2JX0A

The paxillin-binding domain (pbd) of g protein coupled receptor (gpcr)-kinase (grk) interacting protein 1 (git1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
LDGDPDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GIT1 paxillin-binding domain is a four-helix bundle, and it binds to both paxillin LD2 and LD4 motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion, signaling protein
molecule keywords ARF GTPase-activating protein GIT1
total genus 41
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12205 GIT1_C G protein-coupled receptor kinase-interacting protein 1 C term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jx0A00
1O3UA 3C8GB 1JOGA 3RQFA 1WOLA 2LK4A 3U0CA 3MFNA 3JYYA 4EBKA 3C8GA 3BRJA 1V4AA 4XEVA 1KNYA 1OW6A 2L6GA 2L6HA 1K05A 1K40A 3GM3A 3RQEA 3K7DA 3GM1A 2Q00A 3B71A 5F28E 3O10A 1K04A 2KK1A 4R32A 3AJMA 3C8GD 4XEKA 1WWPA 2JPUA 3L8IA 3RQGA 1ZZPA 1QVXA 3JZ0A 2PBEA 1KTMA 1OW7A 3GM2A 1UFBA 4EBJA 3S9OA 2HSBA 1OW8A 2JX0A 2L6FA 3L8JA 4NQFA 3TULA 2YWAA 3C18A 4XEFA 3U3FA 1PV3A 1WTYA
chains in the Genus database with same CATH superfamily
1JPNA 4CS8C 4Z9JA 3RVZA 1M2VA 1SMYF 3FOOA 3IHUA 3ZWIA 3QMKA 2IYLD 3G4XA 3Q6NA 2J9VA 3ZTMA 2XXAA 2J0XA 2Q9BA 2VCAA 4A4AA 1K05A 1A41A 1E85A 3O6XA 3PDMP 1HW2A 2NPUA 1PD0A 1G8XA 3DMDA 1T6IA 1YDIA 1JMWA 3DJNB 3S27A 5JVEA 2HUJA 4NTBA 3A11A 3JRTA 2RSEB 5BQHA 1XZQA 2YL7A 3C7JA 3X2QC 4EBJA 4JC7A 3SYNA 4YL0A 1TWCA 5KYWB 1RJ9B 3S84A 5E33A 1BZ4A 5JRAA 4G7HF 5BUOA 4P9TA 1Q0KA 4IGGA 3CSKA 2OG2A 3NMIA 2UUIA 4XTKA 4OIPF 2AWCA 4M63A 1Z7Qc 1G4US 4BJTA 4CBEA 3EGDB 4IAQA 1AEPA 3C8GA 1CGNA 2EIJC 4U9EA 3NKDA 4GQHA 3ZSUA 3RQEA 3EG9B 1QZXA 2OEVA 2R7OA 1GM5A 2Y3GA 2P6VA 2G62A 3FAJA 3GM1A 1YVIA 3GANA 4MW8A 1D0XA 3O10A 4I44A 2GFHA 2QY9A 5A69A 3B0UX 1T5OA 2OQMA 4E0HA 2A6HF 2VH3A 5DQTA 3FXHA 1JPJA 3K66A 3CEXA 1Q0GA 4WJ0A 3AG4C 1OCOC 3M79A 2KJGA 1FFTC 1TFKB 2XLDA 1YA9A 4CDVA 3CZ6A 3S28A 3LEVA 5IY5C 1HE9A 1HMDA 2Y69C 2XLVA 2J46A 5JUAA 1NLXA 5HV9A 3HNKA 1CPQA 1APCA 1MMGA 2A0UA 2ASRA 2UUHA 2DGJA 4I1OB 4AE4B 1TQGA 1TFOB 3KYJA 5KYYA 3W4YA 4JEBA 1W2WA 4DJ9A 3BEHA 2XL6A 3PHF2 4XPWA 1CPRA 2Y39A 5JS5A 5CIVA 3Q6MA 3ITFA 3K1IC 4XPYA 5COFA 5JT4A 1YJGA 3QZCA 2YQYA 1D1CA 4MTOA 4X0RA 3L1MA 3E9VA 4PFOA 2IOQA 5B1BC 3T4RA 1I4YA 1WASA 2YRFA 3ASNC 2GA0A 3TOMA 3M4CA 4MVSA 2XLEA 3SNHA 1M57C 3RKOF 2HV7A 1KU2A 3GM2A 2Q3TA 3GORA 4N6HA 1NFOA 3SXMA 3T6JA 5AC4A 3JTLO 4BJ5C 1RKEB 3EHNA 3QW1A 1J8YF 4NTAA 4WABA 4ZLDA 2EIKC 1Z5ZA 1HW1A 1WOLA 3EQLF 5AC5A 4H54A 2M4EA 2OEXA 4LERA 4PJMA 1Z6AA 4JEAA 2LCHA 4F4BA 1EI7A 4XEVA 4DRHB 3DZAA 1KNYA 4MW3A 4BEJA 4YT2A 4GEHA 4PR9A 2WB7A 3KKBA 4OD5A 3TD7A 2J7PD 3K7DA 2R7UA 3HJCA 5K0IA 2G3KA 2KK1A 2OOCA 3QVYA 2R7WA 4YL3A 4WGYA 2LD6A 3U3BA 1QPUA 4OD4A 3EH1A 1E84A 3SXYA 3H65A 4MTFA 4NC3A 3UGPA 2J7PA 2X51A 2YKZA 5E3CA 3ZTZA 1ZHWA 1C03A 3L34A 1ZU4A 4IAOA 3UGOA 4LLEA 5D91A 3U3FA 2IXMA 1OQCA 1LS1A 3LUTB 2R05A 2BL2A 1BR1A 1MMNA 5CI9A 1RCPA 4GYTA 2WZGA 2R03A 4KC9A 4ULWA 1ZHYA 4RD9A 4D4NA 4CS9C 5DS5A 2A6EF 2CGEA 2NUPB 2YLIA 3I5PA 1F1MA 1H7IA 2OJED 2EPMX 4IB4A 1VLSA 5COGA 5FZTA 1OXKA 3M15A 4C7OB 4U5HA 3HTKC 1HY5A 3C62A 3KPHA 1UG7A 2LIGA 1OR3A 2V26A 3QTHA 5JP7A 4N06A 3U2LA 2LQGA 1TR2A 4CSAA 2XS1A 1FTSA 1NU7D 3N24A 4NCQA 2AU5A 3SZRA 3JRMO 3U5SA 4IARA 2VASA 3MLGA 3DD7A 2A69F 3U8PA 1LE2A 3G4ZA 3TJ5A 3C8ZA 4EWCA 5JLIA 4O79A 5BQGA 3RFYA 1JRAA 4YT8A 4JCHA 2AWYA 2PX0A 2G3VA 3RF3A 1TKNA 4B6IA 3VRCA 1VOMA 3MYIA 3W8IA 2PF4E 3JYHA 1A7VA 3N2ZB 1I5NA 5KYUA 2YL3A 4WGZA 3LESA 4OIOF 5KYNA 4OIQF 4K1OA 3RQFA 2XM4A 3JCUQ 1EKYA 3R7CA 3FMSA 1D0ZA 1WGWA 2A0BA 2BC5A 2EIMC 3NYMA 5KYYB 5DLJA 2WZLA 1WN0A 2R7QA 3LS1A 5EGYA 5F5FA 2DI3A 2F22A 4PJNA 5L0HA 3ABLC 1ZYRF 2YLGA 4I3MA 3ATPA 4BJ1A 1D1BA 2I15A 2FAPB 2CYDA 2EPKX 3F47A 2P61A 3AG3C 4Z9HA 2D4UA 2Q7RA 4FX5A 1E86A 1DOVA 1FAPB 3JSEO 2ZXRA 3JSZA 2R25A 2HSBA 3VAYA 1BBHA 3B0VC 3CAXA 1T01A 2LFFA 2PX3A 2L6FA 1RKCA 4XQ1A 2WVQA 3DJUB 3LLIA 3RIPA 5T3TA 1O3UA 3C63A 3IPMO 1YZAA 4C3DA 2KGOA 5B3IA 3DWWA 2VC9A 4JJFA 2FFHA 3U8VA 4YT5A 3NMJA 4U9DA 3EZHA 1VLTA 3MX3A 1PCXA 4JJGA 4ANJA 3V5XA 4W8KA 2MHRA 4PJLA 4CX9A 3KYIA 1U0BB 2HMQA 1G4WR 1EA8A 2XS8A 1L3PA 4ER9A 3B71A 4Q5SF 1ORJA 3AJMA 2HZ8A 4LLCA 2Q9CA 2YVKA 4Q7CA 4DVZA 2H7VC 3B29A 1NSGB 5HSWA 3LLKA 4U5GA 1GS9A 5KYXA 3ZC4A 1A7DA 3FDQA 2B0HA 3J06A 2QUPA 3TULA 4EIYA 5L0IA 2LP4A 4U5CE 2YZSA 2M64A 2Q9AA 1Q0DA 2OCCC 4JZAA 1JOGA 1HE1A 4DBRA 1XZPA 2YL1A 4MVZA 2P0NA 3W2WA 3TQOA 3O55A 3UR3C 3DE8A 3EHMA 3OWTA 3EFOA 2KNHA 3EGXA 4MQ9F 2V3CC 3WG7C 3NYLA 3R2PA 3SEOA 3DKAA 4FESA 5A6AA 4N4WA 4PFPA 2L6GA 2W45A 3B9QA 3G50A 3S0XA 3GM3A 3LNRA 1M6TA 2LSEA 3HNLA 2A1DD 1V54C 3IQCA 2IXNA 1LE4A 1YLMA 2OU6A 4MVRA 4O7GA 2HKVA 1SF8A 1VTMP 2R7RA 1VB5A 3ZQYA 5L3QA 3U9MA 2HSQA 2RD9A 1ZZPA 1LPEA 1C02A 3A9CA 1M2OA 5E2QA 3E70C 4JTCB 5KYWA 1NZEA 1E83A 2C03A 3U9JA 3VYWA 4CS8A 4XEFA 4KNVA 2ZPAA 1D0YA 4MVQA 3GEIA 2XL8A 3RVYA 3C8GB 2L7AA 4NTFA 1LS4A 1V74B 2X0CA 5L0DA 1NG1A 1Z63A 2NUTB 4C3BA 1B68A 256BA 2WVOA 4XPXA 1ST6A 4OIRF 2H7OA 2B0JA 2Y3DA 2XSEA 3MBGA 3N0TA 2CNWD 4CJOA 3LJBA 1C17M 2EINC 1IW7F 2R7SA 1LI5A 2A68F 2XRHA 1J8MF 3JT1A 4G7OF 4XEKA 4CJGA 4RDAA 4DRIB 2PFDA 2R7TA 3RQGA 4YWQA 1H9TA 4P6IC 4EHPA 1T6QA 1H6GA 1YARO 3DM9B 3TK0A 1BDJB 4J30B 2HJMA 4J32B 4CIHA 4JRZA 5L0FA 4L6RA 3DE9A 3QVZA 3IQ5A 4JURI 5B3SC 1S7ZA 1VMAA 1FNTc 4CS7A 3LAYA 4C3EA 1TWHA 5EK0A 3PMRA 2PP4A 1WATA 2O9XA 4U5FE 3UMHA 4LDRA 3IEEA 3M1CB 2J0WA 4JTDB 4DBQA 5A6JA 3WAQA 2XLWA 3SXKA 2XL4A 1K40A 2FGYA 2J45A 2Z15A 3H2UA 3UMKA 2QTVA 2DB4A 4CSAC 3FOPA 3FAPB 1A0BA 1ZHXA 3DI5A 3K33A 1FMVA 4JVSA 3L8IA 5L0CA 1G5ZA 5E3AA 4QI2A 3O39A 3POVA 2PBEA 5EHHA 1UFBA 2IM8A 4XLNF 5A6BA 2VB6A 2NSFA 4DXWA 4NQFA 4W8PA 2D5RB 4YJWA 5KYXB 2KC3A 1Q0FA 2E87A 2LFDA 1T6UA 2ZXOA 4JE9A 4YK5A 4YL1A 2DYRC 3ABMC 2NG1A 4LDQA 5L0JA 4MNDA 1RJ9A 4HFKB 2AP3A 2HMZA 4ZLCA 4RBNA 1PD1A 2XM0A 4LDKA 4PK4A 4BJ6C 3I4UA 1N1CA 1FFHA 4OINF 1ORYA 5T3WA 2EILC 5CI8A 3VF0A 3ZVRA 5DQZA 3EGXB 1OCCC 2PNOA 3UMIA 2J8WA 5FCLA 5AGFA 2KQ9A 1M56C 3ECSA 1R5ID 3EG9A 4MS2A 3DAFA 2R7XA 1YZCA 1WWPA 4H4KC 1LVKA 4IJJA 1VYIA 3W2VA 3CQZA 3ASOC 4NY3A 1OW7A 4BJ5A 3ZIBA 2VCBA 3U0CA 1BR2A 2EPLX 2CCYA 3L8JA 3U2MA 2ZD9A 5A6BD 1SYQA 2GDCA 3S90A 2KSFA 2H7BA 2LK4A 3EZIA 5JSLA 3TJ6A 1H9GA 1BR4A 4J7TA 1OCRC 1E2XA 3BRJA 1MQVA 4KNWA 4AE4A 2YL0A 4E7ZA 2WL8A 3DAGA 1OW6A 1NU9C 2QE9A 1ORSC 1Z23A 2Y3HA 3FHDA 3V7OA 3ZG1A 1MMDA 3HKKA 2ETSA 4JW1A 4FWVA 4BEMJ 4HE8D 4E7SA 2KYHA 3GWLA 4XLPF 3RH3A 4R32A 2L81A 3F46A 2L9JA 1YYXA 3KL4A 3V5ZA 3T9OA 1T9KA 4AL0A 3Q7GA 5KYUB 3DM5A 1VYKA 1YYJA 3OA1A 1Y6DA 2KW3C 3C18A 1PV3A 1CGOA 2H8AA 3HLZA 2NSGA 1FMWA 1OKKD 4EBBA 4AL1A 3AQBA 1RKEA 1MNDA 3B0PA 3LEOA 4HEAJ 4U5DE 4EBKA 2W4BA 3V5YA 4ULVA 2ICWG 1TWGA 2ZXPA 2P7VA 3GWNA 4JKVA 2L6HA 5F5HA 3FVYA 1QKRA 2AVKA 4MVMA 3MYFA 1NBBA 1OKKA 3X1OA 3NRHA 5DS4A 1DOWA 2Q00A 4JCZA 4G78A 1K04A 1NFNA 1ZVZA 3S29A 1QSPA 5BQIA 3GEEA 3PCVA 5DVWA 3DXJF 1OXBA 1GQAA 3RYLA 4U5EE 2MWQA 1GGQA 3HNJA 3NKEA 2J9BA 2XLOA 4AK9A 2C04A 1M2VB 3T6BA 1V55C 1ZW3A 2W9YA 2GAQA 3AQCA 3Q7LA 1AUEA 4N6CA 4YN0B 5COMA 2EPNA 2VCCA 3ZDLA 4YT4A 2Y3BA 4IRUA 3US6A 4EKWA 2XXAB 3AOUA 2IXOA 1SZIA 3L0IA 4DVYP 1LIHA 1TWAA 2XLMA 2XLHA 3EH2A 2MYSA 4Q4ZF 1O5HA 2TMVP 2WVNA 2NUPA 3NDBB 2HJ3A 2J9WA 4KBLA 4BPMA 5L3VA 4C7OA 2JD3A 1R4TA 1IZMA 2R7VA 4O6MA 4PACA 5F28E 2OJQA 1FR0A 4MTGA 4A2NB 1JR8A 4CS9A 3TOLA 2JPUA 3ZQVA 5A6KA 5L0GA 1QVXA 3H2VA 4BJ6A 3HNIA 4O6YA 2CDQA 3EPVA 3RW0A 2ZXWC 1QLEC 3K6BA 3W8HA 4ONSA 1Q0MA 1OW8A 3M4BA 3WHNA 2EPOA 2BE5F 2QNLA 2WZFA 3SXZA 3EGDA 4CDYA 3EFOB 3IQ6A 2J9UA 1OR2A 2HFIA 2P1AA 1LM3B 4EUKB 1D1AA 3JYYA 3MFNA 3NMKA 5GPGB 1AVOB 1JAFA 4CIPA 1O87A 1MMAA 2DYSC 2IXPA 2GWWA 2W4MA 3SP1A 4DRJB 4IWBA 1LI7A 4HFFB 3NYJA 1Y4CA 4K0DA 2CNWA 1ZHTA 1RMVA 4QDLA 4XWJA 5D92A 3AGTA 3C8GD 3LS0A 1Z3IX 4G7ZF 1RXQA 3VM6A 4U5BE 4AX2A 3GEHA 3IQTA 5T1DB 4O6NA 4MVOA 3OEOA 3S9OA 4BG0A 2I8BA 1ZW2A 2Q4FA 2YLDA 1SR2A 4I1MA 1U89A 2YWAA 3AGUA 4P9FA 2NUTA 2OKUA 1I4ZA 2IBFA 1YA7O 1WTYA 4K7BA 3I5QA 4PJJA 5TJ5E 3WODF 3K1HA 4JTAB 1CGME 4J7YA 4G0HA 2YHSA 3KH2A 2CW0F 3LNMB 3NG1A 1LKXA 1S05A 3UNGC 1L7CA 1V4AA 4E17A 5B1AC 1A7EA 4Z9IA 2HV6A 4E0IA 5DS6A 3QW0A 4KI2A 1XWJA 3K1IA 4JIOA 4QI0A 4UDVA 1ZU5A 2YEVA 4LACB 3ABKC 3T6GB 1OCZC 3AG1C 4DOZA 1MNEA 3GODA 3JZ0A 3KMIA 1KTMA 1EQ1A 4E18A 2QLAA 2R02A 2HS5A 4FAPB 2R9RB 3AG2C 4D4XA 1YAUO 4MVUA 2JX0A 1HMOA 1U6HA 1ZHZA 1VK5A 4CDAA 3EJNA 1QQ3A
chains in the Genus database with same CATH topology
1O3UA 3C8GB 1JOGA 3RQFA 1WOLA 2LK4A 3U0CA 3MFNA 3JYYA 4EBKA 3C8GA 3BRJA 1V4AA 4XEVA 1KNYA 1OW6A 2L6GA 2L6HA 1K05A 1K40A 3GM3A 3RQEA 3K7DA 3GM1A 2Q00A 3B71A 5F28E 3O10A 1K04A 2KK1A 4R32A 3AJMA 3C8GD 4XEKA 1WWPA 2JPUA 3L8IA 3RQGA 1ZZPA 1QVXA 3JZ0A 2PBEA 1KTMA 1OW7A 3GM2A 1UFBA 4EBJA 3S9OA 2HSBA 1OW8A 2JX0A 2L6FA 3L8JA 4NQFA 3TULA 2YWAA 3C18A 4XEFA 3U3FA 1PV3A 1WTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3U A;  3C8G B;  1JOG A;  3RQF A;  1WOL A;  2LK4 A;  3U0C A;  3MFN A;  3JYY A;  4EBK A;  3C8G A;  3BRJ A;  1V4A A;  4XEV A;  1KNY A;  1OW6 A;  2L6G A;  2L6H A;  1K05 A;  1K40 A;  3GM3 A;  3RQE A;  3K7D A;  3GM1 A;  2Q00 A;  3B71 A;  5F28 E;  3O10 A;  1K04 A;  2KK1 A;  4R32 A;  3AJM A;  3C8G D;  4XEK A;  1WWP A;  2JPU A;  3L8I A;  3RQG A;  1ZZP A;  1QVX A;  3JZ0 A;  2PBE A;  1KTM A;  1OW7 A;  3GM2 A;  1UFB A;  4EBJ A;  3S9O A;  2HSB A;  1OW8 A;  2JX0 A;  2L6F A;  3L8J A;  4NQF A;  3TUL A;  2YWA A;  3C18 A;  4XEF A;  3U3F A;  1PV3 A;  1WTY A; 
#chains in the Genus database with same CATH topology
 1JPN A;  4CS8 C;  4Z9J A;  3RVZ A;  1M2V A;  1SMY F;  3FOO A;  3IHU A;  3ZWI A;  3QMK A;  2IYL D;  3G4X A;  3Q6N A;  2J9V A;  3ZTM A;  2XXA A;  2J0X A;  2Q9B A;  2VCA A;  4A4A A;  1K05 A;  1A41 A;  1E85 A;  3O6X A;  3PDM P;  1HW2 A;  2NPU A;  1PD0 A;  1G8X A;  3DMD A;  1T6I A;  1YDI A;  1JMW A;  3DJN B;  3S27 A;  5JVE A;  2HUJ A;  4NTB A;  3A11 A;  3JRT A;  2RSE B;  5BQH A;  1XZQ A;  2YL7 A;  3C7J A;  3X2Q C;  4EBJ A;  4JC7 A;  3SYN A;  4YL0 A;  1TWC A;  5KYW B;  1RJ9 B;  3S84 A;  5E33 A;  1BZ4 A;  5JRA A;  4G7H F;  5BUO A;  4P9T A;  1Q0K A;  4IGG A;  3CSK A;  2OG2 A;  3NMI A;  2UUI A;  4XTK A;  4OIP F;  2AWC A;  4M63 A;  1Z7Q c;  1G4U S;  4BJT A;  4CBE A;  3EGD B;  4IAQ A;  1AEP A;  3C8G A;  1CGN A;  2EIJ C;  4U9E A;  3NKD A;  4GQH A;  3ZSU A;  3RQE A;  3EG9 B;  1QZX A;  2OEV A;  2R7O A;  1GM5 A;  2Y3G A;  2P6V A;  2G62 A;  3FAJ A;  3GM1 A;  1YVI A;  3GAN A;  4MW8 A;  1D0X A;  3O10 A;  4I44 A;  2GFH A;  2QY9 A;  5A69 A;  3B0U X;  1T5O A;  2OQM A;  4E0H A;  2A6H F;  2VH3 A;  5DQT A;  3FXH A;  1JPJ A;  3K66 A;  3CEX A;  1Q0G A;  4WJ0 A;  3AG4 C;  1OCO C;  3M79 A;  2KJG A;  1FFT C;  1TFK B;  2XLD A;  1YA9 A;  4CDV A;  3CZ6 A;  3S28 A;  3LEV A;  5IY5 C;  1HE9 A;  1HMD A;  2Y69 C;  2XLV A;  2J46 A;  5JUA A;  1NLX A;  5HV9 A;  3HNK A;  1CPQ A;  1APC A;  1MMG A;  2A0U A;  2ASR A;  2UUH A;  2DGJ A;  4I1O B;  4AE4 B;  1TQG A;  1TFO B;  3KYJ A;  5KYY A;  3W4Y A;  4JEB A;  1W2W A;  4DJ9 A;  3BEH A;  2XL6 A;  3PHF 2;  4XPW A;  1CPR A;  2Y39 A;  5JS5 A;  5CIV A;  3Q6M A;  3ITF A;  3K1I C;  4XPY A;  5COF A;  5JT4 A;  1YJG A;  3QZC A;  2YQY A;  1D1C A;  4MTO A;  4X0R A;  3L1M A;  3E9V A;  4PFO A;  2IOQ A;  5B1B C;  3T4R A;  1I4Y A;  1WAS A;  2YRF A;  3ASN C;  2GA0 A;  3TOM A;  3M4C A;  4MVS A;  2XLE A;  3SNH A;  1M57 C;  3RKO F;  2HV7 A;  1KU2 A;  3GM2 A;  2Q3T A;  3GOR A;  4N6H A;  1NFO A;  3SXM A;  3T6J A;  5AC4 A;  3JTL O;  4BJ5 C;  1RKE B;  3EHN A;  3QW1 A;  1J8Y F;  4NTA A;  4WAB A;  4ZLD A;  2EIK C;  1Z5Z A;  1HW1 A;  1WOL A;  3EQL F;  5AC5 A;  4H54 A;  2M4E A;  2OEX A;  4LER A;  4PJM A;  1Z6A A;  4JEA A;  2LCH A;  4F4B A;  1EI7 A;  4XEV A;  4DRH B;  3DZA A;  1KNY A;  4MW3 A;  4BEJ A;  4YT2 A;  4GEH A;  4PR9 A;  2WB7 A;  3KKB A;  4OD5 A;  3TD7 A;  2J7P D;  3K7D A;  2R7U A;  3HJC A;  5K0I A;  2G3K A;  2KK1 A;  2OOC A;  3QVY A;  2R7W A;  4YL3 A;  4WGY A;  2LD6 A;  3U3B A;  1QPU A;  4OD4 A;  3EH1 A;  1E84 A;  3SXY A;  3H65 A;  4MTF A;  4NC3 A;  3UGP A;  2J7P A;  2X51 A;  2YKZ A;  5E3C A;  3ZTZ A;  1ZHW A;  1C03 A;  3L34 A;  1ZU4 A;  4IAO A;  3UGO A;  4LLE A;  5D91 A;  3U3F A;  2IXM A;  1OQC A;  1LS1 A;  3LUT B;  2R05 A;  2BL2 A;  1BR1 A;  1MMN A;  5CI9 A;  1RCP A;  4GYT A;  2WZG A;  2R03 A;  4KC9 A;  4ULW A;  1ZHY A;  4RD9 A;  4D4N A;  4CS9 C;  5DS5 A;  2A6E F;  2CGE A;  2NUP B;  2YLI A;  3I5P A;  1F1M A;  1H7I A;  2OJE D;  2EPM X;  4IB4 A;  1VLS A;  5COG A;  5FZT A;  1OXK A;  3M15 A;  4C7O B;  4U5H A;  3HTK C;  1HY5 A;  3C62 A;  3KPH A;  1UG7 A;  2LIG A;  1OR3 A;  2V26 A;  3QTH A;  5JP7 A;  4N06 A;  3U2L A;  2LQG A;  1TR2 A;  4CSA A;  2XS1 A;  1FTS A;  1NU7 D;  3N24 A;  4NCQ A;  2AU5 A;  3SZR A;  3JRM O;  3U5S A;  4IAR A;  2VAS A;  3MLG A;  3DD7 A;  2A69 F;  3U8P A;  1LE2 A;  3G4Z A;  3TJ5 A;  3C8Z A;  4EWC A;  5JLI A;  4O79 A;  5BQG A;  3RFY A;  1JRA A;  4YT8 A;  4JCH A;  2AWY A;  2PX0 A;  2G3V A;  3RF3 A;  1TKN A;  4B6I A;  3VRC A;  1VOM A;  3MYI A;  3W8I A;  2PF4 E;  3JYH A;  1A7V A;  3N2Z B;  1I5N A;  5KYU A;  2YL3 A;  4WGZ A;  3LES A;  4OIO F;  5KYN A;  4OIQ F;  4K1O A;  3RQF A;  2XM4 A;  3JCU Q;  1EKY A;  3R7C A;  3FMS A;  1D0Z A;  1WGW A;  2A0B A;  2BC5 A;  2EIM C;  3NYM A;  5KYY B;  5DLJ A;  2WZL A;  1WN0 A;  2R7Q A;  3LS1 A;  5EGY A;  5F5F A;  2DI3 A;  2F22 A;  4PJN A;  5L0H A;  3ABL C;  1ZYR F;  2YLG A;  4I3M A;  3ATP A;  4BJ1 A;  1D1B A;  2I15 A;  2FAP B;  2CYD A;  2EPK X;  3F47 A;  2P61 A;  3AG3 C;  4Z9H A;  2D4U A;  2Q7R A;  4FX5 A;  1E86 A;  1DOV A;  1FAP B;  3JSE O;  2ZXR A;  3JSZ A;  2R25 A;  2HSB A;  3VAY A;  1BBH A;  3B0V C;  3CAX A;  1T01 A;  2LFF A;  2PX3 A;  2L6F A;  1RKC A;  4XQ1 A;  2WVQ A;  3DJU B;  3LLI A;  3RIP A;  5T3T A;  1O3U A;  3C63 A;  3IPM O;  1YZA A;  4C3D A;  2KGO A;  5B3I A;  3DWW A;  2VC9 A;  4JJF A;  2FFH A;  3U8V A;  4YT5 A;  3NMJ A;  4U9D A;  3EZH A;  1VLT A;  3MX3 A;  1PCX A;  4JJG A;  4ANJ A;  3V5X A;  4W8K A;  2MHR A;  4PJL A;  4CX9 A;  3KYI A;  1U0B B;  2HMQ A;  1G4W R;  1EA8 A;  2XS8 A;  1L3P A;  4ER9 A;  3B71 A;  4Q5S F;  1ORJ A;  3AJM A;  2HZ8 A;  4LLC A;  2Q9C A;  2YVK A;  4Q7C A;  4DVZ A;  2H7V C;  3B29 A;  1NSG B;  5HSW A;  3LLK A;  4U5G A;  1GS9 A;  5KYX A;  3ZC4 A;  1A7D A;  3FDQ A;  2B0H A;  3J06 A;  2QUP A;  3TUL A;  4EIY A;  5L0I A;  2LP4 A;  4U5C E;  2YZS A;  2M64 A;  2Q9A A;  1Q0D A;  2OCC C;  4JZA A;  1JOG A;  1HE1 A;  4DBR A;  1XZP A;  2YL1 A;  4MVZ A;  2P0N A;  3W2W A;  3TQO A;  3O55 A;  3UR3 C;  3DE8 A;  3EHM A;  3OWT A;  3EFO A;  2KNH A;  3EGX A;  4MQ9 F;  2V3C C;  3WG7 C;  3NYL A;  3R2P A;  3SEO A;  3DKA A;  4FES A;  5A6A A;  4N4W A;  4PFP A;  2L6G A;  2W45 A;  3B9Q A;  3G50 A;  3S0X A;  3GM3 A;  3LNR A;  1M6T A;  2LSE A;  3HNL A;  2A1D D;  1V54 C;  3IQC A;  2IXN A;  1LE4 A;  1YLM A;  2OU6 A;  4MVR A;  4O7G A;  2HKV A;  1SF8 A;  1VTM P;  2R7R A;  1VB5 A;  3ZQY A;  5L3Q A;  3U9M A;  2HSQ A;  2RD9 A;  1ZZP A;  1LPE A;  1C02 A;  3A9C A;  1M2O A;  5E2Q A;  3E70 C;  4JTC B;  5KYW A;  1NZE A;  1E83 A;  2C03 A;  3U9J A;  3VYW A;  4CS8 A;  4XEF A;  4KNV A;  2ZPA A;  1D0Y A;  4MVQ A;  3GEI A;  2XL8 A;  3RVY A;  3C8G B;  2L7A A;  4NTF A;  1LS4 A;  1V74 B;  2X0C A;  5L0D A;  1NG1 A;  1Z63 A;  2NUT B;  4C3B A;  1B68 A;  256B A;  2WVO A;  4XPX A;  1ST6 A;  4OIR F;  2H7O A;  2B0J A;  2Y3D A;  2XSE A;  3MBG A;  3N0T A;  2CNW D;  4CJO A;  3LJB A;  1C17 M;  2EIN C;  1IW7 F;  2R7S A;  1LI5 A;  2A68 F;  2XRH A;  1J8M F;  3JT1 A;  4G7O F;  4XEK A;  4CJG A;  4RDA A;  4DRI B;  2PFD A;  2R7T A;  3RQG A;  4YWQ A;  1H9T A;  4P6I C;  4EHP A;  1T6Q A;  1H6G A;  1YAR O;  3DM9 B;  3TK0 A;  1BDJ B;  4J30 B;  2HJM A;  4J32 B;  4CIH A;  4JRZ A;  5L0F A;  4L6R A;  3DE9 A;  3QVZ A;  3IQ5 A;  4JUR I;  5B3S C;  1S7Z A;  1VMA A;  1FNT c;  4CS7 A;  3LAY A;  4C3E A;  1TWH A;  5EK0 A;  3PMR A;  2PP4 A;  1WAT A;  2O9X A;  4U5F E;  3UMH A;  4LDR A;  3IEE A;  3M1C B;  2J0W A;  4JTD B;  4DBQ A;  5A6J A;  3WAQ A;  2XLW A;  3SXK A;  2XL4 A;  1K40 A;  2FGY A;  2J45 A;  2Z15 A;  3H2U A;  3UMK A;  2QTV A;  2DB4 A;  4CSA C;  3FOP A;  3FAP B;  1A0B A;  1ZHX A;  3DI5 A;  3K33 A;  1FMV A;  4JVS A;  3L8I A;  5L0C A;  1G5Z A;  5E3A A;  4QI2 A;  3O39 A;  3POV A;  2PBE A;  5EHH A;  1UFB A;  2IM8 A;  4XLN F;  5A6B A;  2VB6 A;  2NSF A;  4DXW A;  4NQF A;  4W8P A;  2D5R B;  4YJW A;  5KYX B;  2KC3 A;  1Q0F A;  2E87 A;  2LFD A;  1T6U A;  2ZXO A;  4JE9 A;  4YK5 A;  4YL1 A;  2DYR C;  3ABM C;  2NG1 A;  4LDQ A;  5L0J A;  4MND A;  1RJ9 A;  4HFK B;  2AP3 A;  2HMZ A;  4ZLC A;  4RBN A;  1PD1 A;  2XM0 A;  4LDK A;  4PK4 A;  4BJ6 C;  3I4U A;  1N1C A;  1FFH A;  4OIN F;  1ORY A;  5T3W A;  2EIL C;  5CI8 A;  3VF0 A;  3ZVR A;  5DQZ A;  3EGX B;  1OCC C;  2PNO A;  3UMI A;  2J8W A;  5FCL A;  5AGF A;  2KQ9 A;  1M56 C;  3ECS A;  1R5I D;  3EG9 A;  4MS2 A;  3DAF A;  2R7X A;  1YZC A;  1WWP A;  4H4K C;  1LVK A;  4IJJ A;  1VYI A;  3W2V A;  3CQZ A;  3ASO C;  4NY3 A;  1OW7 A;  4BJ5 A;  3ZIB A;  2VCB A;  3U0C A;  1BR2 A;  2EPL X;  2CCY A;  3L8J A;  3U2M A;  2ZD9 A;  5A6B D;  1SYQ A;  2GDC A;  3S90 A;  2KSF A;  2H7B A;  2LK4 A;  3EZI A;  5JSL A;  3TJ6 A;  1H9G A;  1BR4 A;  4J7T A;  1OCR C;  1E2X A;  3BRJ A;  1MQV A;  4KNW A;  4AE4 A;  2YL0 A;  4E7Z A;  2WL8 A;  3DAG A;  1OW6 A;  1NU9 C;  2QE9 A;  1ORS C;  1Z23 A;  2Y3H A;  3FHD A;  3V7O A;  3ZG1 A;  1MMD A;  3HKK A;  2ETS A;  4JW1 A;  4FWV A;  4BEM J;  4HE8 D;  4E7S A;  2KYH A;  3GWL A;  4XLP F;  3RH3 A;  4R32 A;  2L81 A;  3F46 A;  2L9J A;  1YYX A;  3KL4 A;  3V5Z A;  3T9O A;  1T9K A;  4AL0 A;  3Q7G A;  5KYU B;  3DM5 A;  1VYK A;  1YYJ A;  3OA1 A;  1Y6D A;  2KW3 C;  3C18 A;  1PV3 A;  1CGO A;  2H8A A;  3HLZ A;  2NSG A;  1FMW A;  1OKK D;  4EBB A;  4AL1 A;  3AQB A;  1RKE A;  1MND A;  3B0P A;  3LEO A;  4HEA J;  4U5D E;  4EBK A;  2W4B A;  3V5Y A;  4ULV A;  2ICW G;  1TWG A;  2ZXP A;  2P7V A;  3GWN A;  4JKV A;  2L6H A;  5F5H A;  3FVY A;  1QKR A;  2AVK A;  4MVM A;  3MYF A;  1NBB A;  1OKK A;  3X1O A;  3NRH A;  5DS4 A;  1DOW A;  2Q00 A;  4JCZ A;  4G78 A;  1K04 A;  1NFN A;  1ZVZ A;  3S29 A;  1QSP A;  5BQI A;  3GEE A;  3PCV A;  5DVW A;  3DXJ F;  1OXB A;  1GQA A;  3RYL A;  4U5E E;  2MWQ A;  1GGQ A;  3HNJ A;  3NKE A;  2J9B A;  2XLO A;  4AK9 A;  2C04 A;  1M2V B;  3T6B A;  1V55 C;  1ZW3 A;  2W9Y A;  2GAQ A;  3AQC A;  3Q7L A;  1AUE A;  4N6C A;  4YN0 B;  5COM A;  2EPN A;  2VCC A;  3ZDL A;  4YT4 A;  2Y3B A;  4IRU A;  3US6 A;  4EKW A;  2XXA B;  3AOU A;  2IXO A;  1SZI A;  3L0I A;  4DVY P;  1LIH A;  1TWA A;  2XLM A;  2XLH A;  3EH2 A;  2MYS A;  4Q4Z F;  1O5H A;  2TMV P;  2WVN A;  2NUP A;  3NDB B;  2HJ3 A;  2J9W A;  4KBL A;  4BPM A;  5L3V A;  4C7O A;  2JD3 A;  1R4T A;  1IZM A;  2R7V A;  4O6M A;  4PAC A;  5F28 E;  2OJQ A;  1FR0 A;  4MTG A;  4A2N B;  1JR8 A;  4CS9 A;  3TOL A;  2JPU A;  3ZQV A;  5A6K A;  5L0G A;  1QVX A;  3H2V A;  4BJ6 A;  3HNI A;  4O6Y A;  2CDQ A;  3EPV A;  3RW0 A;  2ZXW C;  1QLE C;  3K6B A;  3W8H A;  4ONS A;  1Q0M A;  1OW8 A;  3M4B A;  3WHN A;  2EPO A;  2BE5 F;  2QNL A;  2WZF A;  3SXZ A;  3EGD A;  4CDY A;  3EFO B;  3IQ6 A;  2J9U A;  1OR2 A;  2HFI A;  2P1A A;  1LM3 B;  4EUK B;  1D1A A;  3JYY A;  3MFN A;  3NMK A;  5GPG B;  1AVO B;  1JAF A;  4CIP A;  1O87 A;  1MMA A;  2DYS C;  2IXP A;  2GWW A;  2W4M A;  3SP1 A;  4DRJ B;  4IWB A;  1LI7 A;  4HFF B;  3NYJ A;  1Y4C A;  4K0D A;  2CNW A;  1ZHT A;  1RMV A;  4QDL A;  4XWJ A;  5D92 A;  3AGT A;  3C8G D;  3LS0 A;  1Z3I X;  4G7Z F;  1RXQ A;  3VM6 A;  4U5B E;  4AX2 A;  3GEH A;  3IQT A;  5T1D B;  4O6N A;  4MVO A;  3OEO A;  3S9O A;  4BG0 A;  2I8B A;  1ZW2 A;  2Q4F A;  2YLD A;  1SR2 A;  4I1M A;  1U89 A;  2YWA A;  3AGU A;  4P9F A;  2NUT A;  2OKU A;  1I4Z A;  2IBF A;  1YA7 O;  1WTY A;  4K7B A;  3I5Q A;  4PJJ A;  5TJ5 E;  3WOD F;  3K1H A;  4JTA B;  1CGM E;  4J7Y A;  4G0H A;  2YHS A;  3KH2 A;  2CW0 F;  3LNM B;  3NG1 A;  1LKX A;  1S05 A;  3UNG C;  1L7C A;  1V4A A;  4E17 A;  5B1A C;  1A7E A;  4Z9I A;  2HV6 A;  4E0I A;  5DS6 A;  3QW0 A;  4KI2 A;  1XWJ A;  3K1I A;  4JIO A;  4QI0 A;  4UDV A;  1ZU5 A;  2YEV A;  4LAC B;  3ABK C;  3T6G B;  1OCZ C;  3AG1 C;  4DOZ A;  1MNE A;  3GOD A;  3JZ0 A;  3KMI A;  1KTM A;  1EQ1 A;  4E18 A;  2QLA A;  2R02 A;  2HS5 A;  4FAP B;  2R9R B;  3AG2 C;  4D4X A;  1YAU O;  4MVU A;  2JX0 A;  1HMO A;  1U6H A;  1ZHZ A;  1VK5 A;  4CDA A;  3EJN A;  1QQ3 A; 
#chains in the Genus database with same CATH homology
 1O3U A;  3C8G B;  1JOG A;  3RQF A;  1WOL A;  2LK4 A;  3U0C A;  3MFN A;  3JYY A;  4EBK A;  3C8G A;  3BRJ A;  1V4A A;  4XEV A;  1KNY A;  1OW6 A;  2L6G A;  2L6H A;  1K05 A;  1K40 A;  3GM3 A;  3RQE A;  3K7D A;  3GM1 A;  2Q00 A;  3B71 A;  5F28 E;  3O10 A;  1K04 A;  2KK1 A;  4R32 A;  3AJM A;  3C8G D;  4XEK A;  1WWP A;  2JPU A;  3L8I A;  3RQG A;  1ZZP A;  1QVX A;  3JZ0 A;  2PBE A;  1KTM A;  1OW7 A;  3GM2 A;  1UFB A;  4EBJ A;  3S9O A;  2HSB A;  1OW8 A;  2JX0 A;  2L6F A;  3L8J A;  4NQF A;  3TUL A;  2YWA A;  3C18 A;  4XEF A;  3U3F A;  1PV3 A;  1WTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...