4D4NA

Nitrosyl complex of the d121a variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHAAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4nA00
2QLAA 4WGYA 4N6HA 2XM4A 4IARA 1BBHA 3QVYA 3ZQYA 3C62A 3M79A 2YL0A 3QW0A 2YL7A 3TOMA 1E83A 4D4XA 3U8PA 3QVZA 2CCYA 1E85A 3ZTMA 2XLHA 1EKYA 4CDAA 1S05A 1YYJA 4N4WA 4CIPA 3ZTZA 4U9EA 3HNLA 3DE9A 5JSLA 2YLIA 5B3IA 1GQAA 1E86A 2J8WA 3L1MA 3M4BA 1YZCA 3DE8A 4ULVA 3IQ6A 2XLEA 2YLDA 2YL1A 4IAQA 3FOOA 3TOLA 1QPUA 1YZAA 3M4CA 3NMIA 3M15A 2J9BA 1LM3B 4WGZA 1YYXA 1A7VA 2XL6A 2YLGA 3VRCA 2XLDA 4CDVA 5JP7A 1M6TA 5JT4A 2XLMA 3NMKA 1RCPA 3C63A 3ZQVA 1CGNA 4CJOA 2XLVA 5JRAA 4CX9A 3FOPA 4L6RA 4CDYA 1E84A 2XL8A 4CJGA 2YL3A 1APCA 3NMJA 3HNKA 1QQ3A 2BC5A 1CPRA 3QW1A 1MQVA 2XM0A 5JS5A 5JLIA 2XLWA 4NC3A 2XLOA 1CGOA 2YKZA 4ER9A 3HNJA 5JVEA 1JAFA 3ZWIA 1NBBA 4EIYA 1CPQA 4JKVA 4JEAA 256BA 5AGFA 3HNIA 4D4NA 4IB4A 4JEBA 5JUAA 4U9DA 3IQ5A 4JE9A
chains in the Genus database with same CATH superfamily
3ECSA 1VLSA 4EHPA 5L3VA 2QLAA 3MLGA 2UUHA 1M57C 2E87A 3WAQA 1HMDA 4PJNA 1WWPA 4YL0A 3U0CA 3QVYA 1WATA 2OG2A 2HKVA 4Q5SF 2IM8A 3K1IC 4P9FA 4YK5A 4CS9A 3RQGA 1EQ1A 4C3DA 1LE2A 2Q9CA 3LAYA 3O55A 4U5EE 3S90A 1ORSC 1RKEB 2J9VA 3EGDB 5T3TA 3CSKA 2HV6A 3U2LA 2CCYA 4H4KC 2KYHA 1AVOB 1QZXA 2Q3TA 2XLHA 2I8BA 4U5HA 5KYYB 4EBKA 2J9WA 1RMVA 4JTDB 4MVMA 1JPJA 5B1AC 3RVZA 3TULA 1S05A 5CI9A 1Z7Qc 2L9JA 3DKAA 2M64A 3O10A 4C7OB 1E2XA 3AGUA 3GM3A 4YL3A 3VYWA 1S7ZA 4CIPA 3B0VC 2B0HA 1T9KA 3EHNA 4JJFA 3SXZA 3AOUA 3IPMO 4G78A 1LPEA 2GAQA 5JSLA 3L34A 2MYSA 1ZHXA 2ZPAA 1SYQA 1RJ9A 1NU7D 1WTYA 4JRZA 3RIPA 1RKCA 5FZTA 3SEOA 3NYJA 3S27A 2UUIA 3L1MA 4R32A 2VASA 2KQ9A 2NUPB 1ZU4A 3ZG1A 1GS9A 4QI2A 5HV9A 2NSGA 2FFHA 2OJQA 2QE9A 2Y3HA 4M63A 2H7VC 3B71A 3MX3A 4E0HA 3WG7C 4IAQA 3UNGC 1Y4CA 1G4US 2G62A 3C8GB 4MTOA 2M4EA 4O6YA 1OKKA 2HMQA 2OOCA 5KYXB 3FXHA 1V4AA 2DGJA 3AG1C 5COGA 5DLJA 2R7RA 4WGZA 1YA7O 3ABLC 4CBEA 1UFBA 2RSEB 3GORA 3Q7LA 4I44A 5DS6A 3JRMO 4I3MA 5JT4A 2Z15A 3VF0A 5L0IA 5A69A 2H8AA 2H7OA 1MMAA 3PDMP 2Y39A 5EHHA 1KTMA 1OW7A 1FNTc 1V54C 2CW0F 1FAPB 1FR0A 3HLZA 1CGNA 3FVYA 3ZQVA 1VB5A 3Q6MA 1GM5A 4I1OB 1M2VB 2HZ8A 1NSGB 1KNYA 5KYWA 4L6RA 1T6IA 4CDYA 1O5HA 4QI0A 1E84A 4MVSA 3GANA 4CJGA 3KL4A 2YL3A 4E18A 2J45A 2MHRA 2OKUA 2A6HF 2J0WA 1OR3A 1ZHWA 4KNWA 5GPGB 2R7SA 2W9YA 2WB7A 4IRUA 1ZVZA 1MQVA 3QW1A 4LACB 4BEJA 2R7XA 2KSFA 5JLIA 4JCZA 2NG1A 4W8PA 2PX3A 2XLWA 2XXAB 3C8GD 2P6VA 1CGOA 1J8YF 1VLTA 5HSWA 1OCRC 3EG9A 3V5XA 2L81A 3IEEA 4NTFA 1JAFA 1T6UA 5JVEA 1PD1A 3RQEA 2XSEA 4ONSA 4YJWA 1XWJA 3AG4C 3MYFA 1A7DA 3LUTB 4YT8A 4JVSA 2A6EF 2KNHA 4JEAA 5BQGA 5AGFA 4D4NA 1G4WR 2AVKA 5DQZA 1JRAA 3EGDA 3ABKC 1NG1A 4U9DA 1WASA 2ZXWC 4LDKA 1U0BB 4J7TA 3PCVA 4YL1A 3S0XA 2C04A 4IWBA 3U8VA 2IOQA 4XPYA 1H9TA 1RXQA 4AK9A 5FCLA 3SXMA 3G4XA 4LDQA 3C62A 2YL0A 3ZSUA 1TFOB 3TK0A 2R7OA 3W2VA 4P9TA 4PR9A 2VCBA 4CSAC 2VCAA 2CNWD 4PJJA 4P6IC 3NKDA 1E83A 1BR1A 2A68F 2Y69C 3R2PA 4PACA 4NY3A 5AC4A 3SP1A 1D0YA 4BPMA 1AEPA 3LNRA 3OEOA 1EKYA 3JT1A 3UMKA 1A0BA 4PFOA 1MNEA 1XZPA 2BL2A 1D1CA 3UMHA 1MMNA 2DYSC 4DXWA 2Y3BA 3GM1A 2A0UA 3LS0A 4NQFA 3M1CB 4XQ1A 4XWJA 3SXKA 1MMGA 4N6CA 1ORJA 2R7TA 3W8HA 4EKWA 4E7SA 2YWAA 3FMSA 4O7GA 2YLIA 1ZHYA 5D91A 1WN0A 5B3IA 1GQAA 2HSBA 2AWYA 3T9OA 2D4UA 2EPKX 1LIHA 1MNDA 2CYDA 3E9VA 2MWQA 2W4BA 5KYUB 3KMIA 3MBGA 1LI5A 2OU6A 4WJ0A 1LS4A 4XPXA 4DJ9A 3UGOA 2QY9A 3B0PA 3NDBB 2YL1A 1LVKA 4U5BE 1QPUA 3M4CA 3IHUA 3EQLF 2J9BA 1A41A 1D0XA 3C8ZA 1LM3B 2R03A 4J32B 1H9GA 2AWCA 4PFPA 1TKNA 3DZAA 1G5ZA 3U9JA 3KKBA 2AP3A 2WVOA 2J0XA 3CAXA 4WABA 2P61A 3OA1A 2ETSA 2NUTA 3EH2A 1BZ4A 1HW1A 2LD6A 1CGME 2IXNA 1TWCA 2G3KA 2IYLD 4LLEA 4NTAA 2EIMC 3TQOA 4BJ5A 5JRAA 4IJJA 1OCOC 3A9CA 3GWLA 2XXAA 3LEOA 4MVOA 2L6GA 1H7IA 4CX9A 1ZZPA 2XL8A 3AQCA 4YT5A 3HNKA 1Z3IX 3RVYA 4BJ1A 5L0GA 3VM6A 2CGEA 2YVKA 4MTFA 1K40A 4AE4B 4BJ5C 2EPMX 2V3CC 2LIGA 4K7BA 1YDIA 2XM0A 3OWTA 2OQMA 1L3PA 5JS5A 2J7PD 2A1DD 4MTGA 3EHMA 1BDJB 2GWWA 3LLIA 5BUOA 3GEIA 3QZCA 1YJGA 2YZSA 3LNMB 2VC9A 1BR4A 4AL0A 1R5ID 1W2WA 4ER9A 2ICWG 3Q6NA 4JTAB 4GYTA 2Y3GA 3ITFA 1U89A 3CZ6A 4G7HF 1T01A 3V7OA 2HUJA 2P7VA 3NYMA 4U5DE 4JKVA 1OR2A 1U6HA 256BA 1YA9A 3BEHA 2L6HA 2HJ3A 4DBRA 5JUAA 1WOLA 4G7ZF 1OCCC 1SMYF 4HFFB 5F28E 4CIHA 1IW7F 3GODA 2LQGA 4JE9A 2KJGA 2KGOA 1ORYA 2QUPA 4N6HA 4ULVA 5COMA 3RFYA 5A6BD 4IARA 4X0RA 5A6KA 3UGPA 3EFOA 3EZIA 3S9OA 4BG0A 2OCCC 4AX2A 4DBQA 1D1BA 5L0FA 3M79A 4G7OF 2GA0A 3K6BA 4JTCB 3US6A 2YL7A 3I5QA 2Y3DA 4YN0B 1I4YA 3ZIBA 2QNLA 4E17A 2FGYA 2R02A 4D4XA 2Q9BA 5BQHA 3ZDLA 1AUEA 3DAGA 5L0HA 3GEHA 3IQTA 3EGXB 1ZHZA 2ASRA 3NYLA 1JMWA 3U3BA 1OW8A 2Q4FA 3KH2A 4YT2A 1E85A 4HE8D 3LS1A 3EPVA 4KNVA 2LSEA 4N06A 1RJ9B 3PHF2 2DB4A 2AU5A 3BRJA 2TMVP 1YYJA 3T6JA 1G8XA 3B0UX 1RKEA 3F47A 1VMAA 1JPNA 4YT4A 4CSAA 5KYNA 3QTHA 3U5SA 4E0IA 4U9EA 3HNLA 2BE5F 5E3AA 1NFOA 1SR2A 3G50A 3DE9A 4A4AA 5A6AA 1B68A 5KYYA 2VB6A 4UDVA 1V74B 3RYLA 2VH3A 4QDLA 5TJ5E 3X1OA 3RW0A 1E86A 1QLEC 3MYIA 4H54A 2LCHA 1TWHA 2J8WA 3GEEA 1LI7A 1VOMA 2WZGA 4XEKA 3T4RA 5L0DA 4C7OA 3JYHA 1ST6A 4OIPF 2LK4A 4DRJB 1I4ZA 2W4MA 2D5RB 4ULWA 4ZLDA 2R7WA 5T1DB 3ZVRA 2HSQA 1SF8A 2HFIA 3DM9B 3JZ0A 4JJGA 1T5OA 3V5YA 3AGTA 1TFKB 1XZQA 1FTSA 1YZCA 3DE8A 1OXKA 2XLEA 2R7VA 3HKKA 4HFKB 3K33A 3KYIA 2NUPA 2IXMA 3ASNC 4JCHA 2P1AA 1TQGA 3I4UA 1M2OA 1Q0DA 3DXJF 3M15A 3IQCA 3L8IA 4G0HA 1Z6AA 4KC9A 2R25A 1YYXA 2XL6A 2X0CA 3SYNA 1SZIA 5DS5A 1YVIA 1YAUO 2B0JA 2XLDA 3H2UA 3VRCA 4CDVA 1TR2A 2OEVA 3ATPA 1HE9A 2ZXOA 3EH1A 3C8GA 2XLMA 4EBBA 4Q4ZF 2NPUA 4U5GA 5KYXA 1QVXA 2DYRC 2W45A 3W8IA 5DS4A 1RCPA 1ZW3A 4LLCA 1OQCA 3QMKA 3C63A 4NCQA 1NLXA 2HJMA 4CJOA 2XLVA 3E70C 5AC5A 2ZXPA 3RQFA 3NKEA 2WVQA 2IXOA 1EA8A 1EI7A 3FAJA 2XRHA 1HMOA 3JRTA 3L0IA 4JURI 5DVWA 4DVYP 2XL4A 3JSZA 5IY5C 2IBFA 1I5NA 2YEVA 4OD4A 4J30B 1HY5A 1D0ZA 4OINF 4DVZA 5L0CA 1FFHA 2O9XA 2QTVA 4OIOF 1UG7A 1APCA 1OKKD 3DJUB 3NMJA 5D92A 4Z9HA 2EIJC 3TJ5A 5F5FA 3EG9B 1L7CA 3ASOC 1M2VA 1V55C 1KU2A 1O87A 3SNHA 4F4BA 2C03A 1QSPA 3EJNA 3R7CA 3AQBA 3JTLO 3I5PA 1Z5ZA 1WGWA 5E3CA 2I15A 3S84A 4KBLA 2CNWA 4RDAA 1HE1A 2YKZA 3MFNA 4NTBA 2KW3C 4C3EA 2YHSA 3B9QA 4XLPF 2R7UA 4MVQA 3J06A 1N1CA 3DWWA 1NBBA 5EGYA 2EPNA 4EIYA 4CS9C 2LFFA 2FAPB 1NFNA 2Q00A 3NG1A 2HV7A 3HNIA 4JEBA 1LKXA 2VCCA 3IQ5A 2JPUA 2G3VA 3EGXA 3L8JA 4MQ9F 4OD5A 5B1BC 4CS8A 1IZMA 1K05A 5E2QA 1K04A 1PCXA 2NSFA 2ZD9A 1PV3A 3KPHA 2XM4A 4WGYA 2L6FA 2PF4E 1HW2A 2CDQA 1BBHA 3G4ZA 3PMRA 5F5HA 3ZQYA 5EK0A 4MNDA 1T6QA 1C17M 3QW0A 4I1MA 3TOMA 4W8KA 4GQHA 4U5FE 4FESA 3H65A 4CS8C 3X2QC 1YLMA 2RD9A 3DM5A 3H2VA 3QVZA 3U8PA 2PP4A 2PNOA 4FWVA 4OIRF 1H6GA 2PX0A 2YRFA 4MVZA 3U2MA 2DI3A 3N0TA 4EWCA 3ZTMA 2R9RB 3RKOF 4BEMJ 3F46A 3N2ZB 4MS2A 3AG3C 3VAYA 5COFA 4J7YA 4CDAA 3O6XA 3U3FA 1DOWA 3NRHA 2X51A 5T3WA 5BQIA 4JW1A 4N4WA 4DRHB 1ZYRF 1VYKA 3WHNA 1DOVA 2KK1A 3ABMC 3ZTZA 2L7AA 5B3SC 3TD7A 2PBEA 4Z9JA 3WODF 4FX5A 3TJ6A 1Q0KA 4C3BA 3U9MA 3C7JA 4PK4A 4MW8A 4JZAA 1TWAA 1Y6DA 3S29A 3M4BA 1VYIA 3DI5A 4MW3A 4FAPB 2J46A 3FAPB 4K1OA 2OJED 2HMZA 3JSEO 1ZHTA 3DD7A 3DAFA 1A7EA 2OEXA 4A2NB 4O79A 3GWNA 4JC7A 4MVRA 4IAOA 1LE4A 1OXBA 2F22A 2HS5A 1QKRA 2V26A 2WZFA 2YLDA 3IQ6A 1FMVA 3LLKA 4U5CE 3FOOA 3S28A 2YQYA 3FHDA 1YZAA 5KYUA 3TOLA 4EBJA 4JIOA 3K1HA 2EINC 2LP4A 3CQZA 2JX0A 2NUTB 3NMIA 4XLNF 3EZHA 4XEFA 2Q7RA 4MVUA 4BJ6A 3FDQA 1NU9C 5DQTA 4GEHA 1A7VA 2YLGA 3V5ZA 2H7BA 2WZLA 1VTMP 1GGQA 1Q0FA 4XPWA 5JP7A 1M6TA 2EIKC 2J7PA 2PFDA 4YWQA 1TWGA 4PJMA 5L3QA 2LFDA 4K0DA 4DOZA 1YARO 3NMKA 4BJ6C 5A6JA 4Z9IA 2GDCA 5E33A 1R4TA 3GM2A 3T6BA 3RH3A 1OCZC 2EPLX 3B29A 4B6IA 1ZW2A 3T6GB 1M56C 1Q0GA 3C18A 2WVNA 3FOPA 3AG2C 3HTKC 3KYJA 1LS1A 4O6NA 4ZLCA 4RBNA 3JYYA 3Q7GA 2EPOA 4ANJA 4IGGA 3UMIA 2WL8A 4CS7A 3RF3A 2ZXRA 4DRIB 1QQ3A 3LJBA 4BJTA 3DMDA 1C02A 2R05A 2BC5A 2JD3A 2EILC 3O39A 5A6BA 1FFTC 1CPRA 1OW6A 3DJNB 4O6MA 4KI2A 2P0NA 1MMDA 2KC3A 2XS8A 3A11A 3K7DA 2Q9AA 2A0BA 3UR3C 1NZEA 2XS1A 4OIQF 5L0JA 5KYWB 2IXPA 2A69F 1JOGA 2GFHA 4HEAJ 2XLOA 2R7QA 4NC3A 3W2WA 1J8MF 3SZRA 4PJLA 3HNJA 1F1MA 4AL1A 1FMWA 1D1AA 3AJMA 3JCUQ 3HJCA 3W4YA 4AE4A 3LESA 1Q0MA 3ZWIA 4EUKB 3CEXA 3EFOB 1CPQA 1ZU5A 2J9UA 3K66A 4RD9A 1PD0A 1VK5A 4Q7CA 4XEVA 1O3UA 3POVA 3K1IA 1Z63A 4XTKA 5CI8A 4IB4A 4LDRA 1C03A 1JR8A 1BR2A 3SXYA 5CIVA 3LEVA 3ZC4A 4E7ZA 4LERA 1Z23A 3N24A 5K0IA
chains in the Genus database with same CATH topology
2QLAA 4WGYA 4N6HA 2XM4A 4IARA 1BBHA 3QVYA 3ZQYA 3C62A 3M79A 2YL0A 3QW0A 2YL7A 3TOMA 1E83A 4D4XA 3U8PA 3QVZA 2CCYA 1E85A 3ZTMA 2XLHA 1EKYA 4CDAA 1S05A 1YYJA 4N4WA 4CIPA 3ZTZA 4U9EA 3HNLA 3DE9A 5JSLA 2YLIA 5B3IA 1GQAA 1E86A 2J8WA 3L1MA 3M4BA 1YZCA 3DE8A 4ULVA 3IQ6A 2XLEA 2YLDA 2YL1A 4IAQA 3FOOA 3TOLA 1QPUA 1YZAA 3M4CA 3NMIA 3M15A 2J9BA 1LM3B 4WGZA 1YYXA 1A7VA 2XL6A 2YLGA 3VRCA 2XLDA 4CDVA 5JP7A 1M6TA 5JT4A 2XLMA 3NMKA 1RCPA 3C63A 3ZQVA 1CGNA 4CJOA 2XLVA 5JRAA 4CX9A 3FOPA 4L6RA 4CDYA 1E84A 2XL8A 4CJGA 2YL3A 1APCA 3NMJA 3HNKA 1QQ3A 2BC5A 1CPRA 3QW1A 1MQVA 2XM0A 5JS5A 5JLIA 2XLWA 4NC3A 2XLOA 1CGOA 2YKZA 4ER9A 3HNJA 5JVEA 1JAFA 3ZWIA 1NBBA 4EIYA 1CPQA 4JKVA 4JEAA 256BA 5AGFA 3HNIA 4D4NA 4IB4A 4JEBA 5JUAA 4U9DA 3IQ5A 4JE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLA A;  4WGY A;  4N6H A;  2XM4 A;  4IAR A;  1BBH A;  3QVY A;  3ZQY A;  3C62 A;  3M79 A;  2YL0 A;  3QW0 A;  2YL7 A;  3TOM A;  1E83 A;  4D4X A;  3U8P A;  3QVZ A;  2CCY A;  1E85 A;  3ZTM A;  2XLH A;  1EKY A;  4CDA A;  1S05 A;  1YYJ A;  4N4W A;  4CIP A;  3ZTZ A;  4U9E A;  3HNL A;  3DE9 A;  5JSL A;  2YLI A;  5B3I A;  1GQA A;  1E86 A;  2J8W A;  3L1M A;  3M4B A;  1YZC A;  3DE8 A;  4ULV A;  3IQ6 A;  2XLE A;  2YLD A;  2YL1 A;  4IAQ A;  3FOO A;  3TOL A;  1QPU A;  1YZA A;  3M4C A;  3NMI A;  3M15 A;  2J9B A;  1LM3 B;  4WGZ A;  1YYX A;  1A7V A;  2XL6 A;  2YLG A;  3VRC A;  2XLD A;  4CDV A;  5JP7 A;  1M6T A;  5JT4 A;  2XLM A;  3NMK A;  1RCP A;  3C63 A;  3ZQV A;  1CGN A;  4CJO A;  2XLV A;  5JRA A;  4CX9 A;  3FOP A;  4L6R A;  4CDY A;  1E84 A;  2XL8 A;  4CJG A;  2YL3 A;  1APC A;  3NMJ A;  3HNK A;  1QQ3 A;  2BC5 A;  1CPR A;  3QW1 A;  1MQV A;  2XM0 A;  5JS5 A;  5JLI A;  2XLW A;  4NC3 A;  2XLO A;  1CGO A;  2YKZ A;  4ER9 A;  3HNJ A;  5JVE A;  1JAF A;  3ZWI A;  1NBB A;  4EIY A;  1CPQ A;  4JKV A;  4JEA A;  256B A;  5AGF A;  3HNI A;  4D4N A;  4IB4 A;  4JEB A;  5JUA A;  4U9D A;  3IQ5 A;  4JE9 A; 
#chains in the Genus database with same CATH topology
 3ECS A;  1VLS A;  4EHP A;  5L3V A;  2QLA A;  3MLG A;  2UUH A;  1M57 C;  2E87 A;  3WAQ A;  1HMD A;  4PJN A;  1WWP A;  4YL0 A;  3U0C A;  3QVY A;  1WAT A;  2OG2 A;  2HKV A;  4Q5S F;  2IM8 A;  3K1I C;  4P9F A;  4YK5 A;  4CS9 A;  3RQG A;  1EQ1 A;  4C3D A;  1LE2 A;  2Q9C A;  3LAY A;  3O55 A;  4U5E E;  3S90 A;  1ORS C;  1RKE B;  2J9V A;  3EGD B;  5T3T A;  3CSK A;  2HV6 A;  3U2L A;  2CCY A;  4H4K C;  2KYH A;  1AVO B;  1QZX A;  2Q3T A;  2XLH A;  2I8B A;  4U5H A;  5KYY B;  4EBK A;  2J9W A;  1RMV A;  4JTD B;  4MVM A;  1JPJ A;  5B1A C;  3RVZ A;  3TUL A;  1S05 A;  5CI9 A;  1Z7Q c;  2L9J A;  3DKA A;  2M64 A;  3O10 A;  4C7O B;  1E2X A;  3AGU A;  3GM3 A;  4YL3 A;  3VYW A;  1S7Z A;  4CIP A;  3B0V C;  2B0H A;  1T9K A;  3EHN A;  4JJF A;  3SXZ A;  3AOU A;  3IPM O;  4G78 A;  1LPE A;  2GAQ A;  5JSL A;  3L34 A;  2MYS A;  1ZHX A;  2ZPA A;  1SYQ A;  1RJ9 A;  1NU7 D;  1WTY A;  4JRZ A;  3RIP A;  1RKC A;  5FZT A;  3SEO A;  3NYJ A;  3S27 A;  2UUI A;  3L1M A;  4R32 A;  2VAS A;  2KQ9 A;  2NUP B;  1ZU4 A;  3ZG1 A;  1GS9 A;  4QI2 A;  5HV9 A;  2NSG A;  2FFH A;  2OJQ A;  2QE9 A;  2Y3H A;  4M63 A;  2H7V C;  3B71 A;  3MX3 A;  4E0H A;  3WG7 C;  4IAQ A;  3UNG C;  1Y4C A;  1G4U S;  2G62 A;  3C8G B;  4MTO A;  2M4E A;  4O6Y A;  1OKK A;  2HMQ A;  2OOC A;  5KYX B;  3FXH A;  1V4A A;  2DGJ A;  3AG1 C;  5COG A;  5DLJ A;  2R7R A;  4WGZ A;  1YA7 O;  3ABL C;  4CBE A;  1UFB A;  2RSE B;  3GOR A;  3Q7L A;  4I44 A;  5DS6 A;  3JRM O;  4I3M A;  5JT4 A;  2Z15 A;  3VF0 A;  5L0I A;  5A69 A;  2H8A A;  2H7O A;  1MMA A;  3PDM P;  2Y39 A;  5EHH A;  1KTM A;  1OW7 A;  1FNT c;  1V54 C;  2CW0 F;  1FAP B;  1FR0 A;  3HLZ A;  1CGN A;  3FVY A;  3ZQV A;  1VB5 A;  3Q6M A;  1GM5 A;  4I1O B;  1M2V B;  2HZ8 A;  1NSG B;  1KNY A;  5KYW A;  4L6R A;  1T6I A;  4CDY A;  1O5H A;  4QI0 A;  1E84 A;  4MVS A;  3GAN A;  4CJG A;  3KL4 A;  2YL3 A;  4E18 A;  2J45 A;  2MHR A;  2OKU A;  2A6H F;  2J0W A;  1OR3 A;  1ZHW A;  4KNW A;  5GPG B;  2R7S A;  2W9Y A;  2WB7 A;  4IRU A;  1ZVZ A;  1MQV A;  3QW1 A;  4LAC B;  4BEJ A;  2R7X A;  2KSF A;  5JLI A;  4JCZ A;  2NG1 A;  4W8P A;  2PX3 A;  2XLW A;  2XXA B;  3C8G D;  2P6V A;  1CGO A;  1J8Y F;  1VLT A;  5HSW A;  1OCR C;  3EG9 A;  3V5X A;  2L81 A;  3IEE A;  4NTF A;  1JAF A;  1T6U A;  5JVE A;  1PD1 A;  3RQE A;  2XSE A;  4ONS A;  4YJW A;  1XWJ A;  3AG4 C;  3MYF A;  1A7D A;  3LUT B;  4YT8 A;  4JVS A;  2A6E F;  2KNH A;  4JEA A;  5BQG A;  5AGF A;  4D4N A;  1G4W R;  2AVK A;  5DQZ A;  1JRA A;  3EGD A;  3ABK C;  1NG1 A;  4U9D A;  1WAS A;  2ZXW C;  4LDK A;  1U0B B;  4J7T A;  3PCV A;  4YL1 A;  3S0X A;  2C04 A;  4IWB A;  3U8V A;  2IOQ A;  4XPY A;  1H9T A;  1RXQ A;  4AK9 A;  5FCL A;  3SXM A;  3G4X A;  4LDQ A;  3C62 A;  2YL0 A;  3ZSU A;  1TFO B;  3TK0 A;  2R7O A;  3W2V A;  4P9T A;  4PR9 A;  2VCB A;  4CSA C;  2VCA A;  2CNW D;  4PJJ A;  4P6I C;  3NKD A;  1E83 A;  1BR1 A;  2A68 F;  2Y69 C;  3R2P A;  4PAC A;  4NY3 A;  5AC4 A;  3SP1 A;  1D0Y A;  4BPM A;  1AEP A;  3LNR A;  3OEO A;  1EKY A;  3JT1 A;  3UMK A;  1A0B A;  4PFO A;  1MNE A;  1XZP A;  2BL2 A;  1D1C A;  3UMH A;  1MMN A;  2DYS C;  4DXW A;  2Y3B A;  3GM1 A;  2A0U A;  3LS0 A;  4NQF A;  3M1C B;  4XQ1 A;  4XWJ A;  3SXK A;  1MMG A;  4N6C A;  1ORJ A;  2R7T A;  3W8H A;  4EKW A;  4E7S A;  2YWA A;  3FMS A;  4O7G A;  2YLI A;  1ZHY A;  5D91 A;  1WN0 A;  5B3I A;  1GQA A;  2HSB A;  2AWY A;  3T9O A;  2D4U A;  2EPK X;  1LIH A;  1MND A;  2CYD A;  3E9V A;  2MWQ A;  2W4B A;  5KYU B;  3KMI A;  3MBG A;  1LI5 A;  2OU6 A;  4WJ0 A;  1LS4 A;  4XPX A;  4DJ9 A;  3UGO A;  2QY9 A;  3B0P A;  3NDB B;  2YL1 A;  1LVK A;  4U5B E;  1QPU A;  3M4C A;  3IHU A;  3EQL F;  2J9B A;  1A41 A;  1D0X A;  3C8Z A;  1LM3 B;  2R03 A;  4J32 B;  1H9G A;  2AWC A;  4PFP A;  1TKN A;  3DZA A;  1G5Z A;  3U9J A;  3KKB A;  2AP3 A;  2WVO A;  2J0X A;  3CAX A;  4WAB A;  2P61 A;  3OA1 A;  2ETS A;  2NUT A;  3EH2 A;  1BZ4 A;  1HW1 A;  2LD6 A;  1CGM E;  2IXN A;  1TWC A;  2G3K A;  2IYL D;  4LLE A;  4NTA A;  2EIM C;  3TQO A;  4BJ5 A;  5JRA A;  4IJJ A;  1OCO C;  3A9C A;  3GWL A;  2XXA A;  3LEO A;  4MVO A;  2L6G A;  1H7I A;  4CX9 A;  1ZZP A;  2XL8 A;  3AQC A;  4YT5 A;  3HNK A;  1Z3I X;  3RVY A;  4BJ1 A;  5L0G A;  3VM6 A;  2CGE A;  2YVK A;  4MTF A;  1K40 A;  4AE4 B;  4BJ5 C;  2EPM X;  2V3C C;  2LIG A;  4K7B A;  1YDI A;  2XM0 A;  3OWT A;  2OQM A;  1L3P A;  5JS5 A;  2J7P D;  2A1D D;  4MTG A;  3EHM A;  1BDJ B;  2GWW A;  3LLI A;  5BUO A;  3GEI A;  3QZC A;  1YJG A;  2YZS A;  3LNM B;  2VC9 A;  1BR4 A;  4AL0 A;  1R5I D;  1W2W A;  4ER9 A;  2ICW G;  3Q6N A;  4JTA B;  4GYT A;  2Y3G A;  3ITF A;  1U89 A;  3CZ6 A;  4G7H F;  1T01 A;  3V7O A;  2HUJ A;  2P7V A;  3NYM A;  4U5D E;  4JKV A;  1OR2 A;  1U6H A;  256B A;  1YA9 A;  3BEH A;  2L6H A;  2HJ3 A;  4DBR A;  5JUA A;  1WOL A;  4G7Z F;  1OCC C;  1SMY F;  4HFF B;  5F28 E;  4CIH A;  1IW7 F;  3GOD A;  2LQG A;  4JE9 A;  2KJG A;  2KGO A;  1ORY A;  2QUP A;  4N6H A;  4ULV A;  5COM A;  3RFY A;  5A6B D;  4IAR A;  4X0R A;  5A6K A;  3UGP A;  3EFO A;  3EZI A;  3S9O A;  4BG0 A;  2OCC C;  4AX2 A;  4DBQ A;  1D1B A;  5L0F A;  3M79 A;  4G7O F;  2GA0 A;  3K6B A;  4JTC B;  3US6 A;  2YL7 A;  3I5Q A;  2Y3D A;  4YN0 B;  1I4Y A;  3ZIB A;  2QNL A;  4E17 A;  2FGY A;  2R02 A;  4D4X A;  2Q9B A;  5BQH A;  3ZDL A;  1AUE A;  3DAG A;  5L0H A;  3GEH A;  3IQT A;  3EGX B;  1ZHZ A;  2ASR A;  3NYL A;  1JMW A;  3U3B A;  1OW8 A;  2Q4F A;  3KH2 A;  4YT2 A;  1E85 A;  4HE8 D;  3LS1 A;  3EPV A;  4KNV A;  2LSE A;  4N06 A;  1RJ9 B;  3PHF 2;  2DB4 A;  2AU5 A;  3BRJ A;  2TMV P;  1YYJ A;  3T6J A;  1G8X A;  3B0U X;  1RKE A;  3F47 A;  1VMA A;  1JPN A;  4YT4 A;  4CSA A;  5KYN A;  3QTH A;  3U5S A;  4E0I A;  4U9E A;  3HNL A;  2BE5 F;  5E3A A;  1NFO A;  1SR2 A;  3G50 A;  3DE9 A;  4A4A A;  5A6A A;  1B68 A;  5KYY A;  2VB6 A;  4UDV A;  1V74 B;  3RYL A;  2VH3 A;  4QDL A;  5TJ5 E;  3X1O A;  3RW0 A;  1E86 A;  1QLE C;  3MYI A;  4H54 A;  2LCH A;  1TWH A;  2J8W A;  3GEE A;  1LI7 A;  1VOM A;  2WZG A;  4XEK A;  3T4R A;  5L0D A;  4C7O A;  3JYH A;  1ST6 A;  4OIP F;  2LK4 A;  4DRJ B;  1I4Z A;  2W4M A;  2D5R B;  4ULW A;  4ZLD A;  2R7W A;  5T1D B;  3ZVR A;  2HSQ A;  1SF8 A;  2HFI A;  3DM9 B;  3JZ0 A;  4JJG A;  1T5O A;  3V5Y A;  3AGT A;  1TFK B;  1XZQ A;  1FTS A;  1YZC A;  3DE8 A;  1OXK A;  2XLE A;  2R7V A;  3HKK A;  4HFK B;  3K33 A;  3KYI A;  2NUP A;  2IXM A;  3ASN C;  4JCH A;  2P1A A;  1TQG A;  3I4U A;  1M2O A;  1Q0D A;  3DXJ F;  3M15 A;  3IQC A;  3L8I A;  4G0H A;  1Z6A A;  4KC9 A;  2R25 A;  1YYX A;  2XL6 A;  2X0C A;  3SYN A;  1SZI A;  5DS5 A;  1YVI A;  1YAU O;  2B0J A;  2XLD A;  3H2U A;  3VRC A;  4CDV A;  1TR2 A;  2OEV A;  3ATP A;  1HE9 A;  2ZXO A;  3EH1 A;  3C8G A;  2XLM A;  4EBB A;  4Q4Z F;  2NPU A;  4U5G A;  5KYX A;  1QVX A;  2DYR C;  2W45 A;  3W8I A;  5DS4 A;  1RCP A;  1ZW3 A;  4LLC A;  1OQC A;  3QMK A;  3C63 A;  4NCQ A;  1NLX A;  2HJM A;  4CJO A;  2XLV A;  3E70 C;  5AC5 A;  2ZXP A;  3RQF A;  3NKE A;  2WVQ A;  2IXO A;  1EA8 A;  1EI7 A;  3FAJ A;  2XRH A;  1HMO A;  3JRT A;  3L0I A;  4JUR I;  5DVW A;  4DVY P;  2XL4 A;  3JSZ A;  5IY5 C;  2IBF A;  1I5N A;  2YEV A;  4OD4 A;  4J30 B;  1HY5 A;  1D0Z A;  4OIN F;  4DVZ A;  5L0C A;  1FFH A;  2O9X A;  2QTV A;  4OIO F;  1UG7 A;  1APC A;  1OKK D;  3DJU B;  3NMJ A;  5D92 A;  4Z9H A;  2EIJ C;  3TJ5 A;  5F5F A;  3EG9 B;  1L7C A;  3ASO C;  1M2V A;  1V55 C;  1KU2 A;  1O87 A;  3SNH A;  4F4B A;  2C03 A;  1QSP A;  3EJN A;  3R7C A;  3AQB A;  3JTL O;  3I5P A;  1Z5Z A;  1WGW A;  5E3C A;  2I15 A;  3S84 A;  4KBL A;  2CNW A;  4RDA A;  1HE1 A;  2YKZ A;  3MFN A;  4NTB A;  2KW3 C;  4C3E A;  2YHS A;  3B9Q A;  4XLP F;  2R7U A;  4MVQ A;  3J06 A;  1N1C A;  3DWW A;  1NBB A;  5EGY A;  2EPN A;  4EIY A;  4CS9 C;  2LFF A;  2FAP B;  1NFN A;  2Q00 A;  3NG1 A;  2HV7 A;  3HNI A;  4JEB A;  1LKX A;  2VCC A;  3IQ5 A;  2JPU A;  2G3V A;  3EGX A;  3L8J A;  4MQ9 F;  4OD5 A;  5B1B C;  4CS8 A;  1IZM A;  1K05 A;  5E2Q A;  1K04 A;  1PCX A;  2NSF A;  2ZD9 A;  1PV3 A;  3KPH A;  2XM4 A;  4WGY A;  2L6F A;  2PF4 E;  1HW2 A;  2CDQ A;  1BBH A;  3G4Z A;  3PMR A;  5F5H A;  3ZQY A;  5EK0 A;  4MND A;  1T6Q A;  1C17 M;  3QW0 A;  4I1M A;  3TOM A;  4W8K A;  4GQH A;  4U5F E;  4FES A;  3H65 A;  4CS8 C;  3X2Q C;  1YLM A;  2RD9 A;  3DM5 A;  3H2V A;  3QVZ A;  3U8P A;  2PP4 A;  2PNO A;  4FWV A;  4OIR F;  1H6G A;  2PX0 A;  2YRF A;  4MVZ A;  3U2M A;  2DI3 A;  3N0T A;  4EWC A;  3ZTM A;  2R9R B;  3RKO F;  4BEM J;  3F46 A;  3N2Z B;  4MS2 A;  3AG3 C;  3VAY A;  5COF A;  4J7Y A;  4CDA A;  3O6X A;  3U3F A;  1DOW A;  3NRH A;  2X51 A;  5T3W A;  5BQI A;  4JW1 A;  4N4W A;  4DRH B;  1ZYR F;  1VYK A;  3WHN A;  1DOV A;  2KK1 A;  3ABM C;  3ZTZ A;  2L7A A;  5B3S C;  3TD7 A;  2PBE A;  4Z9J A;  3WOD F;  4FX5 A;  3TJ6 A;  1Q0K A;  4C3B A;  3U9M A;  3C7J A;  4PK4 A;  4MW8 A;  4JZA A;  1TWA A;  1Y6D A;  3S29 A;  3M4B A;  1VYI A;  3DI5 A;  4MW3 A;  4FAP B;  2J46 A;  3FAP B;  4K1O A;  2OJE D;  2HMZ A;  3JSE O;  1ZHT A;  3DD7 A;  3DAF A;  1A7E A;  2OEX A;  4A2N B;  4O79 A;  3GWN A;  4JC7 A;  4MVR A;  4IAO A;  1LE4 A;  1OXB A;  2F22 A;  2HS5 A;  1QKR A;  2V26 A;  2WZF A;  2YLD A;  3IQ6 A;  1FMV A;  3LLK A;  4U5C E;  3FOO A;  3S28 A;  2YQY A;  3FHD A;  1YZA A;  5KYU A;  3TOL A;  4EBJ A;  4JIO A;  3K1H A;  2EIN C;  2LP4 A;  3CQZ A;  2JX0 A;  2NUT B;  3NMI A;  4XLN F;  3EZH A;  4XEF A;  2Q7R A;  4MVU A;  4BJ6 A;  3FDQ A;  1NU9 C;  5DQT A;  4GEH A;  1A7V A;  2YLG A;  3V5Z A;  2H7B A;  2WZL A;  1VTM P;  1GGQ A;  1Q0F A;  4XPW A;  5JP7 A;  1M6T A;  2EIK C;  2J7P A;  2PFD A;  4YWQ A;  1TWG A;  4PJM A;  5L3Q A;  2LFD A;  4K0D A;  4DOZ A;  1YAR O;  3NMK A;  4BJ6 C;  5A6J A;  4Z9I A;  2GDC A;  5E33 A;  1R4T A;  3GM2 A;  3T6B A;  3RH3 A;  1OCZ C;  2EPL X;  3B29 A;  4B6I A;  1ZW2 A;  3T6G B;  1M56 C;  1Q0G A;  3C18 A;  2WVN A;  3FOP A;  3AG2 C;  3HTK C;  3KYJ A;  1LS1 A;  4O6N A;  4ZLC A;  4RBN A;  3JYY A;  3Q7G A;  2EPO A;  4ANJ A;  4IGG A;  3UMI A;  2WL8 A;  4CS7 A;  3RF3 A;  2ZXR A;  4DRI B;  1QQ3 A;  3LJB A;  4BJT A;  3DMD A;  1C02 A;  2R05 A;  2BC5 A;  2JD3 A;  2EIL C;  3O39 A;  5A6B A;  1FFT C;  1CPR A;  1OW6 A;  3DJN B;  4O6M A;  4KI2 A;  2P0N A;  1MMD A;  2KC3 A;  2XS8 A;  3A11 A;  3K7D A;  2Q9A A;  2A0B A;  3UR3 C;  1NZE A;  2XS1 A;  4OIQ F;  5L0J A;  5KYW B;  2IXP A;  2A69 F;  1JOG A;  2GFH A;  4HEA J;  2XLO A;  2R7Q A;  4NC3 A;  3W2W A;  1J8M F;  3SZR A;  4PJL A;  3HNJ A;  1F1M A;  4AL1 A;  1FMW A;  1D1A A;  3AJM A;  3JCU Q;  3HJC A;  3W4Y A;  4AE4 A;  3LES A;  1Q0M A;  3ZWI A;  4EUK B;  3CEX A;  3EFO B;  1CPQ A;  1ZU5 A;  2J9U A;  3K66 A;  4RD9 A;  1PD0 A;  1VK5 A;  4Q7C A;  4XEV A;  1O3U A;  3POV A;  3K1I A;  1Z63 A;  4XTK A;  5CI8 A;  4IB4 A;  4LDR A;  1C03 A;  1JR8 A;  1BR2 A;  3SXY A;  5CIV A;  3LEV A;  3ZC4 A;  4E7Z A;  4LER A;  1Z23 A;  3N24 A;  5K0I A; 
#chains in the Genus database with same CATH homology
 2QLA A;  4WGY A;  4N6H A;  2XM4 A;  4IAR A;  1BBH A;  3QVY A;  3ZQY A;  3C62 A;  3M79 A;  2YL0 A;  3QW0 A;  2YL7 A;  3TOM A;  1E83 A;  4D4X A;  3U8P A;  3QVZ A;  2CCY A;  1E85 A;  3ZTM A;  2XLH A;  1EKY A;  4CDA A;  1S05 A;  1YYJ A;  4N4W A;  4CIP A;  3ZTZ A;  4U9E A;  3HNL A;  3DE9 A;  5JSL A;  2YLI A;  5B3I A;  1GQA A;  1E86 A;  2J8W A;  3L1M A;  3M4B A;  1YZC A;  3DE8 A;  4ULV A;  3IQ6 A;  2XLE A;  2YLD A;  2YL1 A;  4IAQ A;  3FOO A;  3TOL A;  1QPU A;  1YZA A;  3M4C A;  3NMI A;  3M15 A;  2J9B A;  1LM3 B;  4WGZ A;  1YYX A;  1A7V A;  2XL6 A;  2YLG A;  3VRC A;  2XLD A;  4CDV A;  5JP7 A;  1M6T A;  5JT4 A;  2XLM A;  3NMK A;  1RCP A;  3C63 A;  3ZQV A;  1CGN A;  4CJO A;  2XLV A;  5JRA A;  4CX9 A;  3FOP A;  4L6R A;  4CDY A;  1E84 A;  2XL8 A;  4CJG A;  2YL3 A;  1APC A;  3NMJ A;  3HNK A;  1QQ3 A;  2BC5 A;  1CPR A;  3QW1 A;  1MQV A;  2XM0 A;  5JS5 A;  5JLI A;  2XLW A;  4NC3 A;  2XLO A;  1CGO A;  2YKZ A;  4ER9 A;  3HNJ A;  5JVE A;  1JAF A;  3ZWI A;  1NBB A;  4EIY A;  1CPQ A;  4JKV A;  4JEA A;  256B A;  5AGF A;  3HNI A;  4D4N A;  4IB4 A;  4JEB A;  5JUA A;  4U9D A;  3IQ5 A;  4JE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...