1YZCA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) with the n- and a part of the c-terminal helices unfolded
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTGRAGNQKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords edesigned apo-cytochrome b562
publication title A protein folding pathway with multiple folding intermediates at atomic resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yzcA01
4WGYA 4IAQA 5JS5A 1CGOA 1RCPA 1GQAA 4D4XA 4CDAA 1E84A 5JLIA 2XLWA 3ZWIA 3HNJA 3QW1A 2XLOA 3NMIA 3M15A 2XLDA 1EKYA 4CDYA 3ZTZA 256BA 4D4NA 1YZAA 2YLGA 3DE9A 1JAFA 4L6RA 1E83A 4NC3A 3QVYA 3DE8A 3HNLA 3HNKA 4JKVA 3C62A 2XLHA 4JEBA 2XLVA 4N4WA 3NMKA 2YL7A 3M4BA 2YL0A 4CJGA 3FOOA 1M6TA 3HNIA 1BBHA 2XL6A 1YYJA 1NBBA 4WGZA 1APCA 4JEAA 5JP7A 5JSLA 1E86A 4ER9A 3FOPA 1YYXA 2YL3A 3IQ5A 4CDVA 4JE9A 1S05A 2XM0A 1CPQA 3TOMA 4EIYA 3VRCA 4CX9A 4CIPA 5B3IA 3M79A 5JT4A 3C63A 4U9DA 1YZCA 4U9EA 2YLIA 3ZTMA 2YL1A 5AGFA 3IQ6A 2XM4A 2YKZA 2XLMA 1MQVA 4N6HA 3ZQVA 5JVEA 2BC5A 3ZQYA 1A7VA 3QVZA 4IB4A 3U8PA 2J8WA 4IARA 4ULVA 3TOLA 2CCYA 5JRAA 4CJOA 2J9BA 1CPRA 2YLDA 1E85A 1LM3B 1CGNA 2QLAA 1QQ3A 3QW0A 1QPUA 2XL8A 5JUAA 2XLEA 3L1MA 3M4CA 3NMJA
chains in the Genus database with same CATH superfamily
3C18A 4U5FE 3U5SA 5L0JA 1ZHZA 1PD1A 1Z23A 4DXWA 2WL8A 1RCPA 4X0RA 4CDAA 1D1AA 5JLIA 3H2VA 4PJNA 4O6NA 1JPNA 3DAFA 1H7IA 4XPXA 5DVWA 3QZCA 3ZWIA 3EG9B 1DOVA 4MS2A 5T3WA 4C3EA 3NKEA 1OCZC 2E87A 5T3TA 3ZVRA 5E3AA 1WASA 4MTFA 2J9WA 2EINC 2R03A 5TJ5E 3RQGA 1L3PA 1G4US 2YLGA 3H2UA 2V26A 3LNRA 4E18A 5KYWA 4KI2A 3CZ6A 2R7QA 2LIGA 2I8BA 2HKVA 3B71A 3GM1A 5KYUB 1Q0GA 1E83A 4OIQF 3EGDB 3HLZA 4FX5A 4NC3A 5A6AA 1T9KA 2VB6A 3HTKC 4N6CA 4ULWA 4BJ1A 3DE8A 3HNLA 3EZIA 2GWWA 4CS8A 4YT4A 2Y3HA 4Q4ZF 4QI2A 2LD6A 2P6VA 3K1IC 3VYWA 3RVYA 4LDKA 3OWTA 2C04A 2ZXWC 4QI0A 4Z9JA 4O79A 1Z3IX 2QY9A 2IOQA 2KYHA 1LE2A 2BL2A 2XL4A 2R7SA 1FR0A 1U0BB 1OXBA 4P6IC 3UGOA 3B0UX 2R7RA 1A41A 2ASRA 4B6IA 2OCCC 4U5HA 3U2LA 3MYFA 4J7TA 2DB4A 2L6GA 3KMIA 4CJGA 1T5OA 3FOOA 5KYYB 1M2OA 2AU5A 4BJ5A 2Q00A 3HNIA 4EBBA 2LFFA 2ZD9A 2JX0A 2PX3A 4CS7A 2YZSA 1YYJA 3IHUA 3O55A 4MVMA 3TK0A 2VCBA 4MVQA 1D1CA 3AQBA 1NBBA 1Q0KA 2W45A 3QTHA 2XRHA 3O10A 4JEAA 5JP7A 2X0CA 3F47A 3SNHA 2ETSA 1Z6AA 2YQYA 1YYXA 3JCUQ 3TQOA 2NUPA 5A69A 4JE9A 2HJMA 4C3DA 3DJNB 2XM0A 1OR2A 1G5ZA 5DS4A 1M57C 2J9VA 3LLIA 3GANA 2GDCA 2L7AA 3NYJA 4NTBA 5L0DA 2HV6A 3KYIA 1D0XA 1AVOB 2NUTB 1JOGA 4BJ6C 2HUJA 1ZW3A 2PP4A 2YWAA 3DWWA 4IWBA 4O6MA 5F28E 3UMKA 4XLPF 4EBKA 3N0TA 4PFOA 1ZVZA 3BRJA 1IZMA 1Z5ZA 3HKKA 4O7GA 3US6A 3AGTA 4JTCB 1K40A 1V74B 3Q6MA 3RIPA 1VOMA 3S29A 2PBEA 2R7TA 2KC3A 3JT1A 2ZPAA 3GORA 2HJ3A 2OG2A 1M2VB 1TQGA 1QZXA 2NSGA 1A7DA 3T9OA 3WHNA 2GFHA 3LLKA 3RYLA 2J7PD 1XWJA 1A7VA 3KYJA 5D92A 4JIOA 3U8VA 2J8WA 4ULVA 3TOLA 3V5XA 2CCYA 4DOZA 2L6HA 4RDAA 1R4TA 2EPOA 4I3MA 2B0JA 4C3BA 3L8JA 3RH3A 1WN0A 5BQIA 2EIJC 4RBNA 1HMOA 1D1BA 2QLAA 2DI3A 3O6XA 1V4AA 1ORSC 1QQ3A 4KC9A 4G7HF 2X51A 2GA0A 4JW1A 1A7EA 3LEOA 4LERA 4XWJA 2O9XA 4CS8C 3T6JA 2HMQA 1HY5A 2R05A 2W4BA 1LKXA 5KYWB 4NTFA 4WGYA 2HV7A 4E7SA 1OW7A 2L9JA 5JS5A 3S0XA 1QKRA 3N2ZB 4PACA 3TJ6A 4YT8A 5KYXA 2KSFA 3ECSA 3K66A 3EH1A 1LIHA 2PFDA 4KNWA 1VLSA 2QE9A 5COMA 4DRHB 5BUOA 1GM5A 1G4WR 1QLEC 1TWHA 2AWYA 2XLDA 1EKYA 1BDJB 3SXKA 2W4MA 3UMHA 1A0BA 2J9UA 3GEEA 5T1DB 4HE8D 3ZTZA 4BJ5C 1XZQA 4D4NA 3LS0A 5BQHA 5FCLA 4A2NB 3X2QC 3EFOB 3K6BA 2VC9A 3NRHA 3JYYA 4WABA 1HMDA 2CNWA 3LAYA 2Q7RA 2OEVA 4L6RA 4IGGA 3RFYA 1MNEA 3J06A 2OQMA 3C8GA 4K1OA 1NG1A 5L0GA 2FAPB 3BEHA 1U89A 2Z15A 4Q7CA 3VF0A 3UGPA 2Q9CA 3SXZA 5L0HA 4NTAA 3AG4C 1OCOC 2WZLA 1SF8A 3FMSA 3OA1A 2CW0F 1KTMA 1YLMA 4LACB 5CI8A 5COGA 3G4XA 4U5BE 2QUPA 2OOCA 2AVKA 3HNKA 1Z7Qc 1L7CA 4JEBA 2PX0A 2HSQA 3IPMO 4N4WA 1JMWA 1TWGA 4C7OA 2WZGA 4XEFA 1VK5A 1BR4A 1S7ZA 2G3VA 1YAUO 2LK4A 3M4BA 5IY5C 1I4ZA 2R7OA 4FWVA 2WVQA 4NQFA 2JPUA 4Z9IA 1BBHA 3MX3A 3O39A 2YHSA 3ZSUA 4DRIB 5DQZA 3ZG1A 4WGZA 1APCA 1T6UA 3DMDA 4XTKA 5E2QA 3X1OA 4AE4B 4YWQA 3FDQA 4ER9A 1VYIA 3FOPA 1ZW2A 2YL3A 3FHDA 1BR2A 3JSEO 4KBLA 4CDVA 4DBQA 3C7JA 4E0IA 2J0XA 3EGDA 2MYSA 3SEOA 2L81A 3TOMA 3HJCA 1Y4CA 2GAQA 3M79A 3NKDA 3FVYA 1XZPA 4LDQA 4PK4A 4YL1A 1MMAA 5A6BD 3ZDLA 4U9EA 1H9GA 1SMYF 2YLIA 3KL4A 3LS1A 3T6BA 4DVYP 1UFBA 3VAYA 3NDBB 4BJTA 3SXYA 2UUIA 5AGFA 1YARO 1QSPA 4HEAJ 1RKEA 2A68F 4KNVA 2LCHA 1OKKD 5A6JA 3L34A 4MTGA 2YKZA 2XXAA 1D0YA 1MQVA 4G78A 1UG7A 5KYYA 3U9JA 1SR2A 3WG7C 2IXPA 1FTSA 3EGXA 2R7UA 1FNTc 2A6EF 1HE9A 2P7VA 4J7YA 4UDVA 4MW8A 3ASNC 4IB4A 4FAPB 5F5FA 4YL3A 3SP1A 4CJOA 4U5EE 3U2MA 3DAGA 4R32A 1E85A 3GM2A 3JRMO 3A9CA 4JTAB 4XPWA 2DGJA 1VB5A 4DVZA 5EHHA 3B9QA 1CGNA 1PD0A 4I44A 1KNYA 1TR2A 4IAOA 5B1AC 2L6FA 1F1MA 2EILC 2Y39A 3JYHA 4PJJA 5GPGB 4EBJA 2NUPB 3QW0A 4E0HA 1J8YF 2EIMC 1GS9A 3B0PA 3M1CB 2NUTA 1FMWA 3AOUA 4CBEA 3L1MA 3M4CA 3S84A 2EPMX 3EHMA 4H4KC 4IAQA 2NPUA 3MYIA 3EPVA 4I1OB 4JURI 4XLNF 3GWLA 5A6BA 5L3QA 4BPMA 3U0CA 5HSWA 1MMNA 2Q4FA 1VMAA 3I5QA 1O5HA 4ANJA 1O87A 1MMGA 2CNWD 2DYRC 3QW1A 1SZIA 3WODF 3E70C 4MVUA 1LS1A 4YL0A 3C8GD 4N06A 3TULA 1TFKB 1EQ1A 3JSZA 3CAXA 2J45A 2G3KA 1OKKA 2P0NA 4QDLA 3TD7A 3UMIA 2P61A 4JZAA 256BA 2IBFA 4BG0A 1WATA 2H7VC 4G0HA 2M64A 3DE9A 4HFKB 4ZLDA 2H7BA 1RJ9A 3Q6NA 4EWCA 2Q3TA 2PNOA 1FFTC 2C03A 1CGME 2IYLD 1TWCA 1W2WA 3V5ZA 1JPJA 2R7WA 3SYNA 3AG3C 1U6HA 4JVSA 3AG2C 2B0HA 4NY3A 4O6YA 2R7VA 1EI7A 3FAPB 2OEXA 4JJFA 2XS1A 4YJWA 1FFHA 2KK1A 2RD9A 3EHNA 1C17M 4JJGA 3RQFA 4JKVA 2Q9AA 4AL1A 3C62A 2A0UA 2VASA 3N24A 2IXMA 2XLHA 2XSEA 1HW2A 2J46A 4WJ0A 1JR8A 1DOWA 2XLVA 4H54A 2OJQA 4EHPA 4NCQA 3NMKA 1EA8A 3JZ0A 4YT2A 5AC4A 1B68A 2YL7A 5BQGA 1R5ID 2LQGA 1NZEA 4J32B 1AUEA 3PDMP 1I5NA 1ST6A 3G50A 3DM5A 5AC5A 1QVXA 3KKBA 1ZHYA 2YL0A 3W8HA 2M4EA 2OU6A 4OIRF 4W8PA 1TKNA 3S28A 1MMDA 1M6TA 3U9MA 4G7OF 4JC7A 2EPKX 3A11A 3RW0A 2LSEA 4JCZA 4CS9A 2Y3DA 5L0FA 4JTDB 3AJMA 4C7OB 4FESA 3NYMA 2OKUA 3EQLF 2EPNA 2KW3C 2HSBA 3I4UA 1WWPA 4U5GA 4RD9A 5KYNA 1E86A 1BR1A 3EFOA 4G7ZF 3ABKC 2WVOA 1OQCA 3S9OA 3IQ5A 3GM3A 1OW6A 1S05A 1CPQA 2YVKA 4K0DA 4OINF 2A6HF 3VRCA 2V3CC 4CX9A 3NG1A 2PF4E 4AK9A 1C02A 5B3IA 3C63A 1OCCC 4CIPA 1ORYA 1ZHWA 3ASOC 4XEKA 3FAJA 2R25A 1YZCA 3DD7A 4U9DA 1SYQA 1E2XA 2Q9BA 2YL1A 4OD5A 3JTLO 1LPEA 2VCAA 4ZLCA 2ZXPA 3EG9A 3IQCA 3QMKA 3EH2A 3GEIA 1HW1A 1OW8A 2JD3A 2LP4A 2IXOA 2XM4A 4W8KA 4XEVA 1RKCA 1VTMP 4LLCA 4N6HA 3Q7LA 3ZQVA 2BC5A 4DBRA 1VLTA 3ZQYA 3FXHA 3QVZA 3MFNA 4PR9A 3DXJF 3RKOF 3K1HA 4IARA 5K0IA 2IM8A 3LEVA 5KYUA 5JRAA 3B0VC 3GWNA 1CPRA 3MBGA 1YDIA 2ZXRA 4J30B 3K33A 3W4YA 1IW7F 4AE4A 1HE1A 4U5DE 2A1DD 1OXKA 1PV3A 2P1AA 3ABLC 1NSGB 2Y69C 3R7CA 5A6KA 1LI5A 2A0BA 2TMVP 3UNGC 4F4BA 2ICWG 1N1CA 1QPUA 2R7XA 1NLXA 2OJED 4OIPF 3DJUB 4CIHA 2XLEA 2D5RB 2W9YA 2G62A 1ORJA 1GQAA 1TWAA 3K7DA 3G4ZA 3RQEA 4A4AA 1MNDA 5EGYA 1ZYRF 2WZFA 3PMRA 3SXMA 4XQ1A 1CGOA 4PJLA 1E84A 4D4XA 3VM6A 2CGEA 2XLWA 3ABMC 3AGUA 2AWCA 3E9VA 3HNJA 4MVOA 4XPYA 2BE5F 3POVA 1FMVA 5E3CA 1RMVA 1GGQA 4YN0B 4BEMJ 4P9TA 2XLOA 1RKEB 2FFHA 3M15A 3NMIA 3LNMB 1M56C 4I1MA 4MVSA 3W2VA 4CDYA 2XXAB 1YJGA 1T6IA 2Y3GA 2AP3A 4CSAA 1YZAA 4CS9C 4DJ9A 1WTYA 3DM9B 3EGXB 1JAFA 1H9TA 3CEXA 1YVIA 4Z9HA 3EJNA 3Q7GA 4JRZA 3AQCA 3L8IA 4LDRA 4MTOA 4MVRA 1AEPA 1O3UA 5FZTA 2QNLA 3DKAA 1T01A 2UUHA 2YRFA 2RSEB 3I5PA 2HFIA 1K04A 2KGOA 3GODA 3QVYA 5L0CA 2H8AA 2QTVA 3U3FA 5DS6A 3PHF2 1LVKA 1FAPB 3CQZA 2NG1A 3NYLA 2MWQA 3UR3C 3RVZA 2KQ9A 3RF3A 1Z63A 1LS4A 5F5HA 3EZHA 1J8MF 1ZU4A 1YA9A 1M2VA 3V5YA 2R02A 3C8ZA 3R2PA 1YA7O 1NFOA 4E7ZA 4MVZA 4YT5A 1V55C 3IEEA 4BEJA 1Q0FA 1I4YA 1D0ZA 1T6QA 2ZXOA 4LLEA 1OCRC 3LJBA 1ZHTA 3H65A 4DRJB 5B1BC 2XL6A 3ZIBA 2KJGA 1NU9C 2EPLX 5CIVA 2CDQA 3V7OA 1RXQA 1NU7D 1OR3A 2WVNA 3MLGA 4PJMA 3DZAA 4E17A 1JRAA 5JSLA 4IRUA 5EK0A 2A69F 3T6GB 3B29A 3TJ5A 3GEHA 2IXNA 1RJ9B 4MW3A 2FGYA 1TFOB 4YK5A 3PCVA 1Q0MA 4M63A 4EIYA 4P9FA 5D91A 4K7BA 1KU2A 3K1IA 3DI5A 3ZC4A 2F22A 5JT4A 5DS5A 1LI7A 4MNDA 4EKWA 3OEOA 5CI9A 3WAQA 4AL0A 2CYDA 1BZ4A 1Q0DA 4AX2A 4EUKB 3KPHA 1ZHXA 4ONSA 3ZTMA 3JRTA 3KH2A 4PFPA 3T4RA 3IQTA 3SZRA 5KYXB 3IQ6A 2WB7A 1WGWA 4GEHA 3AG1C 2XLMA 5JVEA 2VH3A 3LESA 1K05A 2Y3BA 3ITFA 2VCCA 3S27A 5L0IA 2R9RB 3CSKA 1ZZPA 5DQTA 3U8PA 2MHRA 2H7OA 1PCXA 5COFA 5HV9A 4CSAC 2J9BA 2YLDA 4MQ9F 1WOLA 2HMZA 4U5CE 1V54C 4OIOF 1LE4A 3ATPA 1LM3B 5DLJA 2J0WA 3C8GB 4GYTA 4JCHA 3U3BA 5B3SC 3L0IA 5L3VA 4GQHA 5E33A 2J7PA 2LFDA 1ZU5A 2YEVA 4Q5SF 2HZ8A 2NSFA 1VYKA 2DYSC 4IJJA 3W8IA 4BJ6A 1G8XA 2KNHA 3F46A 2XL8A 5JUAA 1C03A 2I15A 3LUTB 3S90A 2EIKC 2HS5A 2XS8A 4OD4A 1H6GA 3NMJA 2D4UA 4HFFB 3W2WA 1Y6DA 1NFNA
chains in the Genus database with same CATH topology
4WGYA 4IAQA 5JS5A 1CGOA 1RCPA 1GQAA 4D4XA 4CDAA 1E84A 5JLIA 2XLWA 3ZWIA 3HNJA 3QW1A 2XLOA 3NMIA 3M15A 2XLDA 1EKYA 4CDYA 3ZTZA 256BA 4D4NA 1YZAA 2YLGA 3DE9A 1JAFA 4L6RA 1E83A 4NC3A 3QVYA 3DE8A 3HNLA 3HNKA 4JKVA 3C62A 2XLHA 4JEBA 2XLVA 4N4WA 3NMKA 2YL7A 3M4BA 2YL0A 4CJGA 3FOOA 1M6TA 3HNIA 1BBHA 2XL6A 1YYJA 1NBBA 4WGZA 1APCA 4JEAA 5JP7A 5JSLA 1E86A 4ER9A 3FOPA 1YYXA 2YL3A 3IQ5A 4CDVA 4JE9A 1S05A 2XM0A 1CPQA 3TOMA 4EIYA 3VRCA 4CX9A 4CIPA 5B3IA 3M79A 5JT4A 3C63A 4U9DA 1YZCA 4U9EA 2YLIA 3ZTMA 2YL1A 5AGFA 3IQ6A 2XM4A 2YKZA 2XLMA 1MQVA 4N6HA 3ZQVA 5JVEA 2BC5A 3ZQYA 1A7VA 3QVZA 4IB4A 3U8PA 2J8WA 4IARA 4ULVA 3TOLA 2CCYA 5JRAA 4CJOA 2J9BA 1CPRA 2YLDA 1E85A 1LM3B 1CGNA 2QLAA 1QQ3A 3QW0A 1QPUA 2XL8A 5JUAA 2XLEA 3L1MA 3M4CA 3NMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  4IAQ A;  5JS5 A;  1CGO A;  1RCP A;  1GQA A;  4D4X A;  4CDA A;  1E84 A;  5JLI A;  2XLW A;  3ZWI A;  3HNJ A;  3QW1 A;  2XLO A;  3NMI A;  3M15 A;  2XLD A;  1EKY A;  4CDY A;  3ZTZ A;  256B A;  4D4N A;  1YZA A;  2YLG A;  3DE9 A;  1JAF A;  4L6R A;  1E83 A;  4NC3 A;  3QVY A;  3DE8 A;  3HNL A;  3HNK A;  4JKV A;  3C62 A;  2XLH A;  4JEB A;  2XLV A;  4N4W A;  3NMK A;  2YL7 A;  3M4B A;  2YL0 A;  4CJG A;  3FOO A;  1M6T A;  3HNI A;  1BBH A;  2XL6 A;  1YYJ A;  1NBB A;  4WGZ A;  1APC A;  4JEA A;  5JP7 A;  5JSL A;  1E86 A;  4ER9 A;  3FOP A;  1YYX A;  2YL3 A;  3IQ5 A;  4CDV A;  4JE9 A;  1S05 A;  2XM0 A;  1CPQ A;  3TOM A;  4EIY A;  3VRC A;  4CX9 A;  4CIP A;  5B3I A;  3M79 A;  5JT4 A;  3C63 A;  4U9D A;  1YZC A;  4U9E A;  2YLI A;  3ZTM A;  2YL1 A;  5AGF A;  3IQ6 A;  2XM4 A;  2YKZ A;  2XLM A;  1MQV A;  4N6H A;  3ZQV A;  5JVE A;  2BC5 A;  3ZQY A;  1A7V A;  3QVZ A;  4IB4 A;  3U8P A;  2J8W A;  4IAR A;  4ULV A;  3TOL A;  2CCY A;  5JRA A;  4CJO A;  2J9B A;  1CPR A;  2YLD A;  1E85 A;  1LM3 B;  1CGN A;  2QLA A;  1QQ3 A;  3QW0 A;  1QPU A;  2XL8 A;  5JUA A;  2XLE A;  3L1M A;  3M4C A;  3NMJ A; 
#chains in the Genus database with same CATH topology
 3C18 A;  4U5F E;  3U5S A;  5L0J A;  1ZHZ A;  1PD1 A;  1Z23 A;  4DXW A;  2WL8 A;  1RCP A;  4X0R A;  4CDA A;  1D1A A;  5JLI A;  3H2V A;  4PJN A;  4O6N A;  1JPN A;  3DAF A;  1H7I A;  4XPX A;  5DVW A;  3QZC A;  3ZWI A;  3EG9 B;  1DOV A;  4MS2 A;  5T3W A;  4C3E A;  3NKE A;  1OCZ C;  2E87 A;  5T3T A;  3ZVR A;  5E3A A;  1WAS A;  4MTF A;  2J9W A;  2EIN C;  2R03 A;  5TJ5 E;  3RQG A;  1L3P A;  1G4U S;  2YLG A;  3H2U A;  2V26 A;  3LNR A;  4E18 A;  5KYW A;  4KI2 A;  3CZ6 A;  2R7Q A;  2LIG A;  2I8B A;  2HKV A;  3B71 A;  3GM1 A;  5KYU B;  1Q0G A;  1E83 A;  4OIQ F;  3EGD B;  3HLZ A;  4FX5 A;  4NC3 A;  5A6A A;  1T9K A;  2VB6 A;  3HTK C;  4N6C A;  4ULW A;  4BJ1 A;  3DE8 A;  3HNL A;  3EZI A;  2GWW A;  4CS8 A;  4YT4 A;  2Y3H A;  4Q4Z F;  4QI2 A;  2LD6 A;  2P6V A;  3K1I C;  3VYW A;  3RVY A;  4LDK A;  3OWT A;  2C04 A;  2ZXW C;  4QI0 A;  4Z9J A;  4O79 A;  1Z3I X;  2QY9 A;  2IOQ A;  2KYH A;  1LE2 A;  2BL2 A;  2XL4 A;  2R7S A;  1FR0 A;  1U0B B;  1OXB A;  4P6I C;  3UGO A;  3B0U X;  2R7R A;  1A41 A;  2ASR A;  4B6I A;  2OCC C;  4U5H A;  3U2L A;  3MYF A;  4J7T A;  2DB4 A;  2L6G A;  3KMI A;  4CJG A;  1T5O A;  3FOO A;  5KYY B;  1M2O A;  2AU5 A;  4BJ5 A;  2Q00 A;  3HNI A;  4EBB A;  2LFF A;  2ZD9 A;  2JX0 A;  2PX3 A;  4CS7 A;  2YZS A;  1YYJ A;  3IHU A;  3O55 A;  4MVM A;  3TK0 A;  2VCB A;  4MVQ A;  1D1C A;  3AQB A;  1NBB A;  1Q0K A;  2W45 A;  3QTH A;  2XRH A;  3O10 A;  4JEA A;  5JP7 A;  2X0C A;  3F47 A;  3SNH A;  2ETS A;  1Z6A A;  2YQY A;  1YYX A;  3JCU Q;  3TQO A;  2NUP A;  5A69 A;  4JE9 A;  2HJM A;  4C3D A;  3DJN B;  2XM0 A;  1OR2 A;  1G5Z A;  5DS4 A;  1M57 C;  2J9V A;  3LLI A;  3GAN A;  2GDC A;  2L7A A;  3NYJ A;  4NTB A;  5L0D A;  2HV6 A;  3KYI A;  1D0X A;  1AVO B;  2NUT B;  1JOG A;  4BJ6 C;  2HUJ A;  1ZW3 A;  2PP4 A;  2YWA A;  3DWW A;  4IWB A;  4O6M A;  5F28 E;  3UMK A;  4XLP F;  4EBK A;  3N0T A;  4PFO A;  1ZVZ A;  3BRJ A;  1IZM A;  1Z5Z A;  3HKK A;  4O7G A;  3US6 A;  3AGT A;  4JTC B;  1K40 A;  1V74 B;  3Q6M A;  3RIP A;  1VOM A;  3S29 A;  2PBE A;  2R7T A;  2KC3 A;  3JT1 A;  2ZPA A;  3GOR A;  2HJ3 A;  2OG2 A;  1M2V B;  1TQG A;  1QZX A;  2NSG A;  1A7D A;  3T9O A;  3WHN A;  2GFH A;  3LLK A;  3RYL A;  2J7P D;  1XWJ A;  1A7V A;  3KYJ A;  5D92 A;  4JIO A;  3U8V A;  2J8W A;  4ULV A;  3TOL A;  3V5X A;  2CCY A;  4DOZ A;  2L6H A;  4RDA A;  1R4T A;  2EPO A;  4I3M A;  2B0J A;  4C3B A;  3L8J A;  3RH3 A;  1WN0 A;  5BQI A;  2EIJ C;  4RBN A;  1HMO A;  1D1B A;  2QLA A;  2DI3 A;  3O6X A;  1V4A A;  1ORS C;  1QQ3 A;  4KC9 A;  4G7H F;  2X51 A;  2GA0 A;  4JW1 A;  1A7E A;  3LEO A;  4LER A;  4XWJ A;  2O9X A;  4CS8 C;  3T6J A;  2HMQ A;  1HY5 A;  2R05 A;  2W4B A;  1LKX A;  5KYW B;  4NTF A;  4WGY A;  2HV7 A;  4E7S A;  1OW7 A;  2L9J A;  5JS5 A;  3S0X A;  1QKR A;  3N2Z B;  4PAC A;  3TJ6 A;  4YT8 A;  5KYX A;  2KSF A;  3ECS A;  3K66 A;  3EH1 A;  1LIH A;  2PFD A;  4KNW A;  1VLS A;  2QE9 A;  5COM A;  4DRH B;  5BUO A;  1GM5 A;  1G4W R;  1QLE C;  1TWH A;  2AWY A;  2XLD A;  1EKY A;  1BDJ B;  3SXK A;  2W4M A;  3UMH A;  1A0B A;  2J9U A;  3GEE A;  5T1D B;  4HE8 D;  3ZTZ A;  4BJ5 C;  1XZQ A;  4D4N A;  3LS0 A;  5BQH A;  5FCL A;  4A2N B;  3X2Q C;  3EFO B;  3K6B A;  2VC9 A;  3NRH A;  3JYY A;  4WAB A;  1HMD A;  2CNW A;  3LAY A;  2Q7R A;  2OEV A;  4L6R A;  4IGG A;  3RFY A;  1MNE A;  3J06 A;  2OQM A;  3C8G A;  4K1O A;  1NG1 A;  5L0G A;  2FAP B;  3BEH A;  1U89 A;  2Z15 A;  4Q7C A;  3VF0 A;  3UGP A;  2Q9C A;  3SXZ A;  5L0H A;  4NTA A;  3AG4 C;  1OCO C;  2WZL A;  1SF8 A;  3FMS A;  3OA1 A;  2CW0 F;  1KTM A;  1YLM A;  4LAC B;  5CI8 A;  5COG A;  3G4X A;  4U5B E;  2QUP A;  2OOC A;  2AVK A;  3HNK A;  1Z7Q c;  1L7C A;  4JEB A;  2PX0 A;  2HSQ A;  3IPM O;  4N4W A;  1JMW A;  1TWG A;  4C7O A;  2WZG A;  4XEF A;  1VK5 A;  1BR4 A;  1S7Z A;  2G3V A;  1YAU O;  2LK4 A;  3M4B A;  5IY5 C;  1I4Z A;  2R7O A;  4FWV A;  2WVQ A;  4NQF A;  2JPU A;  4Z9I A;  1BBH A;  3MX3 A;  3O39 A;  2YHS A;  3ZSU A;  4DRI B;  5DQZ A;  3ZG1 A;  4WGZ A;  1APC A;  1T6U A;  3DMD A;  4XTK A;  5E2Q A;  3X1O A;  4AE4 B;  4YWQ A;  3FDQ A;  4ER9 A;  1VYI A;  3FOP A;  1ZW2 A;  2YL3 A;  3FHD A;  1BR2 A;  3JSE O;  4KBL A;  4CDV A;  4DBQ A;  3C7J A;  4E0I A;  2J0X A;  3EGD A;  2MYS A;  3SEO A;  2L81 A;  3TOM A;  3HJC A;  1Y4C A;  2GAQ A;  3M79 A;  3NKD A;  3FVY A;  1XZP A;  4LDQ A;  4PK4 A;  4YL1 A;  1MMA A;  5A6B D;  3ZDL A;  4U9E A;  1H9G A;  1SMY F;  2YLI A;  3KL4 A;  3LS1 A;  3T6B A;  4DVY P;  1UFB A;  3VAY A;  3NDB B;  4BJT A;  3SXY A;  2UUI A;  5AGF A;  1YAR O;  1QSP A;  4HEA J;  1RKE A;  2A68 F;  4KNV A;  2LCH A;  1OKK D;  5A6J A;  3L34 A;  4MTG A;  2YKZ A;  2XXA A;  1D0Y A;  1MQV A;  4G78 A;  1UG7 A;  5KYY A;  3U9J A;  1SR2 A;  3WG7 C;  2IXP A;  1FTS A;  3EGX A;  2R7U A;  1FNT c;  2A6E F;  1HE9 A;  2P7V A;  4J7Y A;  4UDV A;  4MW8 A;  3ASN C;  4IB4 A;  4FAP B;  5F5F A;  4YL3 A;  3SP1 A;  4CJO A;  4U5E E;  3U2M A;  3DAG A;  4R32 A;  1E85 A;  3GM2 A;  3JRM O;  3A9C A;  4JTA B;  4XPW A;  2DGJ A;  1VB5 A;  4DVZ A;  5EHH A;  3B9Q A;  1CGN A;  1PD0 A;  4I44 A;  1KNY A;  1TR2 A;  4IAO A;  5B1A C;  2L6F A;  1F1M A;  2EIL C;  2Y39 A;  3JYH A;  4PJJ A;  5GPG B;  4EBJ A;  2NUP B;  3QW0 A;  4E0H A;  1J8Y F;  2EIM C;  1GS9 A;  3B0P A;  3M1C B;  2NUT A;  1FMW A;  3AOU A;  4CBE A;  3L1M A;  3M4C A;  3S84 A;  2EPM X;  3EHM A;  4H4K C;  4IAQ A;  2NPU A;  3MYI A;  3EPV A;  4I1O B;  4JUR I;  4XLN F;  3GWL A;  5A6B A;  5L3Q A;  4BPM A;  3U0C A;  5HSW A;  1MMN A;  2Q4F A;  1VMA A;  3I5Q A;  1O5H A;  4ANJ A;  1O87 A;  1MMG A;  2CNW D;  2DYR C;  3QW1 A;  1SZI A;  3WOD F;  3E70 C;  4MVU A;  1LS1 A;  4YL0 A;  3C8G D;  4N06 A;  3TUL A;  1TFK B;  1EQ1 A;  3JSZ A;  3CAX A;  2J45 A;  2G3K A;  1OKK A;  2P0N A;  4QDL A;  3TD7 A;  3UMI A;  2P61 A;  4JZA A;  256B A;  2IBF A;  4BG0 A;  1WAT A;  2H7V C;  4G0H A;  2M64 A;  3DE9 A;  4HFK B;  4ZLD A;  2H7B A;  1RJ9 A;  3Q6N A;  4EWC A;  2Q3T A;  2PNO A;  1FFT C;  2C03 A;  1CGM E;  2IYL D;  1TWC A;  1W2W A;  3V5Z A;  1JPJ A;  2R7W A;  3SYN A;  3AG3 C;  1U6H A;  4JVS A;  3AG2 C;  2B0H A;  4NY3 A;  4O6Y A;  2R7V A;  1EI7 A;  3FAP B;  2OEX A;  4JJF A;  2XS1 A;  4YJW A;  1FFH A;  2KK1 A;  2RD9 A;  3EHN A;  1C17 M;  4JJG A;  3RQF A;  4JKV A;  2Q9A A;  4AL1 A;  3C62 A;  2A0U A;  2VAS A;  3N24 A;  2IXM A;  2XLH A;  2XSE A;  1HW2 A;  2J46 A;  4WJ0 A;  1JR8 A;  1DOW A;  2XLV A;  4H54 A;  2OJQ A;  4EHP A;  4NCQ A;  3NMK A;  1EA8 A;  3JZ0 A;  4YT2 A;  5AC4 A;  1B68 A;  2YL7 A;  5BQG A;  1R5I D;  2LQG A;  1NZE A;  4J32 B;  1AUE A;  3PDM P;  1I5N A;  1ST6 A;  3G50 A;  3DM5 A;  5AC5 A;  1QVX A;  3KKB A;  1ZHY A;  2YL0 A;  3W8H A;  2M4E A;  2OU6 A;  4OIR F;  4W8P A;  1TKN A;  3S28 A;  1MMD A;  1M6T A;  3U9M A;  4G7O F;  4JC7 A;  2EPK X;  3A11 A;  3RW0 A;  2LSE A;  4JCZ A;  4CS9 A;  2Y3D A;  5L0F A;  4JTD B;  3AJM A;  4C7O B;  4FES A;  3NYM A;  2OKU A;  3EQL F;  2EPN A;  2KW3 C;  2HSB A;  3I4U A;  1WWP A;  4U5G A;  4RD9 A;  5KYN A;  1E86 A;  1BR1 A;  3EFO A;  4G7Z F;  3ABK C;  2WVO A;  1OQC A;  3S9O A;  3IQ5 A;  3GM3 A;  1OW6 A;  1S05 A;  1CPQ A;  2YVK A;  4K0D A;  4OIN F;  2A6H F;  3VRC A;  2V3C C;  4CX9 A;  3NG1 A;  2PF4 E;  4AK9 A;  1C02 A;  5B3I A;  3C63 A;  1OCC C;  4CIP A;  1ORY A;  1ZHW A;  3ASO C;  4XEK A;  3FAJ A;  2R25 A;  1YZC A;  3DD7 A;  4U9D A;  1SYQ A;  1E2X A;  2Q9B A;  2YL1 A;  4OD5 A;  3JTL O;  1LPE A;  2VCA A;  4ZLC A;  2ZXP A;  3EG9 A;  3IQC A;  3QMK A;  3EH2 A;  3GEI A;  1HW1 A;  1OW8 A;  2JD3 A;  2LP4 A;  2IXO A;  2XM4 A;  4W8K A;  4XEV A;  1RKC A;  1VTM P;  4LLC A;  4N6H A;  3Q7L A;  3ZQV A;  2BC5 A;  4DBR A;  1VLT A;  3ZQY A;  3FXH A;  3QVZ A;  3MFN A;  4PR9 A;  3DXJ F;  3RKO F;  3K1H A;  4IAR A;  5K0I A;  2IM8 A;  3LEV A;  5KYU A;  5JRA A;  3B0V C;  3GWN A;  1CPR A;  3MBG A;  1YDI A;  2ZXR A;  4J30 B;  3K33 A;  3W4Y A;  1IW7 F;  4AE4 A;  1HE1 A;  4U5D E;  2A1D D;  1OXK A;  1PV3 A;  2P1A A;  3ABL C;  1NSG B;  2Y69 C;  3R7C A;  5A6K A;  1LI5 A;  2A0B A;  2TMV P;  3UNG C;  4F4B A;  2ICW G;  1N1C A;  1QPU A;  2R7X A;  1NLX A;  2OJE D;  4OIP F;  3DJU B;  4CIH A;  2XLE A;  2D5R B;  2W9Y A;  2G62 A;  1ORJ A;  1GQA A;  1TWA A;  3K7D A;  3G4Z A;  3RQE A;  4A4A A;  1MND A;  5EGY A;  1ZYR F;  2WZF A;  3PMR A;  3SXM A;  4XQ1 A;  1CGO A;  4PJL A;  1E84 A;  4D4X A;  3VM6 A;  2CGE A;  2XLW A;  3ABM C;  3AGU A;  2AWC A;  3E9V A;  3HNJ A;  4MVO A;  4XPY A;  2BE5 F;  3POV A;  1FMV A;  5E3C A;  1RMV A;  1GGQ A;  4YN0 B;  4BEM J;  4P9T A;  2XLO A;  1RKE B;  2FFH A;  3M15 A;  3NMI A;  3LNM B;  1M56 C;  4I1M A;  4MVS A;  3W2V A;  4CDY A;  2XXA B;  1YJG A;  1T6I A;  2Y3G A;  2AP3 A;  4CSA A;  1YZA A;  4CS9 C;  4DJ9 A;  1WTY A;  3DM9 B;  3EGX B;  1JAF A;  1H9T A;  3CEX A;  1YVI A;  4Z9H A;  3EJN A;  3Q7G A;  4JRZ A;  3AQC A;  3L8I A;  4LDR A;  4MTO A;  4MVR A;  1AEP A;  1O3U A;  5FZT A;  2QNL A;  3DKA A;  1T01 A;  2UUH A;  2YRF A;  2RSE B;  3I5P A;  2HFI A;  1K04 A;  2KGO A;  3GOD A;  3QVY A;  5L0C A;  2H8A A;  2QTV A;  3U3F A;  5DS6 A;  3PHF 2;  1LVK A;  1FAP B;  3CQZ A;  2NG1 A;  3NYL A;  2MWQ A;  3UR3 C;  3RVZ A;  2KQ9 A;  3RF3 A;  1Z63 A;  1LS4 A;  5F5H A;  3EZH A;  1J8M F;  1ZU4 A;  1YA9 A;  1M2V A;  3V5Y A;  2R02 A;  3C8Z A;  3R2P A;  1YA7 O;  1NFO A;  4E7Z A;  4MVZ A;  4YT5 A;  1V55 C;  3IEE A;  4BEJ A;  1Q0F A;  1I4Y A;  1D0Z A;  1T6Q A;  2ZXO A;  4LLE A;  1OCR C;  3LJB A;  1ZHT A;  3H65 A;  4DRJ B;  5B1B C;  2XL6 A;  3ZIB A;  2KJG A;  1NU9 C;  2EPL X;  5CIV A;  2CDQ A;  3V7O A;  1RXQ A;  1NU7 D;  1OR3 A;  2WVN A;  3MLG A;  4PJM A;  3DZA A;  4E17 A;  1JRA A;  5JSL A;  4IRU A;  5EK0 A;  2A69 F;  3T6G B;  3B29 A;  3TJ5 A;  3GEH A;  2IXN A;  1RJ9 B;  4MW3 A;  2FGY A;  1TFO B;  4YK5 A;  3PCV A;  1Q0M A;  4M63 A;  4EIY A;  4P9F A;  5D91 A;  4K7B A;  1KU2 A;  3K1I A;  3DI5 A;  3ZC4 A;  2F22 A;  5JT4 A;  5DS5 A;  1LI7 A;  4MND A;  4EKW A;  3OEO A;  5CI9 A;  3WAQ A;  4AL0 A;  2CYD A;  1BZ4 A;  1Q0D A;  4AX2 A;  4EUK B;  3KPH A;  1ZHX A;  4ONS A;  3ZTM A;  3JRT A;  3KH2 A;  4PFP A;  3T4R A;  3IQT A;  3SZR A;  5KYX B;  3IQ6 A;  2WB7 A;  1WGW A;  4GEH A;  3AG1 C;  2XLM A;  5JVE A;  2VH3 A;  3LES A;  1K05 A;  2Y3B A;  3ITF A;  2VCC A;  3S27 A;  5L0I A;  2R9R B;  3CSK A;  1ZZP A;  5DQT A;  3U8P A;  2MHR A;  2H7O A;  1PCX A;  5COF A;  5HV9 A;  4CSA C;  2J9B A;  2YLD A;  4MQ9 F;  1WOL A;  2HMZ A;  4U5C E;  1V54 C;  4OIO F;  1LE4 A;  3ATP A;  1LM3 B;  5DLJ A;  2J0W A;  3C8G B;  4GYT A;  4JCH A;  3U3B A;  5B3S C;  3L0I A;  5L3V A;  4GQH A;  5E33 A;  2J7P A;  2LFD A;  1ZU5 A;  2YEV A;  4Q5S F;  2HZ8 A;  2NSF A;  1VYK A;  2DYS C;  4IJJ A;  3W8I A;  4BJ6 A;  1G8X A;  2KNH A;  3F46 A;  2XL8 A;  5JUA A;  1C03 A;  2I15 A;  3LUT B;  3S90 A;  2EIK C;  2HS5 A;  2XS8 A;  4OD4 A;  1H6G A;  3NMJ A;  2D4U A;  4HFF B;  3W2W A;  1Y6D A;  1NFN A; 
#chains in the Genus database with same CATH homology
 4WGY A;  4IAQ A;  5JS5 A;  1CGO A;  1RCP A;  1GQA A;  4D4X A;  4CDA A;  1E84 A;  5JLI A;  2XLW A;  3ZWI A;  3HNJ A;  3QW1 A;  2XLO A;  3NMI A;  3M15 A;  2XLD A;  1EKY A;  4CDY A;  3ZTZ A;  256B A;  4D4N A;  1YZA A;  2YLG A;  3DE9 A;  1JAF A;  4L6R A;  1E83 A;  4NC3 A;  3QVY A;  3DE8 A;  3HNL A;  3HNK A;  4JKV A;  3C62 A;  2XLH A;  4JEB A;  2XLV A;  4N4W A;  3NMK A;  2YL7 A;  3M4B A;  2YL0 A;  4CJG A;  3FOO A;  1M6T A;  3HNI A;  1BBH A;  2XL6 A;  1YYJ A;  1NBB A;  4WGZ A;  1APC A;  4JEA A;  5JP7 A;  5JSL A;  1E86 A;  4ER9 A;  3FOP A;  1YYX A;  2YL3 A;  3IQ5 A;  4CDV A;  4JE9 A;  1S05 A;  2XM0 A;  1CPQ A;  3TOM A;  4EIY A;  3VRC A;  4CX9 A;  4CIP A;  5B3I A;  3M79 A;  5JT4 A;  3C63 A;  4U9D A;  1YZC A;  4U9E A;  2YLI A;  3ZTM A;  2YL1 A;  5AGF A;  3IQ6 A;  2XM4 A;  2YKZ A;  2XLM A;  1MQV A;  4N6H A;  3ZQV A;  5JVE A;  2BC5 A;  3ZQY A;  1A7V A;  3QVZ A;  4IB4 A;  3U8P A;  2J8W A;  4IAR A;  4ULV A;  3TOL A;  2CCY A;  5JRA A;  4CJO A;  2J9B A;  1CPR A;  2YLD A;  1E85 A;  1LM3 B;  1CGN A;  2QLA A;  1QQ3 A;  3QW0 A;  1QPU A;  2XL8 A;  5JUA A;  2XLE A;  3L1M A;  3M4C A;  3NMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...