4D4NA

Nitrosyl complex of the d121a variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHAAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 50
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4nA00
3HNJA 3C62A 4NC3A 3FOPA 1YZCA 3M4CA 3TOMA 3HNKA 3IQ5A 5AGFA 2YLDA 4D4XA 1CGOA 3ZTZA 5B3IA 1RCPA 4EIYA 4L6RA 2BC5A 4CDVA 1S05A 1E86A 2XM4A 1QQ3A 1E84A 1APCA 3NMIA 2XLHA 4CJOA 3QVYA 3FOOA 2XLOA 3HNLA 1QPUA 4U9EA 4N6HA 3ZQVA 3QW0A 4ER9A 4CX9A 2YKZA 1EKYA 3ZTMA 1BBHA 3VRCA 4IAQA 3IQ6A 2XL8A 5JP7A 4JEAA 2XLMA 3QW1A 4CJGA 4IARA 1A7VA 4JE9A 4WGZA 2XLDA 1NBBA 2YL7A 1M6TA 3DE9A 2XM0A 3ZQYA 4CIPA 1CPRA 1CGNA 3NMJA 3U8PA 5JS5A 1CPQA 2J8WA 4D4NA 4CDAA 2YL3A 3L1MA 3C63A 3M15A 3DE8A 2XLVA 2YLIA 4JEBA 2YL1A 1YZAA 3M4BA 1MQVA 4CDYA 4WGYA 1E85A 1YYXA 3ZWIA 5JVEA 2XL6A 1GQAA 5JUAA 3TOLA 5JLIA 1E83A 4ULVA 1LM3B 5JT4A 2XLWA 4JKVA 256BA 4N4WA 2CCYA 2QLAA 5JRAA 2J9BA 3HNIA 3NMKA 1JAFA 5JSLA 2YL0A 2YLGA 3QVZA 1YYJA 4IB4A 4U9DA 2XLEA 3M79A
chains in the Genus database with same CATH superfamily
3DJUB 4YL1A 3X2QC 1NFNA 1OR2A 2IM8A 1LKXA 2KC3A 1JPJA 3DM9B 2E87A 3HKKA 5KYNA 2IXOA 3HNKA 1LI7A 5D91A 4ULWA 2YLDA 1H6GA 1CGOA 3VAYA 2CW0F 4C7OB 3AQCA 4FX5A 1OXBA 2R25A 1NG1A 5COGA 3LS0A 2ICWG 3H2UA 3EHMA 4EIYA 2CYDA 4L6RA 4U5HA 2H7BA 4MTOA 4XWJA 1Z7Qc 4Q4ZF 1PD1A 4YT5A 3GEHA 4CDVA 2R7QA 1G4WR 3SXMA 4PJJA 2J7PD 3NMIA 3LNRA 2LK4A 4A4AA 4CS9A 3W2WA 4E17A 2XLOA 4NTFA 3PDMP 2R7OA 4CS8A 1YVIA 2IBFA 4N6HA 1A41A 4G7HF 2KNHA 5L0GA 4FWVA 3FHDA 4CX9A 1HMOA 2G62A 1U0BB 2R7SA 4YN0B 2R05A 4H4KC 4XPWA 2L9JA 1YLMA 3VRCA 5E2QA 5HSWA 3OWTA 2PF4E 2L6GA 2YQYA 3W4YA 1RXQA 2XL8A 3AJMA 4P9TA 1YA9A 3S29A 1Z5ZA 1OCRC 4JEAA 3JT1A 2XLMA 1C02A 1A7VA 3AQBA 3NKDA 1SZIA 4LERA 2Q3TA 1QLEC 2Z15A 2YL7A 1R5ID 2Q9CA 2NUTA 4XQ1A 2V26A 4CIPA 4CSAC 1CPRA 4YL0A 2F22A 4P9FA 4E7ZA 4CIHA 1BR2A 1PCXA 3WODF 4MNDA 3L0IA 3Q6NA 2VCCA 2LD6A 1VLTA 4MW8A 5K0IA 4PK4A 3ITFA 2J8WA 2ZXRA 2XXAB 2Q7RA 2A68F 4LACB 4LLEA 3LS1A 3LESA 2XL4A 4YWQA 1TWCA 3EQLF 2JPUA 3LNMB 1ZHWA 3N0TA 4CS9C 1JR8A 2IXPA 1W2WA 3UGOA 2CNWD 1K05A 2WZFA 4HFFB 1GS9A 3EGDA 3GM1A 4OIRF 4ANJA 3NYLA 3UGPA 3B29A 1RMVA 3JYHA 4I44A 4KNWA 3O10A 4JCZA 1G5ZA 2GDCA 1MNDA 4WGYA 1YA7O 4W8KA 1ZHXA 1YYXA 2EPLX 2M64A 4J32B 5COMA 5JVEA 1U6HA 2NUTB 1T6QA 2BL2A 2EPNA 1B68A 4U5CE 5E3CA 1T9KA 4PFPA 5JUAA 1Z6AA 3UR3C 3EH1A 3OA1A 2IXMA 3UNGC 4JJGA 2MHRA 4AE4A 3KKBA 4I1OB 2EIJC 5JLIA 3C8GA 4GYTA 4QI2A 3R7CA 4AK9A 2NUPB 1LM3B 5JT4A 1OCOC 1ZU5A 3NG1A 1VYKA 2A0UA 4DRHB 4E18A 3IPMO 3VYWA 2LQGA 3HLZA 3O6XA 3SXYA 2PNOA 2A6HF 3SXZA 1KU2A 2G3KA 2WB7A 4BG0A 1A0BA 2PBEA 1TFOB 3HJCA 3S27A 2MYSA 2QY9A 3C18A 5CI9A 3US6A 4BPMA 1WASA 3S28A 1E2XA 2VB6A 1RJ9A 4JURI 2I15A 3Q6MA 5B1AC 2EPKX 2NPUA 1PV3A 3IEEA 2J9WA 5BQHA 5IY5C 1LE4A 3B71A 1T5OA 4EBJA 2L81A 3LAYA 3PHF2 2HFIA 1M2OA 5JSLA 2DYSC 2YL0A 2YWAA 3KH2A 2YZSA 3LLIA 4HE8D 2XLEA 1LS4A 1VTMP 5HV9A 2WL8A 2XSEA 2W45A 3GANA 4G78A 4AE4B 1ZYRF 1LPEA 3U3BA 3C8GB 2NSGA 1PD0A 2A6EF 1H9TA 3C62A 1EI7A 3FOPA 1FMVA 1LE2A 3EGXA 3GEEA 5DLJA 4OIOF 5A6JA 1SYQA 1HE1A 1BR1A 1VB5A 2AWYA 3IQ5A 2HV6A 3T9OA 1SF8A 2YHSA 5FCLA 3RKOF 5GPGB 3KMIA 2KJGA 4C3BA 3ECSA 3RQFA 1ORSC 4J7YA 4OIPF 2EINC 1OW7A 3CAXA 4MVQA 1S05A 4MVSA 1F1MA 1E86A 3GWNA 3QVYA 1WATA 3FOOA 3HNLA 4O6NA 5CIVA 1JRAA 1Y6DA 1RKCA 1T6IA 2OOCA 1I5NA 1QPUA 4U9EA 3WG7C 2DI3A 3E70C 3ZQVA 2IXNA 3K1IA 2RSEB 1YJGA 3EZIA 1VOMA 3O55A 3RVYA 1Q0FA 2ZPAA 3TD7A 3FVYA 2VCAA 3MBGA 2PX3A 3ZTMA 1LVKA 4BJ5C 2A69F 4IAQA 4PR9A 1VLSA 2FAPB 3L8IA 4KC9A 4AX2A 4P6IC 4U5GA 5D92A 2W9YA 5JP7A 2C04A 4CSAA 3W8IA 1TWGA 2PX0A 4KNVA 4BJTA 2FGYA 4DOZA 4C3EA 5AC4A 5KYWA 4C3DA 2P6VA 4PFOA 1NLXA 4U5EE 1G8XA 3I4UA 3PMRA 2IYLD 1NBBA 2J9UA 1M6TA 2BE5F 4KBLA 2VC9A 3ZQYA 4YT4A 3IQCA 3S90A 3Q7GA 3U5SA 3ZDLA 2R03A 2VCBA 4M63A 5E33A 4W8PA 1Z63A 5COFA 1V54C 1WGWA 2R9RB 4MQ9F 2OG2A 4N6CA 2W4MA 1AVOB 1DOVA 4XLNF 4D4NA 5A6KA 5F5FA 4JVSA 4F4BA 4CDAA 2YL3A 3SYNA 1D1BA 4JTDB 4FESA 1LS1A 4AL1A 2OCCC 1BR4A 3B0UX 4CS7A 3C63A 4R32A 3V5YA 1QSPA 3T4RA 3JSZA 4XEFA 4WJ0A 2J9VA 3DAGA 4JEBA 3LEVA 3CEXA 3L34A 3K1IC 4WABA 3T6JA 1MQVA 5KYWB 2Y3HA 3BRJA 1M2VA 1ZZPA 4Z9JA 3EPVA 3JRMO 4DVZA 3RQGA 1S7ZA 4LLCA 3KYIA 1Q0KA 2EPMX 4JCHA 3QZCA 3EH2A 5DS5A 1D0XA 1EA8A 1Z3IX 2YRFA 4XEKA 3ZVRA 4AL0A 3EFOA 3AG1C 2P1AA 3N24A 4ULVA 3T6GB 2P61A 2VH3A 1MNEA 2HSBA 256BA 2R7VA 5DQZA 5L0DA 3DXJF 4NTBA 2EILC 3RFYA 3GORA 3MX3A 4MW3A 1I4YA 2LP4A 2EIKC 3CZ6A 2LCHA 2QLAA 2UUIA 3W8HA 3JRTA 3ABMC 5TJ5E 4DRJB 1A7DA 5FZTA 3RW0A 4O79A 1JMWA 2TMVP 2QE9A 4OD4A 4HEAJ 2A0BA 4RDAA 2WVNA 4EHPA 2HJMA 1WWPA 2J9BA 4MVMA 1LIHA 4QI0A 4EBKA 1JAFA 4J30B 2R7UA 1FTSA 2L7AA 3QVZA 1YYJA 4GEHA 4U9DA 1O3UA 2X0CA 4ZLCA 5L0JA 3NYMA 3KPHA 1WOLA 2ZXWC 2V3CC 2HS5A 2HMQA 5L0CA 4NTAA 5L0IA 4ZLDA 3EFOB 3M79A 4G0HA 4JC7A 3HNJA 3IQTA 1CGME 4PACA 1ZVZA 2LIGA 2WZGA 1VMAA 4NC3A 1V4AA 1M56C 2P0NA 4OINF 2YEVA 4PJMA 3SNHA 4DRIB 4BEMJ 3RVZA 3V5XA 4D4XA 3I5PA 4LDKA 2KSFA 3UMIA 2J0WA 1H7IA 4EBBA 1KTMA 5B3IA 1MMAA 2ZD9A 3QTHA 2R7TA 3EGDB 4IRUA 1N1CA 1T6UA 4CBEA 4I1MA 1ORJA 1ZW2A 1QKRA 3NKEA 5A6BA 3RIPA 1APCA 1ZHZA 3U2MA 2C03A 1WTYA 1ZW3A 3AOUA 4BJ5A 5T3WA 3O39A 3ZG1A 2OQMA 1BDJB 1HMDA 1FR0A 3U3FA 2GA0A 3QW0A 3RYLA 3C8GD 1IZMA 2OEXA 2H8AA 2Q4FA 1I4ZA 1OXKA 3DAFA 5B1BC 3ZC4A 2I8BA 5DVWA 4MVOA 2UUHA 4MTGA 1K40A 3C7JA 5L0FA 1MMGA 4G7OF 2Y3GA 3U9JA 3IQ6A 2AVKA 2G3VA 1NU9C 1OCZC 3MFNA 3KYJA 4YT2A 4CJGA 4DXWA 4IARA 2YVKA 2XLDA 4IGGA 1RKEA 2MWQA 3FDQA 2Y3DA 1ZU4A 2FFHA 3AG4C 3U2LA 5KYXA 2OJQA 4DJ9A 1XZPA 2OEVA 2XM0A 1RJ9B 5KYYA 4JJFA 1YDIA 5KYUA 1CGNA 1TWAA 1D0ZA 1XZQA 4O7GA 5L3VA 3NMJA 2B0JA 4MTFA 4UDVA 3U8PA 4RBNA 3GEIA 1OW8A 3U8VA 4E0IA 2PFDA 3G4ZA 3T6BA 2Q00A 5F28E 3VF0A 1U89A 4BEJA 4LDQA 1FFHA 3L1MA 4Q7CA 4FAPB 3DE8A 2XLVA 2YLIA 3B0VC 3EGXB 4O6MA 3G4XA 4OIQF 3N2ZB 2DYRC 3TJ5A 4Z9HA 3M4BA 5AC5A 2X51A 5EGYA 1HW1A 2WVQA 5A6AA 4CDYA 3DJNB 4ONSA 3NYJA 3DM5A 1RKEB 4JTCB 4B6IA 3JZ0A 3M1CB 4XPYA 4MVZA 1E85A 3RF3A 1JPNA 3FAPB 4MS2A 2J7PA 2W4BA 4I3MA 5E3AA 2XS8A 4NCQA 5CI8A 3X1OA 4MVUA 2HKVA 2KW3C 3FAJA 3GM2A 1XWJA 1YARO 3DWWA 1AUEA 3A11A 3F47A 3MYFA 2VASA 3ATPA 4JKVA 1C17M 1V74B 1J8YF 2WVOA 4XEVA 1Y4CA 2WZLA 4N4WA 1LI5A 4DVYP 1WN0A 2LSEA 1HW2A 3C8ZA 2QTVA 2KK1A 4A2NB 4BJ1A 4EKWA 4NY3A 3UMKA 1FMWA 1G4US 1MMDA 2Y69C 3NRHA 4YK5A 1NZEA 2OU6A 2OJED 4JTAB 1TKNA 1VK5A 2J0XA 3JYYA 1T01A 3H65A 3HNIA 3JTLO 3NMKA 3RH3A 4E0HA 3EJNA 2YLGA 1SR2A 2R7RA 4IB4A 2RD9A 3A9CA 1O5HA 2DB4A 3NDBB 2XXAA 4J7TA 2HJ3A 2GAQA 3ABLC 5EK0A 4NQFA 1J8MF 2QUPA 3DMDA 1D0YA 2KQ9A 1R4TA 1VYIA 4XTKA 1ORYA 1ST6A 2NSFA 2Y39A 2Y3BA 1YZCA 3GODA 3M4CA 1IW7F 1HY5A 3TOMA 3WHNA 4IAOA 2M4EA 2D4UA 4O6YA 5AGFA 1UG7A 1E84A 2CNWA 5DS6A 3ZTZA 2R7XA 5T3TA 1RCPA 4IJJA 2KGOA 2GWWA 2QNLA 2PP4A 3G50A 3Q7LA 5DS4A 1H9GA 4H54A 4BJ6A 4U5DE 3S84A 2BC5A 4DBQA 3LUTB 2HSQA 1YAUO 3LJBA 2XM4A 1TQGA 2O9XA 3B0PA 1QQ3A 3K66A 1M2VB 2OKUA 3K7DA 2XLHA 4N06A 4RD9A 1TWHA 3TJ6A 3ZSUA 4CJOA 3LLKA 3R2PA 3QMKA 4PJNA 3TQOA 1L7CA 2NUPA 5L0HA 4X0RA 3AG2C 4ER9A 4E7SA 2YKZA 3J06A 1EKYA 1BBHA 2ASRA 5DQTA 1AEPA 4GQHA 4HFKB 2J46A 2EIMC 1QVXA 2CGEA 1Q0MA 2ZXPA 4LDRA 3EG9A 3DD7A 4JZAA 4U5FE 4Z9IA 4CS8C 2HV7A 3SEOA 2AWCA 1ZHYA 2A1DD 3QW1A 1V55C 4OD5A 4WGZA 3H2VA 4JE9A 3V5ZA 2J45A 1NU7D 3K1HA 3E9VA 3WAQA 3RQEA 5B3SC 1ZHTA 3SZRA 1TR2A 2NG1A 3DZAA 3EHNA 3POVA 3BEHA 3DE9A 3I5QA 2HUJA 4XLPF 2IOQA 3PCVA 3U9MA 4EWCA 3ASOC 3OEOA 1OW6A 4IWBA 3DI5A 3B9QA 5JS5A 1OKKA 1CPQA 3AGTA 3IHUA 4QDLA 1KNYA 2DGJA 2XRHA 4BJ6C 4EUKB 2ETSA 3S9OA 3CSKA 1FNTc 2P7VA 4JW1A 3TULA 3GM3A 4MVRA 5BUOA 2EPOA 1OQCA 5F5HA 1OCCC 3CQZA 1NSGB 2ZXOA 3HTKC 3M15A 4JRZA 4K7BA 4G7ZF 1TFKB 3EG9B 2JD3A 3F46A 2YL1A 3KL4A 3MYIA 1YZAA 5T1DB 4KI2A 1OR3A 3DKAA 3SP1A 2LFDA 3ZIBA 2XS1A 1BZ4A 3SXKA 2Q9AA 4YT8A 1GGQA 1K04A 5A69A 4XPXA 5BQIA 1UFBA 2D5RB 1L3PA 3ZWIA 5A6BD 1JOGA 4K0DA 2L6HA 2XL6A 5EHHA 1GQAA 2CDQA 1Z23A 4YL3A 1FAPB 3W2VA 3TOLA 3L8JA 1OKKD 2H7VC 4U5BE 4JIOA 3VM6A 1GM5A 3UMHA 1C03A 4YJWA 1E83A 4Q5SF 2HZ8A 2XLWA 3ABKC 1MMNA 3EZHA 1M57C 1A7EA 3GWLA 2KYHA 2B0HA 2CCYA 2L6FA 2JX0A 2AP3A 3K6BA 4PJLA 4C7OA 4K1OA 2AU5A 3JCUQ 3AG3C 3MLGA 1SMYF 2LFFA 1D1AA 2H7OA 3K33A 1FFTC 2HMZA 1Q0DA 2R02A 3FMSA 5JRAA 3AGUA 2GFHA 1Q0GA 3S0XA 1HE9A 2Q9BA 3TK0A 5KYXB 3ASNC 3LEOA 3V7OA 1EQ1A 3JSEO 4DBRA 5KYYB 3U0CA 2R7WA 1NFOA 1D1CA 5BQGA 5KYUB 5L3QA 1QZXA 3FXHA 1O87A 1DOWA
chains in the Genus database with same CATH topology
3HNJA 3C62A 4NC3A 3FOPA 1YZCA 3M4CA 3TOMA 3HNKA 3IQ5A 5AGFA 2YLDA 4D4XA 1CGOA 3ZTZA 5B3IA 1RCPA 4EIYA 4L6RA 2BC5A 4CDVA 1S05A 1E86A 2XM4A 1QQ3A 1E84A 1APCA 3NMIA 2XLHA 4CJOA 3QVYA 3FOOA 2XLOA 3HNLA 1QPUA 4U9EA 4N6HA 3ZQVA 3QW0A 4ER9A 4CX9A 2YKZA 1EKYA 3ZTMA 1BBHA 3VRCA 4IAQA 3IQ6A 2XL8A 5JP7A 4JEAA 2XLMA 3QW1A 4CJGA 4IARA 1A7VA 4JE9A 4WGZA 2XLDA 1NBBA 2YL7A 1M6TA 3DE9A 2XM0A 3ZQYA 4CIPA 1CPRA 1CGNA 3NMJA 3U8PA 5JS5A 1CPQA 2J8WA 4D4NA 4CDAA 2YL3A 3L1MA 3C63A 3M15A 3DE8A 2XLVA 2YLIA 4JEBA 2YL1A 1YZAA 3M4BA 1MQVA 4CDYA 4WGYA 1E85A 1YYXA 3ZWIA 5JVEA 2XL6A 1GQAA 5JUAA 3TOLA 5JLIA 1E83A 4ULVA 1LM3B 5JT4A 2XLWA 4JKVA 256BA 4N4WA 2CCYA 2QLAA 5JRAA 2J9BA 3HNIA 3NMKA 1JAFA 5JSLA 2YL0A 2YLGA 3QVZA 1YYJA 4IB4A 4U9DA 2XLEA 3M79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNJ A;  3C62 A;  4NC3 A;  3FOP A;  1YZC A;  3M4C A;  3TOM A;  3HNK A;  3IQ5 A;  5AGF A;  2YLD A;  4D4X A;  1CGO A;  3ZTZ A;  5B3I A;  1RCP A;  4EIY A;  4L6R A;  2BC5 A;  4CDV A;  1S05 A;  1E86 A;  2XM4 A;  1QQ3 A;  1E84 A;  1APC A;  3NMI A;  2XLH A;  4CJO A;  3QVY A;  3FOO A;  2XLO A;  3HNL A;  1QPU A;  4U9E A;  4N6H A;  3ZQV A;  3QW0 A;  4ER9 A;  4CX9 A;  2YKZ A;  1EKY A;  3ZTM A;  1BBH A;  3VRC A;  4IAQ A;  3IQ6 A;  2XL8 A;  5JP7 A;  4JEA A;  2XLM A;  3QW1 A;  4CJG A;  4IAR A;  1A7V A;  4JE9 A;  4WGZ A;  2XLD A;  1NBB A;  2YL7 A;  1M6T A;  3DE9 A;  2XM0 A;  3ZQY A;  4CIP A;  1CPR A;  1CGN A;  3NMJ A;  3U8P A;  5JS5 A;  1CPQ A;  2J8W A;  4D4N A;  4CDA A;  2YL3 A;  3L1M A;  3C63 A;  3M15 A;  3DE8 A;  2XLV A;  2YLI A;  4JEB A;  2YL1 A;  1YZA A;  3M4B A;  1MQV A;  4CDY A;  4WGY A;  1E85 A;  1YYX A;  3ZWI A;  5JVE A;  2XL6 A;  1GQA A;  5JUA A;  3TOL A;  5JLI A;  1E83 A;  4ULV A;  1LM3 B;  5JT4 A;  2XLW A;  4JKV A;  256B A;  4N4W A;  2CCY A;  2QLA A;  5JRA A;  2J9B A;  3HNI A;  3NMK A;  1JAF A;  5JSL A;  2YL0 A;  2YLG A;  3QVZ A;  1YYJ A;  4IB4 A;  4U9D A;  2XLE A;  3M79 A; 
#chains in the Genus database with same CATH topology
 3DJU B;  4YL1 A;  3X2Q C;  1NFN A;  1OR2 A;  2IM8 A;  1LKX A;  2KC3 A;  1JPJ A;  3DM9 B;  2E87 A;  3HKK A;  5KYN A;  2IXO A;  3HNK A;  1LI7 A;  5D91 A;  4ULW A;  2YLD A;  1H6G A;  1CGO A;  3VAY A;  2CW0 F;  4C7O B;  3AQC A;  4FX5 A;  1OXB A;  2R25 A;  1NG1 A;  5COG A;  3LS0 A;  2ICW G;  3H2U A;  3EHM A;  4EIY A;  2CYD A;  4L6R A;  4U5H A;  2H7B A;  4MTO A;  4XWJ A;  1Z7Q c;  4Q4Z F;  1PD1 A;  4YT5 A;  3GEH A;  4CDV A;  2R7Q A;  1G4W R;  3SXM A;  4PJJ A;  2J7P D;  3NMI A;  3LNR A;  2LK4 A;  4A4A A;  4CS9 A;  3W2W A;  4E17 A;  2XLO A;  4NTF A;  3PDM P;  2R7O A;  4CS8 A;  1YVI A;  2IBF A;  4N6H A;  1A41 A;  4G7H F;  2KNH A;  5L0G A;  4FWV A;  3FHD A;  4CX9 A;  1HMO A;  2G62 A;  1U0B B;  2R7S A;  4YN0 B;  2R05 A;  4H4K C;  4XPW A;  2L9J A;  1YLM A;  3VRC A;  5E2Q A;  5HSW A;  3OWT A;  2PF4 E;  2L6G A;  2YQY A;  3W4Y A;  1RXQ A;  2XL8 A;  3AJM A;  4P9T A;  1YA9 A;  3S29 A;  1Z5Z A;  1OCR C;  4JEA A;  3JT1 A;  2XLM A;  1C02 A;  1A7V A;  3AQB A;  3NKD A;  1SZI A;  4LER A;  2Q3T A;  1QLE C;  2Z15 A;  2YL7 A;  1R5I D;  2Q9C A;  2NUT A;  4XQ1 A;  2V26 A;  4CIP A;  4CSA C;  1CPR A;  4YL0 A;  2F22 A;  4P9F A;  4E7Z A;  4CIH A;  1BR2 A;  1PCX A;  3WOD F;  4MND A;  3L0I A;  3Q6N A;  2VCC A;  2LD6 A;  1VLT A;  4MW8 A;  5K0I A;  4PK4 A;  3ITF A;  2J8W A;  2ZXR A;  2XXA B;  2Q7R A;  2A68 F;  4LAC B;  4LLE A;  3LS1 A;  3LES A;  2XL4 A;  4YWQ A;  1TWC A;  3EQL F;  2JPU A;  3LNM B;  1ZHW A;  3N0T A;  4CS9 C;  1JR8 A;  2IXP A;  1W2W A;  3UGO A;  2CNW D;  1K05 A;  2WZF A;  4HFF B;  1GS9 A;  3EGD A;  3GM1 A;  4OIR F;  4ANJ A;  3NYL A;  3UGP A;  3B29 A;  1RMV A;  3JYH A;  4I44 A;  4KNW A;  3O10 A;  4JCZ A;  1G5Z A;  2GDC A;  1MND A;  4WGY A;  1YA7 O;  4W8K A;  1ZHX A;  1YYX A;  2EPL X;  2M64 A;  4J32 B;  5COM A;  5JVE A;  1U6H A;  2NUT B;  1T6Q A;  2BL2 A;  2EPN A;  1B68 A;  4U5C E;  5E3C A;  1T9K A;  4PFP A;  5JUA A;  1Z6A A;  3UR3 C;  3EH1 A;  3OA1 A;  2IXM A;  3UNG C;  4JJG A;  2MHR A;  4AE4 A;  3KKB A;  4I1O B;  2EIJ C;  5JLI A;  3C8G A;  4GYT A;  4QI2 A;  3R7C A;  4AK9 A;  2NUP B;  1LM3 B;  5JT4 A;  1OCO C;  1ZU5 A;  3NG1 A;  1VYK A;  2A0U A;  4DRH B;  4E18 A;  3IPM O;  3VYW A;  2LQG A;  3HLZ A;  3O6X A;  3SXY A;  2PNO A;  2A6H F;  3SXZ A;  1KU2 A;  2G3K A;  2WB7 A;  4BG0 A;  1A0B A;  2PBE A;  1TFO B;  3HJC A;  3S27 A;  2MYS A;  2QY9 A;  3C18 A;  5CI9 A;  3US6 A;  4BPM A;  1WAS A;  3S28 A;  1E2X A;  2VB6 A;  1RJ9 A;  4JUR I;  2I15 A;  3Q6M A;  5B1A C;  2EPK X;  2NPU A;  1PV3 A;  3IEE A;  2J9W A;  5BQH A;  5IY5 C;  1LE4 A;  3B71 A;  1T5O A;  4EBJ A;  2L81 A;  3LAY A;  3PHF 2;  2HFI A;  1M2O A;  5JSL A;  2DYS C;  2YL0 A;  2YWA A;  3KH2 A;  2YZS A;  3LLI A;  4HE8 D;  2XLE A;  1LS4 A;  1VTM P;  5HV9 A;  2WL8 A;  2XSE A;  2W45 A;  3GAN A;  4G78 A;  4AE4 B;  1ZYR F;  1LPE A;  3U3B A;  3C8G B;  2NSG A;  1PD0 A;  2A6E F;  1H9T A;  3C62 A;  1EI7 A;  3FOP A;  1FMV A;  1LE2 A;  3EGX A;  3GEE A;  5DLJ A;  4OIO F;  5A6J A;  1SYQ A;  1HE1 A;  1BR1 A;  1VB5 A;  2AWY A;  3IQ5 A;  2HV6 A;  3T9O A;  1SF8 A;  2YHS A;  5FCL A;  3RKO F;  5GPG B;  3KMI A;  2KJG A;  4C3B A;  3ECS A;  3RQF A;  1ORS C;  4J7Y A;  4OIP F;  2EIN C;  1OW7 A;  3CAX A;  4MVQ A;  1S05 A;  4MVS A;  1F1M A;  1E86 A;  3GWN A;  3QVY A;  1WAT A;  3FOO A;  3HNL A;  4O6N A;  5CIV A;  1JRA A;  1Y6D A;  1RKC A;  1T6I A;  2OOC A;  1I5N A;  1QPU A;  4U9E A;  3WG7 C;  2DI3 A;  3E70 C;  3ZQV A;  2IXN A;  3K1I A;  2RSE B;  1YJG A;  3EZI A;  1VOM A;  3O55 A;  3RVY A;  1Q0F A;  2ZPA A;  3TD7 A;  3FVY A;  2VCA A;  3MBG A;  2PX3 A;  3ZTM A;  1LVK A;  4BJ5 C;  2A69 F;  4IAQ A;  4PR9 A;  1VLS A;  2FAP B;  3L8I A;  4KC9 A;  4AX2 A;  4P6I C;  4U5G A;  5D92 A;  2W9Y A;  5JP7 A;  2C04 A;  4CSA A;  3W8I A;  1TWG A;  2PX0 A;  4KNV A;  4BJT A;  2FGY A;  4DOZ A;  4C3E A;  5AC4 A;  5KYW A;  4C3D A;  2P6V A;  4PFO A;  1NLX A;  4U5E E;  1G8X A;  3I4U A;  3PMR A;  2IYL D;  1NBB A;  2J9U A;  1M6T A;  2BE5 F;  4KBL A;  2VC9 A;  3ZQY A;  4YT4 A;  3IQC A;  3S90 A;  3Q7G A;  3U5S A;  3ZDL A;  2R03 A;  2VCB A;  4M63 A;  5E33 A;  4W8P A;  1Z63 A;  5COF A;  1V54 C;  1WGW A;  2R9R B;  4MQ9 F;  2OG2 A;  4N6C A;  2W4M A;  1AVO B;  1DOV A;  4XLN F;  4D4N A;  5A6K A;  5F5F A;  4JVS A;  4F4B A;  4CDA A;  2YL3 A;  3SYN A;  1D1B A;  4JTD B;  4FES A;  1LS1 A;  4AL1 A;  2OCC C;  1BR4 A;  3B0U X;  4CS7 A;  3C63 A;  4R32 A;  3V5Y A;  1QSP A;  3T4R A;  3JSZ A;  4XEF A;  4WJ0 A;  2J9V A;  3DAG A;  4JEB A;  3LEV A;  3CEX A;  3L34 A;  3K1I C;  4WAB A;  3T6J A;  1MQV A;  5KYW B;  2Y3H A;  3BRJ A;  1M2V A;  1ZZP A;  4Z9J A;  3EPV A;  3JRM O;  4DVZ A;  3RQG A;  1S7Z A;  4LLC A;  3KYI A;  1Q0K A;  2EPM X;  4JCH A;  3QZC A;  3EH2 A;  5DS5 A;  1D0X A;  1EA8 A;  1Z3I X;  2YRF A;  4XEK A;  3ZVR A;  4AL0 A;  3EFO A;  3AG1 C;  2P1A A;  3N24 A;  4ULV A;  3T6G B;  2P61 A;  2VH3 A;  1MNE A;  2HSB A;  256B A;  2R7V A;  5DQZ A;  5L0D A;  3DXJ F;  4NTB A;  2EIL C;  3RFY A;  3GOR A;  3MX3 A;  4MW3 A;  1I4Y A;  2LP4 A;  2EIK C;  3CZ6 A;  2LCH A;  2QLA A;  2UUI A;  3W8H A;  3JRT A;  3ABM C;  5TJ5 E;  4DRJ B;  1A7D A;  5FZT A;  3RW0 A;  4O79 A;  1JMW A;  2TMV P;  2QE9 A;  4OD4 A;  4HEA J;  2A0B A;  4RDA A;  2WVN A;  4EHP A;  2HJM A;  1WWP A;  2J9B A;  4MVM A;  1LIH A;  4QI0 A;  4EBK A;  1JAF A;  4J30 B;  2R7U A;  1FTS A;  2L7A A;  3QVZ A;  1YYJ A;  4GEH A;  4U9D A;  1O3U A;  2X0C A;  4ZLC A;  5L0J A;  3NYM A;  3KPH A;  1WOL A;  2ZXW C;  2V3C C;  2HS5 A;  2HMQ A;  5L0C A;  4NTA A;  5L0I A;  4ZLD A;  3EFO B;  3M79 A;  4G0H A;  4JC7 A;  3HNJ A;  3IQT A;  1CGM E;  4PAC A;  1ZVZ A;  2LIG A;  2WZG A;  1VMA A;  4NC3 A;  1V4A A;  1M56 C;  2P0N A;  4OIN F;  2YEV A;  4PJM A;  3SNH A;  4DRI B;  4BEM J;  3RVZ A;  3V5X A;  4D4X A;  3I5P A;  4LDK A;  2KSF A;  3UMI A;  2J0W A;  1H7I A;  4EBB A;  1KTM A;  5B3I A;  1MMA A;  2ZD9 A;  3QTH A;  2R7T A;  3EGD B;  4IRU A;  1N1C A;  1T6U A;  4CBE A;  4I1M A;  1ORJ A;  1ZW2 A;  1QKR A;  3NKE A;  5A6B A;  3RIP A;  1APC A;  1ZHZ A;  3U2M A;  2C03 A;  1WTY A;  1ZW3 A;  3AOU A;  4BJ5 A;  5T3W A;  3O39 A;  3ZG1 A;  2OQM A;  1BDJ B;  1HMD A;  1FR0 A;  3U3F A;  2GA0 A;  3QW0 A;  3RYL A;  3C8G D;  1IZM A;  2OEX A;  2H8A A;  2Q4F A;  1I4Z A;  1OXK A;  3DAF A;  5B1B C;  3ZC4 A;  2I8B A;  5DVW A;  4MVO A;  2UUH A;  4MTG A;  1K40 A;  3C7J A;  5L0F A;  1MMG A;  4G7O F;  2Y3G A;  3U9J A;  3IQ6 A;  2AVK A;  2G3V A;  1NU9 C;  1OCZ C;  3MFN A;  3KYJ A;  4YT2 A;  4CJG A;  4DXW A;  4IAR A;  2YVK A;  2XLD A;  4IGG A;  1RKE A;  2MWQ A;  3FDQ A;  2Y3D A;  1ZU4 A;  2FFH A;  3AG4 C;  3U2L A;  5KYX A;  2OJQ A;  4DJ9 A;  1XZP A;  2OEV A;  2XM0 A;  1RJ9 B;  5KYY A;  4JJF A;  1YDI A;  5KYU A;  1CGN A;  1TWA A;  1D0Z A;  1XZQ A;  4O7G A;  5L3V A;  3NMJ A;  2B0J A;  4MTF A;  4UDV A;  3U8P A;  4RBN A;  3GEI A;  1OW8 A;  3U8V A;  4E0I A;  2PFD A;  3G4Z A;  3T6B A;  2Q00 A;  5F28 E;  3VF0 A;  1U89 A;  4BEJ A;  4LDQ A;  1FFH A;  3L1M A;  4Q7C A;  4FAP B;  3DE8 A;  2XLV A;  2YLI A;  3B0V C;  3EGX B;  4O6M A;  3G4X A;  4OIQ F;  3N2Z B;  2DYR C;  3TJ5 A;  4Z9H A;  3M4B A;  5AC5 A;  2X51 A;  5EGY A;  1HW1 A;  2WVQ A;  5A6A A;  4CDY A;  3DJN B;  4ONS A;  3NYJ A;  3DM5 A;  1RKE B;  4JTC B;  4B6I A;  3JZ0 A;  3M1C B;  4XPY A;  4MVZ A;  1E85 A;  3RF3 A;  1JPN A;  3FAP B;  4MS2 A;  2J7P A;  2W4B A;  4I3M A;  5E3A A;  2XS8 A;  4NCQ A;  5CI8 A;  3X1O A;  4MVU A;  2HKV A;  2KW3 C;  3FAJ A;  3GM2 A;  1XWJ A;  1YAR O;  3DWW A;  1AUE A;  3A11 A;  3F47 A;  3MYF A;  2VAS A;  3ATP A;  4JKV A;  1C17 M;  1V74 B;  1J8Y F;  2WVO A;  4XEV A;  1Y4C A;  2WZL A;  4N4W A;  1LI5 A;  4DVY P;  1WN0 A;  2LSE A;  1HW2 A;  3C8Z A;  2QTV A;  2KK1 A;  4A2N B;  4BJ1 A;  4EKW A;  4NY3 A;  3UMK A;  1FMW A;  1G4U S;  1MMD A;  2Y69 C;  3NRH A;  4YK5 A;  1NZE A;  2OU6 A;  2OJE D;  4JTA B;  1TKN A;  1VK5 A;  2J0X A;  3JYY A;  1T01 A;  3H65 A;  3HNI A;  3JTL O;  3NMK A;  3RH3 A;  4E0H A;  3EJN A;  2YLG A;  1SR2 A;  2R7R A;  4IB4 A;  2RD9 A;  3A9C A;  1O5H A;  2DB4 A;  3NDB B;  2XXA A;  4J7T A;  2HJ3 A;  2GAQ A;  3ABL C;  5EK0 A;  4NQF A;  1J8M F;  2QUP A;  3DMD A;  1D0Y A;  2KQ9 A;  1R4T A;  1VYI A;  4XTK A;  1ORY A;  1ST6 A;  2NSF A;  2Y39 A;  2Y3B A;  1YZC A;  3GOD A;  3M4C A;  1IW7 F;  1HY5 A;  3TOM A;  3WHN A;  4IAO A;  2M4E A;  2D4U A;  4O6Y A;  5AGF A;  1UG7 A;  1E84 A;  2CNW A;  5DS6 A;  3ZTZ A;  2R7X A;  5T3T A;  1RCP A;  4IJJ A;  2KGO A;  2GWW A;  2QNL A;  2PP4 A;  3G50 A;  3Q7L A;  5DS4 A;  1H9G A;  4H54 A;  4BJ6 A;  4U5D E;  3S84 A;  2BC5 A;  4DBQ A;  3LUT B;  2HSQ A;  1YAU O;  3LJB A;  2XM4 A;  1TQG A;  2O9X A;  3B0P A;  1QQ3 A;  3K66 A;  1M2V B;  2OKU A;  3K7D A;  2XLH A;  4N06 A;  4RD9 A;  1TWH A;  3TJ6 A;  3ZSU A;  4CJO A;  3LLK A;  3R2P A;  3QMK A;  4PJN A;  3TQO A;  1L7C A;  2NUP A;  5L0H A;  4X0R A;  3AG2 C;  4ER9 A;  4E7S A;  2YKZ A;  3J06 A;  1EKY A;  1BBH A;  2ASR A;  5DQT A;  1AEP A;  4GQH A;  4HFK B;  2J46 A;  2EIM C;  1QVX A;  2CGE A;  1Q0M A;  2ZXP A;  4LDR A;  3EG9 A;  3DD7 A;  4JZA A;  4U5F E;  4Z9I A;  4CS8 C;  2HV7 A;  3SEO A;  2AWC A;  1ZHY A;  2A1D D;  3QW1 A;  1V55 C;  4OD5 A;  4WGZ A;  3H2V A;  4JE9 A;  3V5Z A;  2J45 A;  1NU7 D;  3K1H A;  3E9V A;  3WAQ A;  3RQE A;  5B3S C;  1ZHT A;  3SZR A;  1TR2 A;  2NG1 A;  3DZA A;  3EHN A;  3POV A;  3BEH A;  3DE9 A;  3I5Q A;  2HUJ A;  4XLP F;  2IOQ A;  3PCV A;  3U9M A;  4EWC A;  3ASO C;  3OEO A;  1OW6 A;  4IWB A;  3DI5 A;  3B9Q A;  5JS5 A;  1OKK A;  1CPQ A;  3AGT A;  3IHU A;  4QDL A;  1KNY A;  2DGJ A;  2XRH A;  4BJ6 C;  4EUK B;  2ETS A;  3S9O A;  3CSK A;  1FNT c;  2P7V A;  4JW1 A;  3TUL A;  3GM3 A;  4MVR A;  5BUO A;  2EPO A;  1OQC A;  5F5H A;  1OCC C;  3CQZ A;  1NSG B;  2ZXO A;  3HTK C;  3M15 A;  4JRZ A;  4K7B A;  4G7Z F;  1TFK B;  3EG9 B;  2JD3 A;  3F46 A;  2YL1 A;  3KL4 A;  3MYI A;  1YZA A;  5T1D B;  4KI2 A;  1OR3 A;  3DKA A;  3SP1 A;  2LFD A;  3ZIB A;  2XS1 A;  1BZ4 A;  3SXK A;  2Q9A A;  4YT8 A;  1GGQ A;  1K04 A;  5A69 A;  4XPX A;  5BQI A;  1UFB A;  2D5R B;  1L3P A;  3ZWI A;  5A6B D;  1JOG A;  4K0D A;  2L6H A;  2XL6 A;  5EHH A;  1GQA A;  2CDQ A;  1Z23 A;  4YL3 A;  1FAP B;  3W2V A;  3TOL A;  3L8J A;  1OKK D;  2H7V C;  4U5B E;  4JIO A;  3VM6 A;  1GM5 A;  3UMH A;  1C03 A;  4YJW A;  1E83 A;  4Q5S F;  2HZ8 A;  2XLW A;  3ABK C;  1MMN A;  3EZH A;  1M57 C;  1A7E A;  3GWL A;  2KYH A;  2B0H A;  2CCY A;  2L6F A;  2JX0 A;  2AP3 A;  3K6B A;  4PJL A;  4C7O A;  4K1O A;  2AU5 A;  3JCU Q;  3AG3 C;  3MLG A;  1SMY F;  2LFF A;  1D1A A;  2H7O A;  3K33 A;  1FFT C;  2HMZ A;  1Q0D A;  2R02 A;  3FMS A;  5JRA A;  3AGU A;  2GFH A;  1Q0G A;  3S0X A;  1HE9 A;  2Q9B A;  3TK0 A;  5KYX B;  3ASN C;  3LEO A;  3V7O A;  1EQ1 A;  3JSE O;  4DBR A;  5KYY B;  3U0C A;  2R7W A;  1NFO A;  1D1C A;  5BQG A;  5KYU B;  5L3Q A;  1QZX A;  3FXH A;  1O87 A;  1DOW A; 
#chains in the Genus database with same CATH homology
 3HNJ A;  3C62 A;  4NC3 A;  3FOP A;  1YZC A;  3M4C A;  3TOM A;  3HNK A;  3IQ5 A;  5AGF A;  2YLD A;  4D4X A;  1CGO A;  3ZTZ A;  5B3I A;  1RCP A;  4EIY A;  4L6R A;  2BC5 A;  4CDV A;  1S05 A;  1E86 A;  2XM4 A;  1QQ3 A;  1E84 A;  1APC A;  3NMI A;  2XLH A;  4CJO A;  3QVY A;  3FOO A;  2XLO A;  3HNL A;  1QPU A;  4U9E A;  4N6H A;  3ZQV A;  3QW0 A;  4ER9 A;  4CX9 A;  2YKZ A;  1EKY A;  3ZTM A;  1BBH A;  3VRC A;  4IAQ A;  3IQ6 A;  2XL8 A;  5JP7 A;  4JEA A;  2XLM A;  3QW1 A;  4CJG A;  4IAR A;  1A7V A;  4JE9 A;  4WGZ A;  2XLD A;  1NBB A;  2YL7 A;  1M6T A;  3DE9 A;  2XM0 A;  3ZQY A;  4CIP A;  1CPR A;  1CGN A;  3NMJ A;  3U8P A;  5JS5 A;  1CPQ A;  2J8W A;  4D4N A;  4CDA A;  2YL3 A;  3L1M A;  3C63 A;  3M15 A;  3DE8 A;  2XLV A;  2YLI A;  4JEB A;  2YL1 A;  1YZA A;  3M4B A;  1MQV A;  4CDY A;  4WGY A;  1E85 A;  1YYX A;  3ZWI A;  5JVE A;  2XL6 A;  1GQA A;  5JUA A;  3TOL A;  5JLI A;  1E83 A;  4ULV A;  1LM3 B;  5JT4 A;  2XLW A;  4JKV A;  256B A;  4N4W A;  2CCY A;  2QLA A;  5JRA A;  2J9B A;  3HNI A;  3NMK A;  1JAF A;  5JSL A;  2YL0 A;  2YLG A;  3QVZ A;  1YYJ A;  4IB4 A;  4U9D A;  2XLE A;  3M79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...