2JPUA

Solution structure of nesg target ssr10, orf c02003 protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
publication title Solution structure of NESG target SsR10, Orf c02003 protein
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jpuA00
3AJMA 4XEFA 2Q00A 1OW6A 3L8IA 2PBEA 1V4AA 3C8GB 2HSBA 4XEVA 1PV3A 1KNYA 1QVXA 3B71A 3TULA 3JZ0A 3O10A 1O3UA 3BRJA 3JYYA 3S9OA 4EBKA 4NQFA 3RQFA 1JOGA 3GM3A 2JPUA 2L6GA 1K40A 3L8JA 1K04A 1OW7A 3C8GA 2L6HA 3GM2A 3C18A 1WWPA 3RQEA 3C8GD 5F28E 4EBJA 3U3FA 4R32A 1K05A 1KTMA 3U0CA 1UFBA 2JX0A 1OW8A 2L6FA 1WTYA 2KK1A 1WOLA 3MFNA 1ZZPA 2LK4A 4XEKA 3K7DA 3RQGA 3GM1A 2YWAA
chains in the Genus database with same CATH superfamily
2LFDA 3NMKA 3UNGC 4D4XA 2OCCC 2BL2A 2NSFA 2RD9A 3C8GB 4E0IA 1VLSA 1NG1A 4WABA 4UDVA 4P9FA 3ABLC 3DAFA 2CW0F 4I44A 4LLEA 4MW8A 2H7BA 1VLTA 1CPQA 2GAQA 5KYXB 1XZQA 4N06A 3GEEA 1JOGA 2KQ9A 5COMA 1TKNA 3HKKA 3PHF2 4O6NA 4Q5SF 4P9TA 5B3SC 3AQCA 3TOMA 3SZRA 2CNWA 1V55C 2ZXWC 4CS9C 4J30B 3N24A 4EBJA 1ZU5A 3SXKA 2HUJA 2IXOA 2Q9AA 2Y39A 1BDJB 1KTMA 1FR0A 2NG1A 3IQ5A 2YLIA 3ZTZA 1HE1A 2HMQA 1ZHTA 2EPLX 2PP4A 2XM0A 3GORA 2J9BA 4IAQA 4DVYP 4U5HA 1HW1A 3A11A 4N6CA 1T6UA 3IQCA 1YYJA 4H54A 3JRMO 3LJBA 3RW0A 5KYWB 3Q7LA 4NY3A 1I4YA 2OG2A 4JZAA 4L6RA 3JCUQ 2KW3C 2EINC 1OR3A 4EHPA 4JJGA 4MVOA 3ZG1A 4OD5A 3C62A 3M79A 1M6TA 3RH3A 1AVOB 4DRJB 2GDCA 1D1BA 5CI9A 1VB5A 2J9WA 4NCQA 4ER9A 1DOWA 2J45A 3MX3A 3OA1A 3NDBB 1ZVZA 3DM5A 1CPRA 2OJED 1M2OA 5COFA 4C7OA 5F5FA 1V54C 1AEPA 4JEBA 2D4UA 1UFBA 1T9KA 2FFHA 2FAPB 4JKVA 3R7CA 4N4WA 3JRTA 4U5GA 1WTYA 2CDQA 2WZLA 4OIQF 2LD6A 5L0HA 3LNRA 4B6IA 1IW7F 3OWTA 3QZCA 1VK5A 4HFKB 5DLJA 2PNOA 2J9UA 4EBKA 2KNHA 3LS1A 5EHHA 1ZHWA 2C03A 3TD7A 4FAPB 5DS5A 5KYYA 2Y3DA 1V4AA 1QQ3A 1BR2A 4H4KC 1L3PA 3FVYA 1G8XA 3N0TA 3W2WA 3BEHA 1BBHA 2FGYA 1M2VB 2Q3TA 2UUIA 3I5PA 3IQTA 4OIRF 1SR2A 4JRZA 2Y3GA 4DJ9A 1FMVA 1ORJA 2D5RB 3ABKC 1HMDA 4I1MA 1NU9C 1VYKA 2J7PA 3C8GA 3DJNB 4IAOA 4MS2A 5D91A 3PCVA 3WHNA 3AG3C 1F1MA 1KU2A 1JAFA 5KYXA 4O79A 1G4WR 3X2QC 5B3IA 4JE9A 3EH2A 4YL0A 1D0ZA 4IWBA 4W8PA 2GA0A 5A6KA 2L7AA 3X1OA 5A69A 1OR2A 4J7TA 2WVOA 2R02A 5BQHA 3QMKA 3C63A 4JC7A 4WGYA 4Z9HA 3AGUA 4AX2A 5HSWA 1LPEA 1JMWA 3EGXB 1H6GA 2ZXRA 5COGA 2J9VA 1MMNA 2J0XA 3B0VC 3NMIA 4EIYA 3JZ0A 1TWHA 2XLEA 2OQMA 2L9JA 2YL3A 4GQHA 3MLGA 3TJ5A 2W4MA 1ZHYA 4BPMA 2L6GA 5T3TA 5A6BA 4ZLDA 1EI7A 5IY5C 2R05A 5D92A 3M1CB 4YK5A 2R7TA 2P6VA 2XLHA 4WJ0A 4PJNA 1YAUO 3F47A 3L34A 3EFOB 3ASOC 4XPYA 5BQGA 3WODF 4CDAA 2YEVA 3H2VA 4CS8C 1VOMA 4G78A 3ITFA 5L0CA 3AG2C 1OXBA 4OD4A 3GODA 3DD7A 1LKXA 3JYHA 4GYTA 5E3CA 3FAJA 2VC9A 2XS8A 3Q6MA 2VCBA 2HV7A 4JCHA 1EQ1A 3DKAA 4OIOF 3L0IA 2XLDA 4PK4A 3A9CA 1OCZC 5E33A 1YJGA 4BG0A 3U8PA 1J8YF 1Q0MA 4BJ6C 4F4BA 4U5BE 1A7VA 3UR3C 3DE8A 3M4BA 5CIVA 3MYIA 2XS1A 2XSEA 3QVZA 4JVSA 3EGDB 2R7OA 3EHMA 2P61A 4OINF 256BA 1FAPB 1VMAA 1O5HA 1K05A 3K1IA 2V3CC 1FTSA 1NSGB 2DGJA 2NPUA 4HEAJ 1OW8A 2AWCA 1Z6AA 2KK1A 4CSAC 1G4US 1T01A 1TWCA 1A41A 2HJ3A 2XL8A 5CI8A 3IPMO 4XPWA 2M4EA 2LQGA 1D1CA 4U5CE 1LVKA 2HV6A 1MMAA 2F22A 3EPVA 1LS1A 3K33A 2R03A 4E18A 1RMVA 2AP3A 2P0NA 3T6BA 1C02A 1OXKA 2OOCA 3UMKA 2HZ8A 3UMHA 4BEMJ 5DS6A 1TWAA 1MNDA 2O9XA 3EH1A 5AGFA 5JP7A 3NKDA 1QZXA 3B0UX 4KI2A 2CCYA 5KYNA 2Q9CA 3HNIA 1NFOA 3S90A 2OKUA 3DAGA 4LERA 1WASA 1GQAA 3I5QA 4J32B 2ZD9A 4G7HF 4KC9A 3FXHA 5E3AA 1GGQA 2YVKA 4PJJA 2XLVA 1G5ZA 4ANJA 4BJ1A 2IOQA 3GM1A 3LS0A 5FCLA 3U0CA 4FWVA 3AJMA 2VH3A 3V5ZA 2M64A 1M57C 4JTDB 3DMDA 1KNYA 4JTCB 2G3KA 4Z9JA 5E2QA 3DM9B 1GS9A 3HNJA 4MQ9F 4DRHB 2XM4A 1LE4A 1D0YA 2DB4A 3S9OA 1IZMA 3O6XA 5JS5A 3VM6A 2BE5F 3AQBA 1A7EA 1FFTC 2XLOA 4AL0A 1RKEA 3U3FA 2EILC 2CNWD 4HE8D 4R32A 4CS9A 1TFKB 1LS4A 4YT8A 3U5SA 2G62A 1ZU4A 3RVZA 4MVRA 1CGNA 1E84A 3FHDA 3US6A 1E86A 1I5NA 3EGDA 1EKYA 3SXZA 1RCPA 4NTBA 4PJMA 5L0DA 4J7YA 5TJ5E 3K7DA 3S84A 1TFOB 2PX3A 2YWAA 2QNLA 3POVA 1MQVA 1OKKA 1WGWA 2OJQA 4YN0B 1Z7Qc 3JSZA 4CX9A 3T6JA 4AE4B 2YQYA 2NSGA 3SP1A 3UGPA 2YRFA 3U3BA 1ORYA 4YT5A 5T3WA 4BJ5C 2YLDA 4E7ZA 3GM3A 3SYNA 2A6EF 2HFIA 2ZXPA 3M4CA 4QI2A 4DRIB 1LIHA 4LDRA 4MTFA 1H7IA 1SYQA 2A68F 1C17M 3ZTMA 4CDVA 1JPNA 3VAYA 4CIHA 3K6BA 1HW2A 4NTFA 2XL4A 2P1AA 3H2UA 1APCA 4MVSA 1JR8A 4U5FE 4IJJA 1I4ZA 2IXMA 1AUEA 3HTKC 3AGTA 4QDLA 1LM3B 1NU7D 2C04A 3L8IA 1QLEC 5AC4A 3N2ZB 2X51A 5DVWA 4YJWA 4U5DE 3GWLA 2W9YA 3EG9B 3NMJA 2Q9BA 3RIPA 3JYYA 2ICWG 3S27A 4Q4ZF 1FMWA 1TR2A 2KC3A 4NQFA 3RQFA 5JVEA 3KL4A 3V5XA 5EK0A 1ZW2A 1RJ9B 5KYWA 3LESA 3E9VA 1E2XA 2J7PD 3C8GD 3KH2A 4DBQA 1QPUA 1L7CA 1OCCC 3F46A 4KNWA 4YL1A 2HSQA 2IBFA 4A2NB 4G7ZF 1Z3IX 3FOOA 3C7JA 2L6FA 1MMGA 3H65A 1WOLA 4BEJA 1UG7A 1CGME 1H9TA 3DJUB 1OCOC 2QE9A 1ZZPA 2AU5A 4XEKA 4YT4A 1ORSC 2CYDA 2YL7A 2LSEA 2R7WA 2TMVP 3W2VA 1FNTc 3CQZA 2Q00A 4CIPA 2PBEA 4LDQA 1NBBA 4DXWA 2HSBA 3HNKA 4E0HA 2R7SA 2RSEB 3VRCA 2AWYA 1XWJA 5BQIA 1VTMP 1TWGA 2R9RB 2ETSA 2HS5A 1E83A 2I15A 2YLGA 3SXMA 2DI3A 1OW7A 3TQOA 5A6BD 4AE4A 2UUHA 3LUTB 2XLWA 3M15A 3QW0A 4JURI 4MNDA 5F28E 5KYUB 3OEOA 2Q4FA 1PD1A 3KPHA 5AC5A 1D1AA 1M2VA 3JT1A 2YZSA 3KYIA 1FFHA 2Y3HA 3DE9A 4CS8A 3EJNA 2LIGA 3ZDLA 2EPOA 2LK4A 3UGOA 1BZ4A 2OEVA 1S05A 4K0DA 2DYSC 1YDIA 5DQZA 1Q0DA 4IRUA 5EGYA 3R2PA 1T6IA 1WATA 3EQLF 3NYMA 4I1OB 4DBRA 2L81A 3C8ZA 3T9OA 1NLXA 2PFDA 2KGOA 4MVMA 3T6GB 3BRJA 3CEXA 3QW1A 4EWCA 4K7BA 3W8IA 4BJ6A 4CS7A 2R7RA 1SF8A 4E17A 5BUOA 3LLIA 2EPKX 3EGXA 3C18A 3G4XA 3KMIA 3NKEA 4IGGA 2VCCA 1U0BB 3V5YA 3ZQYA 5L0FA 2WB7A 2MYSA 3EG9A 3QTHA 4EUKB 3AG4C 3EHNA 1MNEA 4MTGA 3Q7GA 1T6QA 2H7VC 2OU6A 3WG7C 1TQGA 2WZGA 3WAQA 1H9GA 4CSAA 2R7XA 4U5EE 4ULWA 1OQCA 1T5OA 1W2WA 2V26A 3RQGA 4D4NA 1BR4A 2R7QA 4CDYA 4MVUA 4XEFA 2X0CA 2ZPAA 3HNLA 4FESA 5K0IA 3EFOA 3B0PA 2B0JA 3FMSA 4XPXA 4MVZA 3VF0A 2A69F 4C3DA 5L0GA 1QVXA 2WVNA 3RFYA 1YZAA 3ZSUA 1RXQA 4O6MA 5DQTA 4DOZA 4A4AA 4JCZA 3PMRA 3AG1C 1LI5A 2WVQA 2H8AA 2VASA 2Y69C 1R4TA 3IEEA 1ZHXA 1K04A 3L1MA 2GFHA 2MHRA 4ONSA 3W4YA 2J0WA 3TK0A 4P6IC 5DS4A 2QLAA 1O87A 1DOVA 2XRHA 3IQ6A 2HKVA 4XLNF 5A6JA 2WZFA 4KBLA 1YZCA 2KSFA 1JPJA 4YL3A 5L3QA 1V74B 3MFNA 1NFNA 4PJLA 4CBEA 5KYUA 2OEXA 2GWWA 3MYFA 4U9DA 1D0XA 3DZAA 4NC3A 4EBBA 2IXNA 2QY9A 1OCRC 1N1CA 1PV3A 1YVIA 1MMDA 2MWQA 3TULA 3T4RA 2NUTB 3CZ6A 2Q7RA 4YWQA 4JEAA 2A0BA 1HMOA 4LDKA 1B68A 4E7SA 3IHUA 5B1BC 5A6AA 3U9MA 4IB4A 2AVKA 4C3BA 1K40A 3B9QA 3RQEA 3SXYA 2H7OA 2W4BA 3GM2A 3LLKA 4JTAB 1A0BA 3ASNC 2QTVA 3NG1A 4ULVA 4LACB 2XXAB 1E85A 2I8BA 4RD9A 2IXPA 2R7VA 2LCHA 2NUPB 3S29A 3ZC4A 4K1OA 4N6HA 1Q0FA 3O55A 5JUAA 3S0XA 2YL0A 1QSPA 4LLCA 1XZPA 3EZHA 1YARO 5L3VA 2YL1A 1PD0A 1Y4CA 2HJMA 3HJCA 1YA9A 3GANA 1OW6A 1Z63A 2IM8A 2E87A 1OKKD 3KYJA 2P7VA 2DYRC 2QUPA 2A0UA 1VYIA 1RKCA 3ZVRA 4FX5A 4PR9A 4RDAA 4X0RA 1ST6A 2J46A 4DVZA 4BJTA 1C03A 4OIPF 5HV9A 1JRAA 3E70C 3GEHA 2VCAA 3L8JA 4BJ5A 1HE9A 2JD3A 4CJGA 2ZXOA 1ZYRF 2ASRA 3ATPA 3K1HA 2LP4A 4PFPA 4XQ1A 5GPGB 4JW1A 3RYLA 2A6HF 2KYHA 3MBGA 4NTAA 2R7UA 3FDQA 4M63A 2JX0A 3DWWA 4G0HA 2EPMX 2WL8A 3HLZA 2Z15A 1NZEA 1QKRA 3LAYA 4YT2A 3RF3A 3LEOA 3PDMP 1PCXA 4PACA 4C3EA 5B1AC 4KNVA 1HY5A 1SMYF 2Y3BA 2YHSA 3NYLA 4JJFA 2B0HA 4XWJA 3CSKA 5T1DB 1YYXA 5JT4A 3FAPB 4O7GA 4XEVA 2EIKC 3NYJA 4QI0A 4HFFB 3V7OA 4ZLCA 3AOUA 3G4ZA 1LE2A 5F5HA 3O10A 1O3UA 4W8KA 3GWNA 3ZQVA 2XL6A 4AK9A 2JPUA 2VB6A 2J8WA 4MVQA 2L6HA 3U2MA 3K1IC 1WWPA 3RKOF 3U9JA 1EA8A 3UMIA 2XLMA 3U2LA 1YLMA 3LNMB 4AL1A 1U89A 4CJOA 3G50A 2NUTA 1R5ID 1Z5ZA 1Y6DA 3RVYA 5JRAA 1U6HA 2G3VA 4O6YA 1LI7A 3DI5A 4PFOA 5JLIA 3VYWA 1BR1A 3SEOA 1ZW3A 4Z9IA 3U8VA 1Q0GA 4Q7CA 2XXAA 2A1DD 3EZIA 2EIMC 3CAXA 2NUPA 4MTOA 3O39A 3QVYA 3TOLA 3DXJF 3K66A 1A7DA 3JSEO 5L0JA 3GEIA 4U9EA 1RKEB 2BC5A 4XLPF 3B71A 2IYLD 1YA7O 3B29A 3ZIBA 3I4UA 3ABMC 2PX0A 4I3MA 3LEVA 4C7OB 3Q6NA 4GEHA 1WN0A 2YKZA 3J06A 2R25A 4MW3A 3W8HA 2W45A 3ZWIA 2EPNA 3NRHA 3S28A 3ECSA 5FZTA 4IARA 1Z23A 4WGZA 5JSLA 1J8MF 3FOPA 4RBNA 2LFFA 3SNHA 1ZHZA 1S7ZA 2HMZA 3JTLO 3KKBA 4JIOA 4XTKA 1M56C 2CGEA 5KYYB 3TJ6A 1Q0KA 2EIJC 2PF4E 1CGOA 4G7OF 1RJ9A 4EKWA 1GM5A 5L0IA 1SZIA 2KJGA
chains in the Genus database with same CATH topology
3AJMA 4XEFA 2Q00A 1OW6A 3L8IA 2PBEA 1V4AA 3C8GB 2HSBA 4XEVA 1PV3A 1KNYA 1QVXA 3B71A 3TULA 3JZ0A 3O10A 1O3UA 3BRJA 3JYYA 3S9OA 4EBKA 4NQFA 3RQFA 1JOGA 3GM3A 2JPUA 2L6GA 1K40A 3L8JA 1K04A 1OW7A 3C8GA 2L6HA 3GM2A 3C18A 1WWPA 3RQEA 3C8GD 5F28E 4EBJA 3U3FA 4R32A 1K05A 1KTMA 3U0CA 1UFBA 2JX0A 1OW8A 2L6FA 1WTYA 2KK1A 1WOLA 3MFNA 1ZZPA 2LK4A 4XEKA 3K7DA 3RQGA 3GM1A 2YWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  4XEF A;  2Q00 A;  1OW6 A;  3L8I A;  2PBE A;  1V4A A;  3C8G B;  2HSB A;  4XEV A;  1PV3 A;  1KNY A;  1QVX A;  3B71 A;  3TUL A;  3JZ0 A;  3O10 A;  1O3U A;  3BRJ A;  3JYY A;  3S9O A;  4EBK A;  4NQF A;  3RQF A;  1JOG A;  3GM3 A;  2JPU A;  2L6G A;  1K40 A;  3L8J A;  1K04 A;  1OW7 A;  3C8G A;  2L6H A;  3GM2 A;  3C18 A;  1WWP A;  3RQE A;  3C8G D;  5F28 E;  4EBJ A;  3U3F A;  4R32 A;  1K05 A;  1KTM A;  3U0C A;  1UFB A;  2JX0 A;  1OW8 A;  2L6F A;  1WTY A;  2KK1 A;  1WOL A;  3MFN A;  1ZZP A;  2LK4 A;  4XEK A;  3K7D A;  3RQG A;  3GM1 A;  2YWA A; 
#chains in the Genus database with same CATH topology
 2LFD A;  3NMK A;  3UNG C;  4D4X A;  2OCC C;  2BL2 A;  2NSF A;  2RD9 A;  3C8G B;  4E0I A;  1VLS A;  1NG1 A;  4WAB A;  4UDV A;  4P9F A;  3ABL C;  3DAF A;  2CW0 F;  4I44 A;  4LLE A;  4MW8 A;  2H7B A;  1VLT A;  1CPQ A;  2GAQ A;  5KYX B;  1XZQ A;  4N06 A;  3GEE A;  1JOG A;  2KQ9 A;  5COM A;  1TKN A;  3HKK A;  3PHF 2;  4O6N A;  4Q5S F;  4P9T A;  5B3S C;  3AQC A;  3TOM A;  3SZR A;  2CNW A;  1V55 C;  2ZXW C;  4CS9 C;  4J30 B;  3N24 A;  4EBJ A;  1ZU5 A;  3SXK A;  2HUJ A;  2IXO A;  2Q9A A;  2Y39 A;  1BDJ B;  1KTM A;  1FR0 A;  2NG1 A;  3IQ5 A;  2YLI A;  3ZTZ A;  1HE1 A;  2HMQ A;  1ZHT A;  2EPL X;  2PP4 A;  2XM0 A;  3GOR A;  2J9B A;  4IAQ A;  4DVY P;  4U5H A;  1HW1 A;  3A11 A;  4N6C A;  1T6U A;  3IQC A;  1YYJ A;  4H54 A;  3JRM O;  3LJB A;  3RW0 A;  5KYW B;  3Q7L A;  4NY3 A;  1I4Y A;  2OG2 A;  4JZA A;  4L6R A;  3JCU Q;  2KW3 C;  2EIN C;  1OR3 A;  4EHP A;  4JJG A;  4MVO A;  3ZG1 A;  4OD5 A;  3C62 A;  3M79 A;  1M6T A;  3RH3 A;  1AVO B;  4DRJ B;  2GDC A;  1D1B A;  5CI9 A;  1VB5 A;  2J9W A;  4NCQ A;  4ER9 A;  1DOW A;  2J45 A;  3MX3 A;  3OA1 A;  3NDB B;  1ZVZ A;  3DM5 A;  1CPR A;  2OJE D;  1M2O A;  5COF A;  4C7O A;  5F5F A;  1V54 C;  1AEP A;  4JEB A;  2D4U A;  1UFB A;  1T9K A;  2FFH A;  2FAP B;  4JKV A;  3R7C A;  4N4W A;  3JRT A;  4U5G A;  1WTY A;  2CDQ A;  2WZL A;  4OIQ F;  2LD6 A;  5L0H A;  3LNR A;  4B6I A;  1IW7 F;  3OWT A;  3QZC A;  1VK5 A;  4HFK B;  5DLJ A;  2PNO A;  2J9U A;  4EBK A;  2KNH A;  3LS1 A;  5EHH A;  1ZHW A;  2C03 A;  3TD7 A;  4FAP B;  5DS5 A;  5KYY A;  2Y3D A;  1V4A A;  1QQ3 A;  1BR2 A;  4H4K C;  1L3P A;  3FVY A;  1G8X A;  3N0T A;  3W2W A;  3BEH A;  1BBH A;  2FGY A;  1M2V B;  2Q3T A;  2UUI A;  3I5P A;  3IQT A;  4OIR F;  1SR2 A;  4JRZ A;  2Y3G A;  4DJ9 A;  1FMV A;  1ORJ A;  2D5R B;  3ABK C;  1HMD A;  4I1M A;  1NU9 C;  1VYK A;  2J7P A;  3C8G A;  3DJN B;  4IAO A;  4MS2 A;  5D91 A;  3PCV A;  3WHN A;  3AG3 C;  1F1M A;  1KU2 A;  1JAF A;  5KYX A;  4O79 A;  1G4W R;  3X2Q C;  5B3I A;  4JE9 A;  3EH2 A;  4YL0 A;  1D0Z A;  4IWB A;  4W8P A;  2GA0 A;  5A6K A;  2L7A A;  3X1O A;  5A69 A;  1OR2 A;  4J7T A;  2WVO A;  2R02 A;  5BQH A;  3QMK A;  3C63 A;  4JC7 A;  4WGY A;  4Z9H A;  3AGU A;  4AX2 A;  5HSW A;  1LPE A;  1JMW A;  3EGX B;  1H6G A;  2ZXR A;  5COG A;  2J9V A;  1MMN A;  2J0X A;  3B0V C;  3NMI A;  4EIY A;  3JZ0 A;  1TWH A;  2XLE A;  2OQM A;  2L9J A;  2YL3 A;  4GQH A;  3MLG A;  3TJ5 A;  2W4M A;  1ZHY A;  4BPM A;  2L6G A;  5T3T A;  5A6B A;  4ZLD A;  1EI7 A;  5IY5 C;  2R05 A;  5D92 A;  3M1C B;  4YK5 A;  2R7T A;  2P6V A;  2XLH A;  4WJ0 A;  4PJN A;  1YAU O;  3F47 A;  3L34 A;  3EFO B;  3ASO C;  4XPY A;  5BQG A;  3WOD F;  4CDA A;  2YEV A;  3H2V A;  4CS8 C;  1VOM A;  4G78 A;  3ITF A;  5L0C A;  3AG2 C;  1OXB A;  4OD4 A;  3GOD A;  3DD7 A;  1LKX A;  3JYH A;  4GYT A;  5E3C A;  3FAJ A;  2VC9 A;  2XS8 A;  3Q6M A;  2VCB A;  2HV7 A;  4JCH A;  1EQ1 A;  3DKA A;  4OIO F;  3L0I A;  2XLD A;  4PK4 A;  3A9C A;  1OCZ C;  5E33 A;  1YJG A;  4BG0 A;  3U8P A;  1J8Y F;  1Q0M A;  4BJ6 C;  4F4B A;  4U5B E;  1A7V A;  3UR3 C;  3DE8 A;  3M4B A;  5CIV A;  3MYI A;  2XS1 A;  2XSE A;  3QVZ A;  4JVS A;  3EGD B;  2R7O A;  3EHM A;  2P61 A;  4OIN F;  256B A;  1FAP B;  1VMA A;  1O5H A;  1K05 A;  3K1I A;  2V3C C;  1FTS A;  1NSG B;  2DGJ A;  2NPU A;  4HEA J;  1OW8 A;  2AWC A;  1Z6A A;  2KK1 A;  4CSA C;  1G4U S;  1T01 A;  1TWC A;  1A41 A;  2HJ3 A;  2XL8 A;  5CI8 A;  3IPM O;  4XPW A;  2M4E A;  2LQG A;  1D1C A;  4U5C E;  1LVK A;  2HV6 A;  1MMA A;  2F22 A;  3EPV A;  1LS1 A;  3K33 A;  2R03 A;  4E18 A;  1RMV A;  2AP3 A;  2P0N A;  3T6B A;  1C02 A;  1OXK A;  2OOC A;  3UMK A;  2HZ8 A;  3UMH A;  4BEM J;  5DS6 A;  1TWA A;  1MND A;  2O9X A;  3EH1 A;  5AGF A;  5JP7 A;  3NKD A;  1QZX A;  3B0U X;  4KI2 A;  2CCY A;  5KYN A;  2Q9C A;  3HNI A;  1NFO A;  3S90 A;  2OKU A;  3DAG A;  4LER A;  1WAS A;  1GQA A;  3I5Q A;  4J32 B;  2ZD9 A;  4G7H F;  4KC9 A;  3FXH A;  5E3A A;  1GGQ A;  2YVK A;  4PJJ A;  2XLV A;  1G5Z A;  4ANJ A;  4BJ1 A;  2IOQ A;  3GM1 A;  3LS0 A;  5FCL A;  3U0C A;  4FWV A;  3AJM A;  2VH3 A;  3V5Z A;  2M64 A;  1M57 C;  4JTD B;  3DMD A;  1KNY A;  4JTC B;  2G3K A;  4Z9J A;  5E2Q A;  3DM9 B;  1GS9 A;  3HNJ A;  4MQ9 F;  4DRH B;  2XM4 A;  1LE4 A;  1D0Y A;  2DB4 A;  3S9O A;  1IZM A;  3O6X A;  5JS5 A;  3VM6 A;  2BE5 F;  3AQB A;  1A7E A;  1FFT C;  2XLO A;  4AL0 A;  1RKE A;  3U3F A;  2EIL C;  2CNW D;  4HE8 D;  4R32 A;  4CS9 A;  1TFK B;  1LS4 A;  4YT8 A;  3U5S A;  2G62 A;  1ZU4 A;  3RVZ A;  4MVR A;  1CGN A;  1E84 A;  3FHD A;  3US6 A;  1E86 A;  1I5N A;  3EGD A;  1EKY A;  3SXZ A;  1RCP A;  4NTB A;  4PJM A;  5L0D A;  4J7Y A;  5TJ5 E;  3K7D A;  3S84 A;  1TFO B;  2PX3 A;  2YWA A;  2QNL A;  3POV A;  1MQV A;  1OKK A;  1WGW A;  2OJQ A;  4YN0 B;  1Z7Q c;  3JSZ A;  4CX9 A;  3T6J A;  4AE4 B;  2YQY A;  2NSG A;  3SP1 A;  3UGP A;  2YRF A;  3U3B A;  1ORY A;  4YT5 A;  5T3W A;  4BJ5 C;  2YLD A;  4E7Z A;  3GM3 A;  3SYN A;  2A6E F;  2HFI A;  2ZXP A;  3M4C A;  4QI2 A;  4DRI B;  1LIH A;  4LDR A;  4MTF A;  1H7I A;  1SYQ A;  2A68 F;  1C17 M;  3ZTM A;  4CDV A;  1JPN A;  3VAY A;  4CIH A;  3K6B A;  1HW2 A;  4NTF A;  2XL4 A;  2P1A A;  3H2U A;  1APC A;  4MVS A;  1JR8 A;  4U5F E;  4IJJ A;  1I4Z A;  2IXM A;  1AUE A;  3HTK C;  3AGT A;  4QDL A;  1LM3 B;  1NU7 D;  2C04 A;  3L8I A;  1QLE C;  5AC4 A;  3N2Z B;  2X51 A;  5DVW A;  4YJW A;  4U5D E;  3GWL A;  2W9Y A;  3EG9 B;  3NMJ A;  2Q9B A;  3RIP A;  3JYY A;  2ICW G;  3S27 A;  4Q4Z F;  1FMW A;  1TR2 A;  2KC3 A;  4NQF A;  3RQF A;  5JVE A;  3KL4 A;  3V5X A;  5EK0 A;  1ZW2 A;  1RJ9 B;  5KYW A;  3LES A;  3E9V A;  1E2X A;  2J7P D;  3C8G D;  3KH2 A;  4DBQ A;  1QPU A;  1L7C A;  1OCC C;  3F46 A;  4KNW A;  4YL1 A;  2HSQ A;  2IBF A;  4A2N B;  4G7Z F;  1Z3I X;  3FOO A;  3C7J A;  2L6F A;  1MMG A;  3H65 A;  1WOL A;  4BEJ A;  1UG7 A;  1CGM E;  1H9T A;  3DJU B;  1OCO C;  2QE9 A;  1ZZP A;  2AU5 A;  4XEK A;  4YT4 A;  1ORS C;  2CYD A;  2YL7 A;  2LSE A;  2R7W A;  2TMV P;  3W2V A;  1FNT c;  3CQZ A;  2Q00 A;  4CIP A;  2PBE A;  4LDQ A;  1NBB A;  4DXW A;  2HSB A;  3HNK A;  4E0H A;  2R7S A;  2RSE B;  3VRC A;  2AWY A;  1XWJ A;  5BQI A;  1VTM P;  1TWG A;  2R9R B;  2ETS A;  2HS5 A;  1E83 A;  2I15 A;  2YLG A;  3SXM A;  2DI3 A;  1OW7 A;  3TQO A;  5A6B D;  4AE4 A;  2UUH A;  3LUT B;  2XLW A;  3M15 A;  3QW0 A;  4JUR I;  4MND A;  5F28 E;  5KYU B;  3OEO A;  2Q4F A;  1PD1 A;  3KPH A;  5AC5 A;  1D1A A;  1M2V A;  3JT1 A;  2YZS A;  3KYI A;  1FFH A;  2Y3H A;  3DE9 A;  4CS8 A;  3EJN A;  2LIG A;  3ZDL A;  2EPO A;  2LK4 A;  3UGO A;  1BZ4 A;  2OEV A;  1S05 A;  4K0D A;  2DYS C;  1YDI A;  5DQZ A;  1Q0D A;  4IRU A;  5EGY A;  3R2P A;  1T6I A;  1WAT A;  3EQL F;  3NYM A;  4I1O B;  4DBR A;  2L81 A;  3C8Z A;  3T9O A;  1NLX A;  2PFD A;  2KGO A;  4MVM A;  3T6G B;  3BRJ A;  3CEX A;  3QW1 A;  4EWC A;  4K7B A;  3W8I A;  4BJ6 A;  4CS7 A;  2R7R A;  1SF8 A;  4E17 A;  5BUO A;  3LLI A;  2EPK X;  3EGX A;  3C18 A;  3G4X A;  3KMI A;  3NKE A;  4IGG A;  2VCC A;  1U0B B;  3V5Y A;  3ZQY A;  5L0F A;  2WB7 A;  2MYS A;  3EG9 A;  3QTH A;  4EUK B;  3AG4 C;  3EHN A;  1MNE A;  4MTG A;  3Q7G A;  1T6Q A;  2H7V C;  2OU6 A;  3WG7 C;  1TQG A;  2WZG A;  3WAQ A;  1H9G A;  4CSA A;  2R7X A;  4U5E E;  4ULW A;  1OQC A;  1T5O A;  1W2W A;  2V26 A;  3RQG A;  4D4N A;  1BR4 A;  2R7Q A;  4CDY A;  4MVU A;  4XEF A;  2X0C A;  2ZPA A;  3HNL A;  4FES A;  5K0I A;  3EFO A;  3B0P A;  2B0J A;  3FMS A;  4XPX A;  4MVZ A;  3VF0 A;  2A69 F;  4C3D A;  5L0G A;  1QVX A;  2WVN A;  3RFY A;  1YZA A;  3ZSU A;  1RXQ A;  4O6M A;  5DQT A;  4DOZ A;  4A4A A;  4JCZ A;  3PMR A;  3AG1 C;  1LI5 A;  2WVQ A;  2H8A A;  2VAS A;  2Y69 C;  1R4T A;  3IEE A;  1ZHX A;  1K04 A;  3L1M A;  2GFH A;  2MHR A;  4ONS A;  3W4Y A;  2J0W A;  3TK0 A;  4P6I C;  5DS4 A;  2QLA A;  1O87 A;  1DOV A;  2XRH A;  3IQ6 A;  2HKV A;  4XLN F;  5A6J A;  2WZF A;  4KBL A;  1YZC A;  2KSF A;  1JPJ A;  4YL3 A;  5L3Q A;  1V74 B;  3MFN A;  1NFN A;  4PJL A;  4CBE A;  5KYU A;  2OEX A;  2GWW A;  3MYF A;  4U9D A;  1D0X A;  3DZA A;  4NC3 A;  4EBB A;  2IXN A;  2QY9 A;  1OCR C;  1N1C A;  1PV3 A;  1YVI A;  1MMD A;  2MWQ A;  3TUL A;  3T4R A;  2NUT B;  3CZ6 A;  2Q7R A;  4YWQ A;  4JEA A;  2A0B A;  1HMO A;  4LDK A;  1B68 A;  4E7S A;  3IHU A;  5B1B C;  5A6A A;  3U9M A;  4IB4 A;  2AVK A;  4C3B A;  1K40 A;  3B9Q A;  3RQE A;  3SXY A;  2H7O A;  2W4B A;  3GM2 A;  3LLK A;  4JTA B;  1A0B A;  3ASN C;  2QTV A;  3NG1 A;  4ULV A;  4LAC B;  2XXA B;  1E85 A;  2I8B A;  4RD9 A;  2IXP A;  2R7V A;  2LCH A;  2NUP B;  3S29 A;  3ZC4 A;  4K1O A;  4N6H A;  1Q0F A;  3O55 A;  5JUA A;  3S0X A;  2YL0 A;  1QSP A;  4LLC A;  1XZP A;  3EZH A;  1YAR O;  5L3V A;  2YL1 A;  1PD0 A;  1Y4C A;  2HJM A;  3HJC A;  1YA9 A;  3GAN A;  1OW6 A;  1Z63 A;  2IM8 A;  2E87 A;  1OKK D;  3KYJ A;  2P7V A;  2DYR C;  2QUP A;  2A0U A;  1VYI A;  1RKC A;  3ZVR A;  4FX5 A;  4PR9 A;  4RDA A;  4X0R A;  1ST6 A;  2J46 A;  4DVZ A;  4BJT A;  1C03 A;  4OIP F;  5HV9 A;  1JRA A;  3E70 C;  3GEH A;  2VCA A;  3L8J A;  4BJ5 A;  1HE9 A;  2JD3 A;  4CJG A;  2ZXO A;  1ZYR F;  2ASR A;  3ATP A;  3K1H A;  2LP4 A;  4PFP A;  4XQ1 A;  5GPG B;  4JW1 A;  3RYL A;  2A6H F;  2KYH A;  3MBG A;  4NTA A;  2R7U A;  3FDQ A;  4M63 A;  2JX0 A;  3DWW A;  4G0H A;  2EPM X;  2WL8 A;  3HLZ A;  2Z15 A;  1NZE A;  1QKR A;  3LAY A;  4YT2 A;  3RF3 A;  3LEO A;  3PDM P;  1PCX A;  4PAC A;  4C3E A;  5B1A C;  4KNV A;  1HY5 A;  1SMY F;  2Y3B A;  2YHS A;  3NYL A;  4JJF A;  2B0H A;  4XWJ A;  3CSK A;  5T1D B;  1YYX A;  5JT4 A;  3FAP B;  4O7G A;  4XEV A;  2EIK C;  3NYJ A;  4QI0 A;  4HFF B;  3V7O A;  4ZLC A;  3AOU A;  3G4Z A;  1LE2 A;  5F5H A;  3O10 A;  1O3U A;  4W8K A;  3GWN A;  3ZQV A;  2XL6 A;  4AK9 A;  2JPU A;  2VB6 A;  2J8W A;  4MVQ A;  2L6H A;  3U2M A;  3K1I C;  1WWP A;  3RKO F;  3U9J A;  1EA8 A;  3UMI A;  2XLM A;  3U2L A;  1YLM A;  3LNM B;  4AL1 A;  1U89 A;  4CJO A;  3G50 A;  2NUT A;  1R5I D;  1Z5Z A;  1Y6D A;  3RVY A;  5JRA A;  1U6H A;  2G3V A;  4O6Y A;  1LI7 A;  3DI5 A;  4PFO A;  5JLI A;  3VYW A;  1BR1 A;  3SEO A;  1ZW3 A;  4Z9I A;  3U8V A;  1Q0G A;  4Q7C A;  2XXA A;  2A1D D;  3EZI A;  2EIM C;  3CAX A;  2NUP A;  4MTO A;  3O39 A;  3QVY A;  3TOL A;  3DXJ F;  3K66 A;  1A7D A;  3JSE O;  5L0J A;  3GEI A;  4U9E A;  1RKE B;  2BC5 A;  4XLP F;  3B71 A;  2IYL D;  1YA7 O;  3B29 A;  3ZIB A;  3I4U A;  3ABM C;  2PX0 A;  4I3M A;  3LEV A;  4C7O B;  3Q6N A;  4GEH A;  1WN0 A;  2YKZ A;  3J06 A;  2R25 A;  4MW3 A;  3W8H A;  2W45 A;  3ZWI A;  2EPN A;  3NRH A;  3S28 A;  3ECS A;  5FZT A;  4IAR A;  1Z23 A;  4WGZ A;  5JSL A;  1J8M F;  3FOP A;  4RBN A;  2LFF A;  3SNH A;  1ZHZ A;  1S7Z A;  2HMZ A;  3JTL O;  3KKB A;  4JIO A;  4XTK A;  1M56 C;  2CGE A;  5KYY B;  3TJ6 A;  1Q0K A;  2EIJ C;  2PF4 E;  1CGO A;  4G7O F;  1RJ9 A;  4EKW A;  1GM5 A;  5L0I A;  1SZI A;  2KJG A; 
#chains in the Genus database with same CATH homology
 3AJM A;  4XEF A;  2Q00 A;  1OW6 A;  3L8I A;  2PBE A;  1V4A A;  3C8G B;  2HSB A;  4XEV A;  1PV3 A;  1KNY A;  1QVX A;  3B71 A;  3TUL A;  3JZ0 A;  3O10 A;  1O3U A;  3BRJ A;  3JYY A;  3S9O A;  4EBK A;  4NQF A;  3RQF A;  1JOG A;  3GM3 A;  2JPU A;  2L6G A;  1K40 A;  3L8J A;  1K04 A;  1OW7 A;  3C8G A;  2L6H A;  3GM2 A;  3C18 A;  1WWP A;  3RQE A;  3C8G D;  5F28 E;  4EBJ A;  3U3F A;  4R32 A;  1K05 A;  1KTM A;  3U0C A;  1UFB A;  2JX0 A;  1OW8 A;  2L6F A;  1WTY A;  2KK1 A;  1WOL A;  3MFN A;  1ZZP A;  2LK4 A;  4XEK A;  3K7D A;  3RQG A;  3GM1 A;  2YWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...