCCC 2ICWG 4CJOA 2PX3A 2KGOA 3JYYA 4MTOA 1NBBA 2XLWA 4G0HA 1FMWA 3I4UA 3C8GD 1OCZC 2NUPA 3SXMA 5BQIA 3GM1A 1SZIA 2KSFA 3B9QA 1VK5A 1ZYRF 2XLDA 4Z9HA 3GORA 3TD7A 1SYQA 2WZFA 5JS5A 3PHF2 3GEHA 3N24A 1EA8A 1LVKA 1XZQA 2I8BA 4N6CA 4CS9A 1QVXA 4Q7CA 4OINF 3HNJA 2NG1A 2KK1A 2ZD9A 3UMHA 3ZG1A 3AQBA 3MYFA 1Z3IX 2UUIA 3T6GB 2YLDA 3C18A 3F46A 2GWWA 2AP3A 2KYHA 4FX5A 1OQCA 4IB4A 4P9TA 1YZAA 2CGEA 4JC7A 4AX2A 1BR1A 2O9XA 3V5ZA 3DAFA 5JP7A 4MS2A 4CS8C 4DOZA 4E7SA 4DVYP 1E83A 2A6HF 2EPMX 1V4AA 2R7VA 1I5NA 1PD0A 1C03A 1FTSA 2J8WA 4LERA 1ZW2A 5A6BA 5EGYA 3CAXA 1G4US 4LDKA 1C17M 1WOLA 1TQGA 3H2VA 4AK9A 4E17A 2Q00A 2A1DD 5COFA 4XTKA 3IQ6A 5CI9A 2YLIA 2OJED 1Z63A 2HJ3A 256BA 2EPLX 4H54A 3RYLA 4YWQA 4BG0A 3O39A 3EFOA 1T01A 3E9VA 1S7ZA 1XWJA 4W8PA 1QSPA 2L6FA 3U9JA 3V5YA 3DJUB 3W2VA 3EZIA 2JD3A 2NSFA 3MBGA 3ZIBA 1ZHTA 1D0XA 1CPQA 3OWTA 2VCBA 5KYWA 2XLHA 4QI0A 1D0ZA 1YA9A 4NTFA 4PJJA 1ZHXA 1LKXA 5D91A 3BEHA 3L8JA 4DRHB 3PDMP 5AC4A 1OXKA 3UR3C 3UNGC 3RH3A 4U5BE 1MNDA 3DE8A 4EWCA 4NCQA 5L0FA 1UFBA 3CEXA 1R5ID 1DOWA 1AEPA 1Z23A 2EIKC 4PJLA 4GQHA 3RVYA 2J45A 3M1CB 4XLPF 4D4XA 4YT8A 3FMSA 2R7UA 2R7SA 2XSEA 3RW0A 1RMVA 1TWCA 4AE4A 2LIGA 4C7OA 1AVOB 2G3VA 3ZTMA 3U3BA 4IRUA 4JCZA 1JR8A 2EIMC 1RKEA 2X51A 3AG1C 3WODF 5KYYB 3DMDA 2L7AA 1H6GA 2VH3A 2JX0A 4J7YA 2P6VA 3DE9A 4LLEA 2QNLA 3S27A 2NUTB 4R32A 4CDVA 2H7VC 2HMQA 2Q3TA 4HEAJ 1TKNA 3ZVRA 2Z15A 3QVZA 3B0UX 2XS8A 4PK4A 4YJWA 5CI8A 3WG7C 1MMAA 4ER9A 5AGFA 3HJCA 3EGXB 1LS4A 4PR9A 3LLIA 3T6BA 3EJNA 3VM6A 3W8IA 4X0RA 1T9KA 5L0HA 1OW6A 2DB4A 3JTLO 1BZ4A 1SF8A 3DWWA 3RQGA 3HLZA 1XZPA 3W2WA 4CSAA 3NDBB 3U2MA 2TMVP 2VASA 2XRHA 3QW1A 4M63A 3X2QC 4U5FE 5DLJA 1OW7A 1TFKB 4KNWA 4JW1A 3W8HA 1M6TA 1LIHA 5L3VA 1Z7Qc 2OU6A 3DKAA 4DJ9A 4XPXA 2QUPA 4BJ1A 1Q0FA 2OOCA 1EI7A 1V54C 2DI3A 2Q9BA 2Y69C 3VAYA 2Y3HA 4J7TA 1CPRA 1NSGB 1VB5A 4E7ZA 3ATPA 3ABLC 1OCRC 3Q7LA 4RBNA 1A7DA 3AGUA 1MMNA 4YT4A 2V26A 1MNEA 4BJ6A 1VTMP 2KC3A 2R7XA 4O7GA 4OD5A 3K7DA 4XPWA 3GEEA 2HZ8A 1ZU5A 2L9JA 3LJBA 2NPUA 4MVUA 5A6KA 2AU5A 3NYJA 1TFOB 1KTMA 3NMJA 4MW3A 4CBEA 2B0HA 4YK5A 4NQFA 4MVSA 2AWCA 2OKUA 3S28A 1QQ3A 3MLGA 3T9OA 3L8IA 1OKKA 2XLMA 1RJ9B 2CW0F 3AJMA 3HTKC 4HFFB 2A0UA 3E70C 2IYLD 3BRJA 4PJMA 4IJJA 2VCCA 3S29A 3KMIA 5FZTA 3QTHA 4EIYA 4KC9A 1F1MA 3ZDLA 2R05A 5JVEA 1O87A 2NUPB 2LFDA 3Q6NA 2L6HA 2LQGA 2P1AA 2CYDA 2XLVA 1GGQA 2HUJA 2EIJC 3GANA 4NTAA 2QLAA 3K1IC 3VRCA 4CDYA 2XL8A 1HE9A 3IQTA 2G62A 3RVZA 3RFYA 3WHNA 3PCVA 3IHUA 3NYMA 5E3CA 4Q4ZF 2P7VA 3G50A 4K1OA 3SEOA 4DBQA 2A0BA 4C3EA 3O6XA 4ULWA 3B0VC 2GA0A 5KYUA 3SXYA 4OIQF
chains in the Genus database with same CATH topology
4WGZA 5JT4A 3NMIA 1CPQA 5JRAA 3QVYA 2YLGA 4JEAA 2YL0A 2XLHA 3ZWIA 1E84A 3U8PA 5JSLA 3M4CA 3L1MA 3HNKA 3DE8A 1E86A 3ZQVA 5JLIA 1E85A 3M4BA 4D4XA 4CIPA 1A7VA 3C63A 1GQAA 2XLEA 3FOPA 1EKYA 1S05A 4IARA 4IAQA 3TOLA 3ZTMA 1CGNA 1MQVA 4NC3A 2BC5A 4N6HA 4U9DA 3HNLA 3HNIA 3DE9A 1LM3B 3NMKA 4CDVA 3M15A 4JKVA 3QVZA 4L6RA 3IQ5A 3FOOA 1JAFA 4ER9A 1RCPA 2YKZA 5AGFA 2YL7A 1YZCA 2CCYA 2XM4A 3QW1A 2J9BA 5B3IA 4CX9A 1YYJA 1M6TA 4U9EA 4CJOA 4ULVA 4N4WA 1NBBA 2XLWA 1QPUA 1CPRA 4D4NA 2YL3A 4CDAA 1CGOA 4JEBA 2XLDA 5JS5A 3QW0A 5JUAA 3HNJA 2YLDA 3TOMA 4WGYA 3NMJA 4IB4A 1YZAA 1QQ3A 1APCA 5JP7A 2XLMA 3ZQYA 1E83A 3C62A 4JE9A 1BBHA 2J8WA 4EIYA 3ZTZA 2XLOA 4CJGA 5JVEA 3IQ6A 3M79A 2XLVA 2YLIA 256BA 2QLAA 3VRCA 4CDYA 2XL6A 2XM0A 2XL8A 1YYXA 2YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGZ A;  5JT4 A;  3NMI A;  1CPQ A;  5JRA A;  3QVY A;  2YLG A;  4JEA A;  2YL0 A;  2XLH A;  3ZWI A;  1E84 A;  3U8P A;  5JSL A;  3M4C A;  3L1M A;  3HNK A;  3DE8 A;  1E86 A;  3ZQV A;  5JLI A;  1E85 A;  3M4B A;  4D4X A;  4CIP A;  1A7V A;  3C63 A;  1GQA A;  2XLE A;  3FOP A;  1EKY A;  1S05 A;  4IAR A;  4IAQ A;  3TOL A;  3ZTM A;  1CGN A;  1MQV A;  4NC3 A;  2BC5 A;  4N6H A;  4U9D A;  3HNL A;  3HNI A;  3DE9 A;  1LM3 B;  3NMK A;  4CDV A;  3M15 A;  4JKV A;  3QVZ A;  4L6R A;  3IQ5 A;  3FOO A;  1JAF A;  4ER9 A;  1RCP A;  2YKZ A;  5AGF A;  2YL7 A;  1YZC A;  2CCY A;  2XM4 A;  3QW1 A;  2J9B A;  5B3I A;  4CX9 A;  1YYJ A;  1M6T A;  4U9E A;  4CJO A;  4ULV A;  4N4W A;  1NBB A;  2XLW A;  1QPU A;  1CPR A;  4D4N A;  2YL3 A;  4CDA A;  1CGO A;  4JEB A;  2XLD A;  5JS5 A;  3QW0 A;  5JUA A;  3HNJ A;  2YLD A;  3TOM A;  4WGY A;  3NMJ A;  4IB4 A;  1YZA A;  1QQ3 A;  1APC A;  5JP7 A;  2XLM A;  3ZQY A;  1E83 A;  3C62 A;  4JE9 A;  1BBH A;  2J8W A;  4EIY A;  3ZTZ A;  2XLO A;  4CJG A;  5JVE A;  3IQ6 A;  3M79 A;  2XLV A;  2YLI A;  256B A;  2QLA A;  3VRC A;  4CDY A;  2XL6 A;  2XM0 A;  2XL8 A;  1YYX A;  2YL1 A; 
#chains in the Genus database with same CATH topology
 2YRF A;  4GYT A;  2YQY A;  3MYI A;  3NMI A;  4K7B A;  5T1D B;  3U9M A;  3RIP A;  2QE9 A;  1EQ1 A;  4QI2 A;  1K40 A;  4JEA A;  1FNT c;  2WL8 A;  3U8P A;  2DYS C;  2MYS A;  4WJ0 A;  2WZL A;  5COG A;  3SXK A;  4DRI B;  3HNK A;  1Q0K A;  3KL4 A;  3IEE A;  4RDA A;  4U5D E;  2WVO A;  1E86 A;  1E85 A;  2PBE A;  3SNH A;  4CIP A;  3NG1 A;  3C63 A;  3S0X A;  1T5O A;  1VYI A;  3KKB A;  2J0W A;  3ITF A;  3TOL A;  3EFO B;  3EHM A;  1CGN A;  2EPO A;  2IM8 A;  2LSE A;  1M2V A;  1ZHZ A;  2FGY A;  2Y39 A;  1Z5Z A;  4IGG A;  4NC3 A;  1C02 A;  5DQT A;  4ZLD A;  3LEV A;  3DI5 A;  1WWP A;  3J06 A;  2KW3 C;  4K0D A;  4U9D A;  2IXP A;  3ZC4 A;  1QKR A;  3HNL A;  3HNI A;  2Q7R A;  4EBB A;  1K05 A;  3N2Z B;  3KPH A;  4CIH A;  1ZHY A;  1NG1 A;  3M15 A;  2LD6 A;  2H7O A;  3R2P A;  4G78 A;  4JKV A;  4G7Z F;  5KYW B;  3UGO A;  3IQ5 A;  1Y4C A;  4JTD B;  3W4Y A;  2OJQ A;  5A69 A;  3WAQ A;  3FOO A;  3DJN B;  5F28 E;  5B3S C;  5KYX A;  1JAF A;  4KBL A;  4UDV A;  1W2W A;  3S90 A;  2R25 A;  3EG9 A;  3O55 A;  1QZX A;  3JCU Q;  1I4Y A;  1FAP B;  1R4T A;  2WB7 A;  4N06 A;  1LE4 A;  4CS8 A;  1TR2 A;  2LCH A;  1LPE A;  2XM4 A;  4JJG A;  1OR3 A;  4MVZ A;  4LLC A;  4DBR A;  1H9G A;  4I44 A;  2ZPA A;  4AE4 B;  4BJT A;  2OQM A;  4C7O B;  2J9B A;  2KQ9 A;  1JMW A;  3JZ0 A;  4P9F A;  3U3F A;  1YYJ A;  3SYN A;  5CIV A;  1FR0 A;  4HE8 D;  1RKE B;  4DRJ B;  1WGW A;  3LNM B;  1J8Y F;  4EBK A;  1IW7 F;  2R03 A;  4ULV A;  5A6A A;  1HMD A;  2BL2 A;  2IXO A;  3KH2 A;  2J46 A;  4MW8 A;  3L34 A;  3KYJ A;  2QY9 A;  4P6I C;  5L0G A;  2R7T A;  1QPU A;  1L3P A;  1B68 A;  1OW8 A;  1OCO C;  2GFH A;  5COM A;  2MHR A;  4FWV A;  4MVR A;  1CGO A;  5HSW A;  1IZM A;  1NFO A;  2IBF A;  4JCH A;  2L81 A;  1M57 C;  3RQE A;  3QW0 A;  1ZW3 A;  1HW1 A;  1BR2 A;  2HSB A;  2J9U A;  1O5H A;  2YEV A;  4JZA A;  2LFF A;  3CZ6 A;  3LES A;  3MFN A;  3FAJ A;  1BR4 A;  1NLX A;  4OIO F;  4PFO A;  5F5F A;  3SZR A;  2IXN A;  2KJG A;  3AQC A;  2HV7 A;  4LDQ A;  1TWG A;  2YVK A;  1U0B B;  2C03 A;  3EGD A;  3FDQ A;  2XS1 A;  4BJ6 C;  4OIR F;  1ORS C;  2W4B A;  5L0J A;  4EKW A;  1APC A;  3T6J A;  4G7O F;  5L0D A;  3ZQY A;  1ZU4 A;  2JPU A;  5GPG B;  1A41 A;  3C62 A;  1MMG A;  2I15 A;  1V74 B;  1ORY A;  3ASO C;  3LAY A;  4MTG A;  1GM5 A;  1WAT A;  2Q9C A;  3ZTZ A;  1HE1 A;  5TJ5 E;  2P61 A;  4FES A;  3V7O A;  4B6I A;  2WZG A;  2AWY A;  3DAG A;  3KYI A;  3I5Q A;  1Q0M A;  2IXM A;  1YLM A;  1T6I A;  1H7I A;  4I3M A;  2DYR C;  2R7O A;  2XM0 A;  2J7P D;  2XXA B;  3OEO A;  2PFD A;  5DS4 A;  1YYX A;  2PP4 A;  2ZXR A;  1NZE A;  5KYN A;  1U89 A;  1I4Z A;  3AG4 C;  5E33 A;  5BQG A;  3TQO A;  1QLE C;  3U2L A;  2YL1 A;  3JT1 A;  4J30 B;  4WAB A;  4C3B A;  5HV9 A;  2V3C C;  5JT4 A;  3Q7G A;  4CS9 C;  4QDL A;  3GWL A;  1UG7 A;  1LI5 A;  3EH2 A;  4XPY A;  1YAU O;  1SR2 A;  2L6G A;  3POV A;  1VOM A;  2CNW D;  4YL0 A;  3EPV A;  4XEK A;  1WN0 A;  1HY5 A;  4OD4 A;  5JSL A;  2VC9 A;  2P0N A;  2GAQ A;  3GM3 A;  4O6M A;  2R9R B;  1YDI A;  3CSK A;  4MTF A;  2IOQ A;  4DXW A;  5L3Q A;  1D1A A;  2HFI A;  2Y3D A;  5DS6 A;  3RQF A;  3JRM O;  3M4B A;  4YL3 A;  1N1C A;  1RKC A;  2W4M A;  3U8V A;  3VF0 A;  2XLE A;  2VCA A;  3FOP A;  3C8G A;  1SMY F;  1YJG A;  2EIL C;  4CS7 A;  1S05 A;  4IAR A;  1TWH A;  3RF3 A;  5BUO A;  2PF4 E;  3EZH A;  1MQV A;  3LEO A;  5E3A A;  4BEM J;  1G5Z A;  2A68 F;  3AOU A;  2BC5 A;  4N6H A;  3QMK A;  4BJ5 A;  5AC5 A;  1Q0D A;  1U6H A;  2GDC A;  3UGP A;  1ZHW A;  2R02 A;  2W45 A;  4A4A A;  5FCL A;  5KYU B;  4MQ9 F;  3TUL A;  4MVQ A;  3CQZ A;  2G3K A;  3L0I A;  3NMK A;  3F47 A;  4DVZ A;  3LLK A;  3HKK A;  4L6R A;  5DQZ A;  3UMK A;  4JTC B;  3SXZ A;  3R7C A;  3DXJ F;  3PMR A;  3IPM O;  2YKZ A;  2ETS A;  2X0C A;  1OXB A;  2A6E F;  3NKD A;  1JPJ A;  1NU7 D;  3H65 A;  1JRA A;  2WVN A;  3Q6M A;  1YZC A;  2OEX A;  4JTA B;  5K0I A;  1H9T A;  5EK0 A;  1E2X A;  1TWA A;  3VYW A;  1G8X A;  2ASR A;  4G7H F;  4RD9 A;  1KU2 A;  2C04 A;  3TJ5 A;  2YZS A;  1Z6A A;  2RSE B;  4IAO A;  2HJM A;  3FAP B;  4U5C E;  5B1A C;  2KNH A;  5A6B D;  2J0X A;  3ZSU A;  1FMV A;  4E0H A;  2R7Q A;  2MWQ A;  5BQH A;  1M2V B;  3B29 A;  4I1M A;  3TJ6 A;  1OCC C;  2DGJ A;  4N4W A;  3K1I A;  4JRZ A;  4U5H A;  3T4R A;  5JLI A;  4XLN F;  1O3U A;  4O6N A;  2A69 F;  4Z9I A;  5F5H A;  1MMD A;  4D4N A;  2YL3 A;  4O79 A;  3SP1 A;  1T6Q A;  4PAC A;  4CDA A;  4JEB A;  4AL1 A;  2QTV A;  3DD7 A;  1OR2 A;  4JJF A;  1ST6 A;  4YT2 A;  3EH1 A;  5KYX B;  4H4K C;  1K04 A;  2LK4 A;  3GM2 A;  5JUA A;  1AUE A;  4Q5S F;  1A7E A;  3EG9 B;  1KNY A;  5T3W A;  3LS1 A;  4E18 A;  3G4Z A;  1VMA A;  3TK0 A;  4EUK B;  5EHH A;  2R7W A;  3K66 A;  3US6 A;  3OA1 A;  3UMI A;  2HS5 A;  2PX0 A;  4BEJ A;  3JSZ A;  2UUH A;  3TOM A;  1LE2 A;  1VLT A;  2D4U A;  2D5R B;  1JOG A;  3NKE A;  1PV3 A;  4WGY A;  3U0C A;  3G4X A;  4W8K A;  2M4E A;  4F4B A;  1D1B A;  1WTY A;  2HV6 A;  2FAP B;  5D92 A;  4JE9 A;  3X1O A;  2J9W A;  4CSA C;  2ZXW C;  1BBH A;  2ZXP A;  4JUR I;  1PCX A;  1M56 C;  3GOD A;  4PFP A;  2XXA A;  4KNV A;  2XLO A;  4CJG A;  3DM9 B;  1ZVZ A;  4XEV A;  3U5S A;  4YN0 B;  3RKO F;  5DS5 A;  2RD9 A;  4GEH A;  3M79 A;  4ONS A;  1G4W R;  4KI2 A;  2OEV A;  4PJN A;  1D1C A;  2ZXO A;  3LS0 A;  4YT5 A;  2XL6 A;  3K1H A;  3GWN A;  3ECS A;  5KYY A;  2LP4 A;  3I5P A;  2XL4 A;  1M2O A;  1ZZP A;  1Q0G A;  3K33 A;  3O10 A;  1D0Y A;  2CDQ A;  1NU9 C;  3EGD B;  5IY5 C;  3V5X A;  4WGZ A;  1LS1 A;  3A11 A;  1ORJ A;  5E2Q A;  2NUT A;  3A9C A;  4U5E E;  2F22 A;  3QVY A;  5JRA A;  1YAR O;  2H8A A;  2NSG A;  2YLG A;  2YL0 A;  2FFH A;  3N0T A;  5B1B C;  3ZWI A;  4XWJ A;  4EHP A;  5L0I A;  4YL1 A;  2AVK A;  2J9V A;  4MND A;  1E84 A;  4OIP F;  2HKV A;  2EIN C;  4XQ1 A;  2Q9A A;  3JYH A;  3M4C A;  3ASN C;  1BDJ B;  2W9Y A;  3EHN A;  3EGX A;  3FXH A;  3L1M A;  1YVI A;  4IWB A;  1NFN A;  4C3D A;  3ZQV A;  3DZA A;  2OG2 A;  4U5G A;  4XEF A;  4BPM A;  4HFK B;  1A7V A;  1GQA A;  2Y3B A;  3GEI A;  3C7J A;  4EBJ A;  4FAP B;  1EKY A;  1FFH A;  4MVO A;  3EQL F;  4IAQ A;  3ABK C;  4LDR A;  4O6Y A;  5T3T A;  3S84 A;  2B0J A;  2H7B A;  1JPN A;  2WVQ A;  3QZC A;  3B0P A;  3AGT A;  5DVW A;  1LI7 A;  4AL0 A;  1V55 C;  4Z9J A;  2J7P A;  1FFT C;  1VYK A;  5A6J A;  1LM3 B;  2Y3G A;  1RXQ A;  1Y6D A;  2R7R A;  1PD1 A;  2PNO A;  2E87 A;  3JSE O;  4ZLC A;  1DOV A;  2M64 A;  3IQC A;  4BJ5 C;  3JRT A;  4J32 B;  2YWA A;  1GS9 A;  1RCP A;  3S9O A;  1T6U A;  2Q4F A;  4JIO A;  2YL7 A;  3LUT B;  2HSQ A;  3B71 A;  2CNW A;  2HMZ A;  2VB6 A;  3NYL A;  2CCY A;  4LAC B;  3LNR A;  3K6B A;  2EPN A;  4I1O B;  1CGM E;  3DM5 A;  4MVM A;  1YA7 O;  4ANJ A;  3C8Z A;  1A0B A;  1OKK D;  1HMO A;  3ABM C;  3C8G B;  3MX3 A;  2YHS A;  4NTB A;  4JVS A;  1HW2 A;  2BE5 F;  3AG3 C;  3FVY A;  5B3I A;  1VLS A;  1WAS A;  2EPK X;  3AG2 C;  3FHD A;  4A2N B;  4CX9 A;  3NRH A;  4E0I A;  1L7C A;  1RJ9 A;  4NY3 A;  1J8M F;  3H2U A;  4U9E A;  5L0C A;  2OCC C;  2ICW G;  4CJO A;  2PX3 A;  2KGO A;  3JYY A;  4MTO A;  1NBB A;  2XLW A;  4G0H A;  1FMW A;  3I4U A;  3C8G D;  1OCZ C;  2NUP A;  3SXM A;  5BQI A;  3GM1 A;  1SZI A;  2KSF A;  3B9Q A;  1VK5 A;  1ZYR F;  2XLD A;  4Z9H A;  3GOR A;  3TD7 A;  1SYQ A;  2WZF A;  5JS5 A;  3PHF 2;  3GEH A;  3N24 A;  1EA8 A;  1LVK A;  1XZQ A;  2I8B A;  4N6C A;  4CS9 A;  1QVX A;  4Q7C A;  4OIN F;  3HNJ A;  2NG1 A;  2KK1 A;  2ZD9 A;  3UMH A;  3ZG1 A;  3AQB A;  3MYF A;  1Z3I X;  2UUI A;  3T6G B;  2YLD A;  3C18 A;  3F46 A;  2GWW A;  2AP3 A;  2KYH A;  4FX5 A;  1OQC A;  4IB4 A;  4P9T A;  1YZA A;  2CGE A;  4JC7 A;  4AX2 A;  1BR1 A;  2O9X A;  3V5Z A;  3DAF A;  5JP7 A;  4MS2 A;  4CS8 C;  4DOZ A;  4E7S A;  4DVY P;  1E83 A;  2A6H F;  2EPM X;  1V4A A;  2R7V A;  1I5N A;  1PD0 A;  1C03 A;  1FTS A;  2J8W A;  4LER A;  1ZW2 A;  5A6B A;  5EGY A;  3CAX A;  1G4U S;  4LDK A;  1C17 M;  1WOL A;  1TQG A;  3H2V A;  4AK9 A;  4E17 A;  2Q00 A;  2A1D D;  5COF A;  4XTK A;  3IQ6 A;  5CI9 A;  2YLI A;  2OJE D;  1Z63 A;  2HJ3 A;  256B A;  2EPL X;  4H54 A;  3RYL A;  4YWQ A;  4BG0 A;  3O39 A;  3EFO A;  1T01 A;  3E9V A;  1S7Z A;  1XWJ A;  4W8P A;  1QSP A;  2L6F A;  3U9J A;  3V5Y A;  3DJU B;  3W2V A;  3EZI A;  2JD3 A;  2NSF A;  3MBG A;  3ZIB A;  1ZHT A;  1D0X A;  1CPQ A;  3OWT A;  2VCB A;  5KYW A;  2XLH A;  4QI0 A;  1D0Z A;  1YA9 A;  4NTF A;  4PJJ A;  1ZHX A;  1LKX A;  5D91 A;  3BEH A;  3L8J A;  4DRH B;  3PDM P;  5AC4 A;  1OXK A;  3UR3 C;  3UNG C;  3RH3 A;  4U5B E;  1MND A;  3DE8 A;  4EWC A;  4NCQ A;  5L0F A;  1UFB A;  3CEX A;  1R5I D;  1DOW A;  1AEP A;  1Z23 A;  2EIK C;  4PJL A;  4GQH A;  3RVY A;  2J45 A;  3M1C B;  4XLP F;  4D4X A;  4YT8 A;  3FMS A;  2R7U A;  2R7S A;  2XSE A;  3RW0 A;  1RMV A;  1TWC A;  4AE4 A;  2LIG A;  4C7O A;  1AVO B;  2G3V A;  3ZTM A;  3U3B A;  4IRU A;  4JCZ A;  1JR8 A;  2EIM C;  1RKE A;  2X51 A;  3AG1 C;  3WOD F;  5KYY B;  3DMD A;  2L7A A;  1H6G A;  2VH3 A;  2JX0 A;  4J7Y A;  2P6V A;  3DE9 A;  4LLE A;  2QNL A;  3S27 A;  2NUT B;  4R32 A;  4CDV A;  2H7V C;  2HMQ A;  2Q3T A;  4HEA J;  1TKN A;  3ZVR A;  2Z15 A;  3QVZ A;  3B0U X;  2XS8 A;  4PK4 A;  4YJW A;  5CI8 A;  3WG7 C;  1MMA A;  4ER9 A;  5AGF A;  3HJC A;  3EGX B;  1LS4 A;  4PR9 A;  3LLI A;  3T6B A;  3EJN A;  3VM6 A;  3W8I A;  4X0R A;  1T9K A;  5L0H A;  1OW6 A;  2DB4 A;  3JTL O;  1BZ4 A;  1SF8 A;  3DWW A;  3RQG A;  3HLZ A;  1XZP A;  3W2W A;  4CSA A;  3NDB B;  3U2M A;  2TMV P;  2VAS A;  2XRH A;  3QW1 A;  4M63 A;  3X2Q C;  4U5F E;  5DLJ A;  1OW7 A;  1TFK B;  4KNW A;  4JW1 A;  3W8H A;  1M6T A;  1LIH A;  5L3V A;  1Z7Q c;  2OU6 A;  3DKA A;  4DJ9 A;  4XPX A;  2QUP A;  4BJ1 A;  1Q0F A;  2OOC A;  1EI7 A;  1V54 C;  2DI3 A;  2Q9B A;  2Y69 C;  3VAY A;  2Y3H A;  4J7T A;  1CPR A;  1NSG B;  1VB5 A;  4E7Z A;  3ATP A;  3ABL C;  1OCR C;  3Q7L A;  4RBN A;  1A7D A;  3AGU A;  1MMN A;  4YT4 A;  2V26 A;  1MNE A;  4BJ6 A;  1VTM P;  2KC3 A;  2R7X A;  4O7G A;  4OD5 A;  3K7D A;  4XPW A;  3GEE A;  2HZ8 A;  1ZU5 A;  2L9J A;  3LJB A;  2NPU A;  4MVU A;  5A6K A;  2AU5 A;  3NYJ A;  1TFO B;  1KTM A;  3NMJ A;  4MW3 A;  4CBE A;  2B0H A;  4YK5 A;  4NQF A;  4MVS A;  2AWC A;  2OKU A;  3S28 A;  1QQ3 A;  3MLG A;  3T9O A;  3L8I A;  1OKK A;  2XLM A;  1RJ9 B;  2CW0 F;  3AJM A;  3HTK C;  4HFF B;  2A0U A;  3E70 C;  2IYL D;  3BRJ A;  4PJM A;  4IJJ A;  2VCC A;  3S29 A;  3KMI A;  5FZT A;  3QTH A;  4EIY A;  4KC9 A;  1F1M A;  3ZDL A;  2R05 A;  5JVE A;  1O87 A;  2NUP B;  2LFD A;  3Q6N A;  2L6H A;  2LQG A;  2P1A A;  2CYD A;  2XLV A;  1GGQ A;  2HUJ A;  2EIJ C;  3GAN A;  4NTA A;  2QLA A;  3K1I C;  3VRC A;  4CDY A;  2XL8 A;  1HE9 A;  3IQT A;  2G62 A;  3RVZ A;  3RFY A;  3WHN A;  3PCV A;  3IHU A;  3NYM A;  5E3C A;  4Q4Z F;  2P7V A;  3G50 A;  4K1O A;  3SEO A;  4DBQ A;  2A0B A;  4C3E A;  3O6X A;  4ULW A;  3B0V C;  2GA0 A;  5KYU A;  3SXY A;  4OIQ F; 
#chains in the Genus database with same CATH homology
 4WGZ A;  5JT4 A;  3NMI A;  1CPQ A;  5JRA A;  3QVY A;  2YLG A;  4JEA A;  2YL0 A;  2XLH A;  3ZWI A;  1E84 A;  3U8P A;  5JSL A;  3M4C A;  3L1M A;  3HNK A;  3DE8 A;  1E86 A;  3ZQV A;  5JLI A;  1E85 A;  3M4B A;  4D4X A;  4CIP A;  1A7V A;  3C63 A;  1GQA A;  2XLE A;  3FOP A;  1EKY A;  1S05 A;  4IAR A;  4IAQ A;  3TOL A;  3ZTM A;  1CGN A;  1MQV A;  4NC3 A;  2BC5 A;  4N6H A;  4U9D A;  3HNL A;  3HNI A;  3DE9 A;  1LM3 B;  3NMK A;  4CDV A;  3M15 A;  4JKV A;  3QVZ A;  4L6R A;  3IQ5 A;  3FOO A;  1JAF A;  4ER9 A;  1RCP A;  2YKZ A;  5AGF A;  2YL7 A;  1YZC A;  2CCY A;  2XM4 A;  3QW1 A;  2J9B A;  5B3I A;  4CX9 A;  1YYJ A;  1M6T A;  4U9E A;  4CJO A;  4ULV A;  4N4W A;  1NBB A;  2XLW A;  1QPU A;  1CPR A;  4D4N A;  2YL3 A;  4CDA A;  1CGO A;  4JEB A;  2XLD A;  5JS5 A;  3QW0 A;  5JUA A;  3HNJ A;  2YLD A;  3TOM A;  4WGY A;  3NMJ A;  4IB4 A;  1YZA A;  1QQ3 A;  1APC A;  5JP7 A;  2XLM A;  3ZQY A;  1E83 A;  3C62 A;  4JE9 A;  1BBH A;  2J8W A;  4EIY A;  3ZTZ A;  2XLO A;  4CJG A;  5JVE A;  3IQ6 A;  3M79 A;  2XLV A;  2YLI A;  256B A;  2QLA A;  3VRC A;  4CDY A;  2XL6 A;  2XM0 A;  2XL8 A;  1YYX A;  2YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...