2JPUA

Solution structure of nesg target ssr10, orf c02003 protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
publication title Solution structure of NESG target SsR10, Orf c02003 protein
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jpuA00
1WTYA 2L6HA 2JPUA 4XEKA 4EBKA 3RQEA 1OW6A 3MFNA 5F28E 3BRJA 3O10A 4XEVA 2Q00A 1QVXA 1OW8A 1V4AA 2YWAA 1K40A 3C8GB 1KTMA 1KNYA 1WOLA 1WWPA 3JYYA 1JOGA 4R32A 1UFBA 3RQFA 3L8JA 3TULA 3C18A 2L6GA 1OW7A 3C8GD 3JZ0A 1PV3A 3GM3A 3B71A 3U0CA 3C8GA 3S9OA 1O3UA 1ZZPA 2PBEA 3AJMA 2L6FA 3U3FA 2KK1A 3GM1A 4NQFA 3RQGA 2LK4A 1K05A 2HSBA 2JX0A 3K7DA 3L8IA 1K04A 3GM2A 4XEFA 4EBJA
chains in the Genus database with same CATH superfamily
2J46A 2Q9BA 2Y39A 1AVOB 3UNGC 2GFHA 3JSEO 3FOPA 1TWCA 1OW6A 2QNLA 3JTLO 3MYIA 4C7OA 4BEJA 1OR2A 1R5ID 4JE9A 4KBLA 5JUAA 2H7OA 1VLTA 2J7PA 4J30B 3E9VA 1TQGA 1RXQA 3FOOA 5FCLA 2YVKA 3QTHA 3JYHA 1J8YF 3U5SA 3RF3A 3KYJA 2LFDA 2B0JA 1NU9C 5TJ5E 2YL0A 2IXOA 1A0BA 1RJ9B 1M56C 4CSAC 4YL0A 2O9XA 2OOCA 4DRIB 3I4UA 3HKKA 3ABLC 1VK5A 5L0FA 2R7QA 3C8GA 1O3UA 3FAJA 3QW1A 1FNTc 4C7OB 3U3FA 1WASA 5DLJA 2J9BA 1EI7A 4MVSA 5E33A 1U89A 3AGTA 4D4NA 4JCHA 5A6KA 1D1BA 4WJ0A 4UDVA 1APCA 3TOLA 1Q0KA 2LSEA 1HY5A 1ZYRF 3JT1A 4MS2A 3AG3C 4N6HA 1ZVZA 4F4BA 4XPYA 2HFIA 4CDVA 3GORA 3C8GB 5B3SC 2EPKX 2Q9AA 4JC7A 3U3BA 3L0IA 2J0XA 4XQ1A 2H7BA 2ZXWC 4XPWA 2D4UA 1GS9A 1RKEA 1UFBA 2IXMA 4P9FA 2HKVA 3ZIBA 3L8JA 3T6GB 4C3DA 1M6TA 3UR3C 3EPVA 3HNJA 4OIRF 1HE9A 2R7RA 3S0XA 4H4KC 1NZEA 1TWGA 1Z6AA 2YHSA 4ULVA 5COFA 2I8BA 3C63A 2X51A 2YLDA 2R03A 1YJGA 1ZHWA 3L1MA 3M1CB 4HFKB 1NG1A 4WGZA 1TKNA 3DWWA 3EHNA 4LERA 1D0XA 5L0JA 3SZRA 1N1CA 1F1MA 1FTSA 1RKEB 2RD9A 4X0RA 4L6RA 2YQYA 4JCZA 2NUTB 2W45A 4BG0A 2R02A 3MFNA 5EHHA 2CCYA 3H2VA 4YK5A 1LM3B 3EGDA 3FVYA 4Z9HA 3LJBA 3ATPA 5B1AC 4E18A 4QI0A 4IARA 1WOLA 3R2PA 5A6BD 2YEVA 2QTVA 4CJOA 1U0BB 4JKVA 3LNRA 3J06A 1T01A 1ZHTA 3AOUA 4E7SA 1ZU4A 3KH2A 1AEPA 5DS5A 5D92A 1Q0DA 4YN0B 2Y3DA 5DVWA 2LD6A 4EWCA 4XLPF 2KK1A 2VH3A 1A7DA 4U9EA 5COGA 3RVYA 2LK4A 2R7XA 3EGDB 5KYXB 2HSBA 4A2NB 4NTAA 3VF0A 4EKWA 4CDYA 2A0UA 2L9JA 1NFNA 3DE9A 3DZAA 1NSGB 1V55C 2A0BA 2W4BA 4O6YA 1VYKA 2Y3HA 3M15A 1TR2A 3EH1A 3O55A 4BJ5C 3EGXA 3U8VA 2G3VA 3T6JA 1EKYA 4E0HA 4EBBA 3RKOF 4PACA 1OKKD 1E2XA 3GWLA 3NYJA 2YLGA 2J0WA 1C02A 1ZW3A 3NMIA 3RQFA 1ORSC 4O7GA 3RVZA 4ZLCA 1NBBA 4NTFA 3SXZA 1FAPB 4JIOA 2Q3TA 3EZIA 1ZZPA 3AJMA 3EG9A 3V5YA 4P9TA 4RD9A 2X0CA 2OEXA 1K05A 3ZQVA 4LDRA 2JX0A 3K7DA 2LCHA 2KW3C 3TOMA 3U8PA 4N06A 2HS5A 4C3BA 4DXWA 1LI7A 1HW2A 5GPGB 2L6HA 1Z5ZA 2JPUA 3U2LA 2YL1A 1SMYF 3RW0A 2QE9A 2HZ8A 3ABKC 1YYXA 5JVEA 4U5BE 4BEMJ 2PFDA 5CI9A 4C3EA 3B0VC 2A1DD 1C17M 2A6EF 2J45A 1K40A 3DM5A 4M63A 1TWHA 1FFHA 1L7CA 1OR3A 2OJED 3LEVA 5E2QA 3IQTA 4ZLDA 1OKKA 4W8KA 2FAPB 3DMDA 5KYUA 5DS4A 1TFOB 1G8XA 5JP7A 3WHNA 5F5HA 5L3VA 1M2OA 1YA9A 3S9OA 5KYNA 3N24A 1VLSA 4MW3A 3K66A 2CNWA 1EQ1A 4CS8C 4JTAB 2ZXRA 3DI5A 3LLIA 2CDQA 3B9QA 2M4EA 2NUPB 1Y6DA 4DVZA 1FR0A 2XM0A 3DM9B 3OWTA 1LS1A 3JCUQ 4IGGA 3RQEA 4EBKA 5KYUB 1OCOC 4IRUA 2XLWA 3O10A 4FESA 5A6AA 1SR2A 3RIPA 3EH2A 3RFYA 2KYHA 2LIGA 3AQCA 3KYIA 3UMHA 5A6JA 3NKEA 2KJGA 1QLEC 4N4WA 4DVYP 5HSWA 5A69A 4PJMA 2P7VA 2F22A 3M79A 2QUPA 1T6QA 2E87A 4WABA 1D1CA 1E86A 3O6XA 4PFPA 2HMQA 1EA8A 3GEEA 3Q6MA 5CI8A 3X1OA 4YT2A 4JEBA 4E17A 4OIQF 2EPOA 4PJLA 2UUHA 3SYNA 3LS0A 4JRZA 2DI3A 2WVNA 2PF4E 2Z15A 1Q0FA 3K6BA 3JRTA 4LDKA 4JVSA 1M57C 4LDQA 4OIOF 1BDJB 1BBHA 1TFKB 5AC4A 4MW8A 2AVKA 3HLZA 3ZVRA 2KGOA 4G7HF 1CPRA 5FZTA 3FHDA 2ZD9A 3MBGA 1A7VA 4DJ9A 4CIHA 2HV7A 3K1IC 3M4CA 1QVXA 4IB4A 1FFTC 3HJCA 4OD5A 2EILC 3FXHA 4PJNA 3C7JA 2R7VA 4XWJA 2Q9CA 2V3CC 2J8WA 3DD7A 4JJGA 3MX3A 1XZQA 2Y3BA 1VYIA 4KI2A 3IQ5A 4D4XA 2DB4A 1OQCA 4JEAA 3U9MA 3DE8A 5JRAA 2XL8A 5L0IA 2AP3A 2FGYA 2A69F 2OG2A 4O6MA 3IQCA 4MTGA 5B1BC 3I5PA 3QVYA 2XL6A 3TJ6A 4BJ6C 2JD3A 4XEFA 4Z9JA 1GQAA 2MWQA 3SXKA 1ZHXA 2XRHA 4MQ9F 1I5NA 2J9UA 1AUEA 4YT4A 2AU5A 2GWWA 3N2ZB 2A6HF 1HMDA 1O5HA 2IOQA 2VASA 4JTDB 3S27A 3T4RA 1T6IA 2QLAA 3ASOC 1Q0GA 2XLHA 1M2VA 4O79A 2MHRA 4BJ5A 3Q7GA 2NSFA 4GQHA 1KTMA 1LI5A 4O6NA 3UMKA 1OCZC 2M64A 3G50A 2ASRA 5T1DB 4U5GA 2DGJA 4CDAA 1VTMP 1HMOA 1OXBA 5F5FA 1BR1A 4BJTA 5L0HA 4JURI 3W2VA 4DRHB 1CGNA 1SF8A 4FX5A 1NU7D 3K33A 4LACB 4YJWA 1BR4A 1PCXA 1UG7A 3LEOA 3MLGA 1G4WR 3QMKA 4J7TA 4ER9A 5KYYA 2NG1A 4QI2A 1M2VB 2WZLA 3RH3A 3DKAA 2WVOA 3UMIA 4IJJA 4IAQA 4K0DA 4PJJA 3LUTB 4P6IC 4U5EE 4E0IA 3SNHA 3NYMA 1XZPA 2HV6A 1MQVA 2YWAA 4RDAA 2D5RB 4CS9C 2HSQA 4OD4A 3R7CA 2L81A 1V74B 2YLIA 1ZU5A 4J32B 2EPLX 3VAYA 2RSEB 3LLKA 5A6BA 1PD0A 1MMNA 2EINC 2HMZA 2WVQA 1O87A 2P6VA 5BQHA 1SZIA 2R05A 1PV3A 3GM3A 3B71A 3A11A 3AG1C 3IEEA 2PBEA 3TK0A 3S29A 3EGXB 1DOVA 1A7EA 2LQGA 3C62A 4YL3A 2A68F 4NTBA 5DQTA 2ZXPA 4OIPF 2XLOA 5E3AA 4MVUA 1QZXA 3QVZA 4U9DA 4WGYA 1PD1A 1YZAA 3IPMO 3V5XA 3F47A 2NPUA 2YL3A 1WN0A 3CAXA 3GODA 2Q00A 5L0DA 1D0YA 2CW0F 2HUJA 1HW1A 1G4US 1ZHYA 2HJMA 1LVKA 1WATA 3EG9B 5COMA 3DJNB 3N0TA 1IZMA 5EK0A 3FDQA 4EUKB 5AC5A 4NC3A 2ICWG 4AE4A 4Q4ZF 3JZ0A 2VB6A 3HNKA 3O39A 2EIMC 3CSKA 3CQZA 3HTKC 5IY5C 2GAQA 2H8AA 3RQGA 4CSAA 3EFOA 1ST6A 4HFFB 3IHUA 5L0CA 3I5QA 1Z23A 1E84A 4HEAJ 1OCRC 3V5ZA 4A4AA 3UGOA 4MNDA 1VB5A 3AGUA 1D0ZA 3LAYA 3DAFA 2GA0A 4CS7A 2YKZA 4AE4B 1RMVA 2OJQA 2Y3GA 3KMIA 1S7ZA 3A9CA 4PFOA 1ORJA 3C8ZA 3FMSA 1YLMA 2MYSA 1MMGA 1WWPA 4ANJA 1JOGA 1LS4A 2KQ9A 3ZQYA 4OINF 1BR2A 1GM5A 3V7OA 3WAQA 2KSFA 3PMRA 2R7SA 3DJUB 2L7AA 3C8GD 4I3MA 1B68A 4AL1A 4CX9A 4CIPA 1W2WA 4FWVA 1CPQA 2W9YA 3DAGA 1T9KA 1Y4CA 3JRMO 3GEIA 1YZCA 3K1HA 2IXPA 1CGOA 4MVRA 5JS5A 3S90A 2KC3A 2J9WA 3L8IA 3FAPB 4PK4A 1RJ9A 1K04A 3ZC4A 5EGYA 2XXAA 1KU2A 1Z63A 4BPMA 1L3PA 2DYRC 4EHPA 3LNMB 3US6A 5L3QA 4BJ6A 5JT4A 2ETSA 4W8PA 3KL4A 2PNOA 4XEVA 2ZXOA 1V4AA 2I15A 2IM8A 4AK9A 2GDCA 5DQZA 1E85A 4E7ZA 4AX2A 2BC5A 4G7OF 1FMWA 2XXAB 1YAUO 1YYJA 1OW7A 4YL1A 4EIYA 4MVZA 3MYFA 2CYDA 2OQMA 1BZ4A 2VC9A 2AWYA 1TWAA 2EPMX 2OEVA 4RBNA 4K1OA 3AG4C 3GM1A 5KYYB 4JJFA 2KNHA 3SXYA 2CGEA 3OEOA 1H9GA 1XWJA 1ORYA 1I4ZA 2WZFA 4G7ZF 2G62A 2EPNA 3H2UA 4U5HA 4Z9IA 1J8MF 3LS1A 2NSGA 3G4ZA 1R4TA 1IW7F 3U9JA 3GANA 3VYWA 3ZTZA 1LE4A 1A41A 1H6GA 2XLVA 3NMJA 1LIHA 2OCCC 3X2QC 4CJGA 3H65A 1OW8A 1S05A 2BE5F 4PR9A 5BUOA 4XLNF 1KNYA 3UGPA 4NY3A 3NDBB 1LKXA 5T3WA 1MMDA 4U5DE 2NUTA 3HNIA 4DRJB 3TQOA 3C18A 2XS1A 4HE8D 2FFHA 2WL8A 3SEOA 2PX3A 2XL4A 2XS8A 5E3CA 4CS9A 1SYQA 2LFFA 4GEHA 2XSEA 3Q6NA 3KKBA 2XLEA 3AG2C 2L6FA 5T3TA 4NQFA 1OXKA 2AWCA 2XLDA 5JLIA 1HE1A 1ZHZA 4DOZA 2LP4A 1LE2A 3BEHA 4ONSA 3W2WA 1VMAA 2R7UA 3PDMP 5BQIA 1JMWA 3B29A 1JR8A 2YRFA 3Q7LA 5CIVA 1G5ZA 1YDIA 2R9RB 3BRJA 5KYXA 3ZSUA 2IBFA 1MNEA 4IAOA 3G4XA 3EZHA 2QY9A 2VCAA 1JPJA 3IQ6A 4Q5SF 1WGWA 3GWNA 3W8IA 2OKUA 2R25A 3AQBA 3JYYA 3NMKA 1V54C 1YVIA 3L34A 1Z7Qc 3SP1A 3B0PA 3TD7A 3W8HA 3ZG1A 4AL0A 3NG1A 3CZ6A 4JW1A 2IXNA 4YT5A 5KYWA 4KNVA 2L6GA 4G0HA 4XPXA 5HV9A 2Y69C 1I4YA 4I1MA 4QDLA 5DS6A 3U0CA 3JSZA 3T6BA 1OCCC 1YA7O 1YARO 2Q4FA 2VCBA 4JTCB 2PX0A 4J7YA 4NCQA 3ITFA 5D91A 4CBEA 2PP4A 4YT8A 3POVA 1FMVA 2C04A 3U2MA 1H7IA 4I44A 3TJ5A 2P61A 4Q7CA 2W4MA 4B6IA 1C03A 1GGQA 4LLEA 3WODF 3S84A 1QQ3A 3OA1A 4CS8A 5KYWB 2H7VC 2OU6A 2WB7A 2WZGA 2P0NA 3PCVA 4K7BA 4U5FE 4ULWA 5F28E 3RYLA 3S28A 4MVOA 4U5CE 4XTKA 4G78A 2IYLD 4IWBA 1D1AA 1NFOA 1JPNA 2G3KA 4MVQA 1DOWA 3PHF2 4LLCA 5B3IA 3HNLA 3NYLA 3ZTMA 2ZPAA 1MMAA 5K0IA 3KPHA 1T6UA 2YZSA 4JZAA 1CGME 1RKCA 2C03A 2EIJC 3ZWIA 256BA 2CNWD 2BL2A 1JAFA 3DXJF 3SXMA 1ZW2A 3ECSA 5BQGA 3QW0A 2P1AA 1RCPA 4KNWA 3T9OA 3ABMC 5AGFA 1JRAA 1MNDA 4DBQA 4EBJA 4YWQA 1WTYA 3ZDLA 2DYSC 3F46A 1H9TA 4XEKA 1QPUA 4KC9A 1U6HA 1Z3IX 3EJNA 3EHMA 3EQLF 2J7PD 2VCCA 4I1OB 2YL7A 2XM4A 3LESA 3NRHA 4GYTA 1E83A 3QZCA 1LPEA 4FAPB 2UUIA 3VRCA 2HJ3A 2NUPA 4R32A 3ASNC 2V26A 5JSLA 2Q7RA 3EFOB 4MTOA 3K1IA 4N6CA 3WG7C 3NKDA 3TULA 2R7TA 2B0HA 4MVMA 3M4BA 2J9VA 2R7OA 3CEXA 1QKRA 4DBRA 1T5OA 2EIKC 1NLXA 1VOMA 2XLMA 3E70C 3GEHA 4MTFA 3VM6A 4BJ1A 5L0GA 3W4YA 2R7WA 4H54A 1Q0MA 1QSPA 2TMVP 3B0UX 3GM2A
chains in the Genus database with same CATH topology
1WTYA 2L6HA 2JPUA 4XEKA 4EBKA 3RQEA 1OW6A 3MFNA 5F28E 3BRJA 3O10A 4XEVA 2Q00A 1QVXA 1OW8A 1V4AA 2YWAA 1K40A 3C8GB 1KTMA 1KNYA 1WOLA 1WWPA 3JYYA 1JOGA 4R32A 1UFBA 3RQFA 3L8JA 3TULA 3C18A 2L6GA 1OW7A 3C8GD 3JZ0A 1PV3A 3GM3A 3B71A 3U0CA 3C8GA 3S9OA 1O3UA 1ZZPA 2PBEA 3AJMA 2L6FA 3U3FA 2KK1A 3GM1A 4NQFA 3RQGA 2LK4A 1K05A 2HSBA 2JX0A 3K7DA 3L8IA 1K04A 3GM2A 4XEFA 4EBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTY A;  2L6H A;  2JPU A;  4XEK A;  4EBK A;  3RQE A;  1OW6 A;  3MFN A;  5F28 E;  3BRJ A;  3O10 A;  4XEV A;  2Q00 A;  1QVX A;  1OW8 A;  1V4A A;  2YWA A;  1K40 A;  3C8G B;  1KTM A;  1KNY A;  1WOL A;  1WWP A;  3JYY A;  1JOG A;  4R32 A;  1UFB A;  3RQF A;  3L8J A;  3TUL A;  3C18 A;  2L6G A;  1OW7 A;  3C8G D;  3JZ0 A;  1PV3 A;  3GM3 A;  3B71 A;  3U0C A;  3C8G A;  3S9O A;  1O3U A;  1ZZP A;  2PBE A;  3AJM A;  2L6F A;  3U3F A;  2KK1 A;  3GM1 A;  4NQF A;  3RQG A;  2LK4 A;  1K05 A;  2HSB A;  2JX0 A;  3K7D A;  3L8I A;  1K04 A;  3GM2 A;  4XEF A;  4EBJ A; 
#chains in the Genus database with same CATH topology
 2J46 A;  2Q9B A;  2Y39 A;  1AVO B;  3UNG C;  2GFH A;  3JSE O;  3FOP A;  1TWC A;  1OW6 A;  2QNL A;  3JTL O;  3MYI A;  4C7O A;  4BEJ A;  1OR2 A;  1R5I D;  4JE9 A;  4KBL A;  5JUA A;  2H7O A;  1VLT A;  2J7P A;  4J30 B;  3E9V A;  1TQG A;  1RXQ A;  3FOO A;  5FCL A;  2YVK A;  3QTH A;  3JYH A;  1J8Y F;  3U5S A;  3RF3 A;  3KYJ A;  2LFD A;  2B0J A;  1NU9 C;  5TJ5 E;  2YL0 A;  2IXO A;  1A0B A;  1RJ9 B;  1M56 C;  4CSA C;  4YL0 A;  2O9X A;  2OOC A;  4DRI B;  3I4U A;  3HKK A;  3ABL C;  1VK5 A;  5L0F A;  2R7Q A;  3C8G A;  1O3U A;  3FAJ A;  3QW1 A;  1FNT c;  4C7O B;  3U3F A;  1WAS A;  5DLJ A;  2J9B A;  1EI7 A;  4MVS A;  5E33 A;  1U89 A;  3AGT A;  4D4N A;  4JCH A;  5A6K A;  1D1B A;  4WJ0 A;  4UDV A;  1APC A;  3TOL A;  1Q0K A;  2LSE A;  1HY5 A;  1ZYR F;  3JT1 A;  4MS2 A;  3AG3 C;  4N6H A;  1ZVZ A;  4F4B A;  4XPY A;  2HFI A;  4CDV A;  3GOR A;  3C8G B;  5B3S C;  2EPK X;  2Q9A A;  4JC7 A;  3U3B A;  3L0I A;  2J0X A;  4XQ1 A;  2H7B A;  2ZXW C;  4XPW A;  2D4U A;  1GS9 A;  1RKE A;  1UFB A;  2IXM A;  4P9F A;  2HKV A;  3ZIB A;  3L8J A;  3T6G B;  4C3D A;  1M6T A;  3UR3 C;  3EPV A;  3HNJ A;  4OIR F;  1HE9 A;  2R7R A;  3S0X A;  4H4K C;  1NZE A;  1TWG A;  1Z6A A;  2YHS A;  4ULV A;  5COF A;  2I8B A;  3C63 A;  2X51 A;  2YLD A;  2R03 A;  1YJG A;  1ZHW A;  3L1M A;  3M1C B;  4HFK B;  1NG1 A;  4WGZ A;  1TKN A;  3DWW A;  3EHN A;  4LER A;  1D0X A;  5L0J A;  3SZR A;  1N1C A;  1F1M A;  1FTS A;  1RKE B;  2RD9 A;  4X0R A;  4L6R A;  2YQY A;  4JCZ A;  2NUT B;  2W45 A;  4BG0 A;  2R02 A;  3MFN A;  5EHH A;  2CCY A;  3H2V A;  4YK5 A;  1LM3 B;  3EGD A;  3FVY A;  4Z9H A;  3LJB A;  3ATP A;  5B1A C;  4E18 A;  4QI0 A;  4IAR A;  1WOL A;  3R2P A;  5A6B D;  2YEV A;  2QTV A;  4CJO A;  1U0B B;  4JKV A;  3LNR A;  3J06 A;  1T01 A;  1ZHT A;  3AOU A;  4E7S A;  1ZU4 A;  3KH2 A;  1AEP A;  5DS5 A;  5D92 A;  1Q0D A;  4YN0 B;  2Y3D A;  5DVW A;  2LD6 A;  4EWC A;  4XLP F;  2KK1 A;  2VH3 A;  1A7D A;  4U9E A;  5COG A;  3RVY A;  2LK4 A;  2R7X A;  3EGD B;  5KYX B;  2HSB A;  4A2N B;  4NTA A;  3VF0 A;  4EKW A;  4CDY A;  2A0U A;  2L9J A;  1NFN A;  3DE9 A;  3DZA A;  1NSG B;  1V55 C;  2A0B A;  2W4B A;  4O6Y A;  1VYK A;  2Y3H A;  3M15 A;  1TR2 A;  3EH1 A;  3O55 A;  4BJ5 C;  3EGX A;  3U8V A;  2G3V A;  3T6J A;  1EKY A;  4E0H A;  4EBB A;  3RKO F;  4PAC A;  1OKK D;  1E2X A;  3GWL A;  3NYJ A;  2YLG A;  2J0W A;  1C02 A;  1ZW3 A;  3NMI A;  3RQF A;  1ORS C;  4O7G A;  3RVZ A;  4ZLC A;  1NBB A;  4NTF A;  3SXZ A;  1FAP B;  4JIO A;  2Q3T A;  3EZI A;  1ZZP A;  3AJM A;  3EG9 A;  3V5Y A;  4P9T A;  4RD9 A;  2X0C A;  2OEX A;  1K05 A;  3ZQV A;  4LDR A;  2JX0 A;  3K7D A;  2LCH A;  2KW3 C;  3TOM A;  3U8P A;  4N06 A;  2HS5 A;  4C3B A;  4DXW A;  1LI7 A;  1HW2 A;  5GPG B;  2L6H A;  1Z5Z A;  2JPU A;  3U2L A;  2YL1 A;  1SMY F;  3RW0 A;  2QE9 A;  2HZ8 A;  3ABK C;  1YYX A;  5JVE A;  4U5B E;  4BEM J;  2PFD A;  5CI9 A;  4C3E A;  3B0V C;  2A1D D;  1C17 M;  2A6E F;  2J45 A;  1K40 A;  3DM5 A;  4M63 A;  1TWH A;  1FFH A;  1L7C A;  1OR3 A;  2OJE D;  3LEV A;  5E2Q A;  3IQT A;  4ZLD A;  1OKK A;  4W8K A;  2FAP B;  3DMD A;  5KYU A;  5DS4 A;  1TFO B;  1G8X A;  5JP7 A;  3WHN A;  5F5H A;  5L3V A;  1M2O A;  1YA9 A;  3S9O A;  5KYN A;  3N24 A;  1VLS A;  4MW3 A;  3K66 A;  2CNW A;  1EQ1 A;  4CS8 C;  4JTA B;  2ZXR A;  3DI5 A;  3LLI A;  2CDQ A;  3B9Q A;  2M4E A;  2NUP B;  1Y6D A;  4DVZ A;  1FR0 A;  2XM0 A;  3DM9 B;  3OWT A;  1LS1 A;  3JCU Q;  4IGG A;  3RQE A;  4EBK A;  5KYU B;  1OCO C;  4IRU A;  2XLW A;  3O10 A;  4FES A;  5A6A A;  1SR2 A;  3RIP A;  3EH2 A;  3RFY A;  2KYH A;  2LIG A;  3AQC A;  3KYI A;  3UMH A;  5A6J A;  3NKE A;  2KJG A;  1QLE C;  4N4W A;  4DVY P;  5HSW A;  5A69 A;  4PJM A;  2P7V A;  2F22 A;  3M79 A;  2QUP A;  1T6Q A;  2E87 A;  4WAB A;  1D1C A;  1E86 A;  3O6X A;  4PFP A;  2HMQ A;  1EA8 A;  3GEE A;  3Q6M A;  5CI8 A;  3X1O A;  4YT2 A;  4JEB A;  4E17 A;  4OIQ F;  2EPO A;  4PJL A;  2UUH A;  3SYN A;  3LS0 A;  4JRZ A;  2DI3 A;  2WVN A;  2PF4 E;  2Z15 A;  1Q0F A;  3K6B A;  3JRT A;  4LDK A;  4JVS A;  1M57 C;  4LDQ A;  4OIO F;  1BDJ B;  1BBH A;  1TFK B;  5AC4 A;  4MW8 A;  2AVK A;  3HLZ A;  3ZVR A;  2KGO A;  4G7H F;  1CPR A;  5FZT A;  3FHD A;  2ZD9 A;  3MBG A;  1A7V A;  4DJ9 A;  4CIH A;  2HV7 A;  3K1I C;  3M4C A;  1QVX A;  4IB4 A;  1FFT C;  3HJC A;  4OD5 A;  2EIL C;  3FXH A;  4PJN A;  3C7J A;  2R7V A;  4XWJ A;  2Q9C A;  2V3C C;  2J8W A;  3DD7 A;  4JJG A;  3MX3 A;  1XZQ A;  2Y3B A;  1VYI A;  4KI2 A;  3IQ5 A;  4D4X A;  2DB4 A;  1OQC A;  4JEA A;  3U9M A;  3DE8 A;  5JRA A;  2XL8 A;  5L0I A;  2AP3 A;  2FGY A;  2A69 F;  2OG2 A;  4O6M A;  3IQC A;  4MTG A;  5B1B C;  3I5P A;  3QVY A;  2XL6 A;  3TJ6 A;  4BJ6 C;  2JD3 A;  4XEF A;  4Z9J A;  1GQA A;  2MWQ A;  3SXK A;  1ZHX A;  2XRH A;  4MQ9 F;  1I5N A;  2J9U A;  1AUE A;  4YT4 A;  2AU5 A;  2GWW A;  3N2Z B;  2A6H F;  1HMD A;  1O5H A;  2IOQ A;  2VAS A;  4JTD B;  3S27 A;  3T4R A;  1T6I A;  2QLA A;  3ASO C;  1Q0G A;  2XLH A;  1M2V A;  4O79 A;  2MHR A;  4BJ5 A;  3Q7G A;  2NSF A;  4GQH A;  1KTM A;  1LI5 A;  4O6N A;  3UMK A;  1OCZ C;  2M64 A;  3G50 A;  2ASR A;  5T1D B;  4U5G A;  2DGJ A;  4CDA A;  1VTM P;  1HMO A;  1OXB A;  5F5F A;  1BR1 A;  4BJT A;  5L0H A;  4JUR I;  3W2V A;  4DRH B;  1CGN A;  1SF8 A;  4FX5 A;  1NU7 D;  3K33 A;  4LAC B;  4YJW A;  1BR4 A;  1PCX A;  1UG7 A;  3LEO A;  3MLG A;  1G4W R;  3QMK A;  4J7T A;  4ER9 A;  5KYY A;  2NG1 A;  4QI2 A;  1M2V B;  2WZL A;  3RH3 A;  3DKA A;  2WVO A;  3UMI A;  4IJJ A;  4IAQ A;  4K0D A;  4PJJ A;  3LUT B;  4P6I C;  4U5E E;  4E0I A;  3SNH A;  3NYM A;  1XZP A;  2HV6 A;  1MQV A;  2YWA A;  4RDA A;  2D5R B;  4CS9 C;  2HSQ A;  4OD4 A;  3R7C A;  2L81 A;  1V74 B;  2YLI A;  1ZU5 A;  4J32 B;  2EPL X;  3VAY A;  2RSE B;  3LLK A;  5A6B A;  1PD0 A;  1MMN A;  2EIN C;  2HMZ A;  2WVQ A;  1O87 A;  2P6V A;  5BQH A;  1SZI A;  2R05 A;  1PV3 A;  3GM3 A;  3B71 A;  3A11 A;  3AG1 C;  3IEE A;  2PBE A;  3TK0 A;  3S29 A;  3EGX B;  1DOV A;  1A7E A;  2LQG A;  3C62 A;  4YL3 A;  2A68 F;  4NTB A;  5DQT A;  2ZXP A;  4OIP F;  2XLO A;  5E3A A;  4MVU A;  1QZX A;  3QVZ A;  4U9D A;  4WGY A;  1PD1 A;  1YZA A;  3IPM O;  3V5X A;  3F47 A;  2NPU A;  2YL3 A;  1WN0 A;  3CAX A;  3GOD A;  2Q00 A;  5L0D A;  1D0Y A;  2CW0 F;  2HUJ A;  1HW1 A;  1G4U S;  1ZHY A;  2HJM A;  1LVK A;  1WAT A;  3EG9 B;  5COM A;  3DJN B;  3N0T A;  1IZM A;  5EK0 A;  3FDQ A;  4EUK B;  5AC5 A;  4NC3 A;  2ICW G;  4AE4 A;  4Q4Z F;  3JZ0 A;  2VB6 A;  3HNK A;  3O39 A;  2EIM C;  3CSK A;  3CQZ A;  3HTK C;  5IY5 C;  2GAQ A;  2H8A A;  3RQG A;  4CSA A;  3EFO A;  1ST6 A;  4HFF B;  3IHU A;  5L0C A;  3I5Q A;  1Z23 A;  1E84 A;  4HEA J;  1OCR C;  3V5Z A;  4A4A A;  3UGO A;  4MND A;  1VB5 A;  3AGU A;  1D0Z A;  3LAY A;  3DAF A;  2GA0 A;  4CS7 A;  2YKZ A;  4AE4 B;  1RMV A;  2OJQ A;  2Y3G A;  3KMI A;  1S7Z A;  3A9C A;  4PFO A;  1ORJ A;  3C8Z A;  3FMS A;  1YLM A;  2MYS A;  1MMG A;  1WWP A;  4ANJ A;  1JOG A;  1LS4 A;  2KQ9 A;  3ZQY A;  4OIN F;  1BR2 A;  1GM5 A;  3V7O A;  3WAQ A;  2KSF A;  3PMR A;  2R7S A;  3DJU B;  2L7A A;  3C8G D;  4I3M A;  1B68 A;  4AL1 A;  4CX9 A;  4CIP A;  1W2W A;  4FWV A;  1CPQ A;  2W9Y A;  3DAG A;  1T9K A;  1Y4C A;  3JRM O;  3GEI A;  1YZC A;  3K1H A;  2IXP A;  1CGO A;  4MVR A;  5JS5 A;  3S90 A;  2KC3 A;  2J9W A;  3L8I A;  3FAP B;  4PK4 A;  1RJ9 A;  1K04 A;  3ZC4 A;  5EGY A;  2XXA A;  1KU2 A;  1Z63 A;  4BPM A;  1L3P A;  2DYR C;  4EHP A;  3LNM B;  3US6 A;  5L3Q A;  4BJ6 A;  5JT4 A;  2ETS A;  4W8P A;  3KL4 A;  2PNO A;  4XEV A;  2ZXO A;  1V4A A;  2I15 A;  2IM8 A;  4AK9 A;  2GDC A;  5DQZ A;  1E85 A;  4E7Z A;  4AX2 A;  2BC5 A;  4G7O F;  1FMW A;  2XXA B;  1YAU O;  1YYJ A;  1OW7 A;  4YL1 A;  4EIY A;  4MVZ A;  3MYF A;  2CYD A;  2OQM A;  1BZ4 A;  2VC9 A;  2AWY A;  1TWA A;  2EPM X;  2OEV A;  4RBN A;  4K1O A;  3AG4 C;  3GM1 A;  5KYY B;  4JJF A;  2KNH A;  3SXY A;  2CGE A;  3OEO A;  1H9G A;  1XWJ A;  1ORY A;  1I4Z A;  2WZF A;  4G7Z F;  2G62 A;  2EPN A;  3H2U A;  4U5H A;  4Z9I A;  1J8M F;  3LS1 A;  2NSG A;  3G4Z A;  1R4T A;  1IW7 F;  3U9J A;  3GAN A;  3VYW A;  3ZTZ A;  1LE4 A;  1A41 A;  1H6G A;  2XLV A;  3NMJ A;  1LIH A;  2OCC C;  3X2Q C;  4CJG A;  3H65 A;  1OW8 A;  1S05 A;  2BE5 F;  4PR9 A;  5BUO A;  4XLN F;  1KNY A;  3UGP A;  4NY3 A;  3NDB B;  1LKX A;  5T3W A;  1MMD A;  4U5D E;  2NUT A;  3HNI A;  4DRJ B;  3TQO A;  3C18 A;  2XS1 A;  4HE8 D;  2FFH A;  2WL8 A;  3SEO A;  2PX3 A;  2XL4 A;  2XS8 A;  5E3C A;  4CS9 A;  1SYQ A;  2LFF A;  4GEH A;  2XSE A;  3Q6N A;  3KKB A;  2XLE A;  3AG2 C;  2L6F A;  5T3T A;  4NQF A;  1OXK A;  2AWC A;  2XLD A;  5JLI A;  1HE1 A;  1ZHZ A;  4DOZ A;  2LP4 A;  1LE2 A;  3BEH A;  4ONS A;  3W2W A;  1VMA A;  2R7U A;  3PDM P;  5BQI A;  1JMW A;  3B29 A;  1JR8 A;  2YRF A;  3Q7L A;  5CIV A;  1G5Z A;  1YDI A;  2R9R B;  3BRJ A;  5KYX A;  3ZSU A;  2IBF A;  1MNE A;  4IAO A;  3G4X A;  3EZH A;  2QY9 A;  2VCA A;  1JPJ A;  3IQ6 A;  4Q5S F;  1WGW A;  3GWN A;  3W8I A;  2OKU A;  2R25 A;  3AQB A;  3JYY A;  3NMK A;  1V54 C;  1YVI A;  3L34 A;  1Z7Q c;  3SP1 A;  3B0P A;  3TD7 A;  3W8H A;  3ZG1 A;  4AL0 A;  3NG1 A;  3CZ6 A;  4JW1 A;  2IXN A;  4YT5 A;  5KYW A;  4KNV A;  2L6G A;  4G0H A;  4XPX A;  5HV9 A;  2Y69 C;  1I4Y A;  4I1M A;  4QDL A;  5DS6 A;  3U0C A;  3JSZ A;  3T6B A;  1OCC C;  1YA7 O;  1YAR O;  2Q4F A;  2VCB A;  4JTC B;  2PX0 A;  4J7Y A;  4NCQ A;  3ITF A;  5D91 A;  4CBE A;  2PP4 A;  4YT8 A;  3POV A;  1FMV A;  2C04 A;  3U2M A;  1H7I A;  4I44 A;  3TJ5 A;  2P61 A;  4Q7C A;  2W4M A;  4B6I A;  1C03 A;  1GGQ A;  4LLE A;  3WOD F;  3S84 A;  1QQ3 A;  3OA1 A;  4CS8 A;  5KYW B;  2H7V C;  2OU6 A;  2WB7 A;  2WZG A;  2P0N A;  3PCV A;  4K7B A;  4U5F E;  4ULW A;  5F28 E;  3RYL A;  3S28 A;  4MVO A;  4U5C E;  4XTK A;  4G78 A;  2IYL D;  4IWB A;  1D1A A;  1NFO A;  1JPN A;  2G3K A;  4MVQ A;  1DOW A;  3PHF 2;  4LLC A;  5B3I A;  3HNL A;  3NYL A;  3ZTM A;  2ZPA A;  1MMA A;  5K0I A;  3KPH A;  1T6U A;  2YZS A;  4JZA A;  1CGM E;  1RKC A;  2C03 A;  2EIJ C;  3ZWI A;  256B A;  2CNW D;  2BL2 A;  1JAF A;  3DXJ F;  3SXM A;  1ZW2 A;  3ECS A;  5BQG A;  3QW0 A;  2P1A A;  1RCP A;  4KNW A;  3T9O A;  3ABM C;  5AGF A;  1JRA A;  1MND A;  4DBQ A;  4EBJ A;  4YWQ A;  1WTY A;  3ZDL A;  2DYS C;  3F46 A;  1H9T A;  4XEK A;  1QPU A;  4KC9 A;  1U6H A;  1Z3I X;  3EJN A;  3EHM A;  3EQL F;  2J7P D;  2VCC A;  4I1O B;  2YL7 A;  2XM4 A;  3LES A;  3NRH A;  4GYT A;  1E83 A;  3QZC A;  1LPE A;  4FAP B;  2UUI A;  3VRC A;  2HJ3 A;  2NUP A;  4R32 A;  3ASN C;  2V26 A;  5JSL A;  2Q7R A;  3EFO B;  4MTO A;  3K1I A;  4N6C A;  3WG7 C;  3NKD A;  3TUL A;  2R7T A;  2B0H A;  4MVM A;  3M4B A;  2J9V A;  2R7O A;  3CEX A;  1QKR A;  4DBR A;  1T5O A;  2EIK C;  1NLX A;  1VOM A;  2XLM A;  3E70 C;  3GEH A;  4MTF A;  3VM6 A;  4BJ1 A;  5L0G A;  3W4Y A;  2R7W A;  4H54 A;  1Q0M A;  1QSP A;  2TMV P;  3B0U X;  3GM2 A; 
#chains in the Genus database with same CATH homology
 1WTY A;  2L6H A;  2JPU A;  4XEK A;  4EBK A;  3RQE A;  1OW6 A;  3MFN A;  5F28 E;  3BRJ A;  3O10 A;  4XEV A;  2Q00 A;  1QVX A;  1OW8 A;  1V4A A;  2YWA A;  1K40 A;  3C8G B;  1KTM A;  1KNY A;  1WOL A;  1WWP A;  3JYY A;  1JOG A;  4R32 A;  1UFB A;  3RQF A;  3L8J A;  3TUL A;  3C18 A;  2L6G A;  1OW7 A;  3C8G D;  3JZ0 A;  1PV3 A;  3GM3 A;  3B71 A;  3U0C A;  3C8G A;  3S9O A;  1O3U A;  1ZZP A;  2PBE A;  3AJM A;  2L6F A;  3U3F A;  2KK1 A;  3GM1 A;  4NQF A;  3RQG A;  2LK4 A;  1K05 A;  2HSB A;  2JX0 A;  3K7D A;  3L8I A;  1K04 A;  3GM2 A;  4XEF A;  4EBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...