4D4NA

Nitrosyl complex of the d121a variant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHAAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Hydrogen Bonding of the Dissociated Histidine Ligand is not Required for Formation of a Proximal No Adduct in Cytochrome C'.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 50
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4d4nA00
3DE9A 3M4BA 4CDAA 5JP7A 2XM0A 3HNIA 4EIYA 3L1MA 4CDVA 4JEAA 256BA 2XLMA 2XLVA 3C62A 3ZQYA 3IQ6A 3ZTZA 2XLOA 5JLIA 2XLDA 2J8WA 1EKYA 3FOOA 2YL0A 1E84A 3TOMA 5JSLA 3C63A 5JS5A 3ZTMA 1LM3B 2YLDA 1CGNA 4D4XA 3QVZA 4NC3A 1YZCA 1QPUA 2XLEA 4L6RA 3IQ5A 3QW0A 4JE9A 2YLIA 1GQAA 4WGZA 4N6HA 4JKVA 1NBBA 2XM4A 2XLWA 4U9EA 3TOLA 1YZAA 3QW1A 5JVEA 2BC5A 2QLAA 3FOPA 4WGYA 4N4WA 3NMJA 4ER9A 2YKZA 1E83A 3HNKA 4CIPA 4ULVA 5JUAA 4CJGA 1A7VA 4IAQA 1CGOA 2XL8A 3ZQVA 4CJOA 1RCPA 3NMKA 2YL3A 3VRCA 2CCYA 3ZWIA 5AGFA 3HNJA 1MQVA 3NMIA 1JAFA 1E85A 2YL1A 1APCA 5JRAA 3M15A 5B3IA 3HNLA 3DE8A 2XLHA 1YYJA 3QVYA 1CPRA 2YLGA 1CPQA 3M79A 4D4NA 1BBHA 2XL6A 2J9BA 4CDYA 1E86A 4IARA 5JT4A 1YYXA 1M6TA 1S05A 4CX9A 4JEBA 4IB4A 1QQ3A 4U9DA 3M4CA 2YL7A 3U8PA
chains in the Genus database with same CATH superfamily
1PCXA 3DE9A 5HV9A 3EH2A 2J7PA 3VF0A 1RXQA 1QKRA 1YAUO 2HS5A 3K7DA 2CGEA 4XTKA 4N6CA 3JSEO 4NTFA 2J9UA 5D92A 2PBEA 2Q9BA 3L1MA 4EIYA 1WGWA 3EG9A 2R7UA 2HSBA 5D91A 1Q0FA 3WAQA 4IRUA 5A6KA 3M1CB 4RDAA 5L0IA 2VCBA 3RIPA 2GAQA 3GANA 2MHRA 3ITFA 5B1BC 2P6VA 3AQCA 3ZQYA 2PX0A 4DBRA 1LE2A 4E7SA 2R7TA 2JD3A 1H7IA 2A6HF 2IXOA 3FMSA 1ORJA 1YA7O 2R05A 2P7VA 1HMOA 2XS8A 2IOQA 2YL0A 1ZW3A 2BL2A 2GWWA 3V5ZA 3TOMA 2DYSC 4PFOA 3Q6MA 4OINF 1D0XA 3SP1A 4YT5A 3UMHA 1V74B 1VYKA 1QVXA 3ZTMA 3K33A 1LI7A 1UG7A 4C3BA 1EA8A 1VLTA 2WZGA 2HV7A 1ZVZA 5DLJA 2Q7RA 1CGNA 4BJ6C 4G7HF 1U6HA 2QTVA 4LLCA 2HZ8A 1YZCA 3EHNA 4XEKA 2XLEA 2Y3HA 5CI8A 3RYLA 3WODF 4G7ZF 3EJNA 1LIHA 1VK5A 1Y6DA 1EI7A 2H7OA 4L6RA 2E87A 4CS9A 2ZXWC 5KYWB 3CAXA 5F5FA 4JE9A 2WVQA 3EGXB 1GQAA 2Q3TA 4C7OB 4YL3A 4PACA 1VLSA 2P0NA 3K1HA 1O3UA 3MYFA 1DOWA 1NBBA 1L3PA 2WZLA 4XLNF 5A6JA 5DS5A 4U9EA 5E33A 2Q00A 2PNOA 3LLIA 3QW1A 1YDIA 3W8HA 1M57C 3LNMB 3U8VA 2KJGA 4PJLA 2QLAA 3JT1A 4K0DA 3O6XA 2CW0F 2Y69C 4ER9A 2FGYA 2XSEA 4MTFA 3Q7LA 1F1MA 2XXAA 1PD1A 3ABLC 3HNKA 3RQGA 1XZQA 1HY5A 3SNHA 1JR8A 3PMRA 3GORA 3U9MA 4P6IC 1FMWA 1WN0A 4NTAA 3VM6A 3LNRA 1A7VA 1OXKA 4FESA 3TJ5A 1C03A 3MFNA 2IBFA 2X51A 3K1IA 4RBNA 4KNVA 1SMYF 2IXNA 3NYJA 3MYIA 1XWJA 1NZEA 3N24A 1OQCA 2HFIA 3EH1A 2DI3A 2V26A 4IAOA 3LEVA 2EPMX 1NLXA 3CQZA 2KYHA 2LIGA 3DI5A 4B6IA 4YJWA 5HSWA 4Q4ZF 4YT2A 1OR3A 1APCA 5JRAA 4GYTA 1FFTC 4XPWA 2QUPA 3RH3A 2YWAA 5L0JA 1T6UA 1HW1A 3IPMO 2PFDA 3NKDA 2XLHA 5F28E 3LLKA 3C8GA 3JZ0A 2OU6A 4EBJA 2EPLX 4MVMA 3KYIA 1MMNA 5A6BA 4EKWA 3QZCA 2OOCA 4DVZA 1WASA 2Q4FA 1NG1A 3G50A 1VYIA 2XL6A 1JOGA 3AG3C 3DZAA 1ZU4A 4CDYA 1BR4A 1RJ9A 2LK4A 1A0BA 2L6HA 3C18A 1YJGA 3EQLF 1LS1A 4XEVA 4EWCA 1B68A 1M2VA 5COMA 1RKEA 2UUHA 4LERA 1M6TA 4O6MA 4Z9IA 4NCQA 3HLZA 4EBBA 1RKCA 1O5HA 4JEBA 4JTCB 3RW0A 5B1AC 4P9FA 5EGYA 4MW3A 3JTLO 2X0CA 2G62A 5IY5C 4OIPF 4KC9A 3FHDA 3RVZA 2YL7A 3NG1A 2VCCA 3T4RA 3AG1C 3GM2A 3GWNA 3M4BA 4CDAA 3TJ6A 2NUTA 5FCLA 3TK0A 3I4UA 3HNIA 2QY9A 1WWPA 2XXAB 1Q0DA 4K7BA 256BA 3C62A 2OEVA 5DQZA 4BJ6A 1JMWA 4K1OA 1BDJB 2H7VC 3ABMC 4CS8C 3O39A 3FXHA 1K40A 1KNYA 2JX0A 2EPKX 5BQGA 4J7TA 3NRHA 3X2QC 2I15A 3NYLA 2ETSA 3IQ6A 3ZTZA 2ICWG 2WL8A 2CNWD 3DAGA 1LE4A 3PDMP 1ZYRF 3VAYA 3FOOA 1A7EA 3C8ZA 2NSGA 1J8YF 1G8XA 4MS2A 2NSFA 1L7CA 1BZ4A 4W8PA 1M56C 2D5RB 2CDQA 3C7JA 1SYQA 3C63A 2RD9A 2KW3C 3JYYA 4JJFA 4E0IA 4KBLA 4OIQF 3L8IA 3DAFA 5A69A 2KSFA 3CSKA 1FAPB 2EINC 4A2NB 4D4XA 5T3TA 4PK4A 3TULA 3B9QA 5COFA 4FX5A 1QPUA 2JPUA 4YK5A 3U5SA 4UDVA 3I5QA 1E2XA 1NSGB 1Z3IX 3IQ5A 5FZTA 1TWHA 2J0XA 4PJNA 5E2QA 2PX3A 2LD6A 4MW8A 2VC9A 1GGQA 3Q6NA 3RVYA 3T6JA 2R9RB 2IYLD 3ASOC 3CEXA 4JKVA 4DRHB 2NUPB 2A0BA 1ZHYA 2PF4E 2XM4A 1GS9A 3DXJF 4I3MA 4XQ1A 3OA1A 1MNEA 1YZAA 1Z5ZA 2OJED 1YLMA 5TJ5E 1U89A 2BC5A 2H8AA 3G4XA 4R32A 5KYYB 2B0HA 3U0CA 1MMGA 3RQEA 4I44A 1MMDA 1MMAA 2L9JA 3EPVA 2Y3GA 3V5XA 4Z9HA 1RMVA 4CIPA 2AVKA 2A68F 4Z9JA 3KH2A 5JUAA 5DQTA 3FAJA 3L34A 2A0UA 2J7PD 3MX3A 4IAQA 4XWJA 4NQFA 4AE4B 1M2OA 1NFOA 4WJ0A 3S90A 4E18A 1H9TA 2XL4A 2DB4A 5KYUA 5A6AA 2OG2A 1R4TA 2J9WA 5GPGB 1G4WR 2HJMA 3ZWIA 3DD7A 2Y3BA 5COGA 3NMIA 3F46A 5L0CA 5KYNA 3DMDA 2ZD9A 3R7CA 5L3VA 4LDQA 2W4MA 1E85A 3EFOB 2R7RA 3KL4A 1CGME 1D0ZA 2P1AA 3M15A 2V3CC 4QI0A 4LACB 4U5HA 3EZHA 5B3IA 3JRTA 4J30B 3IQCA 3I5PA 2F22A 4JRZA 1YA9A 4ZLCA 1D0YA 3FVYA 1SR2A 1A41A 2YLGA 2GA0A 3FDQA 1TWAA 3AOUA 4OIOF 2GFHA 3U9JA 4XLPF 2TMVP 1ZZPA 2J9BA 2B0JA 2C04A 1O87A 2YVKA 4IARA 3EGDA 3SYNA 2Q9CA 3EG9B 1FR0A 1NFNA 2W4BA 3EHMA 4CS8A 1OKKA 1YYXA 3NYMA 3ZVRA 2OJQA 4I1MA 3PHF2 1S05A 4X0RA 1I4YA 2R7XA 4EUKB 2QNLA 1TFOB 4LDKA 4YL0A 4JC7A 1XZPA 1JRAA 3K6BA 3U8PA 2L7AA 4JJGA 3DJUB 3EZIA 3H2VA 1LVKA 1IW7F 3GEIA 2O9XA 4JTAB 4YWQA 5L0FA 4ONSA 2XM0A 3IQTA 4IWBA 1V55C 3A11A 1NU7D 1OW6A 4H4KC 3FAPB 4MVZA 2Q9AA 3ZG1A 1I4ZA 4O79A 1WTYA 3ASNC 1ZHZA 2G3VA 4JTDB 3S29A 1J8MF 5EK0A 4G78A 2HMQA 3G4ZA 4C3DA 1K05A 1PD0A 4CS7A 1QLEC 2XLOA 1NU9C 1UFBA 3KPHA 4JCZA 2XLDA 3T9OA 3RKOF 3SXZA 4BEJA 3POVA 2R25A 1WOLA 2EIKC 2YQYA 4HE8D 2OQMA 2VASA 4NTBA 2R7WA 5JSLA 4AL0A 3DJNB 3GEHA 4MNDA 3OEOA 2FAPB 3KKBA 1YARO 4JURI 4KNWA 2WZFA 3JRMO 2HJ3A 1FTSA 3H65A 3X1OA 3RFYA 3JYHA 1VB5A 1Q0KA 1C17M 3KYJA 3QVZA 1ZU5A 3AJMA 3ATPA 3NKEA 4J7YA 3C8GD 3S9OA 2R7OA 2YRFA 4ANJA 1VMAA 1OW7A 1TR2A 2IXMA 5B3SC 5A6BD 3QW0A 3WG7C 1LI5A 1HE1A 2YLIA 4YL1A 4PFPA 4WGZA 3UMIA 2CYDA 4N6HA 4BPMA 4MVRA 1GM5A 4Q7CA 3A9CA 5DVWA 3SXKA 4C3EA 1D1BA 3U2MA 5K0IA 1FNTc 2A1DD 2YZSA 3EGDB 4G0HA 5KYXA 3S0XA 2L6FA 4MTOA 4WABA 1G5ZA 2GDCA 1ZW2A 2C03A 2VCAA 3HTKC 1R5ID 3FOPA 2HV6A 4N4WA 4WGYA 3UMKA 4OIRF 1E83A 2R7QA 3ECSA 1HW2A 4DVYP 3AGTA 5KYWA 1HMDA 2YEVA 2ZPAA 3EGXA 2LCHA 4U5FE 4DBQA 3K1IC 3O55A 4C7OA 4CJGA 3LJBA 1JPNA 5L0DA 4I1OB 4AX2A 1EQ1A 2XRHA 3C8GB 3U3BA 1CGOA 4OD4A 3LESA 2D4UA 3AG2C 4CJOA 4BG0A 2WB7A 3HJCA 2AWCA 1IZMA 5BQIA 3NMKA 2Y39A 3JSZA 2A6EF 3V5YA 4MVUA 2CCYA 2IM8A 3W4YA 4AK9A 1OCCC 3HNJA 1QSPA 1V54C 2UUIA 3SXYA 2ZXPA 1RJ9B 4ZLDA 4NY3A 4O7GA 3TD7A 1LKXA 2M64A 4U5BE 1ORYA 1TKNA 2EILC 1YVIA 4F4BA 4RD9A 1M2VB 1U0BB 1RKEB 3RF3A 4DRJB 2AU5A 3DE8A 2KQ9A 3AG4C 1T9KA 1YYJA 2NG1A 4LDRA 3SZRA 3W2VA 4U5CE 1Z23A 1CPRA 4P9TA 1Z63A 1K04A 2HMZA 1CPQA 3E70C 1ST6A 4MVQA 3M79A 4DXWA 1BBHA 3Q7GA 1OCOC 2NUTB 3N0TA 4HEAJ 3ZDLA 2KGOA 1Q0MA 2P61A 4XPXA 2EIJC 1SZIA 4EHPA 1OW8A 3W2WA 1PV3A 3AGUA 2WVNA 2WVOA 1H9GA 2ZXOA 2LFDA 2R03A 3UNGC 4CIHA 3R2PA 4H54A 5T3WA 3WHNA 2FFHA 4YT4A 1QQ3A 3DM9B 1A7DA 1OCZC 4DOZA 4HFFB 3O10A 5KYXB 4EBKA 4BEMJ 2IXPA 3M4CA 3T6GB 2HKVA 1HE9A 3B29A 1T6QA 2LP4A 4O6NA 2LQGA 5JP7A 4BJ5C 3HKKA 5DS6A 3IHUA 3LUTB 2R7SA 2PP4A 2VH3A 4MQ9F 2MWQA 4YN0B 4CDVA 3F47A 4JEAA 1H6GA 2XLMA 2XLVA 5EHHA 4DRIB 3B0UX 1N1CA 5L0HA 3ZIBA 4FWVA 2R7VA 3LS0A 1DOVA 4U5DE 3L8JA 2ASRA 3UGOA 1ZHWA 4QDLA 3ZC4A 1JPJA 4JIOA 4AL1A 2YHSA 3E9VA 1BR1A 2Y3DA 4CSAC 1T01A 1MNDA 2MYSA 3U2LA 3CZ6A 5JLIA 2ZXRA 3BEHA 2J8WA 1QZXA 2OKUA 1EKYA 1LPEA 3JCUQ 1E84A 4G7OF 3SEOA 3L0IA 3KMIA 5L0GA 3PCVA 5JS5A 2KK1A 3MLGA 3S27A 1LM3B 4O6YA 4OD5A 2YLDA 4MTGA 1S7ZA 3SXMA 3GWLA 2OEXA 4LLEA 5CI9A 2DGJA 4NC3A 4U5EE 3UR3C 3US6A 4IGGA 1SF8A 3NDBB 2J0WA 4JZAA 1VTMP 2Z15A 2QE9A 2L81A 3DM5A 4YT8A 4GQHA 3B71A 5F5HA 3B0VC 4PJMA 5E3AA 4FAPB 1FFHA 3QMKA 3W8IA 2RSEB 1V4AA 3RQFA 2XLWA 1C02A 1TWGA 4QI2A 3GODA 3TOLA 5KYUB 2G3KA 5AC4A 1TFKB 3LEOA 4JVSA 2VB6A 5JVEA 3S84A 1OKKD 5AC5A 4IJJA 2AP3A 4JW1A 3NMJA 5E3CA 2L6GA 1LS4A 1VOMA 2W9YA 2YKZA 4U5GA 5T1DB 4M63A 5DS4A 3VYWA 2DYRC 4ULVA 4CS9C 4DJ9A 4N06A 1Z7Qc 2A69F 2AWYA 2HSQA 4W8KA 4MVOA 1OCRC 2NUPA 2XL8A 4MVSA 3ZQVA 1RCPA 2CNWA 1FMVA 1Q0GA 4PJJA 4ULWA 2LSEA 2YL3A 2OCCC 3VRCA 3T6BA 5AGFA 3AQBA 5KYYA 1D1AA 3K66A 3H2UA 3MBGA 4XPYA 1Z6AA 1MQVA 3N2ZB 1JAFA 3DKAA 2J46A 1W2WA 2J9VA 2EPOA 2YL1A 1KTMA 4PR9A 2EPNA 5BQHA 3GEEA 3HNLA 3LAYA 3DWWA 2H7BA 4E0HA 5L3QA 4HFKB 1AVOB 1OR2A 2I8BA 2NPUA 4AE4A 4BJ1A 4CBEA 2KNHA 3ZSUA 3U3FA 1G4US 3QVYA 2R02A 3TQOA 1Y4CA 2BE5F 2M4EA 3OWTA 5CIVA 4D4NA 2XS1A 4BJ5A 3B0PA 3QTHA 1D1CA 1TWCA 5BUOA 2W45A 1KU2A 1ORSC 1I5NA 1E86A 2J45A 1T6IA 3BRJA 4J32B 3EFOA 5JT4A 1ZHXA 4BJTA 4E7ZA 3UGPA 3J06A 2LFFA 1AEPA 2HUJA 4Q5SF 1WATA 1BR2A 4KI2A 1ZHTA 3GM3A 3GM1A 2EIMC 2KC3A 4GEHA 3V7OA 4CX9A 1OXBA 1T5OA 4E17A 3IEEA 4IB4A 4CSAA 1TQGA 4JCHA 4XEFA 3ABKC 1AUEA 4A4AA 4U9DA 3LS1A 3S28A
chains in the Genus database with same CATH topology
3DE9A 3M4BA 4CDAA 5JP7A 2XM0A 3HNIA 4EIYA 3L1MA 4CDVA 4JEAA 256BA 2XLMA 2XLVA 3C62A 3ZQYA 3IQ6A 3ZTZA 2XLOA 5JLIA 2XLDA 2J8WA 1EKYA 3FOOA 2YL0A 1E84A 3TOMA 5JSLA 3C63A 5JS5A 3ZTMA 1LM3B 2YLDA 1CGNA 4D4XA 3QVZA 4NC3A 1YZCA 1QPUA 2XLEA 4L6RA 3IQ5A 3QW0A 4JE9A 2YLIA 1GQAA 4WGZA 4N6HA 4JKVA 1NBBA 2XM4A 2XLWA 4U9EA 3TOLA 1YZAA 3QW1A 5JVEA 2BC5A 2QLAA 3FOPA 4WGYA 4N4WA 3NMJA 4ER9A 2YKZA 1E83A 3HNKA 4CIPA 4ULVA 5JUAA 4CJGA 1A7VA 4IAQA 1CGOA 2XL8A 3ZQVA 4CJOA 1RCPA 3NMKA 2YL3A 3VRCA 2CCYA 3ZWIA 5AGFA 3HNJA 1MQVA 3NMIA 1JAFA 1E85A 2YL1A 1APCA 5JRAA 3M15A 5B3IA 3HNLA 3DE8A 2XLHA 1YYJA 3QVYA 1CPRA 2YLGA 1CPQA 3M79A 4D4NA 1BBHA 2XL6A 2J9BA 4CDYA 1E86A 4IARA 5JT4A 1YYXA 1M6TA 1S05A 4CX9A 4JEBA 4IB4A 1QQ3A 4U9DA 3M4CA 2YL7A 3U8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE9 A;  3M4B A;  4CDA A;  5JP7 A;  2XM0 A;  3HNI A;  4EIY A;  3L1M A;  4CDV A;  4JEA A;  256B A;  2XLM A;  2XLV A;  3C62 A;  3ZQY A;  3IQ6 A;  3ZTZ A;  2XLO A;  5JLI A;  2XLD A;  2J8W A;  1EKY A;  3FOO A;  2YL0 A;  1E84 A;  3TOM A;  5JSL A;  3C63 A;  5JS5 A;  3ZTM A;  1LM3 B;  2YLD A;  1CGN A;  4D4X A;  3QVZ A;  4NC3 A;  1YZC A;  1QPU A;  2XLE A;  4L6R A;  3IQ5 A;  3QW0 A;  4JE9 A;  2YLI A;  1GQA A;  4WGZ A;  4N6H A;  4JKV A;  1NBB A;  2XM4 A;  2XLW A;  4U9E A;  3TOL A;  1YZA A;  3QW1 A;  5JVE A;  2BC5 A;  2QLA A;  3FOP A;  4WGY A;  4N4W A;  3NMJ A;  4ER9 A;  2YKZ A;  1E83 A;  3HNK A;  4CIP A;  4ULV A;  5JUA A;  4CJG A;  1A7V A;  4IAQ A;  1CGO A;  2XL8 A;  3ZQV A;  4CJO A;  1RCP A;  3NMK A;  2YL3 A;  3VRC A;  2CCY A;  3ZWI A;  5AGF A;  3HNJ A;  1MQV A;  3NMI A;  1JAF A;  1E85 A;  2YL1 A;  1APC A;  5JRA A;  3M15 A;  5B3I A;  3HNL A;  3DE8 A;  2XLH A;  1YYJ A;  3QVY A;  1CPR A;  2YLG A;  1CPQ A;  3M79 A;  4D4N A;  1BBH A;  2XL6 A;  2J9B A;  4CDY A;  1E86 A;  4IAR A;  5JT4 A;  1YYX A;  1M6T A;  1S05 A;  4CX9 A;  4JEB A;  4IB4 A;  1QQ3 A;  4U9D A;  3M4C A;  2YL7 A;  3U8P A; 
#chains in the Genus database with same CATH topology
 1PCX A;  3DE9 A;  5HV9 A;  3EH2 A;  2J7P A;  3VF0 A;  1RXQ A;  1QKR A;  1YAU O;  2HS5 A;  3K7D A;  2CGE A;  4XTK A;  4N6C A;  3JSE O;  4NTF A;  2J9U A;  5D92 A;  2PBE A;  2Q9B A;  3L1M A;  4EIY A;  1WGW A;  3EG9 A;  2R7U A;  2HSB A;  5D91 A;  1Q0F A;  3WAQ A;  4IRU A;  5A6K A;  3M1C B;  4RDA A;  5L0I A;  2VCB A;  3RIP A;  2GAQ A;  3GAN A;  2MHR A;  3ITF A;  5B1B C;  2P6V A;  3AQC A;  3ZQY A;  2PX0 A;  4DBR A;  1LE2 A;  4E7S A;  2R7T A;  2JD3 A;  1H7I A;  2A6H F;  2IXO A;  3FMS A;  1ORJ A;  1YA7 O;  2R05 A;  2P7V A;  1HMO A;  2XS8 A;  2IOQ A;  2YL0 A;  1ZW3 A;  2BL2 A;  2GWW A;  3V5Z A;  3TOM A;  2DYS C;  4PFO A;  3Q6M A;  4OIN F;  1D0X A;  3SP1 A;  4YT5 A;  3UMH A;  1V74 B;  1VYK A;  1QVX A;  3ZTM A;  3K33 A;  1LI7 A;  1UG7 A;  4C3B A;  1EA8 A;  1VLT A;  2WZG A;  2HV7 A;  1ZVZ A;  5DLJ A;  2Q7R A;  1CGN A;  4BJ6 C;  4G7H F;  1U6H A;  2QTV A;  4LLC A;  2HZ8 A;  1YZC A;  3EHN A;  4XEK A;  2XLE A;  2Y3H A;  5CI8 A;  3RYL A;  3WOD F;  4G7Z F;  3EJN A;  1LIH A;  1VK5 A;  1Y6D A;  1EI7 A;  2H7O A;  4L6R A;  2E87 A;  4CS9 A;  2ZXW C;  5KYW B;  3CAX A;  5F5F A;  4JE9 A;  2WVQ A;  3EGX B;  1GQA A;  2Q3T A;  4C7O B;  4YL3 A;  4PAC A;  1VLS A;  2P0N A;  3K1H A;  1O3U A;  3MYF A;  1DOW A;  1NBB A;  1L3P A;  2WZL A;  4XLN F;  5A6J A;  5DS5 A;  4U9E A;  5E33 A;  2Q00 A;  2PNO A;  3LLI A;  3QW1 A;  1YDI A;  3W8H A;  1M57 C;  3LNM B;  3U8V A;  2KJG A;  4PJL A;  2QLA A;  3JT1 A;  4K0D A;  3O6X A;  2CW0 F;  2Y69 C;  4ER9 A;  2FGY A;  2XSE A;  4MTF A;  3Q7L A;  1F1M A;  2XXA A;  1PD1 A;  3ABL C;  3HNK A;  3RQG A;  1XZQ A;  1HY5 A;  3SNH A;  1JR8 A;  3PMR A;  3GOR A;  3U9M A;  4P6I C;  1FMW A;  1WN0 A;  4NTA A;  3VM6 A;  3LNR A;  1A7V A;  1OXK A;  4FES A;  3TJ5 A;  1C03 A;  3MFN A;  2IBF A;  2X51 A;  3K1I A;  4RBN A;  4KNV A;  1SMY F;  2IXN A;  3NYJ A;  3MYI A;  1XWJ A;  1NZE A;  3N24 A;  1OQC A;  2HFI A;  3EH1 A;  2DI3 A;  2V26 A;  4IAO A;  3LEV A;  2EPM X;  1NLX A;  3CQZ A;  2KYH A;  2LIG A;  3DI5 A;  4B6I A;  4YJW A;  5HSW A;  4Q4Z F;  4YT2 A;  1OR3 A;  1APC A;  5JRA A;  4GYT A;  1FFT C;  4XPW A;  2QUP A;  3RH3 A;  2YWA A;  5L0J A;  1T6U A;  1HW1 A;  3IPM O;  2PFD A;  3NKD A;  2XLH A;  5F28 E;  3LLK A;  3C8G A;  3JZ0 A;  2OU6 A;  4EBJ A;  2EPL X;  4MVM A;  3KYI A;  1MMN A;  5A6B A;  4EKW A;  3QZC A;  2OOC A;  4DVZ A;  1WAS A;  2Q4F A;  1NG1 A;  3G50 A;  1VYI A;  2XL6 A;  1JOG A;  3AG3 C;  3DZA A;  1ZU4 A;  4CDY A;  1BR4 A;  1RJ9 A;  2LK4 A;  1A0B A;  2L6H A;  3C18 A;  1YJG A;  3EQL F;  1LS1 A;  4XEV A;  4EWC A;  1B68 A;  1M2V A;  5COM A;  1RKE A;  2UUH A;  4LER A;  1M6T A;  4O6M A;  4Z9I A;  4NCQ A;  3HLZ A;  4EBB A;  1RKC A;  1O5H A;  4JEB A;  4JTC B;  3RW0 A;  5B1A C;  4P9F A;  5EGY A;  4MW3 A;  3JTL O;  2X0C A;  2G62 A;  5IY5 C;  4OIP F;  4KC9 A;  3FHD A;  3RVZ A;  2YL7 A;  3NG1 A;  2VCC A;  3T4R A;  3AG1 C;  3GM2 A;  3GWN A;  3M4B A;  4CDA A;  3TJ6 A;  2NUT A;  5FCL A;  3TK0 A;  3I4U A;  3HNI A;  2QY9 A;  1WWP A;  2XXA B;  1Q0D A;  4K7B A;  256B A;  3C62 A;  2OEV A;  5DQZ A;  4BJ6 A;  1JMW A;  4K1O A;  1BDJ B;  2H7V C;  3ABM C;  4CS8 C;  3O39 A;  3FXH A;  1K40 A;  1KNY A;  2JX0 A;  2EPK X;  5BQG A;  4J7T A;  3NRH A;  3X2Q C;  2I15 A;  3NYL A;  2ETS A;  3IQ6 A;  3ZTZ A;  2ICW G;  2WL8 A;  2CNW D;  3DAG A;  1LE4 A;  3PDM P;  1ZYR F;  3VAY A;  3FOO A;  1A7E A;  3C8Z A;  2NSG A;  1J8Y F;  1G8X A;  4MS2 A;  2NSF A;  1L7C A;  1BZ4 A;  4W8P A;  1M56 C;  2D5R B;  2CDQ A;  3C7J A;  1SYQ A;  3C63 A;  2RD9 A;  2KW3 C;  3JYY A;  4JJF A;  4E0I A;  4KBL A;  4OIQ F;  3L8I A;  3DAF A;  5A69 A;  2KSF A;  3CSK A;  1FAP B;  2EIN C;  4A2N B;  4D4X A;  5T3T A;  4PK4 A;  3TUL A;  3B9Q A;  5COF A;  4FX5 A;  1QPU A;  2JPU A;  4YK5 A;  3U5S A;  4UDV A;  3I5Q A;  1E2X A;  1NSG B;  1Z3I X;  3IQ5 A;  5FZT A;  1TWH A;  2J0X A;  4PJN A;  5E2Q A;  2PX3 A;  2LD6 A;  4MW8 A;  2VC9 A;  1GGQ A;  3Q6N A;  3RVY A;  3T6J A;  2R9R B;  2IYL D;  3ASO C;  3CEX A;  4JKV A;  4DRH B;  2NUP B;  2A0B A;  1ZHY A;  2PF4 E;  2XM4 A;  1GS9 A;  3DXJ F;  4I3M A;  4XQ1 A;  3OA1 A;  1MNE A;  1YZA A;  1Z5Z A;  2OJE D;  1YLM A;  5TJ5 E;  1U89 A;  2BC5 A;  2H8A A;  3G4X A;  4R32 A;  5KYY B;  2B0H A;  3U0C A;  1MMG A;  3RQE A;  4I44 A;  1MMD A;  1MMA A;  2L9J A;  3EPV A;  2Y3G A;  3V5X A;  4Z9H A;  1RMV A;  4CIP A;  2AVK A;  2A68 F;  4Z9J A;  3KH2 A;  5JUA A;  5DQT A;  3FAJ A;  3L34 A;  2A0U A;  2J7P D;  3MX3 A;  4IAQ A;  4XWJ A;  4NQF A;  4AE4 B;  1M2O A;  1NFO A;  4WJ0 A;  3S90 A;  4E18 A;  1H9T A;  2XL4 A;  2DB4 A;  5KYU A;  5A6A A;  2OG2 A;  1R4T A;  2J9W A;  5GPG B;  1G4W R;  2HJM A;  3ZWI A;  3DD7 A;  2Y3B A;  5COG A;  3NMI A;  3F46 A;  5L0C A;  5KYN A;  3DMD A;  2ZD9 A;  3R7C A;  5L3V A;  4LDQ A;  2W4M A;  1E85 A;  3EFO B;  2R7R A;  3KL4 A;  1CGM E;  1D0Z A;  2P1A A;  3M15 A;  2V3C C;  4QI0 A;  4LAC B;  4U5H A;  3EZH A;  5B3I A;  3JRT A;  4J30 B;  3IQC A;  3I5P A;  2F22 A;  4JRZ A;  1YA9 A;  4ZLC A;  1D0Y A;  3FVY A;  1SR2 A;  1A41 A;  2YLG A;  2GA0 A;  3FDQ A;  1TWA A;  3AOU A;  4OIO F;  2GFH A;  3U9J A;  4XLP F;  2TMV P;  1ZZP A;  2J9B A;  2B0J A;  2C04 A;  1O87 A;  2YVK A;  4IAR A;  3EGD A;  3SYN A;  2Q9C A;  3EG9 B;  1FR0 A;  1NFN A;  2W4B A;  3EHM A;  4CS8 A;  1OKK A;  1YYX A;  3NYM A;  3ZVR A;  2OJQ A;  4I1M A;  3PHF 2;  1S05 A;  4X0R A;  1I4Y A;  2R7X A;  4EUK B;  2QNL A;  1TFO B;  4LDK A;  4YL0 A;  4JC7 A;  1XZP A;  1JRA A;  3K6B A;  3U8P A;  2L7A A;  4JJG A;  3DJU B;  3EZI A;  3H2V A;  1LVK A;  1IW7 F;  3GEI A;  2O9X A;  4JTA B;  4YWQ A;  5L0F A;  4ONS A;  2XM0 A;  3IQT A;  4IWB A;  1V55 C;  3A11 A;  1NU7 D;  1OW6 A;  4H4K C;  3FAP B;  4MVZ A;  2Q9A A;  3ZG1 A;  1I4Z A;  4O79 A;  1WTY A;  3ASN C;  1ZHZ A;  2G3V A;  4JTD B;  3S29 A;  1J8M F;  5EK0 A;  4G78 A;  2HMQ A;  3G4Z A;  4C3D A;  1K05 A;  1PD0 A;  4CS7 A;  1QLE C;  2XLO A;  1NU9 C;  1UFB A;  3KPH A;  4JCZ A;  2XLD A;  3T9O A;  3RKO F;  3SXZ A;  4BEJ A;  3POV A;  2R25 A;  1WOL A;  2EIK C;  2YQY A;  4HE8 D;  2OQM A;  2VAS A;  4NTB A;  2R7W A;  5JSL A;  4AL0 A;  3DJN B;  3GEH A;  4MND A;  3OEO A;  2FAP B;  3KKB A;  1YAR O;  4JUR I;  4KNW A;  2WZF A;  3JRM O;  2HJ3 A;  1FTS A;  3H65 A;  3X1O A;  3RFY A;  3JYH A;  1VB5 A;  1Q0K A;  1C17 M;  3KYJ A;  3QVZ A;  1ZU5 A;  3AJM A;  3ATP A;  3NKE A;  4J7Y A;  3C8G D;  3S9O A;  2R7O A;  2YRF A;  4ANJ A;  1VMA A;  1OW7 A;  1TR2 A;  2IXM A;  5B3S C;  5A6B D;  3QW0 A;  3WG7 C;  1LI5 A;  1HE1 A;  2YLI A;  4YL1 A;  4PFP A;  4WGZ A;  3UMI A;  2CYD A;  4N6H A;  4BPM A;  4MVR A;  1GM5 A;  4Q7C A;  3A9C A;  5DVW A;  3SXK A;  4C3E A;  1D1B A;  3U2M A;  5K0I A;  1FNT c;  2A1D D;  2YZS A;  3EGD B;  4G0H A;  5KYX A;  3S0X A;  2L6F A;  4MTO A;  4WAB A;  1G5Z A;  2GDC A;  1ZW2 A;  2C03 A;  2VCA A;  3HTK C;  1R5I D;  3FOP A;  2HV6 A;  4N4W A;  4WGY A;  3UMK A;  4OIR F;  1E83 A;  2R7Q A;  3ECS A;  1HW2 A;  4DVY P;  3AGT A;  5KYW A;  1HMD A;  2YEV A;  2ZPA A;  3EGX A;  2LCH A;  4U5F E;  4DBQ A;  3K1I C;  3O55 A;  4C7O A;  4CJG A;  3LJB A;  1JPN A;  5L0D A;  4I1O B;  4AX2 A;  1EQ1 A;  2XRH A;  3C8G B;  3U3B A;  1CGO A;  4OD4 A;  3LES A;  2D4U A;  3AG2 C;  4CJO A;  4BG0 A;  2WB7 A;  3HJC A;  2AWC A;  1IZM A;  5BQI A;  3NMK A;  2Y39 A;  3JSZ A;  2A6E F;  3V5Y A;  4MVU A;  2CCY A;  2IM8 A;  3W4Y A;  4AK9 A;  1OCC C;  3HNJ A;  1QSP A;  1V54 C;  2UUI A;  3SXY A;  2ZXP A;  1RJ9 B;  4ZLD A;  4NY3 A;  4O7G A;  3TD7 A;  1LKX A;  2M64 A;  4U5B E;  1ORY A;  1TKN A;  2EIL C;  1YVI A;  4F4B A;  4RD9 A;  1M2V B;  1U0B B;  1RKE B;  3RF3 A;  4DRJ B;  2AU5 A;  3DE8 A;  2KQ9 A;  3AG4 C;  1T9K A;  1YYJ A;  2NG1 A;  4LDR A;  3SZR A;  3W2V A;  4U5C E;  1Z23 A;  1CPR A;  4P9T A;  1Z63 A;  1K04 A;  2HMZ A;  1CPQ A;  3E70 C;  1ST6 A;  4MVQ A;  3M79 A;  4DXW A;  1BBH A;  3Q7G A;  1OCO C;  2NUT B;  3N0T A;  4HEA J;  3ZDL A;  2KGO A;  1Q0M A;  2P61 A;  4XPX A;  2EIJ C;  1SZI A;  4EHP A;  1OW8 A;  3W2W A;  1PV3 A;  3AGU A;  2WVN A;  2WVO A;  1H9G A;  2ZXO A;  2LFD A;  2R03 A;  3UNG C;  4CIH A;  3R2P A;  4H54 A;  5T3W A;  3WHN A;  2FFH A;  4YT4 A;  1QQ3 A;  3DM9 B;  1A7D A;  1OCZ C;  4DOZ A;  4HFF B;  3O10 A;  5KYX B;  4EBK A;  4BEM J;  2IXP A;  3M4C A;  3T6G B;  2HKV A;  1HE9 A;  3B29 A;  1T6Q A;  2LP4 A;  4O6N A;  2LQG A;  5JP7 A;  4BJ5 C;  3HKK A;  5DS6 A;  3IHU A;  3LUT B;  2R7S A;  2PP4 A;  2VH3 A;  4MQ9 F;  2MWQ A;  4YN0 B;  4CDV A;  3F47 A;  4JEA A;  1H6G A;  2XLM A;  2XLV A;  5EHH A;  4DRI B;  3B0U X;  1N1C A;  5L0H A;  3ZIB A;  4FWV A;  2R7V A;  3LS0 A;  1DOV A;  4U5D E;  3L8J A;  2ASR A;  3UGO A;  1ZHW A;  4QDL A;  3ZC4 A;  1JPJ A;  4JIO A;  4AL1 A;  2YHS A;  3E9V A;  1BR1 A;  2Y3D A;  4CSA C;  1T01 A;  1MND A;  2MYS A;  3U2L A;  3CZ6 A;  5JLI A;  2ZXR A;  3BEH A;  2J8W A;  1QZX A;  2OKU A;  1EKY A;  1LPE A;  3JCU Q;  1E84 A;  4G7O F;  3SEO A;  3L0I A;  3KMI A;  5L0G A;  3PCV A;  5JS5 A;  2KK1 A;  3MLG A;  3S27 A;  1LM3 B;  4O6Y A;  4OD5 A;  2YLD A;  4MTG A;  1S7Z A;  3SXM A;  3GWL A;  2OEX A;  4LLE A;  5CI9 A;  2DGJ A;  4NC3 A;  4U5E E;  3UR3 C;  3US6 A;  4IGG A;  1SF8 A;  3NDB B;  2J0W A;  4JZA A;  1VTM P;  2Z15 A;  2QE9 A;  2L81 A;  3DM5 A;  4YT8 A;  4GQH A;  3B71 A;  5F5H A;  3B0V C;  4PJM A;  5E3A A;  4FAP B;  1FFH A;  3QMK A;  3W8I A;  2RSE B;  1V4A A;  3RQF A;  2XLW A;  1C02 A;  1TWG A;  4QI2 A;  3GOD A;  3TOL A;  5KYU B;  2G3K A;  5AC4 A;  1TFK B;  3LEO A;  4JVS A;  2VB6 A;  5JVE A;  3S84 A;  1OKK D;  5AC5 A;  4IJJ A;  2AP3 A;  4JW1 A;  3NMJ A;  5E3C A;  2L6G A;  1LS4 A;  1VOM A;  2W9Y A;  2YKZ A;  4U5G A;  5T1D B;  4M63 A;  5DS4 A;  3VYW A;  2DYR C;  4ULV A;  4CS9 C;  4DJ9 A;  4N06 A;  1Z7Q c;  2A69 F;  2AWY A;  2HSQ A;  4W8K A;  4MVO A;  1OCR C;  2NUP A;  2XL8 A;  4MVS A;  3ZQV A;  1RCP A;  2CNW A;  1FMV A;  1Q0G A;  4PJJ A;  4ULW A;  2LSE A;  2YL3 A;  2OCC C;  3VRC A;  3T6B A;  5AGF A;  3AQB A;  5KYY A;  1D1A A;  3K66 A;  3H2U A;  3MBG A;  4XPY A;  1Z6A A;  1MQV A;  3N2Z B;  1JAF A;  3DKA A;  2J46 A;  1W2W A;  2J9V A;  2EPO A;  2YL1 A;  1KTM A;  4PR9 A;  2EPN A;  5BQH A;  3GEE A;  3HNL A;  3LAY A;  3DWW A;  2H7B A;  4E0H A;  5L3Q A;  4HFK B;  1AVO B;  1OR2 A;  2I8B A;  2NPU A;  4AE4 A;  4BJ1 A;  4CBE A;  2KNH A;  3ZSU A;  3U3F A;  1G4U S;  3QVY A;  2R02 A;  3TQO A;  1Y4C A;  2BE5 F;  2M4E A;  3OWT A;  5CIV A;  4D4N A;  2XS1 A;  4BJ5 A;  3B0P A;  3QTH A;  1D1C A;  1TWC A;  5BUO A;  2W45 A;  1KU2 A;  1ORS C;  1I5N A;  1E86 A;  2J45 A;  1T6I A;  3BRJ A;  4J32 B;  3EFO A;  5JT4 A;  1ZHX A;  4BJT A;  4E7Z A;  3UGP A;  3J06 A;  2LFF A;  1AEP A;  2HUJ A;  4Q5S F;  1WAT A;  1BR2 A;  4KI2 A;  1ZHT A;  3GM3 A;  3GM1 A;  2EIM C;  2KC3 A;  4GEH A;  3V7O A;  4CX9 A;  1OXB A;  1T5O A;  4E17 A;  3IEE A;  4IB4 A;  4CSA A;  1TQG A;  4JCH A;  4XEF A;  3ABK C;  1AUE A;  4A4A A;  4U9D A;  3LS1 A;  3S28 A; 
#chains in the Genus database with same CATH homology
 3DE9 A;  3M4B A;  4CDA A;  5JP7 A;  2XM0 A;  3HNI A;  4EIY A;  3L1M A;  4CDV A;  4JEA A;  256B A;  2XLM A;  2XLV A;  3C62 A;  3ZQY A;  3IQ6 A;  3ZTZ A;  2XLO A;  5JLI A;  2XLD A;  2J8W A;  1EKY A;  3FOO A;  2YL0 A;  1E84 A;  3TOM A;  5JSL A;  3C63 A;  5JS5 A;  3ZTM A;  1LM3 B;  2YLD A;  1CGN A;  4D4X A;  3QVZ A;  4NC3 A;  1YZC A;  1QPU A;  2XLE A;  4L6R A;  3IQ5 A;  3QW0 A;  4JE9 A;  2YLI A;  1GQA A;  4WGZ A;  4N6H A;  4JKV A;  1NBB A;  2XM4 A;  2XLW A;  4U9E A;  3TOL A;  1YZA A;  3QW1 A;  5JVE A;  2BC5 A;  2QLA A;  3FOP A;  4WGY A;  4N4W A;  3NMJ A;  4ER9 A;  2YKZ A;  1E83 A;  3HNK A;  4CIP A;  4ULV A;  5JUA A;  4CJG A;  1A7V A;  4IAQ A;  1CGO A;  2XL8 A;  3ZQV A;  4CJO A;  1RCP A;  3NMK A;  2YL3 A;  3VRC A;  2CCY A;  3ZWI A;  5AGF A;  3HNJ A;  1MQV A;  3NMI A;  1JAF A;  1E85 A;  2YL1 A;  1APC A;  5JRA A;  3M15 A;  5B3I A;  3HNL A;  3DE8 A;  2XLH A;  1YYJ A;  3QVY A;  1CPR A;  2YLG A;  1CPQ A;  3M79 A;  4D4N A;  1BBH A;  2XL6 A;  2J9B A;  4CDY A;  1E86 A;  4IAR A;  5JT4 A;  1YYX A;  1M6T A;  1S05 A;  4CX9 A;  4JEB A;  4IB4 A;  1QQ3 A;  4U9D A;  3M4C A;  2YL7 A;  3U8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...