5COFA

Crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
172
Chain Sequence
SMSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKGTEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSELSYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRLRKWAKNNNISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
total genus 62
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5cofA00
2F22A 3DI5A 2YQYA 3DKAA 5COGA 1RXQA 5COMA 2QNLA 4N6CA 2OU6A 3CEXA 2P1AA 5COFA 2HKVA 2RD9A 2OQMA 2QE9A 2NSFA 5CIVA 2NSGA 3QTHA 3GORA
chains in the Genus database with same CATH superfamily
5KYUB 3ABLC 3KYIA 5KYNA 1VTMP 1NG1A 1OKKD 5EK0A 4JW1A 4MVRA 3SXYA 4LDRA 4EWCA 5JP7A 1OCOC 3VM6A 2H7VC 4HEAJ 4P9FA 1MNDA 4E17A 1JPNA 2QTVA 2Y3BA 2ZXPA 1A0BA 2EPOA 4EBKA 1M57C 4MW8A 1FFHA 5CI8A 2YRFA 2R7XA 4DRJB 5CIVA 1SYQA 2BE5F 3PMRA 4MNDA 3RYLA 3ZQYA 1CGNA 1TWAA 1V54C 2Q9CA 3OA1A 3TOMA 4AL1A 1WOLA 3NYJA 2BL2A 2WL8A 4JIOA 4CIPA 1LE2A 4MQ9F 1V4AA 3PHF2 4RBNA 4XLNF 3U2MA 5L0DA 3DMDA 1Q0GA 2IBFA 1H9GA 3EH2A 1D1AA 1OW7A 2LK4A 3DI5A 3S9OA 3U3FA 3AQBA 5AC5A 3DD7A 3LNMB 2J45A 5D91A 1K40A 1OR3A 2EIKC 3DAGA 5F28E 2VCBA 3SNHA 3DAFA 3RW0A 2L9JA 3ZTMA 4OD5A 4A2NB 1E83A 2AWYA 1BDJB 3SXZA 3SYNA 3W2VA 3ZQVA 4CDYA 1EQ1A 2ZD9A 2QUPA 1J8MF 2WZLA 3B0PA 2HKVA 4DJ9A 4MS2A 4NTFA 2R7UA 5BQGA 3TULA 2HV7A 4OIRF 3CZ6A 5FZTA 3EPVA 3L8IA 4JTCB 1HW1A 3H2UA 3FMSA 4U5GA 3JSZA 3NMKA 4G7OF 5JVEA 1L3PA 3L1MA 1XZQA 4C3BA 2KGOA 2HS5A 4J7YA 4CS8C 4FWVA 2WVNA 2YL1A 2W45A 3QZCA 3RF3A 3FXHA 1E2XA 4YJWA 1H6GA 3NRHA 4IAOA 4E0IA 2XSEA 2PNOA 4JRZA 4MTGA 5HSWA 4BPMA 2Q00A 3EHMA 3MFNA 5CI9A 2L81A 3UMKA 1CGME 3R2PA 4U5HA 3EHNA 1EA8A 2AU5A 3UMIA 3CAXA 3RKOF 5A6BD 2L7AA 5A6AA 3TOLA 3B9QA 3TJ6A 3UGOA 1Z7Qc 1MMNA 3O10A 5AGFA 1N1CA 4O6NA 2W4BA 4KC9A 5JS5A 1WGWA 1LS4A 1OXKA 1UFBA 1O3UA 3A11A 2VCAA 2Y3DA 2EILC 1I4ZA 4OIQF 2G3VA 3JT1A 3FOOA 2JPUA 3EZIA 1LS1A 2L6GA 1JRAA 3WHNA 4PJMA 3HJCA 4NTAA 1D0YA 1A7DA 2DYRC 3OWTA 3SXMA 1E85A 2P61A 1JOGA 2W9YA 1TFKB 3DWWA 3QVZA 3WODF 4YWQA 2R7WA 4CSAA 5BUOA 4U5FE 3RVZA 2CCYA 3AOUA 3K6BA 4K0DA 4B6IA 1SMYF 1ZHWA 5T3TA 3WG7C 2KSFA 1D1BA 1LI5A 4RDAA 3F47A 1FTSA 4WABA 4Q4ZF 1T9KA 1ZHXA 2EPKX 1I5NA 1K04A 4IWBA 2XLWA 2R7VA 2XXAA 2PF4E 3ABKC 3O39A 4MTFA 1RJ9A 2LCHA 2XXAB 3I5QA 1OCZC 4AE4A 4ANJA 2KNHA 3IQ5A 4J32B 1RJ9B 3JTLO 4Q5SF 3NKDA 4AE4B 2A0UA 2GDCA 2EINC 3HLZA 1NLXA 4F4BA 2R7TA 3T6BA 2J0WA 3QW1A 1MQVA 1JAFA 4J30B 4N6HA 4XEVA 1U89A 5E3AA 1WTYA 3RFYA 4QI2A 2M64A 3DE9A 2H7OA 2HSQA 4QI0A 3MX3A 4U5BE 2WB7A 3JSEO 3X1OA 1VOMA 3IQTA 4PJLA 2NUTA 2R25A 1Q0DA 2A6EF 1NSGB 4C3EA 4O79A 1BR4A 1BR1A 2NUTB 2NPUA 3PDMP 3K7DA 2KW3C 3EG9A 4YL0A 3EFOA 2HMQA 3OEOA 3S27A 4CS8A 1LPEA 3FHDA 3MYFA 2Q4FA 4PFOA 3EG9B 2XS1A 1SR2A 2P6VA 3EFOB 1V74B 4G7ZF 1ZZPA 2VH3A 2KQ9A 2HFIA 4E7SA 4JTAB 5B1AC 5BQHA 4BG0A 1XWJA 4CIHA 3UGPA 4XEKA 2AP3A 3UNGC 1OXBA 2HJ3A 3K1HA 3KMIA 3NG1A 5IY5C 4OIPF 4ZLCA 2A1DD 5A69A 4XPWA 3C62A 2ICWG 3JRMO 1VB5A 4JJFA 3JZ0A 2VASA 3U5SA 3UMHA 2GAQA 2YLGA 4DVYP 5B3SC 1ZHZA 1ZU5A 1SZIA 1IW7F 1WN0A 2V26A 3S28A 3GEEA 3CQZA 2EPLX 1LIHA 3M4CA 4LLCA 3V7OA 4CX9A 1CGOA 1RKEA 4AL0A 4CDVA 1T01A 2OCCC 3C18A 3DE8A 5A6KA 5DS6A 3TK0A 1RKEB 3HNKA 3SEOA 2GFHA 4Z9HA 4MVSA 4KI2A 5T3WA 1RKCA 2YL3A 2HMZA 3E9VA 2J7PA 3M79A 5GPGB 4AK9A 4DRHB 5L0JA 1D1CA 1HMDA 4DVZA 3BRJA 3A9CA 1T6QA 3B71A 4N4WA 3FDQA 1PD0A 3MBGA 3T9OA 5F5HA 1A7EA 3O6XA 1NZEA 1QPUA 2YLDA 3ASNC 4XPYA 4CS9C 4EIYA 2OU6A 1YJGA 3UR3C 1VYIA 3TJ5A 4H54A 2P0NA 1OW6A 1FR0A 2EPNA 2Q3TA 3EJNA 3S84A 4AX2A 2PP4A 4IRUA 4A4AA 4NCQA 2MHRA 2XLEA 1KU2A 3C8GA 4CJOA 2CDQA 5L0GA 2YEVA 2CW0F 2FGYA 4BJ6A 4NQFA 1D0XA 1BR2A 1LVKA 1MMGA 1OQCA 2KK1A 1C17M 2Z15A 3C8GB 3RVYA 5JUAA 4XTKA 4UDVA 2G3KA 1M56C 4D4XA 2NUPA 3U3BA 4PK4A 4YT2A 3NYMA 2YL7A 2A6HF 5DQTA 2NUPB 3DXJF 1LKXA 5DQZA 3AQCA 3ZIBA 1LE4A 2VCCA 1EI7A 4C3DA 2OEVA 2VC9A 2I15A 2NG1A 4XQ1A 2H7BA 1CPRA 4JCZA 3DZAA 4GEHA 1FFTC 2EPMX 4E18A 5EGYA 1YA9A 1E86A 4XWJA 4MVOA 3M15A 2YWAA 3PCVA 3KL4A 3V5ZA 2OG2A 1SF8A 2B0JA 4W8PA 4JEBA 5E3CA 3K1IC 2WZFA 3N2ZB 1Z63A 4BEMJ 1WASA 1AEPA 1GGQA 3IEEA 3KPHA 2OOCA 4IB4A 3N0TA 2BC5A 3LAYA 1ZW2A 3RIPA 1S05A 3QW0A 1WATA 3AG4C 4CS7A 1Z5ZA 2YZSA 3DM9B 1M6TA 4CDAA 4GQHA 2J9UA 4CJGA 1G5ZA 4IJJA 4PFPA 3W8HA 4JC7A 1DOVA 1TFOB 3ZC4A 4XEFA 4WGZA 5L3VA 3HNJA 2C03A 4FAPB 4I44A 3NYLA 1YLMA 3S0XA 1VK5A 2X0CA 2XM4A 2XLDA 5JLIA 2ZPAA 5TJ5E 3LESA 4OIOF 2EIJC 3S90A 1GM5A 4M63A 5COFA 1ZU4A 4G78A 1L7CA 4IGGA 1QKRA 5JSLA 2IYLD 3L0IA 3U8VA 4RD9A 1ST6A 4EBBA 4Z9IA 1YARO 2J9VA 2LP4A 1VMAA 3AG3C 5T1DB 3B0VC 3AG2C 4WGYA 4EHPA 4Z9JA 4H4KC 1YAUO 1U6HA 3LS1A 4DXWA 1LI7A 5JRAA 1ORSC 3ZSUA 2IXOA 3RH3A 2LQGA 1ORYA 1ZHTA 2JX0A 4CS9A 1ZW3A 2R7QA 4EKWA 2CNWA 3LLIA 2R05A 2LSEA 2XL6A 3F46A 2XL4A 5B3IA 3LNRA 2L6FA 2Q9BA 2IXMA 5A6JA 5HV9A 2R9RB 1RCPA 2XL8A 4K7BA 1R4TA 4ONSA 1HW2A 3ZWIA 2XM0A 4YT4A 1NU9C 2HUJA 5AC4A 2AWCA 2IXNA 3HTKC 4ULWA 1YVIA 1MMDA 3GWLA 3Q7LA 3AGUA 4YN0B 1PCXA 2OQMA 2NSFA 1J8YF 4JE9A 1ZYRF 4LERA 4MVMA 1E84A 2OEXA 3Q7GA 3GM1A 3AG1C 4BJTA 4FESA 1U0BB 2YHSA 4LDKA 4ER9A 2GWWA 3LUTB 5FCLA 3VYWA 3FAPB 1Q0KA 2XLMA 2HV6A 2LIGA 3GEIA 1RMVA 2CGEA 3C7JA 2J8WA 2YQYA 4ULVA 2OKUA 2DI3A 2YL0A 2XS8A 4I1OB 1FMWA 4U5CE 5DS5A 1TR2A 3K1IA 3LEOA 1QZXA 1XZPA 3NMIA 2P1AA 2B0HA 2J9WA 2L6HA 2FFHA 3MLGA 2LD6A 3FVYA 3I5PA 1NBBA 2A69F 2IM8A 2XRHA 3W8IA 1M2VA 3IHUA 4PJJA 1HY5A 3ATPA 3U2LA 1Y4CA 3G4XA 2ZXOA 3DJNB 3T6GB 1M2VB 3NMJA 1OKKA 2YVKA 1HE1A 4MW3A 3G4ZA 1TWHA 4W8KA 5KYXA 2NSGA 4NY3A 2LFFA 2ASRA 1NU7D 4U5EE 3W4YA 5KYXB 3C63A 2XLHA 5KYYA 1FNTc 1QLEC 2E87A 2V3CC 3TQOA 1ORJA 4G7HF 3QTHA 1WWPA 4BJ5C 5KYYB 1VLTA 1Y6DA 1H9TA 5COGA 3FOPA 3X2QC 2XLVA 1O5HA 3SP1A 2QNLA 4NTBA 3DM5A 2UUHA 2PBEA 2RSEB 3Q6MA 2Y39A 4NC3A 3LJBA 3KH2A 1QVXA 1AVOB 1PD1A 4HE8D 4MTOA 2KYHA 1G4US 3AJMA 3EQLF 4MVUA 1H7IA 2YLIA 2J7PD 2Q7RA 1GQAA 3NDBB 5JT4A 3SXKA 4YL1A 2P7VA 3IPMO 2VB6A 4CSAC 3B0UX 1YDIA 2KC3A 1KNYA 2OJQA 4E0HA 2X51A 3US6A 2R7RA 5L0IA 2TMVP 3C8ZA 5F5FA 1A41A 2M4EA 3E70C 1DOWA 1MNEA 2IXPA 3ZVRA 3ECSA 1OCCC 3BEHA 3KKBA 1FAPB 4HFFB 4YK5A 2G62A 3SZRA 3J06A 5COMA 3C8GD 2MWQA 4LDQA 3MYIA 1YA7O 4C7OA 1HE9A 1JMWA 1FMVA 2XLOA 4JURI 4D4NA 1TWCA 1K05A 2OJED 1NFOA 1Z6AA 3U9JA 1BZ4A 2KJGA 3WAQA 4C7OB 4X0RA 2PX3A 3IQCA 3JYYA 4U9DA 1OR2A 2RD9A 3B29A 3DJUB 2C04A 4I3MA 4DOZA 3ABMC 3GEHA 3M1CB 4PACA 1EKYA 2AVKA 1JPJA 2DYSC 3POVA 3JCUQ 4P9TA 1APCA 2R02A 2MYSA 3ASOC 5D92A 4J7TA 2Q9AA 4DRIB 2WVOA 2UUIA 2FAPB 4MVQA 2ZXRA 1Q0MA 2A68F 4OINF 4L6RA 2IOQA 5A6BA 4JZAA 4O6MA 5K0IA 3VF0A 4XPXA 3ZDLA 3Q6NA 1R5ID 3GM3A 4IAQA 2WZGA 1Z23A 1OCRC 4P6IC 2QLAA 2LFDA 4IARA 3TD7A 4BJ1A 3VRCA 3HNLA 2Y3GA 3QMKA 1ZVZA 2D5RB 1V55C 4R32A 2QY9A 4BJ5A 3GANA 5B1BC 1TKNA 3GODA 3HKKA 1C02A 4JTDB 2J9BA 4KBLA 4U5DE 2D4UA 3ZG1A 4CBEA 3LEVA 4KNVA 5KYWA 1OW8A 1G4WR 2GA0A 3CSKA 4ZLDA 5EHHA 5KYWB 4MVZA 3FAJA 1YYJA 4U9EA 4YL3A 1D0ZA 3ZTZA 4Q7CA 1LM3B 3G50A 1T6IA 3JRTA 2JD3A 3R7CA 3LS0A 1RXQA 3EGDA 3K66A 3K33A 3LLKA 1W2WA 3H65A 3V5XA 2Y3HA 1T6UA 4JVSA 1IZMA 1CPQA 2HJMA 3U9MA 1B68A 1HMOA 2HSBA 2J46A 3EGDB 5L0CA 1S7ZA 3IQ6A 5E2QA 1GS9A 3AGTA 1UG7A 5L3QA 2W4MA 5DS4A 5L0HA 2CNWD 2YKZA 3GWNA 3U8PA 1ZHYA 3RQEA 4HFKB 4E7ZA 2O9XA 4JCHA 4JKVA 4DBQA 1YZCA 3QVYA 3EGXA 4DBRA 4N06A 3H2VA 2PFDA 3NKEA 1BBHA 2Y69C 2HZ8A 3EGXB 3L8JA 4I1MA 1Q0FA 3KYJA 2J0XA 3RQGA 3HNIA 5BQIA 2R7SA 3ITFA 1JR8A 4O7GA 1TQGA 5DVWA 1YYXA 3V5YA 3GORA 3N24A 4BJ6C 4EUKB 2F22A 3DKAA 3EH1A 1YZAA 1VLSA 2CYDA 3I4UA 4K1OA 3L34A 3M4BA 3EZHA 1VYKA 2ETSA 1TWGA 1M2OA 2DB4A 4QDLA 1G8XA 1QQ3A 3T6JA 3W2WA 1KTMA 1Z3IX 2H8AA 1MMAA 4N6CA 4YT5A 1QSPA 3T4RA 3CEXA 3JYHA 2I8BA 3O55A 5DLJA 2WVQA 4PR9A 1I4YA 4LLEA 4OD4A 4YT8A 4WJ0A 4BEJA 2R03A 1O87A 1C03A 4PJNA 2EIMC 1PV3A 4JJGA 4JEAA 2ZXWC 4G0HA 2QE9A 5L0FA 1T5OA 2R7OA 2DGJA 2PX0A 256BA 3GM2A 4LACB 4FX5A 4KNWA 1F1MA 1A7VA 5E33A 1NFNA 3RQFA 3S29A 4GYTA 5KYUA 1AUEA 4EBJA 3U0CA 3VAYA 4O6YA 2A0BA 4XLPF
chains in the Genus database with same CATH topology
2F22A 3DI5A 2YQYA 3DKAA 5COGA 1RXQA 5COMA 2QNLA 4N6CA 2OU6A 3CEXA 2P1AA 5COFA 2HKVA 2RD9A 2OQMA 2QE9A 2NSFA 5CIVA 2NSGA 3QTHA 3GORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F22 A;  3DI5 A;  2YQY A;  3DKA A;  5COG A;  1RXQ A;  5COM A;  2QNL A;  4N6C A;  2OU6 A;  3CEX A;  2P1A A;  5COF A;  2HKV A;  2RD9 A;  2OQM A;  2QE9 A;  2NSF A;  5CIV A;  2NSG A;  3QTH A;  3GOR A; 
#chains in the Genus database with same CATH topology
 5KYU B;  3ABL C;  3KYI A;  5KYN A;  1VTM P;  1NG1 A;  1OKK D;  5EK0 A;  4JW1 A;  4MVR A;  3SXY A;  4LDR A;  4EWC A;  5JP7 A;  1OCO C;  3VM6 A;  2H7V C;  4HEA J;  4P9F A;  1MND A;  4E17 A;  1JPN A;  2QTV A;  2Y3B A;  2ZXP A;  1A0B A;  2EPO A;  4EBK A;  1M57 C;  4MW8 A;  1FFH A;  5CI8 A;  2YRF A;  2R7X A;  4DRJ B;  5CIV A;  1SYQ A;  2BE5 F;  3PMR A;  4MND A;  3RYL A;  3ZQY A;  1CGN A;  1TWA A;  1V54 C;  2Q9C A;  3OA1 A;  3TOM A;  4AL1 A;  1WOL A;  3NYJ A;  2BL2 A;  2WL8 A;  4JIO A;  4CIP A;  1LE2 A;  4MQ9 F;  1V4A A;  3PHF 2;  4RBN A;  4XLN F;  3U2M A;  5L0D A;  3DMD A;  1Q0G A;  2IBF A;  1H9G A;  3EH2 A;  1D1A A;  1OW7 A;  2LK4 A;  3DI5 A;  3S9O A;  3U3F A;  3AQB A;  5AC5 A;  3DD7 A;  3LNM B;  2J45 A;  5D91 A;  1K40 A;  1OR3 A;  2EIK C;  3DAG A;  5F28 E;  2VCB A;  3SNH A;  3DAF A;  3RW0 A;  2L9J A;  3ZTM A;  4OD5 A;  4A2N B;  1E83 A;  2AWY A;  1BDJ B;  3SXZ A;  3SYN A;  3W2V A;  3ZQV A;  4CDY A;  1EQ1 A;  2ZD9 A;  2QUP A;  1J8M F;  2WZL A;  3B0P A;  2HKV A;  4DJ9 A;  4MS2 A;  4NTF A;  2R7U A;  5BQG A;  3TUL A;  2HV7 A;  4OIR F;  3CZ6 A;  5FZT A;  3EPV A;  3L8I A;  4JTC B;  1HW1 A;  3H2U A;  3FMS A;  4U5G A;  3JSZ A;  3NMK A;  4G7O F;  5JVE A;  1L3P A;  3L1M A;  1XZQ A;  4C3B A;  2KGO A;  2HS5 A;  4J7Y A;  4CS8 C;  4FWV A;  2WVN A;  2YL1 A;  2W45 A;  3QZC A;  3RF3 A;  3FXH A;  1E2X A;  4YJW A;  1H6G A;  3NRH A;  4IAO A;  4E0I A;  2XSE A;  2PNO A;  4JRZ A;  4MTG A;  5HSW A;  4BPM A;  2Q00 A;  3EHM A;  3MFN A;  5CI9 A;  2L81 A;  3UMK A;  1CGM E;  3R2P A;  4U5H A;  3EHN A;  1EA8 A;  2AU5 A;  3UMI A;  3CAX A;  3RKO F;  5A6B D;  2L7A A;  5A6A A;  3TOL A;  3B9Q A;  3TJ6 A;  3UGO A;  1Z7Q c;  1MMN A;  3O10 A;  5AGF A;  1N1C A;  4O6N A;  2W4B A;  4KC9 A;  5JS5 A;  1WGW A;  1LS4 A;  1OXK A;  1UFB A;  1O3U A;  3A11 A;  2VCA A;  2Y3D A;  2EIL C;  1I4Z A;  4OIQ F;  2G3V A;  3JT1 A;  3FOO A;  2JPU A;  3EZI A;  1LS1 A;  2L6G A;  1JRA A;  3WHN A;  4PJM A;  3HJC A;  4NTA A;  1D0Y A;  1A7D A;  2DYR C;  3OWT A;  3SXM A;  1E85 A;  2P61 A;  1JOG A;  2W9Y A;  1TFK B;  3DWW A;  3QVZ A;  3WOD F;  4YWQ A;  2R7W A;  4CSA A;  5BUO A;  4U5F E;  3RVZ A;  2CCY A;  3AOU A;  3K6B A;  4K0D A;  4B6I A;  1SMY F;  1ZHW A;  5T3T A;  3WG7 C;  2KSF A;  1D1B A;  1LI5 A;  4RDA A;  3F47 A;  1FTS A;  4WAB A;  4Q4Z F;  1T9K A;  1ZHX A;  2EPK X;  1I5N A;  1K04 A;  4IWB A;  2XLW A;  2R7V A;  2XXA A;  2PF4 E;  3ABK C;  3O39 A;  4MTF A;  1RJ9 A;  2LCH A;  2XXA B;  3I5Q A;  1OCZ C;  4AE4 A;  4ANJ A;  2KNH A;  3IQ5 A;  4J32 B;  1RJ9 B;  3JTL O;  4Q5S F;  3NKD A;  4AE4 B;  2A0U A;  2GDC A;  2EIN C;  3HLZ A;  1NLX A;  4F4B A;  2R7T A;  3T6B A;  2J0W A;  3QW1 A;  1MQV A;  1JAF A;  4J30 B;  4N6H A;  4XEV A;  1U89 A;  5E3A A;  1WTY A;  3RFY A;  4QI2 A;  2M64 A;  3DE9 A;  2H7O A;  2HSQ A;  4QI0 A;  3MX3 A;  4U5B E;  2WB7 A;  3JSE O;  3X1O A;  1VOM A;  3IQT A;  4PJL A;  2NUT A;  2R25 A;  1Q0D A;  2A6E F;  1NSG B;  4C3E A;  4O79 A;  1BR4 A;  1BR1 A;  2NUT B;  2NPU A;  3PDM P;  3K7D A;  2KW3 C;  3EG9 A;  4YL0 A;  3EFO A;  2HMQ A;  3OEO A;  3S27 A;  4CS8 A;  1LPE A;  3FHD A;  3MYF A;  2Q4F A;  4PFO A;  3EG9 B;  2XS1 A;  1SR2 A;  2P6V A;  3EFO B;  1V74 B;  4G7Z F;  1ZZP A;  2VH3 A;  2KQ9 A;  2HFI A;  4E7S A;  4JTA B;  5B1A C;  5BQH A;  4BG0 A;  1XWJ A;  4CIH A;  3UGP A;  4XEK A;  2AP3 A;  3UNG C;  1OXB A;  2HJ3 A;  3K1H A;  3KMI A;  3NG1 A;  5IY5 C;  4OIP F;  4ZLC A;  2A1D D;  5A69 A;  4XPW A;  3C62 A;  2ICW G;  3JRM O;  1VB5 A;  4JJF A;  3JZ0 A;  2VAS A;  3U5S A;  3UMH A;  2GAQ A;  2YLG A;  4DVY P;  5B3S C;  1ZHZ A;  1ZU5 A;  1SZI A;  1IW7 F;  1WN0 A;  2V26 A;  3S28 A;  3GEE A;  3CQZ A;  2EPL X;  1LIH A;  3M4C A;  4LLC A;  3V7O A;  4CX9 A;  1CGO A;  1RKE A;  4AL0 A;  4CDV A;  1T01 A;  2OCC C;  3C18 A;  3DE8 A;  5A6K A;  5DS6 A;  3TK0 A;  1RKE B;  3HNK A;  3SEO A;  2GFH A;  4Z9H A;  4MVS A;  4KI2 A;  5T3W A;  1RKC A;  2YL3 A;  2HMZ A;  3E9V A;  2J7P A;  3M79 A;  5GPG B;  4AK9 A;  4DRH B;  5L0J A;  1D1C A;  1HMD A;  4DVZ A;  3BRJ A;  3A9C A;  1T6Q A;  3B71 A;  4N4W A;  3FDQ A;  1PD0 A;  3MBG A;  3T9O A;  5F5H A;  1A7E A;  3O6X A;  1NZE A;  1QPU A;  2YLD A;  3ASN C;  4XPY A;  4CS9 C;  4EIY A;  2OU6 A;  1YJG A;  3UR3 C;  1VYI A;  3TJ5 A;  4H54 A;  2P0N A;  1OW6 A;  1FR0 A;  2EPN A;  2Q3T A;  3EJN A;  3S84 A;  4AX2 A;  2PP4 A;  4IRU A;  4A4A A;  4NCQ A;  2MHR A;  2XLE A;  1KU2 A;  3C8G A;  4CJO A;  2CDQ A;  5L0G A;  2YEV A;  2CW0 F;  2FGY A;  4BJ6 A;  4NQF A;  1D0X A;  1BR2 A;  1LVK A;  1MMG A;  1OQC A;  2KK1 A;  1C17 M;  2Z15 A;  3C8G B;  3RVY A;  5JUA A;  4XTK A;  4UDV A;  2G3K A;  1M56 C;  4D4X A;  2NUP A;  3U3B A;  4PK4 A;  4YT2 A;  3NYM A;  2YL7 A;  2A6H F;  5DQT A;  2NUP B;  3DXJ F;  1LKX A;  5DQZ A;  3AQC A;  3ZIB A;  1LE4 A;  2VCC A;  1EI7 A;  4C3D A;  2OEV A;  2VC9 A;  2I15 A;  2NG1 A;  4XQ1 A;  2H7B A;  1CPR A;  4JCZ A;  3DZA A;  4GEH A;  1FFT C;  2EPM X;  4E18 A;  5EGY A;  1YA9 A;  1E86 A;  4XWJ A;  4MVO A;  3M15 A;  2YWA A;  3PCV A;  3KL4 A;  3V5Z A;  2OG2 A;  1SF8 A;  2B0J A;  4W8P A;  4JEB A;  5E3C A;  3K1I C;  2WZF A;  3N2Z B;  1Z63 A;  4BEM J;  1WAS A;  1AEP A;  1GGQ A;  3IEE A;  3KPH A;  2OOC A;  4IB4 A;  3N0T A;  2BC5 A;  3LAY A;  1ZW2 A;  3RIP A;  1S05 A;  3QW0 A;  1WAT A;  3AG4 C;  4CS7 A;  1Z5Z A;  2YZS A;  3DM9 B;  1M6T A;  4CDA A;  4GQH A;  2J9U A;  4CJG A;  1G5Z A;  4IJJ A;  4PFP A;  3W8H A;  4JC7 A;  1DOV A;  1TFO B;  3ZC4 A;  4XEF A;  4WGZ A;  5L3V A;  3HNJ A;  2C03 A;  4FAP B;  4I44 A;  3NYL A;  1YLM A;  3S0X A;  1VK5 A;  2X0C A;  2XM4 A;  2XLD A;  5JLI A;  2ZPA A;  5TJ5 E;  3LES A;  4OIO F;  2EIJ C;  3S90 A;  1GM5 A;  4M63 A;  5COF A;  1ZU4 A;  4G78 A;  1L7C A;  4IGG A;  1QKR A;  5JSL A;  2IYL D;  3L0I A;  3U8V A;  4RD9 A;  1ST6 A;  4EBB A;  4Z9I A;  1YAR O;  2J9V A;  2LP4 A;  1VMA A;  3AG3 C;  5T1D B;  3B0V C;  3AG2 C;  4WGY A;  4EHP A;  4Z9J A;  4H4K C;  1YAU O;  1U6H A;  3LS1 A;  4DXW A;  1LI7 A;  5JRA A;  1ORS C;  3ZSU A;  2IXO A;  3RH3 A;  2LQG A;  1ORY A;  1ZHT A;  2JX0 A;  4CS9 A;  1ZW3 A;  2R7Q A;  4EKW A;  2CNW A;  3LLI A;  2R05 A;  2LSE A;  2XL6 A;  3F46 A;  2XL4 A;  5B3I A;  3LNR A;  2L6F A;  2Q9B A;  2IXM A;  5A6J A;  5HV9 A;  2R9R B;  1RCP A;  2XL8 A;  4K7B A;  1R4T A;  4ONS A;  1HW2 A;  3ZWI A;  2XM0 A;  4YT4 A;  1NU9 C;  2HUJ A;  5AC4 A;  2AWC A;  2IXN A;  3HTK C;  4ULW A;  1YVI A;  1MMD A;  3GWL A;  3Q7L A;  3AGU A;  4YN0 B;  1PCX A;  2OQM A;  2NSF A;  1J8Y F;  4JE9 A;  1ZYR F;  4LER A;  4MVM A;  1E84 A;  2OEX A;  3Q7G A;  3GM1 A;  3AG1 C;  4BJT A;  4FES A;  1U0B B;  2YHS A;  4LDK A;  4ER9 A;  2GWW A;  3LUT B;  5FCL A;  3VYW A;  3FAP B;  1Q0K A;  2XLM A;  2HV6 A;  2LIG A;  3GEI A;  1RMV A;  2CGE A;  3C7J A;  2J8W A;  2YQY A;  4ULV A;  2OKU A;  2DI3 A;  2YL0 A;  2XS8 A;  4I1O B;  1FMW A;  4U5C E;  5DS5 A;  1TR2 A;  3K1I A;  3LEO A;  1QZX A;  1XZP A;  3NMI A;  2P1A A;  2B0H A;  2J9W A;  2L6H A;  2FFH A;  3MLG A;  2LD6 A;  3FVY A;  3I5P A;  1NBB A;  2A69 F;  2IM8 A;  2XRH A;  3W8I A;  1M2V A;  3IHU A;  4PJJ A;  1HY5 A;  3ATP A;  3U2L A;  1Y4C A;  3G4X A;  2ZXO A;  3DJN B;  3T6G B;  1M2V B;  3NMJ A;  1OKK A;  2YVK A;  1HE1 A;  4MW3 A;  3G4Z A;  1TWH A;  4W8K A;  5KYX A;  2NSG A;  4NY3 A;  2LFF A;  2ASR A;  1NU7 D;  4U5E E;  3W4Y A;  5KYX B;  3C63 A;  2XLH A;  5KYY A;  1FNT c;  1QLE C;  2E87 A;  2V3C C;  3TQO A;  1ORJ A;  4G7H F;  3QTH A;  1WWP A;  4BJ5 C;  5KYY B;  1VLT A;  1Y6D A;  1H9T A;  5COG A;  3FOP A;  3X2Q C;  2XLV A;  1O5H A;  3SP1 A;  2QNL A;  4NTB A;  3DM5 A;  2UUH A;  2PBE A;  2RSE B;  3Q6M A;  2Y39 A;  4NC3 A;  3LJB A;  3KH2 A;  1QVX A;  1AVO B;  1PD1 A;  4HE8 D;  4MTO A;  2KYH A;  1G4U S;  3AJM A;  3EQL F;  4MVU A;  1H7I A;  2YLI A;  2J7P D;  2Q7R A;  1GQA A;  3NDB B;  5JT4 A;  3SXK A;  4YL1 A;  2P7V A;  3IPM O;  2VB6 A;  4CSA C;  3B0U X;  1YDI A;  2KC3 A;  1KNY A;  2OJQ A;  4E0H A;  2X51 A;  3US6 A;  2R7R A;  5L0I A;  2TMV P;  3C8Z A;  5F5F A;  1A41 A;  2M4E A;  3E70 C;  1DOW A;  1MNE A;  2IXP A;  3ZVR A;  3ECS A;  1OCC C;  3BEH A;  3KKB A;  1FAP B;  4HFF B;  4YK5 A;  2G62 A;  3SZR A;  3J06 A;  5COM A;  3C8G D;  2MWQ A;  4LDQ A;  3MYI A;  1YA7 O;  4C7O A;  1HE9 A;  1JMW A;  1FMV A;  2XLO A;  4JUR I;  4D4N A;  1TWC A;  1K05 A;  2OJE D;  1NFO A;  1Z6A A;  3U9J A;  1BZ4 A;  2KJG A;  3WAQ A;  4C7O B;  4X0R A;  2PX3 A;  3IQC A;  3JYY A;  4U9D A;  1OR2 A;  2RD9 A;  3B29 A;  3DJU B;  2C04 A;  4I3M A;  4DOZ A;  3ABM C;  3GEH A;  3M1C B;  4PAC A;  1EKY A;  2AVK A;  1JPJ A;  2DYS C;  3POV A;  3JCU Q;  4P9T A;  1APC A;  2R02 A;  2MYS A;  3ASO C;  5D92 A;  4J7T A;  2Q9A A;  4DRI B;  2WVO A;  2UUI A;  2FAP B;  4MVQ A;  2ZXR A;  1Q0M A;  2A68 F;  4OIN F;  4L6R A;  2IOQ A;  5A6B A;  4JZA A;  4O6M A;  5K0I A;  3VF0 A;  4XPX A;  3ZDL A;  3Q6N A;  1R5I D;  3GM3 A;  4IAQ A;  2WZG A;  1Z23 A;  1OCR C;  4P6I C;  2QLA A;  2LFD A;  4IAR A;  3TD7 A;  4BJ1 A;  3VRC A;  3HNL A;  2Y3G A;  3QMK A;  1ZVZ A;  2D5R B;  1V55 C;  4R32 A;  2QY9 A;  4BJ5 A;  3GAN A;  5B1B C;  1TKN A;  3GOD A;  3HKK A;  1C02 A;  4JTD B;  2J9B A;  4KBL A;  4U5D E;  2D4U A;  3ZG1 A;  4CBE A;  3LEV A;  4KNV A;  5KYW A;  1OW8 A;  1G4W R;  2GA0 A;  3CSK A;  4ZLD A;  5EHH A;  5KYW B;  4MVZ A;  3FAJ A;  1YYJ A;  4U9E A;  4YL3 A;  1D0Z A;  3ZTZ A;  4Q7C A;  1LM3 B;  3G50 A;  1T6I A;  3JRT A;  2JD3 A;  3R7C A;  3LS0 A;  1RXQ A;  3EGD A;  3K66 A;  3K33 A;  3LLK A;  1W2W A;  3H65 A;  3V5X A;  2Y3H A;  1T6U A;  4JVS A;  1IZM A;  1CPQ A;  2HJM A;  3U9M A;  1B68 A;  1HMO A;  2HSB A;  2J46 A;  3EGD B;  5L0C A;  1S7Z A;  3IQ6 A;  5E2Q A;  1GS9 A;  3AGT A;  1UG7 A;  5L3Q A;  2W4M A;  5DS4 A;  5L0H A;  2CNW D;  2YKZ A;  3GWN A;  3U8P A;  1ZHY A;  3RQE A;  4HFK B;  4E7Z A;  2O9X A;  4JCH A;  4JKV A;  4DBQ A;  1YZC A;  3QVY A;  3EGX A;  4DBR A;  4N06 A;  3H2V A;  2PFD A;  3NKE A;  1BBH A;  2Y69 C;  2HZ8 A;  3EGX B;  3L8J A;  4I1M A;  1Q0F A;  3KYJ A;  2J0X A;  3RQG A;  3HNI A;  5BQI A;  2R7S A;  3ITF A;  1JR8 A;  4O7G A;  1TQG A;  5DVW A;  1YYX A;  3V5Y A;  3GOR A;  3N24 A;  4BJ6 C;  4EUK B;  2F22 A;  3DKA A;  3EH1 A;  1YZA A;  1VLS A;  2CYD A;  3I4U A;  4K1O A;  3L34 A;  3M4B A;  3EZH A;  1VYK A;  2ETS A;  1TWG A;  1M2O A;  2DB4 A;  4QDL A;  1G8X A;  1QQ3 A;  3T6J A;  3W2W A;  1KTM A;  1Z3I X;  2H8A A;  1MMA A;  4N6C A;  4YT5 A;  1QSP A;  3T4R A;  3CEX A;  3JYH A;  2I8B A;  3O55 A;  5DLJ A;  2WVQ A;  4PR9 A;  1I4Y A;  4LLE A;  4OD4 A;  4YT8 A;  4WJ0 A;  4BEJ A;  2R03 A;  1O87 A;  1C03 A;  4PJN A;  2EIM C;  1PV3 A;  4JJG A;  4JEA A;  2ZXW C;  4G0H A;  2QE9 A;  5L0F A;  1T5O A;  2R7O A;  2DGJ A;  2PX0 A;  256B A;  3GM2 A;  4LAC B;  4FX5 A;  4KNW A;  1F1M A;  1A7V A;  5E33 A;  1NFN A;  3RQF A;  3S29 A;  4GYT A;  5KYU A;  1AUE A;  4EBJ A;  3U0C A;  3VAY A;  4O6Y A;  2A0B A;  4XLP F; 
#chains in the Genus database with same CATH homology
 2F22 A;  3DI5 A;  2YQY A;  3DKA A;  5COG A;  1RXQ A;  5COM A;  2QNL A;  4N6C A;  2OU6 A;  3CEX A;  2P1A A;  5COF A;  2HKV A;  2RD9 A;  2OQM A;  2QE9 A;  2NSF A;  5CIV A;  2NSG A;  3QTH A;  3GOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...