5COFA

Crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
172
Chain Sequence
SMSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKGTEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSELSYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRLRKWAKNNNISL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
molecule tags Unknown function
total genus 62
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5cofA00
1RXQA 2RD9A 2NSGA 5COGA 5COMA 2OQMA 5CIVA 2NSFA 4N6CA 2QE9A 3DI5A 3GORA 2P1AA 2OU6A 3DKAA 5COFA 3CEXA 2YQYA 2QNLA 3QTHA 2F22A 2HKVA
chains in the Genus database with same CATH superfamily
2EIMC 5JRAA 4NTFA 1WASA 2B0JA 1TWAA 3HNIA 2FGYA 4MVZA 3S27A 3U2MA 4F4BA 1QVXA 1GS9A 1SYQA 3DXJF 2GAQA 4YWQA 2NSGA 4W8KA 2G62A 5COGA 4G7ZF 2XLEA 3N2ZB 4MQ9F 4O6YA 4J30B 3RF3A 1U6HA 4IRUA 2B0HA 3WODF 5L3QA 2Z15A 1EI7A 4CSAC 2LSEA 3SXKA 2HMZA 5F5HA 2XM0A 2YLIA 2XL4A 3HJCA 1H6GA 2PP4A 2XS1A 3S29A 3AOUA 2P61A 3QMKA 1MMDA 3WG7C 4U5DE 4IARA 1VOMA 1XWJA 4EIYA 1ZHYA 4O79A 3EG9A 3ZTZA 1MNDA 4GQHA 3C8GD 4AK9A 1BR2A 1Q0KA 4JTDB 2XSEA 3S28A 3KL4A 4YK5A 2CCYA 1SMYF 1YARO 3JCUQ 3SNHA 4XLPF 1H9GA 3K33A 4RD9A 1F1MA 3ABMC 5T3WA 5DS4A 1YDIA 2YL0A 3JRMO 4D4XA 2OCCC 5EGYA 5A6KA 5GPGB 2LQGA 3K1IC 5L3VA 3HNKA 5L0DA 2HSQA 1VLSA 1JRAA 1VYKA 2NUTB 2YLDA 1HY5A 1YA7O 3FVYA 3U9MA 3EZIA 3M4BA 3AG2C 1WTYA 1OR2A 5CI8A 3ZC4A 2P1AA 2XLVA 3KYIA 5BQIA 4FWVA 2Q7RA 1R4TA 1SZIA 2Y3GA 4KBLA 2P6VA 3L8IA 3X2QC 4BG0A 4AE4B 4AL1A 2EINC 2W45A 1LM3B 2C03A 3CZ6A 3T4RA 4PJNA 2Q9CA 1RKEB 2ICWG 1OR3A 5L0HA 2KC3A 2VC9A 1M2VA 2J9UA 4CS8C 1C03A 2W4BA 3R7CA 1SF8A 2HJ3A 3AG4C 2L6GA 3H2UA 3A9CA 3LS1A 4PJJA 1CGME 2AU5A 1LE4A 2G3VA 2MHRA 1FMWA 2Y39A 4NTAA 4ULVA 2IOQA 3C62A 5D91A 2UUHA 3O10A 4JTCB 4W8PA 4WJ0A 1HE9A 4OINF 4C3DA 3DI5A 2JX0A 1G8XA 1Z5ZA 4WABA 3ZIBA 1MMAA 4CSAA 1C02A 1Y4CA 2DYSC 3GORA 4I1OB 1A41A 3POVA 1ZHZA 4U5EE 4G7OF 4XEVA 5T3TA 2I8BA 1PD1A 4WGZA 3DWWA 4CBEA 1JMWA 4PFPA 1YAUO 4Z9JA 2LFFA 4YJWA 1HW2A 4EBBA 3FXHA 3HLZA 2KK1A 4MVRA 5KYWA 1KTMA 1VYIA 4LDRA 2F22A 2XLWA 1OW7A 3U3FA 2YZSA 3E9VA 1HE1A 3Q7GA 1Z3IX 3Q7LA 4AX2A 2R7SA 2EILC 2VB6A 2L6FA 3DM5A 4LLEA 3NG1A 4Z9IA 5JSLA 2A69F 1YLMA 4U5HA 3ZVRA 2W9YA 2EPNA 1G5ZA 4JRZA 4L6RA 4JURI 2R7XA 3U0CA 2CGEA 3K1IA 4QDLA 4ANJA 3ABLC 2J9VA 2EIJC 2ZXPA 3IQCA 4KNWA 5KYYB 4PJLA 4ULWA 5COFA 1Z63A 1V55C 2CW0F 2OKUA 4JC7A 2OG2A 3K66A 2EPMX 2YL1A 5IY5C 4P6IC 2MWQA 3JTLO 2LP4A 3MYIA 4DBRA 3JSEO 1E83A 3B9QA 2Q9BA 1Y6DA 2A1DD 4K7BA 4O6NA 5A69A 1LPEA 4MVSA 3CSKA 3RW0A 3VYWA 2VCCA 3NKEA 1PV3A 1NU9C 4CS8A 4JJFA 2A0UA 2DI3A 3TJ6A 4O7GA 3KPHA 1G4WR 3S9OA 3V5XA 2W4MA 5KYNA 2GWWA 3NYLA 3Q6NA 1RJ9B 1NFNA 2OJED 3GM2A 2FAPB 4G0HA 4MVMA 5DQZA 1ZU5A 2Y3DA 1OCZC 5DS6A 3C8GA 1TKNA 4G78A 4R32A 4CS7A 1M57C 3AGTA 2OOCA 5AGFA 2R7WA 4YN0B 2GFHA 4C7OB 2IXMA 2QLAA 1JOGA 2DB4A 1T5OA 1TR2A 4WGYA 2WVOA 3GANA 3NRHA 3RKOF 3RVYA 2Q3TA 3S0XA 2ZD9A 4UDVA 4O6MA 3BRJA 2BE5F 5BUOA 4YL0A 3S90A 3KMIA 1I5NA 3L0IA 4GYTA 4JCZA 1EKYA 2XLHA 4G7HF 1RMVA 3M79A 1VLTA 3L1MA 1V74B 2Q9AA 2J0WA 3M4CA 5AC4A 1J8YF 1S05A 2AVKA 2PX3A 2J9WA 3C18A 4N6HA 3HNLA 4K0DA 3W2WA 3PDMP 4PR9A 1WOLA 1C17M 3V5ZA 3NMKA 2EPLX 3B29A 4U5GA 4FESA 1FR0A 2OQMA 2AWCA 4NCQA 1V54C 2OJQA 2A6EF 1MNEA 3DM9B 3LNRA 3EHMA 3U3BA 2R7OA 3US6A 3G50A 1YJGA 1T6UA 1D1BA 1OCRC 1LI5A 3EPVA 4LDKA 1YYJA 4CX9A 2PBEA 3SP1A 1A7EA 1FAPB 3TD7A 3OWTA 1TWGA 4JEAA 3DD7A 3LESA 2HUJA 2XLDA 2LK4A 2H7VC 1OW8A 1FFHA 1R5ID 2L7AA 3A11A 5F28E 5AC5A 1RJ9A 3I4UA 2J8WA 3C8ZA 3NMIA 5L0IA 2RD9A 1NG1A 2H7BA 4XPYA 4LERA 4JW1A 2R7QA 1J8MF 2DGJA 2JPUA 3G4ZA 4C7OA 3JYHA 5KYXA 3NYJA 1BR1A 4DXWA 2A6HF 2HV7A 4PACA 1T6IA 1LVKA 1YZAA 2KYHA 1BZ4A 4B6IA 2ZXRA 3F46A 2D4UA 3RVZA 1IW7F 3TJ5A 3CEXA 3NKDA 5E33A 3T6JA 3K6BA 4E7SA 2FFHA 1JAFA 3DZAA 4OIRF 3RQEA 4EKWA 3QVZA 1WWPA 1CGOA 4CS9A 1DOWA 4IWBA 3LEVA 5JP7A 4JKVA 4DOZA 1VK5A 3DAGA 1HMOA 1JPNA 1U89A 5A6JA 1GM5A 3ITFA 2WB7A 3UMIA 2KQ9A 3HKKA 1ORYA 5JUAA 5K0IA 3B0VC 1ZW2A 3EH1A 4PJMA 3NMJA 1OW6A 4RDAA 4CDYA 3OA1A 2R7UA 3IEEA 2NSFA 3ZWIA 2D5RB 1ZYRF 4YL3A 3DJNB 4DJ9A 2R03A 4I3MA 3J06A 2KSFA 3RYLA 4QI0A 1ST6A 1QSPA 3VM6A 4MVQA 4A4AA 1QZXA 1NZEA 3VRCA 5DS5A 4I44A 2MYSA 2R02A 1JR8A 4BJTA 2Y3HA 5KYXB 2KNHA 2ASRA 3OEOA 4DRIB 1CPRA 1NFOA 1L3PA 1RKCA 2L81A 2LD6A 2C04A 4IAOA 4N06A 1HW1A 1OXKA 2KW3C 2QTVA 4M63A 3KKBA 3JT1A 2NUTA 1Q0GA 4YT5A 1PD0A 4CDAA 3EQLF 1Q0FA 1OKKD 5JVEA 4E17A 2BL2A 2YHSA 1KU2A 3AGUA 3EGXB 4JVSA 1TFOB 3JRTA 3LLKA 3O55A 3JZ0A 2V26A 2XM4A 4MVOA 4AE4A 2HMQA 2NUPB 2J9BA 3IPMO 3L34A 2HFIA 1RKEA 1EQ1A 1TFKB 2TMVP 3FHDA 2IBFA 2R7VA 1Q0MA 2XLMA 1T6QA 2Q4FA 1LS4A 1XZQA 3G4XA 2R25A 3Q6MA 3SXMA 3W8IA 2J7PA 4U5BE 4C3EA 3AJMA 4OIPF 1Z6AA 2KGOA 3F47A 4DVYP 2P0NA 4Z9HA 4N4WA 3T9OA 1FNTc 3E70C 4J7YA 4NTBA 2IXPA 2WVNA 2XS8A 4JEBA 1JPJA 3HTKC 4P9TA 2NPUA 1OCOC 3IQ6A 2XXAB 1N1CA 4IAQA 4J7TA 4ONSA 1AEPA 1ZHXA 1FMVA 2L6HA 2HSBA 2J45A 1QKRA 2H7OA 3VAYA 4H54A 3QW0A 2NG1A 3ZDLA 2L9JA 4CDVA 3N24A 5DVWA 1EA8A 2CYDA 1LKXA 1A7DA 2LCHA 4ZLCA 3MLGA 5JS5A 5JLIA 1YYXA 1XZPA 2Y3BA 2HZ8A 4DRJB 3JYYA 1UG7A 3JSZA 4EBKA 2O9XA 4XWJA 4DBQA 1BBHA 1D0XA 1ZW3A 4JCHA 2WZLA 5T1DB 3RFYA 1YA9A 3ATPA 3EG9B 3HNJA 1NSGB 2WZGA 3EJNA 3SYNA 4EUKB 3GEIA 4U9DA 3AG3C 3M1CB 256BA 4PK4A 4IJJA 2G3KA 2GA0A 4Q7CA 5BQGA 5JT4A 5KYYA 5L0JA 1I4YA 2Q00A 3EFOB 2YRFA 3FOPA 4N6CA 3B0UX 2J7PD 1ORSC 2X0CA 2M4EA 5DQTA 3O6XA 4K1OA 4NC3A 2R7TA 3AG1C 1D0ZA 4HEAJ 4BJ1A 5L0GA 4FAPB 3QVYA 4MTOA 5DLJA 1OXBA 2OEXA 4XLNF 3NDBB 3GWNA 1NU7D 2CNWD 3V7OA 3DE9A 1L7CA 1Q0DA 4A2NB 3QZCA 4OD4A 3EH2A 1M2OA 1KNYA 2RSEB 3H2VA 4U5CE 2YEVA 4JE9A 3ZTMA 1LE2A 1YZCA 2JD3A 1WGWA 4XEKA 3W8HA 5A6BD 1VB5A 2XL6A 1SR2A 1CPQA 2DYRC 1M2VB 1UFBA 4LLCA 4NY3A 4FX5A 3V5YA 3WHNA 5CIVA 4MW8A 3RQFA 1DOVA 3CAXA 4HFKB 4I1MA 2R9RB 3C7JA 1HMDA 1VMAA 3GEEA 4MVUA 1U0BB 2PNOA 2X51A 3RIPA 2ZXOA 1AVOB 3B71A 3UGOA 3UMHA 4YT8A 3ASOC 3SXZA 2A0BA 2J46A 3FOOA 3GWLA 1LS1A 4CIPA 3QTHA 2XL8A 4KNVA 4OIOF 3S84A 1OKKA 1AUEA 3IHUA 3GEHA 5KYUB 3MBGA 1YVIA 1IZMA 5HV9A 1OCCC 2HKVA 4YT2A 5A6AA 2E87A 1A7VA 3EFOA 3L8JA 4BJ6C 4LACB 2EPKX 2R05A 1D1AA 5CI9A 1LIHA 5KYWB 1H9TA 4BJ5C 2R7RA 5E2QA 1APCA 5HSWA 1A0BA 3DJUB 2P7VA 1ZHTA 4P9FA 3KH2A 3SZRA 4MTGA 1T9KA 2HS5A 3ECSA 2ETSA 2ZXWC 2VASA 3I5QA 1BDJB 2QY9A 3GODA 3TQOA 1ORJA 3LNMB 1CGNA 3EHNA 4AL0A 3M15A 3MYFA 4OD5A 3TULA 1WN0A 3EZHA 3LJBA 5E3AA 4BEMJ 3SXYA 3B0PA 3T6BA 4E7ZA 4YT4A 1T01A 1PCXA 4NQFA 4Q5SF 1RXQA 3ZSUA 3RQGA 4KI2A 4GEHA 3PCVA 4BEJA 3PHF2 3KYJA 3TK0A 1E2XA 3MX3A 1B68A 5E3CA 4DRHB 3ZG1A 3PMRA 4H4KC 3AQCA 5BQHA 2GDCA 1TWCA 1LI7A 1W2WA 4EHPA 2PF4E 3EGDB 2QE9A 3AQBA 3IQ5A 4JIOA 4JZAA 2YWAA 1Z7Qc 3SEOA 3GM3A 3LLIA 1K04A 4HFFB 4U5FE 4U9EA 2QUPA 5KYUA 3UR3C 1QQ3A 3UGPA 3DKAA 1K05A 3NYMA 2VCAA 1FTSA 1MQVA 3C8GB 3W2VA 3K1HA 2QNLA 4JJGA 3FAJA 1TQGA 1NLXA 4MW3A 4XEFA 3U2LA 3I5PA 2H8AA 4E0IA 5B3SC 4ZLDA 4MTFA 3U8PA 3O39A 1ZZPA 3QW1A 5L0FA 4LDQA 1E84A 2PX0A 2YLGA 2WZFA 5FZTA 4DVZA 3UMKA 1O5HA 2IYLD 5D92A 5EK0A 1TWHA 1M6TA 4BJ6A 4CJOA 4BPMA 4OIQF 4QI2A 4HE8D 5COMA 1GQAA 4BJ5A 1E86A 2YL7A 2LFDA 2CNWA 2YKZA 3WAQA 3ZQYA 5L0CA 2V3CC 2IXOA 1O87A 4E18A 1FFTC 4Q4ZF 4XQ1A 3LEOA 3UNGC 2BC5A 2EPOA 2Y69C 2EIKC 2YVKA 3C63A 2IXNA 3T6GB 3U5SA 3FDQA 1VTMP 5A6BA 3GM1A 5B1BC 2YL3A 5F5FA 1QLEC 2AWYA 2LIGA 2YQYA 3H65A 3RH3A 3CQZA 1D1CA 2IM8A 4CIHA 2HJMA 4XPWA 4RBNA 1ZU4A 5B1AC 3TOMA 5B3IA 1S7ZA 3ZQVA 4C3BA 3LAYA 4J32B 3DMDA 4IGGA 4D4NA 2VCBA 1WATA 3LUTB 4MS2A 2VH3A 3EGXA 4YL1A 3R2PA 3U9JA 1ZHWA 3EGDA 2I15A 4ER9A 4IB4A 2XLOA 3IQTA 3N0TA 1GGQA 3W4YA 3ABKC 3MFNA 4CJGA 2NUPA 5EHHA 1E85A 2ZPAA 4X0RA 4XPXA 5TJ5E 1OQCA 4XTKA 3ASNC 4EBJA 1G4US 2OEVA 2UUIA 3U8VA 2WL8A 1MMNA 1M56C 2HV6A 1V4AA 2A68F 2XRHA 2AP3A 2CDQA 2OU6A 4JTAB 1H7IA 1I4ZA 4E0HA 3VF0A 1NBBA 1RCPA 2M64A 3TOLA 2KJGA 4EWCA 2J0XA 1Z23A 3K7DA 5FCLA 3FAPB 1BR4A 4CS9C 1K40A 3DAFA 4KC9A 3X1OA 4PFOA 2PFDA 1ZVZA 1O3UA 1D0YA 3DE8A 3BEHA 2XXAA 3FMSA 2WVQA 4MNDA 1QPUA 3LS0A 1MMGA
chains in the Genus database with same CATH topology
1RXQA 2RD9A 2NSGA 5COGA 5COMA 2OQMA 5CIVA 2NSFA 4N6CA 2QE9A 3DI5A 3GORA 2P1AA 2OU6A 3DKAA 5COFA 3CEXA 2YQYA 2QNLA 3QTHA 2F22A 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  2RD9 A;  2NSG A;  5COG A;  5COM A;  2OQM A;  5CIV A;  2NSF A;  4N6C A;  2QE9 A;  3DI5 A;  3GOR A;  2P1A A;  2OU6 A;  3DKA A;  5COF A;  3CEX A;  2YQY A;  2QNL A;  3QTH A;  2F22 A;  2HKV A; 
#chains in the Genus database with same CATH topology
 2EIM C;  5JRA A;  4NTF A;  1WAS A;  2B0J A;  1TWA A;  3HNI A;  2FGY A;  4MVZ A;  3S27 A;  3U2M A;  4F4B A;  1QVX A;  1GS9 A;  1SYQ A;  3DXJ F;  2GAQ A;  4YWQ A;  2NSG A;  4W8K A;  2G62 A;  5COG A;  4G7Z F;  2XLE A;  3N2Z B;  4MQ9 F;  4O6Y A;  4J30 B;  3RF3 A;  1U6H A;  4IRU A;  2B0H A;  3WOD F;  5L3Q A;  2Z15 A;  1EI7 A;  4CSA C;  2LSE A;  3SXK A;  2HMZ A;  5F5H A;  2XM0 A;  2YLI A;  2XL4 A;  3HJC A;  1H6G A;  2PP4 A;  2XS1 A;  3S29 A;  3AOU A;  2P61 A;  3QMK A;  1MMD A;  3WG7 C;  4U5D E;  4IAR A;  1VOM A;  1XWJ A;  4EIY A;  1ZHY A;  4O79 A;  3EG9 A;  3ZTZ A;  1MND A;  4GQH A;  3C8G D;  4AK9 A;  1BR2 A;  1Q0K A;  4JTD B;  2XSE A;  3S28 A;  3KL4 A;  4YK5 A;  2CCY A;  1SMY F;  1YAR O;  3JCU Q;  3SNH A;  4XLP F;  1H9G A;  3K33 A;  4RD9 A;  1F1M A;  3ABM C;  5T3W A;  5DS4 A;  1YDI A;  2YL0 A;  3JRM O;  4D4X A;  2OCC C;  5EGY A;  5A6K A;  5GPG B;  2LQG A;  3K1I C;  5L3V A;  3HNK A;  5L0D A;  2HSQ A;  1VLS A;  1JRA A;  1VYK A;  2NUT B;  2YLD A;  1HY5 A;  1YA7 O;  3FVY A;  3U9M A;  3EZI A;  3M4B A;  3AG2 C;  1WTY A;  1OR2 A;  5CI8 A;  3ZC4 A;  2P1A A;  2XLV A;  3KYI A;  5BQI A;  4FWV A;  2Q7R A;  1R4T A;  1SZI A;  2Y3G A;  4KBL A;  2P6V A;  3L8I A;  3X2Q C;  4BG0 A;  4AE4 B;  4AL1 A;  2EIN C;  2W45 A;  1LM3 B;  2C03 A;  3CZ6 A;  3T4R A;  4PJN A;  2Q9C A;  1RKE B;  2ICW G;  1OR3 A;  5L0H A;  2KC3 A;  2VC9 A;  1M2V A;  2J9U A;  4CS8 C;  1C03 A;  2W4B A;  3R7C A;  1SF8 A;  2HJ3 A;  3AG4 C;  2L6G A;  3H2U A;  3A9C A;  3LS1 A;  4PJJ A;  1CGM E;  2AU5 A;  1LE4 A;  2G3V A;  2MHR A;  1FMW A;  2Y39 A;  4NTA A;  4ULV A;  2IOQ A;  3C62 A;  5D91 A;  2UUH A;  3O10 A;  4JTC B;  4W8P A;  4WJ0 A;  1HE9 A;  4OIN F;  4C3D A;  3DI5 A;  2JX0 A;  1G8X A;  1Z5Z A;  4WAB A;  3ZIB A;  1MMA A;  4CSA A;  1C02 A;  1Y4C A;  2DYS C;  3GOR A;  4I1O B;  1A41 A;  3POV A;  1ZHZ A;  4U5E E;  4G7O F;  4XEV A;  5T3T A;  2I8B A;  1PD1 A;  4WGZ A;  3DWW A;  4CBE A;  1JMW A;  4PFP A;  1YAU O;  4Z9J A;  2LFF A;  4YJW A;  1HW2 A;  4EBB A;  3FXH A;  3HLZ A;  2KK1 A;  4MVR A;  5KYW A;  1KTM A;  1VYI A;  4LDR A;  2F22 A;  2XLW A;  1OW7 A;  3U3F A;  2YZS A;  3E9V A;  1HE1 A;  3Q7G A;  1Z3I X;  3Q7L A;  4AX2 A;  2R7S A;  2EIL C;  2VB6 A;  2L6F A;  3DM5 A;  4LLE A;  3NG1 A;  4Z9I A;  5JSL A;  2A69 F;  1YLM A;  4U5H A;  3ZVR A;  2W9Y A;  2EPN A;  1G5Z A;  4JRZ A;  4L6R A;  4JUR I;  2R7X A;  3U0C A;  2CGE A;  3K1I A;  4QDL A;  4ANJ A;  3ABL C;  2J9V A;  2EIJ C;  2ZXP A;  3IQC A;  4KNW A;  5KYY B;  4PJL A;  4ULW A;  5COF A;  1Z63 A;  1V55 C;  2CW0 F;  2OKU A;  4JC7 A;  2OG2 A;  3K66 A;  2EPM X;  2YL1 A;  5IY5 C;  4P6I C;  2MWQ A;  3JTL O;  2LP4 A;  3MYI A;  4DBR A;  3JSE O;  1E83 A;  3B9Q A;  2Q9B A;  1Y6D A;  2A1D D;  4K7B A;  4O6N A;  5A69 A;  1LPE A;  4MVS A;  3CSK A;  3RW0 A;  3VYW A;  2VCC A;  3NKE A;  1PV3 A;  1NU9 C;  4CS8 A;  4JJF A;  2A0U A;  2DI3 A;  3TJ6 A;  4O7G A;  3KPH A;  1G4W R;  3S9O A;  3V5X A;  2W4M A;  5KYN A;  2GWW A;  3NYL A;  3Q6N A;  1RJ9 B;  1NFN A;  2OJE D;  3GM2 A;  2FAP B;  4G0H A;  4MVM A;  5DQZ A;  1ZU5 A;  2Y3D A;  1OCZ C;  5DS6 A;  3C8G A;  1TKN A;  4G78 A;  4R32 A;  4CS7 A;  1M57 C;  3AGT A;  2OOC A;  5AGF A;  2R7W A;  4YN0 B;  2GFH A;  4C7O B;  2IXM A;  2QLA A;  1JOG A;  2DB4 A;  1T5O A;  1TR2 A;  4WGY A;  2WVO A;  3GAN A;  3NRH A;  3RKO F;  3RVY A;  2Q3T A;  3S0X A;  2ZD9 A;  4UDV A;  4O6M A;  3BRJ A;  2BE5 F;  5BUO A;  4YL0 A;  3S90 A;  3KMI A;  1I5N A;  3L0I A;  4GYT A;  4JCZ A;  1EKY A;  2XLH A;  4G7H F;  1RMV A;  3M79 A;  1VLT A;  3L1M A;  1V74 B;  2Q9A A;  2J0W A;  3M4C A;  5AC4 A;  1J8Y F;  1S05 A;  2AVK A;  2PX3 A;  2J9W A;  3C18 A;  4N6H A;  3HNL A;  4K0D A;  3W2W A;  3PDM P;  4PR9 A;  1WOL A;  1C17 M;  3V5Z A;  3NMK A;  2EPL X;  3B29 A;  4U5G A;  4FES A;  1FR0 A;  2OQM A;  2AWC A;  4NCQ A;  1V54 C;  2OJQ A;  2A6E F;  1MNE A;  3DM9 B;  3LNR A;  3EHM A;  3U3B A;  2R7O A;  3US6 A;  3G50 A;  1YJG A;  1T6U A;  1D1B A;  1OCR C;  1LI5 A;  3EPV A;  4LDK A;  1YYJ A;  4CX9 A;  2PBE A;  3SP1 A;  1A7E A;  1FAP B;  3TD7 A;  3OWT A;  1TWG A;  4JEA A;  3DD7 A;  3LES A;  2HUJ A;  2XLD A;  2LK4 A;  2H7V C;  1OW8 A;  1FFH A;  1R5I D;  2L7A A;  3A11 A;  5F28 E;  5AC5 A;  1RJ9 A;  3I4U A;  2J8W A;  3C8Z A;  3NMI A;  5L0I A;  2RD9 A;  1NG1 A;  2H7B A;  4XPY A;  4LER A;  4JW1 A;  2R7Q A;  1J8M F;  2DGJ A;  2JPU A;  3G4Z A;  4C7O A;  3JYH A;  5KYX A;  3NYJ A;  1BR1 A;  4DXW A;  2A6H F;  2HV7 A;  4PAC A;  1T6I A;  1LVK A;  1YZA A;  2KYH A;  1BZ4 A;  4B6I A;  2ZXR A;  3F46 A;  2D4U A;  3RVZ A;  1IW7 F;  3TJ5 A;  3CEX A;  3NKD A;  5E33 A;  3T6J A;  3K6B A;  4E7S A;  2FFH A;  1JAF A;  3DZA A;  4OIR F;  3RQE A;  4EKW A;  3QVZ A;  1WWP A;  1CGO A;  4CS9 A;  1DOW A;  4IWB A;  3LEV A;  5JP7 A;  4JKV A;  4DOZ A;  1VK5 A;  3DAG A;  1HMO A;  1JPN A;  1U89 A;  5A6J A;  1GM5 A;  3ITF A;  2WB7 A;  3UMI A;  2KQ9 A;  3HKK A;  1ORY A;  5JUA A;  5K0I A;  3B0V C;  1ZW2 A;  3EH1 A;  4PJM A;  3NMJ A;  1OW6 A;  4RDA A;  4CDY A;  3OA1 A;  2R7U A;  3IEE A;  2NSF A;  3ZWI A;  2D5R B;  1ZYR F;  4YL3 A;  3DJN B;  4DJ9 A;  2R03 A;  4I3M A;  3J06 A;  2KSF A;  3RYL A;  4QI0 A;  1ST6 A;  1QSP A;  3VM6 A;  4MVQ A;  4A4A A;  1QZX A;  1NZE A;  3VRC A;  5DS5 A;  4I44 A;  2MYS A;  2R02 A;  1JR8 A;  4BJT A;  2Y3H A;  5KYX B;  2KNH A;  2ASR A;  3OEO A;  4DRI B;  1CPR A;  1NFO A;  1L3P A;  1RKC A;  2L81 A;  2LD6 A;  2C04 A;  4IAO A;  4N06 A;  1HW1 A;  1OXK A;  2KW3 C;  2QTV A;  4M63 A;  3KKB A;  3JT1 A;  2NUT A;  1Q0G A;  4YT5 A;  1PD0 A;  4CDA A;  3EQL F;  1Q0F A;  1OKK D;  5JVE A;  4E17 A;  2BL2 A;  2YHS A;  1KU2 A;  3AGU A;  3EGX B;  4JVS A;  1TFO B;  3JRT A;  3LLK A;  3O55 A;  3JZ0 A;  2V26 A;  2XM4 A;  4MVO A;  4AE4 A;  2HMQ A;  2NUP B;  2J9B A;  3IPM O;  3L34 A;  2HFI A;  1RKE A;  1EQ1 A;  1TFK B;  2TMV P;  3FHD A;  2IBF A;  2R7V A;  1Q0M A;  2XLM A;  1T6Q A;  2Q4F A;  1LS4 A;  1XZQ A;  3G4X A;  2R25 A;  3Q6M A;  3SXM A;  3W8I A;  2J7P A;  4U5B E;  4C3E A;  3AJM A;  4OIP F;  1Z6A A;  2KGO A;  3F47 A;  4DVY P;  2P0N A;  4Z9H A;  4N4W A;  3T9O A;  1FNT c;  3E70 C;  4J7Y A;  4NTB A;  2IXP A;  2WVN A;  2XS8 A;  4JEB A;  1JPJ A;  3HTK C;  4P9T A;  2NPU A;  1OCO C;  3IQ6 A;  2XXA B;  1N1C A;  4IAQ A;  4J7T A;  4ONS A;  1AEP A;  1ZHX A;  1FMV A;  2L6H A;  2HSB A;  2J45 A;  1QKR A;  2H7O A;  3VAY A;  4H54 A;  3QW0 A;  2NG1 A;  3ZDL A;  2L9J A;  4CDV A;  3N24 A;  5DVW A;  1EA8 A;  2CYD A;  1LKX A;  1A7D A;  2LCH A;  4ZLC A;  3MLG A;  5JS5 A;  5JLI A;  1YYX A;  1XZP A;  2Y3B A;  2HZ8 A;  4DRJ B;  3JYY A;  1UG7 A;  3JSZ A;  4EBK A;  2O9X A;  4XWJ A;  4DBQ A;  1BBH A;  1D0X A;  1ZW3 A;  4JCH A;  2WZL A;  5T1D B;  3RFY A;  1YA9 A;  3ATP A;  3EG9 B;  3HNJ A;  1NSG B;  2WZG A;  3EJN A;  3SYN A;  4EUK B;  3GEI A;  4U9D A;  3AG3 C;  3M1C B;  256B A;  4PK4 A;  4IJJ A;  2G3K A;  2GA0 A;  4Q7C A;  5BQG A;  5JT4 A;  5KYY A;  5L0J A;  1I4Y A;  2Q00 A;  3EFO B;  2YRF A;  3FOP A;  4N6C A;  3B0U X;  2J7P D;  1ORS C;  2X0C A;  2M4E A;  5DQT A;  3O6X A;  4K1O A;  4NC3 A;  2R7T A;  3AG1 C;  1D0Z A;  4HEA J;  4BJ1 A;  5L0G A;  4FAP B;  3QVY A;  4MTO A;  5DLJ A;  1OXB A;  2OEX A;  4XLN F;  3NDB B;  3GWN A;  1NU7 D;  2CNW D;  3V7O A;  3DE9 A;  1L7C A;  1Q0D A;  4A2N B;  3QZC A;  4OD4 A;  3EH2 A;  1M2O A;  1KNY A;  2RSE B;  3H2V A;  4U5C E;  2YEV A;  4JE9 A;  3ZTM A;  1LE2 A;  1YZC A;  2JD3 A;  1WGW A;  4XEK A;  3W8H A;  5A6B D;  1VB5 A;  2XL6 A;  1SR2 A;  1CPQ A;  2DYR C;  1M2V B;  1UFB A;  4LLC A;  4NY3 A;  4FX5 A;  3V5Y A;  3WHN A;  5CIV A;  4MW8 A;  3RQF A;  1DOV A;  3CAX A;  4HFK B;  4I1M A;  2R9R B;  3C7J A;  1HMD A;  1VMA A;  3GEE A;  4MVU A;  1U0B B;  2PNO A;  2X51 A;  3RIP A;  2ZXO A;  1AVO B;  3B71 A;  3UGO A;  3UMH A;  4YT8 A;  3ASO C;  3SXZ A;  2A0B A;  2J46 A;  3FOO A;  3GWL A;  1LS1 A;  4CIP A;  3QTH A;  2XL8 A;  4KNV A;  4OIO F;  3S84 A;  1OKK A;  1AUE A;  3IHU A;  3GEH A;  5KYU B;  3MBG A;  1YVI A;  1IZM A;  5HV9 A;  1OCC C;  2HKV A;  4YT2 A;  5A6A A;  2E87 A;  1A7V A;  3EFO A;  3L8J A;  4BJ6 C;  4LAC B;  2EPK X;  2R05 A;  1D1A A;  5CI9 A;  1LIH A;  5KYW B;  1H9T A;  4BJ5 C;  2R7R A;  5E2Q A;  1APC A;  5HSW A;  1A0B A;  3DJU B;  2P7V A;  1ZHT A;  4P9F A;  3KH2 A;  3SZR A;  4MTG A;  1T9K A;  2HS5 A;  3ECS A;  2ETS A;  2ZXW C;  2VAS A;  3I5Q A;  1BDJ B;  2QY9 A;  3GOD A;  3TQO A;  1ORJ A;  3LNM B;  1CGN A;  3EHN A;  4AL0 A;  3M15 A;  3MYF A;  4OD5 A;  3TUL A;  1WN0 A;  3EZH A;  3LJB A;  5E3A A;  4BEM J;  3SXY A;  3B0P A;  3T6B A;  4E7Z A;  4YT4 A;  1T01 A;  1PCX A;  4NQF A;  4Q5S F;  1RXQ A;  3ZSU A;  3RQG A;  4KI2 A;  4GEH A;  3PCV A;  4BEJ A;  3PHF 2;  3KYJ A;  3TK0 A;  1E2X A;  3MX3 A;  1B68 A;  5E3C A;  4DRH B;  3ZG1 A;  3PMR A;  4H4K C;  3AQC A;  5BQH A;  2GDC A;  1TWC A;  1LI7 A;  1W2W A;  4EHP A;  2PF4 E;  3EGD B;  2QE9 A;  3AQB A;  3IQ5 A;  4JIO A;  4JZA A;  2YWA A;  1Z7Q c;  3SEO A;  3GM3 A;  3LLI A;  1K04 A;  4HFF B;  4U5F E;  4U9E A;  2QUP A;  5KYU A;  3UR3 C;  1QQ3 A;  3UGP A;  3DKA A;  1K05 A;  3NYM A;  2VCA A;  1FTS A;  1MQV A;  3C8G B;  3W2V A;  3K1H A;  2QNL A;  4JJG A;  3FAJ A;  1TQG A;  1NLX A;  4MW3 A;  4XEF A;  3U2L A;  3I5P A;  2H8A A;  4E0I A;  5B3S C;  4ZLD A;  4MTF A;  3U8P A;  3O39 A;  1ZZP A;  3QW1 A;  5L0F A;  4LDQ A;  1E84 A;  2PX0 A;  2YLG A;  2WZF A;  5FZT A;  4DVZ A;  3UMK A;  1O5H A;  2IYL D;  5D92 A;  5EK0 A;  1TWH A;  1M6T A;  4BJ6 A;  4CJO A;  4BPM A;  4OIQ F;  4QI2 A;  4HE8 D;  5COM A;  1GQA A;  4BJ5 A;  1E86 A;  2YL7 A;  2LFD A;  2CNW A;  2YKZ A;  3WAQ A;  3ZQY A;  5L0C A;  2V3C C;  2IXO A;  1O87 A;  4E18 A;  1FFT C;  4Q4Z F;  4XQ1 A;  3LEO A;  3UNG C;  2BC5 A;  2EPO A;  2Y69 C;  2EIK C;  2YVK A;  3C63 A;  2IXN A;  3T6G B;  3U5S A;  3FDQ A;  1VTM P;  5A6B A;  3GM1 A;  5B1B C;  2YL3 A;  5F5F A;  1QLE C;  2AWY A;  2LIG A;  2YQY A;  3H65 A;  3RH3 A;  3CQZ A;  1D1C A;  2IM8 A;  4CIH A;  2HJM A;  4XPW A;  4RBN A;  1ZU4 A;  5B1A C;  3TOM A;  5B3I A;  1S7Z A;  3ZQV A;  4C3B A;  3LAY A;  4J32 B;  3DMD A;  4IGG A;  4D4N A;  2VCB A;  1WAT A;  3LUT B;  4MS2 A;  2VH3 A;  3EGX A;  4YL1 A;  3R2P A;  3U9J A;  1ZHW A;  3EGD A;  2I15 A;  4ER9 A;  4IB4 A;  2XLO A;  3IQT A;  3N0T A;  1GGQ A;  3W4Y A;  3ABK C;  3MFN A;  4CJG A;  2NUP A;  5EHH A;  1E85 A;  2ZPA A;  4X0R A;  4XPX A;  5TJ5 E;  1OQC A;  4XTK A;  3ASN C;  4EBJ A;  1G4U S;  2OEV A;  2UUI A;  3U8V A;  2WL8 A;  1MMN A;  1M56 C;  2HV6 A;  1V4A A;  2A68 F;  2XRH A;  2AP3 A;  2CDQ A;  2OU6 A;  4JTA B;  1H7I A;  1I4Z A;  4E0H A;  3VF0 A;  1NBB A;  1RCP A;  2M64 A;  3TOL A;  2KJG A;  4EWC A;  2J0X A;  1Z23 A;  3K7D A;  5FCL A;  3FAP B;  1BR4 A;  4CS9 C;  1K40 A;  3DAF A;  4KC9 A;  3X1O A;  4PFO A;  2PFD A;  1ZVZ A;  1O3U A;  1D0Y A;  3DE8 A;  3BEH A;  2XXA A;  3FMS A;  2WVQ A;  4MND A;  1QPU A;  3LS0 A;  1MMG A; 
#chains in the Genus database with same CATH homology
 1RXQ A;  2RD9 A;  2NSG A;  5COG A;  5COM A;  2OQM A;  5CIV A;  2NSF A;  4N6C A;  2QE9 A;  3DI5 A;  3GOR A;  2P1A A;  2OU6 A;  3DKA A;  5COF A;  3CEX A;  2YQY A;  2QNL A;  3QTH A;  2F22 A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...