2JX0A

The paxillin-binding domain (pbd) of g protein coupled receptor (gpcr)-kinase (grk) interacting protein 1 (git1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
LDGDPDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARF GTPase-activating protein GIT1
publication title GIT1 paxillin-binding domain is a four-helix bundle, and it binds to both paxillin LD2 and LD4 motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion, signaling protein
total genus 41
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12205 GIT1_C G protein-coupled receptor kinase-interacting protein 1 C term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jx0A00
1QVXA 3GM2A 2KK1A 3L8IA 2LK4A 3O10A 3RQGA 3B71A 1JOGA 1ZZPA 2PBEA 1V4AA 1OW8A 1K40A 1KNYA 3L8JA 3K7DA 4EBJA 1WWPA 2JX0A 3JYYA 3RQEA 1PV3A 3GM3A 2HSBA 1WOLA 2L6FA 2Q00A 2L6HA 3C18A 1WTYA 3U3FA 1K05A 2YWAA 3AJMA 3C8GD 1UFBA 4R32A 4XEVA 3RQFA 4XEKA 1K04A 1OW7A 1OW6A 3GM1A 3MFNA 3JZ0A 1O3UA 4XEFA 1KTMA 3U0CA 2JPUA 3C8GB 3C8GA 3TULA 4EBKA 2L6GA 3BRJA 5F28E 3S9OA 4NQFA
chains in the Genus database with same CATH superfamily
5JUAA 1A7DA 3T6GB 1SYQA 3X2QC 3K33A 5CIVA 2XM4A 1VK5A 2DGJA 1ORJA 4GQHA 4U5FE 4PJMA 4EUKB 3DXJF 1I4ZA 4CIHA 5L0HA 1K40A 2WVOA 5E3CA 3K7DA 4CBEA 3FOPA 2OU6A 3C7JA 3UNGC 4BJ5C 3N24A 3RQEA 3E9VA 3GM3A 3VM6A 1OKKD 3C63A 4Z9JA 1NFOA 2DYRC 2XL6A 4OIOF 4BPMA 3T6JA 1ZYRF 2R7VA 2LQGA 3NDBB 1GS9A 2A68F 1MQVA 4CS9C 1OXBA 4JURI 5JRAA 4U9DA 5B3SC 3ITFA 3ABMC 1ZW3A 4J7TA 4K0DA 4G0HA 1KTMA 2BC5A 3JTLO 3U2LA 4JE9A 3WAQA 4DRIB 5L3QA 3RIPA 5K0IA 1JPNA 3GWLA 1F1MA 4U9EA 1W2WA 2LIGA 5L0IA 3GODA 3AG2C 3G50A 1TWHA 3GANA 1CGNA 3NYMA 2XL8A 4JC7A 1FAPB 3TK0A 1OCZC 3JYYA 3RFYA 3I4UA 4MVRA 2L6FA 2VB6A 3EGDB 2L6HA 3CEXA 1JMWA 3AQCA 4PJJA 3F47A 5JP7A 4CDYA 1FR0A 1H9TA 3C8GD 4G78A 3DJUB 3FVYA 3LS0A 4Z9IA 2NUTA 4E7ZA 3NMIA 1OKKA 4O6MA 3V5YA 1RCPA 2HFIA 1Q0DA 3POVA 4JCHA 3U8PA 3ZWIA 4HFFB 4YL1A 2VASA 3EHMA 4YK5A 3ZDLA 3TULA 5F28E 2OJQA 1YA7O 1TFOB 3OEOA 1CPQA 2C03A 4O7GA 3QTHA 4EWCA 5DS5A 2Y3DA 5EGYA 2QTVA 2WVNA 3HTKC 3U9JA 1QKRA 2KSFA 2W45A 3DZAA 2GDCA 1D0YA 5E33A 5T3TA 2IOQA 1WOLA 2MHRA 3A11A 3AGUA 4JTAB 3K66A 4BJ6C 5BQIA 3X1OA 1K05A 3U9MA 2NPUA 2PX0A 4DXWA 2XLEA 2UUIA 4CS8A 3AG3C 1YYJA 4CSAA 1CPRA 4CSAC 3NYLA 3U8VA 3W8HA 2EIMC 3HLZA 4IWBA 3J06A 3IQ5A 1HE1A 1XZPA 1O3UA 2CYDA 3DMDA 1U89A 3NG1A 3C8GB 2G62A 3C8GA 3VRCA 4YT2A 4YT5A 4E18A 2H8AA 1GQAA 3M79A 3KPHA 1ST6A 1CGOA 1A0BA 4MVUA 2LD6A 3GORA 4NY3A 3W2WA 3LEVA 3PHF2 2KW3C 1E86A 3ECSA 1ZVZA 1FFTC 2R7QA 3F46A 3S28A 2XLMA 3JSEO 2ZXOA 2FGYA 3AG4C 3G4XA 2ETSA 1T6IA 1KU2A 2LP4A 1M2VB 1M2VA 3N2ZB 2VCAA 2R7RA 4I1OB 4JEBA 4MW8A 1T9KA 1MNEA 2B0JA 2XSEA 3NMJA 3U2MA 2D5RB 3VF0A 4CIPA 4QI2A 3OA1A 4XEVA 4NTBA 3W2VA 2ASRA 1EI7A 1M56C 1N1CA 1MMGA 2YL7A 3UMHA 256BA 3EHNA 3RVZA 1YARO 1Q0KA 2R25A 3JZ0A 2G3VA 2NG1A 4PJLA 3UGOA 2WVQA 1HE9A 2WZLA 2D4UA 4P9TA 3ZTZA 3DM5A 2LFFA 5AGFA 4U5BE 3GWNA 3EPVA 2XL4A 4JVSA 1JOGA 4U5CE 1CGME 1DOWA 2PBEA 2WZFA 4YT4A 2G3KA 4G7ZF 1BBHA 3UMIA 3EZIA 2HJMA 5KYNA 1Z63A 3MYIA 4JEAA 1WTYA 2YLIA 4C3DA 1H9GA 1BDJB 2HJ3A 5JSLA 2GAQA 4AE4B 4AE4A 5FCLA 5KYYA 3DE8A 4GYTA 4JKVA 3QW0A 1U6HA 2I15A 2WB7A 1Z6AA 2W4MA 2CW0F 1R4TA 2W4BA 3EFOA 4BJ1A 4DVZA 3LLIA 3BEHA 1YA9A 4Z9HA 3ZVRA 5KYXB 3QMKA 5KYXA 1O5HA 5A6KA 3S9OA 2GFHA 4N4WA 4A4AA 2MYSA 3HJCA 4FAPB 3H2UA 3LS1A 4W8KA 1RXQA 3H65A 5AC5A 5A69A 1OW8A 2DB4A 1RJ9A 1I4YA 2AU5A 3WODF 4FWVA 2LSEA 3LLKA 1PV3A 4BJ5A 2PX3A 5L0FA 3AOUA 4I44A 4J7YA 4IARA 4JTCB 4X0RA 1YZAA 1T6QA 2J9WA 4G7HF 2NSFA 2R9RB 5FZTA 4PFOA 3TOLA 2J7PD 3ZSUA 3S90A 3AG1C 4ANJA 2AP3A 4YN0B 2R7WA 3IHUA 4AL0A 4YL0A 2Q9CA 4CS9A 3GM1A 1Q0MA 2J9VA 2QNLA 3CSKA 3LNRA 4HFKB 4WABA 3TJ6A 5A6AA 3TQOA 1C03A 1G4US 3B0UX 3ASOC 1FMVA 5DVWA 2GWWA 4O79A 5BQHA 1M6TA 4JZAA 1LI5A 4M63A 1APCA 3S84A 2R02A 4Q4ZF 2KK1A 2XM0A 3HNJA 2KC3A 3SP1A 4CJGA 4C7OA 2WZGA 3ZIBA 2AVKA 1HMOA 3IEEA 4RBNA 1RMVA 1U0BB 1D1CA 1PCXA 1QQ3A 2KJGA 2QY9A 3CZ6A 3NKDA 4AX2A 4ULVA 3W4YA 3G4ZA 4BJTA 5A6BD 1LIHA 4O6NA 2IXNA 3FXHA 3DAFA 3U3FA 1YVIA 4I1MA 1HW2A 2J0WA 3M15A 2Q7RA 2YLGA 4YJWA 1NG1A 1OCOC 3ATPA 3CAXA 1VB5A 2HS5A 2DI3A 4JCZA 2NUTB 4DBQA 3T9OA 4MTGA 4XTKA 2QUPA 3GEIA 4MNDA 4BEMJ 5L3VA 4Q7CA 5DQZA 1R5ID 2J7PA 3NYJA 4ZLDA 1UG7A 4NQFA 1NU9C 3IPMO 1D0ZA 2M64A 4JJGA 4MQ9F 2XXAB 2XXAA 4K7BA 2EPNA 1D1BA 1E83A 2YHSA 1ZZPA 2YL3A 4XWJA 1GGQA 4NCQA 3GEEA 2IBFA 1Z5ZA 1ZHXA 2IXOA 5DS4A 4AL1A 3S0XA 2HKVA 4MVMA 4XQ1A 4RDAA 4ZLCA 5F5HA 4N06A 4C3EA 4EHPA 1EA8A 4IGGA 2YKZA 4BJ6A 3EGXB 4YL3A 3EGXA 3MLGA 4LERA 4YT8A 1HY5A 3DWWA 2X0CA 3K1IC 3MX3A 2M4EA 1M57C 5COFA 3RF3A 2EIKC 2E87A 1OQCA 3PMRA 4MVZA 3RVYA 4EBBA 2R7XA 2V26A 5D91A 1H6GA 3HNKA 3O55A 3LAYA 4DVYP 3I5PA 4U5GA 2R7OA 2J45A 4QDLA 5COGA 2LCHA 4JW1A 4FX5A 4XPYA 2TMVP 4U5EE 1BR2A 1BR1A 3SYNA 2CCYA 3L8JA 3R2PA 4LLEA 2ZD9A 5HSWA 1Q0GA 3NMKA 1JRAA 4IB4A 1J8MF 2R05A 2Z15A 2DYSC 2Y3BA 3LJBA 2NUPB 4JIOA 2NUPA 3LNMB 4E0IA 4KI2A 1I5NA 1M2OA 2KGOA 4ONSA 4U5HA 4DJ9A 1FNTc 2OJED 4IAOA 3U5SA 2JD3A 4DRHB 2Y39A 3OWTA 2A6HF 4WGZA 1MNDA 3T6BA 3SXYA 1VYKA 2ICWG 3MYFA 3NRHA 2UUHA 3WG7C 4CJOA 2L6GA 1BR4A 1AEPA 1L7CA 4DRJB 3K6BA 3KYJA 3R7CA 1GM5A 3SZRA 3V5XA 2XLOA 5D92A 3ASNC 5T3WA 4K1OA 1V4AA 5JT4A 5L0CA 3VYWA 2KNHA 1A7EA 1YDIA 5JS5A 3KH2A 2FFHA 3DKAA 4MTOA 4E7SA 5GPGB 5EHHA 1NZEA 1LE4A 4BG0A 2H7BA 2P6VA 3C8ZA 1WASA 1ORYA 2OEXA 5IY5C 4Q5SF 1J8YF 1OCRC 4MVQA 2I8BA 5KYYB 2RD9A 2R7TA 1ZHYA 3FMSA 4XEKA 1MMNA 2A0BA 2BE5F 4KNWA 4P9FA 2CGEA 4DBRA 1T5OA 1QSPA 1XZQA 1RKEB 2P0NA 1RKEA 2OOCA 1HW1A 2XLDA 3DAGA 3EFOB 3FAJA 2BL2A 5BQGA 4A2NB 2QE9A 4CDVA 1HMDA 2HMQA 1NBBA 1JPJA 2IM8A 4HE8D 3B29A 1QVXA 5DLJA 3B9QA 3E70C 2VCBA 2VCCA 3LUTB 2A1DD 1NU7D 1T6UA 3B71A 3M4BA 1VYIA 4LLCA 2HV7A 2XLHA 2A6EF 3EG9B 1TKNA 3EG9A 1B68A 1RJ9B 3H2VA 3RKOF 3ZC4A 2JX0A 2L81A 3JT1A 2R03A 2PNOA 4NTFA 3VAYA 1ZU5A 4OINF 3AQBA 4IAQA 3N0TA 4RD9A 5CI8A 2EIJC 3AJMA 2YL0A 3KL4A 4R32A 2YL1A 4XPXA 3RQFA 1IW7F 4NTAA 1C02A 4XPWA 1O87A 3RH3A 3FDQA 1Q0FA 3ABLC 4ULWA 5F5FA 1D1AA 1QPUA 2CDQA 3JSZA 1WN0A 1Z7Qc 3AGTA 1NLXA 3S29A 4LDQA 1DOVA 1G8XA 2JPUA 4LDKA 4BEJA 5KYWA 2OCCC 3US6A 3ZG1A 3BRJA 1XWJA 1TWCA 5DQTA 1YLMA 1ZHWA 1YAUO 2KYHA 2ZPAA 1QLEC 4WGYA 4C7OB 3PDMP 5DS6A 2EILC 4F4BA 3RW0A 3LESA 3FOOA 1G4WR 5KYUA 5KYUB 1Z3IX 3U3BA 2X51A 4FESA 1PD0A 2WL8A 1T01A 1PD1A 4OD4A 2NSGA 3ZTMA 1EKYA 1V55C 1LS1A 4P6IC 1VLTA 3QVYA 3K1HA 2HV6A 3KYIA 2J0XA 2OG2A 4MVSA 2QLAA 4E0HA 2V3CC 4CX9A 1Y4CA 1OR2A 5E3AA 1ORSC 3W8IA 3SXMA 2ZXRA 2R7SA 4D4XA 2HUJA 3KKBA 4IRUA 4XEFA 1S05A 4B6IA 1LVKA 5KYWB 2J8WA 4EBKA 3JRTA 4PFPA 3L0IA 5E2QA 3SXZA 2J46A 4PACA 3RQGA 4UDVA 2HSQA 3IQTA 1SF8A 2EPMX 1G5ZA 2EPLX 2VC9A 1NSGB 1LI7A 1V54C 2XLWA 4JTDB 3SXKA 4J30B 3C62A 2OQMA 5A6JA 4HEAJ 2HSBA 3EGDA 3JYHA 3JCUQ 1JAFA 2Q00A 1VMAA 3UGPA 3S27A 3DM9B 2AWYA 3HNLA 2YQYA 4XLNF 3HKKA 2OKUA 3O6XA 3K1IA 4ER9A 2ZXWC 2PFDA 3ABKC 3M4CA 1A41A 2J9BA 1LM3B 1OW6A 1ZW2A 1RKCA 3LEOA 2YZSA 3TD7A 5A6BA 4PK4A 3L1MA 3RYLA 3V7OA 4PJNA 4OIRF 1NFNA 1SMYF 1LE2A 1FTSA 2CNWD 2PP4A 4GEHA 3MBGA 4H54A 3DJNB 4AK9A 2Q9BA 3Q7GA 5L0GA 2LK4A 2L9JA 2Y3GA 5L0DA 3Q6MA 1Y6DA 4JJFA 3EQLF 3T4RA 1E85A 2P61A 2OEVA 3FAPB 3ZQYA 3Q6NA 3SEOA 4EBJA 2C04A 2XS1A 1FFHA 1WWPA 1LKXA 2Q4FA 3EH2A 3IQ6A 4JRZA 4KBLA 2YRFA 2H7VC 1LPEA 1WGWA 2VH3A 1VLSA 2A69F 2LFDA 4W8PA 2AWCA 4C3BA 3FHDA 4CDAA 5T1DB 3KMIA 2J9UA 1TQGA 1Z23A 2O9XA 4CS8C 2A0UA 5HV9A 3M1CB 2GA0A 3DD7A 3JRMO 3O39A 4G7OF 2F22A 1TWGA 2FAPB 3TOMA 1BZ4A 5TJ5E 1VTMP 2B0HA 1TFKB 4U5DE 1AUEA 2HMZA 2EINC 3EZHA 2IXMA 4I3MA 2Q3TA 1ZU4A 1AVOB 1C17M 1A7VA 2P1AA 1WATA 4L6RA 4MS2A 3GM2A 3O10A 3HNIA 5B3IA 3ZQVA 4OIPF 2Q9AA 2EPOA 1V74B 3QW1A 1KNYA 4NC3A 1SZIA 3B0PA 1ZHZA 2ZXPA 1VOMA 3B0VC 4E17A 1H7IA 2CNWA 3Q7LA 3QVZA 4CS7A 4EKWA 5JLIA 5AC4A 3EJNA 2L7AA 4WJ0A 3NKEA 4MTFA 5COMA 5CI9A 2KQ9A 4PR9A 1OR3A 1UFBA 3TJ5A 1QZXA 2IXPA 4N6HA 1L3PA 3UR3C 1OW7A 2W9YA 5L0JA 1JR8A 3EH1A 4OIQF 5B1BC 2IYLD 1SR2A 4YWQA 3U0CA 4N6CA 3DE9A 1S7ZA 2YEVA 1OCCC 2Y3HA 2XS8A 3MFNA 1IZMA 4LACB 3UMKA 2P7VA 3L8IA 3L34A 3CQZA 4H4KC 4OD5A 1EQ1A 3IQCA 5B1AC 2YVKA 3I5QA 1YZCA 1LS4A 4MVOA 5EK0A 2R7UA 1E84A 2RSEB 4KNVA 3SNHA 1OXKA 3PCVA 4J32B 1E2XA 2HZ8A 5BUOA 1ZHTA 1MMDA 3GEHA 4DOZA 3C18A 4XLPF 4IJJA 2PF4E 1YJGA 2YLDA 2YWAA 4MW3A 4D4NA 1D0XA 1K04A 2XRHA 3V5ZA 2XLVA 1MMAA 2EPKX 3A9CA 3DI5A 1YYXA 3QZCA 3WHNA 2H7OA 2MWQA 1FMWA 4EIYA 1TWAA 5JVEA 4LDRA 4O6YA 1TR2A 2Y69C 4KC9A 4QI0A
chains in the Genus database with same CATH topology
1QVXA 3GM2A 2KK1A 3L8IA 2LK4A 3O10A 3RQGA 3B71A 1JOGA 1ZZPA 2PBEA 1V4AA 1OW8A 1K40A 1KNYA 3L8JA 3K7DA 4EBJA 1WWPA 2JX0A 3JYYA 3RQEA 1PV3A 3GM3A 2HSBA 1WOLA 2L6FA 2Q00A 2L6HA 3C18A 1WTYA 3U3FA 1K05A 2YWAA 3AJMA 3C8GD 1UFBA 4R32A 4XEVA 3RQFA 4XEKA 1K04A 1OW7A 1OW6A 3GM1A 3MFNA 3JZ0A 1O3UA 4XEFA 1KTMA 3U0CA 2JPUA 3C8GB 3C8GA 3TULA 4EBKA 2L6GA 3BRJA 5F28E 3S9OA 4NQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVX A;  3GM2 A;  2KK1 A;  3L8I A;  2LK4 A;  3O10 A;  3RQG A;  3B71 A;  1JOG A;  1ZZP A;  2PBE A;  1V4A A;  1OW8 A;  1K40 A;  1KNY A;  3L8J A;  3K7D A;  4EBJ A;  1WWP A;  2JX0 A;  3JYY A;  3RQE A;  1PV3 A;  3GM3 A;  2HSB A;  1WOL A;  2L6F A;  2Q00 A;  2L6H A;  3C18 A;  1WTY A;  3U3F A;  1K05 A;  2YWA A;  3AJM A;  3C8G D;  1UFB A;  4R32 A;  4XEV A;  3RQF A;  4XEK A;  1K04 A;  1OW7 A;  1OW6 A;  3GM1 A;  3MFN A;  3JZ0 A;  1O3U A;  4XEF A;  1KTM A;  3U0C A;  2JPU A;  3C8G B;  3C8G A;  3TUL A;  4EBK A;  2L6G A;  3BRJ A;  5F28 E;  3S9O A;  4NQF A; 
#chains in the Genus database with same CATH topology
 5JUA A;  1A7D A;  3T6G B;  1SYQ A;  3X2Q C;  3K33 A;  5CIV A;  2XM4 A;  1VK5 A;  2DGJ A;  1ORJ A;  4GQH A;  4U5F E;  4PJM A;  4EUK B;  3DXJ F;  1I4Z A;  4CIH A;  5L0H A;  1K40 A;  2WVO A;  5E3C A;  3K7D A;  4CBE A;  3FOP A;  2OU6 A;  3C7J A;  3UNG C;  4BJ5 C;  3N24 A;  3RQE A;  3E9V A;  3GM3 A;  3VM6 A;  1OKK D;  3C63 A;  4Z9J A;  1NFO A;  2DYR C;  2XL6 A;  4OIO F;  4BPM A;  3T6J A;  1ZYR F;  2R7V A;  2LQG A;  3NDB B;  1GS9 A;  2A68 F;  1MQV A;  4CS9 C;  1OXB A;  4JUR I;  5JRA A;  4U9D A;  5B3S C;  3ITF A;  3ABM C;  1ZW3 A;  4J7T A;  4K0D A;  4G0H A;  1KTM A;  2BC5 A;  3JTL O;  3U2L A;  4JE9 A;  3WAQ A;  4DRI B;  5L3Q A;  3RIP A;  5K0I A;  1JPN A;  3GWL A;  1F1M A;  4U9E A;  1W2W A;  2LIG A;  5L0I A;  3GOD A;  3AG2 C;  3G50 A;  1TWH A;  3GAN A;  1CGN A;  3NYM A;  2XL8 A;  4JC7 A;  1FAP B;  3TK0 A;  1OCZ C;  3JYY A;  3RFY A;  3I4U A;  4MVR A;  2L6F A;  2VB6 A;  3EGD B;  2L6H A;  3CEX A;  1JMW A;  3AQC A;  4PJJ A;  3F47 A;  5JP7 A;  4CDY A;  1FR0 A;  1H9T A;  3C8G D;  4G78 A;  3DJU B;  3FVY A;  3LS0 A;  4Z9I A;  2NUT A;  4E7Z A;  3NMI A;  1OKK A;  4O6M A;  3V5Y A;  1RCP A;  2HFI A;  1Q0D A;  3POV A;  4JCH A;  3U8P A;  3ZWI A;  4HFF B;  4YL1 A;  2VAS A;  3EHM A;  4YK5 A;  3ZDL A;  3TUL A;  5F28 E;  2OJQ A;  1YA7 O;  1TFO B;  3OEO A;  1CPQ A;  2C03 A;  4O7G A;  3QTH A;  4EWC A;  5DS5 A;  2Y3D A;  5EGY A;  2QTV A;  2WVN A;  3HTK C;  3U9J A;  1QKR A;  2KSF A;  2W45 A;  3DZA A;  2GDC A;  1D0Y A;  5E33 A;  5T3T A;  2IOQ A;  1WOL A;  2MHR A;  3A11 A;  3AGU A;  4JTA B;  3K66 A;  4BJ6 C;  5BQI A;  3X1O A;  1K05 A;  3U9M A;  2NPU A;  2PX0 A;  4DXW A;  2XLE A;  2UUI A;  4CS8 A;  3AG3 C;  1YYJ A;  4CSA A;  1CPR A;  4CSA C;  3NYL A;  3U8V A;  3W8H A;  2EIM C;  3HLZ A;  4IWB A;  3J06 A;  3IQ5 A;  1HE1 A;  1XZP A;  1O3U A;  2CYD A;  3DMD A;  1U89 A;  3NG1 A;  3C8G B;  2G62 A;  3C8G A;  3VRC A;  4YT2 A;  4YT5 A;  4E18 A;  2H8A A;  1GQA A;  3M79 A;  3KPH A;  1ST6 A;  1CGO A;  1A0B A;  4MVU A;  2LD6 A;  3GOR A;  4NY3 A;  3W2W A;  3LEV A;  3PHF 2;  2KW3 C;  1E86 A;  3ECS A;  1ZVZ A;  1FFT C;  2R7Q A;  3F46 A;  3S28 A;  2XLM A;  3JSE O;  2ZXO A;  2FGY A;  3AG4 C;  3G4X A;  2ETS A;  1T6I A;  1KU2 A;  2LP4 A;  1M2V B;  1M2V A;  3N2Z B;  2VCA A;  2R7R A;  4I1O B;  4JEB A;  4MW8 A;  1T9K A;  1MNE A;  2B0J A;  2XSE A;  3NMJ A;  3U2M A;  2D5R B;  3VF0 A;  4CIP A;  4QI2 A;  3OA1 A;  4XEV A;  4NTB A;  3W2V A;  2ASR A;  1EI7 A;  1M56 C;  1N1C A;  1MMG A;  2YL7 A;  3UMH A;  256B A;  3EHN A;  3RVZ A;  1YAR O;  1Q0K A;  2R25 A;  3JZ0 A;  2G3V A;  2NG1 A;  4PJL A;  3UGO A;  2WVQ A;  1HE9 A;  2WZL A;  2D4U A;  4P9T A;  3ZTZ A;  3DM5 A;  2LFF A;  5AGF A;  4U5B E;  3GWN A;  3EPV A;  2XL4 A;  4JVS A;  1JOG A;  4U5C E;  1CGM E;  1DOW A;  2PBE A;  2WZF A;  4YT4 A;  2G3K A;  4G7Z F;  1BBH A;  3UMI A;  3EZI A;  2HJM A;  5KYN A;  1Z63 A;  3MYI A;  4JEA A;  1WTY A;  2YLI A;  4C3D A;  1H9G A;  1BDJ B;  2HJ3 A;  5JSL A;  2GAQ A;  4AE4 B;  4AE4 A;  5FCL A;  5KYY A;  3DE8 A;  4GYT A;  4JKV A;  3QW0 A;  1U6H A;  2I15 A;  2WB7 A;  1Z6A A;  2W4M A;  2CW0 F;  1R4T A;  2W4B A;  3EFO A;  4BJ1 A;  4DVZ A;  3LLI A;  3BEH A;  1YA9 A;  4Z9H A;  3ZVR A;  5KYX B;  3QMK A;  5KYX A;  1O5H A;  5A6K A;  3S9O A;  2GFH A;  4N4W A;  4A4A A;  2MYS A;  3HJC A;  4FAP B;  3H2U A;  3LS1 A;  4W8K A;  1RXQ A;  3H65 A;  5AC5 A;  5A69 A;  1OW8 A;  2DB4 A;  1RJ9 A;  1I4Y A;  2AU5 A;  3WOD F;  4FWV A;  2LSE A;  3LLK A;  1PV3 A;  4BJ5 A;  2PX3 A;  5L0F A;  3AOU A;  4I44 A;  4J7Y A;  4IAR A;  4JTC B;  4X0R A;  1YZA A;  1T6Q A;  2J9W A;  4G7H F;  2NSF A;  2R9R B;  5FZT A;  4PFO A;  3TOL A;  2J7P D;  3ZSU A;  3S90 A;  3AG1 C;  4ANJ A;  2AP3 A;  4YN0 B;  2R7W A;  3IHU A;  4AL0 A;  4YL0 A;  2Q9C A;  4CS9 A;  3GM1 A;  1Q0M A;  2J9V A;  2QNL A;  3CSK A;  3LNR A;  4HFK B;  4WAB A;  3TJ6 A;  5A6A A;  3TQO A;  1C03 A;  1G4U S;  3B0U X;  3ASO C;  1FMV A;  5DVW A;  2GWW A;  4O79 A;  5BQH A;  1M6T A;  4JZA A;  1LI5 A;  4M63 A;  1APC A;  3S84 A;  2R02 A;  4Q4Z F;  2KK1 A;  2XM0 A;  3HNJ A;  2KC3 A;  3SP1 A;  4CJG A;  4C7O A;  2WZG A;  3ZIB A;  2AVK A;  1HMO A;  3IEE A;  4RBN A;  1RMV A;  1U0B B;  1D1C A;  1PCX A;  1QQ3 A;  2KJG A;  2QY9 A;  3CZ6 A;  3NKD A;  4AX2 A;  4ULV A;  3W4Y A;  3G4Z A;  4BJT A;  5A6B D;  1LIH A;  4O6N A;  2IXN A;  3FXH A;  3DAF A;  3U3F A;  1YVI A;  4I1M A;  1HW2 A;  2J0W A;  3M15 A;  2Q7R A;  2YLG A;  4YJW A;  1NG1 A;  1OCO C;  3ATP A;  3CAX A;  1VB5 A;  2HS5 A;  2DI3 A;  4JCZ A;  2NUT B;  4DBQ A;  3T9O A;  4MTG A;  4XTK A;  2QUP A;  3GEI A;  4MND A;  4BEM J;  5L3V A;  4Q7C A;  5DQZ A;  1R5I D;  2J7P A;  3NYJ A;  4ZLD A;  1UG7 A;  4NQF A;  1NU9 C;  3IPM O;  1D0Z A;  2M64 A;  4JJG A;  4MQ9 F;  2XXA B;  2XXA A;  4K7B A;  2EPN A;  1D1B A;  1E83 A;  2YHS A;  1ZZP A;  2YL3 A;  4XWJ A;  1GGQ A;  4NCQ A;  3GEE A;  2IBF A;  1Z5Z A;  1ZHX A;  2IXO A;  5DS4 A;  4AL1 A;  3S0X A;  2HKV A;  4MVM A;  4XQ1 A;  4RDA A;  4ZLC A;  5F5H A;  4N06 A;  4C3E A;  4EHP A;  1EA8 A;  4IGG A;  2YKZ A;  4BJ6 A;  3EGX B;  4YL3 A;  3EGX A;  3MLG A;  4LER A;  4YT8 A;  1HY5 A;  3DWW A;  2X0C A;  3K1I C;  3MX3 A;  2M4E A;  1M57 C;  5COF A;  3RF3 A;  2EIK C;  2E87 A;  1OQC A;  3PMR A;  4MVZ A;  3RVY A;  4EBB A;  2R7X A;  2V26 A;  5D91 A;  1H6G A;  3HNK A;  3O55 A;  3LAY A;  4DVY P;  3I5P A;  4U5G A;  2R7O A;  2J45 A;  4QDL A;  5COG A;  2LCH A;  4JW1 A;  4FX5 A;  4XPY A;  2TMV P;  4U5E E;  1BR2 A;  1BR1 A;  3SYN A;  2CCY A;  3L8J A;  3R2P A;  4LLE A;  2ZD9 A;  5HSW A;  1Q0G A;  3NMK A;  1JRA A;  4IB4 A;  1J8M F;  2R05 A;  2Z15 A;  2DYS C;  2Y3B A;  3LJB A;  2NUP B;  4JIO A;  2NUP A;  3LNM B;  4E0I A;  4KI2 A;  1I5N A;  1M2O A;  2KGO A;  4ONS A;  4U5H A;  4DJ9 A;  1FNT c;  2OJE D;  4IAO A;  3U5S A;  2JD3 A;  4DRH B;  2Y39 A;  3OWT A;  2A6H F;  4WGZ A;  1MND A;  3T6B A;  3SXY A;  1VYK A;  2ICW G;  3MYF A;  3NRH A;  2UUH A;  3WG7 C;  4CJO A;  2L6G A;  1BR4 A;  1AEP A;  1L7C A;  4DRJ B;  3K6B A;  3KYJ A;  3R7C A;  1GM5 A;  3SZR A;  3V5X A;  2XLO A;  5D92 A;  3ASN C;  5T3W A;  4K1O A;  1V4A A;  5JT4 A;  5L0C A;  3VYW A;  2KNH A;  1A7E A;  1YDI A;  5JS5 A;  3KH2 A;  2FFH A;  3DKA A;  4MTO A;  4E7S A;  5GPG B;  5EHH A;  1NZE A;  1LE4 A;  4BG0 A;  2H7B A;  2P6V A;  3C8Z A;  1WAS A;  1ORY A;  2OEX A;  5IY5 C;  4Q5S F;  1J8Y F;  1OCR C;  4MVQ A;  2I8B A;  5KYY B;  2RD9 A;  2R7T A;  1ZHY A;  3FMS A;  4XEK A;  1MMN A;  2A0B A;  2BE5 F;  4KNW A;  4P9F A;  2CGE A;  4DBR A;  1T5O A;  1QSP A;  1XZQ A;  1RKE B;  2P0N A;  1RKE A;  2OOC A;  1HW1 A;  2XLD A;  3DAG A;  3EFO B;  3FAJ A;  2BL2 A;  5BQG A;  4A2N B;  2QE9 A;  4CDV A;  1HMD A;  2HMQ A;  1NBB A;  1JPJ A;  2IM8 A;  4HE8 D;  3B29 A;  1QVX A;  5DLJ A;  3B9Q A;  3E70 C;  2VCB A;  2VCC A;  3LUT B;  2A1D D;  1NU7 D;  1T6U A;  3B71 A;  3M4B A;  1VYI A;  4LLC A;  2HV7 A;  2XLH A;  2A6E F;  3EG9 B;  1TKN A;  3EG9 A;  1B68 A;  1RJ9 B;  3H2V A;  3RKO F;  3ZC4 A;  2JX0 A;  2L81 A;  3JT1 A;  2R03 A;  2PNO A;  4NTF A;  3VAY A;  1ZU5 A;  4OIN F;  3AQB A;  4IAQ A;  3N0T A;  4RD9 A;  5CI8 A;  2EIJ C;  3AJM A;  2YL0 A;  3KL4 A;  4R32 A;  2YL1 A;  4XPX A;  3RQF A;  1IW7 F;  4NTA A;  1C02 A;  4XPW A;  1O87 A;  3RH3 A;  3FDQ A;  1Q0F A;  3ABL C;  4ULW A;  5F5F A;  1D1A A;  1QPU A;  2CDQ A;  3JSZ A;  1WN0 A;  1Z7Q c;  3AGT A;  1NLX A;  3S29 A;  4LDQ A;  1DOV A;  1G8X A;  2JPU A;  4LDK A;  4BEJ A;  5KYW A;  2OCC C;  3US6 A;  3ZG1 A;  3BRJ A;  1XWJ A;  1TWC A;  5DQT A;  1YLM A;  1ZHW A;  1YAU O;  2KYH A;  2ZPA A;  1QLE C;  4WGY A;  4C7O B;  3PDM P;  5DS6 A;  2EIL C;  4F4B A;  3RW0 A;  3LES A;  3FOO A;  1G4W R;  5KYU A;  5KYU B;  1Z3I X;  3U3B A;  2X51 A;  4FES A;  1PD0 A;  2WL8 A;  1T01 A;  1PD1 A;  4OD4 A;  2NSG A;  3ZTM A;  1EKY A;  1V55 C;  1LS1 A;  4P6I C;  1VLT A;  3QVY A;  3K1H A;  2HV6 A;  3KYI A;  2J0X A;  2OG2 A;  4MVS A;  2QLA A;  4E0H A;  2V3C C;  4CX9 A;  1Y4C A;  1OR2 A;  5E3A A;  1ORS C;  3W8I A;  3SXM A;  2ZXR A;  2R7S A;  4D4X A;  2HUJ A;  3KKB A;  4IRU A;  4XEF A;  1S05 A;  4B6I A;  1LVK A;  5KYW B;  2J8W A;  4EBK A;  3JRT A;  4PFP A;  3L0I A;  5E2Q A;  3SXZ A;  2J46 A;  4PAC A;  3RQG A;  4UDV A;  2HSQ A;  3IQT A;  1SF8 A;  2EPM X;  1G5Z A;  2EPL X;  2VC9 A;  1NSG B;  1LI7 A;  1V54 C;  2XLW A;  4JTD B;  3SXK A;  4J30 B;  3C62 A;  2OQM A;  5A6J A;  4HEA J;  2HSB A;  3EGD A;  3JYH A;  3JCU Q;  1JAF A;  2Q00 A;  1VMA A;  3UGP A;  3S27 A;  3DM9 B;  2AWY A;  3HNL A;  2YQY A;  4XLN F;  3HKK A;  2OKU A;  3O6X A;  3K1I A;  4ER9 A;  2ZXW C;  2PFD A;  3ABK C;  3M4C A;  1A41 A;  2J9B A;  1LM3 B;  1OW6 A;  1ZW2 A;  1RKC A;  3LEO A;  2YZS A;  3TD7 A;  5A6B A;  4PK4 A;  3L1M A;  3RYL A;  3V7O A;  4PJN A;  4OIR F;  1NFN A;  1SMY F;  1LE2 A;  1FTS A;  2CNW D;  2PP4 A;  4GEH A;  3MBG A;  4H54 A;  3DJN B;  4AK9 A;  2Q9B A;  3Q7G A;  5L0G A;  2LK4 A;  2L9J A;  2Y3G A;  5L0D A;  3Q6M A;  1Y6D A;  4JJF A;  3EQL F;  3T4R A;  1E85 A;  2P61 A;  2OEV A;  3FAP B;  3ZQY A;  3Q6N A;  3SEO A;  4EBJ A;  2C04 A;  2XS1 A;  1FFH A;  1WWP A;  1LKX A;  2Q4F A;  3EH2 A;  3IQ6 A;  4JRZ A;  4KBL A;  2YRF A;  2H7V C;  1LPE A;  1WGW A;  2VH3 A;  1VLS A;  2A69 F;  2LFD A;  4W8P A;  2AWC A;  4C3B A;  3FHD A;  4CDA A;  5T1D B;  3KMI A;  2J9U A;  1TQG A;  1Z23 A;  2O9X A;  4CS8 C;  2A0U A;  5HV9 A;  3M1C B;  2GA0 A;  3DD7 A;  3JRM O;  3O39 A;  4G7O F;  2F22 A;  1TWG A;  2FAP B;  3TOM A;  1BZ4 A;  5TJ5 E;  1VTM P;  2B0H A;  1TFK B;  4U5D E;  1AUE A;  2HMZ A;  2EIN C;  3EZH A;  2IXM A;  4I3M A;  2Q3T A;  1ZU4 A;  1AVO B;  1C17 M;  1A7V A;  2P1A A;  1WAT A;  4L6R A;  4MS2 A;  3GM2 A;  3O10 A;  3HNI A;  5B3I A;  3ZQV A;  4OIP F;  2Q9A A;  2EPO A;  1V74 B;  3QW1 A;  1KNY A;  4NC3 A;  1SZI A;  3B0P A;  1ZHZ A;  2ZXP A;  1VOM A;  3B0V C;  4E17 A;  1H7I A;  2CNW A;  3Q7L A;  3QVZ A;  4CS7 A;  4EKW A;  5JLI A;  5AC4 A;  3EJN A;  2L7A A;  4WJ0 A;  3NKE A;  4MTF A;  5COM A;  5CI9 A;  2KQ9 A;  4PR9 A;  1OR3 A;  1UFB A;  3TJ5 A;  1QZX A;  2IXP A;  4N6H A;  1L3P A;  3UR3 C;  1OW7 A;  2W9Y A;  5L0J A;  1JR8 A;  3EH1 A;  4OIQ F;  5B1B C;  2IYL D;  1SR2 A;  4YWQ A;  3U0C A;  4N6C A;  3DE9 A;  1S7Z A;  2YEV A;  1OCC C;  2Y3H A;  2XS8 A;  3MFN A;  1IZM A;  4LAC B;  3UMK A;  2P7V A;  3L8I A;  3L34 A;  3CQZ A;  4H4K C;  4OD5 A;  1EQ1 A;  3IQC A;  5B1A C;  2YVK A;  3I5Q A;  1YZC A;  1LS4 A;  4MVO A;  5EK0 A;  2R7U A;  1E84 A;  2RSE B;  4KNV A;  3SNH A;  1OXK A;  3PCV A;  4J32 B;  1E2X A;  2HZ8 A;  5BUO A;  1ZHT A;  1MMD A;  3GEH A;  4DOZ A;  3C18 A;  4XLP F;  4IJJ A;  2PF4 E;  1YJG A;  2YLD A;  2YWA A;  4MW3 A;  4D4N A;  1D0X A;  1K04 A;  2XRH A;  3V5Z A;  2XLV A;  1MMA A;  2EPK X;  3A9C A;  3DI5 A;  1YYX A;  3QZC A;  3WHN A;  2H7O A;  2MWQ A;  1FMW A;  4EIY A;  1TWA A;  5JVE A;  4LDR A;  4O6Y A;  1TR2 A;  2Y69 C;  4KC9 A;  4QI0 A; 
#chains in the Genus database with same CATH homology
 1QVX A;  3GM2 A;  2KK1 A;  3L8I A;  2LK4 A;  3O10 A;  3RQG A;  3B71 A;  1JOG A;  1ZZP A;  2PBE A;  1V4A A;  1OW8 A;  1K40 A;  1KNY A;  3L8J A;  3K7D A;  4EBJ A;  1WWP A;  2JX0 A;  3JYY A;  3RQE A;  1PV3 A;  3GM3 A;  2HSB A;  1WOL A;  2L6F A;  2Q00 A;  2L6H A;  3C18 A;  1WTY A;  3U3F A;  1K05 A;  2YWA A;  3AJM A;  3C8G D;  1UFB A;  4R32 A;  4XEV A;  3RQF A;  4XEK A;  1K04 A;  1OW7 A;  1OW6 A;  3GM1 A;  3MFN A;  3JZ0 A;  1O3U A;  4XEF A;  1KTM A;  3U0C A;  2JPU A;  3C8G B;  3C8G A;  3TUL A;  4EBK A;  2L6G A;  3BRJ A;  5F28 E;  3S9O A;  4NQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...