2JPUA

Solution structure of nesg target ssr10, orf c02003 protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of NESG target SsR10, Orf c02003 protein
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics
molecule keywords Orf c02003 protein
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jpuA00
1KNYA 2L6FA 3JYYA 3L8IA 3MFNA 3GM2A 1JOGA 3TULA 3C8GA 3RQFA 4EBJA 1OW8A 1WWPA 2KK1A 1V4AA 3O10A 3U3FA 2HSBA 2JX0A 1K04A 3RQGA 3K7DA 2Q00A 2L6GA 1O3UA 1OW7A 3U0CA 1QVXA 4XEVA 3RQEA 3L8JA 4XEKA 2L6HA 1K40A 1ZZPA 2LK4A 2PBEA 3GM1A 4XEFA 1KTMA 5F28E 3S9OA 3AJMA 4EBKA 3C8GB 1WTYA 3GM3A 3BRJA 2JPUA 4R32A 3B71A 1UFBA 2YWAA 1WOLA 1OW6A 3C8GD 4NQFA 3C18A 1PV3A 1K05A 3JZ0A
chains in the Genus database with same CATH superfamily
3DM9B 1A41A 1TWGA 5COFA 1AEPA 1E86A 3CAXA 3U9JA 2CW0F 3OA1A 1YDIA 1OCCC 2PNOA 3M4CA 3X1OA 3HJCA 2D4UA 4YWQA 2OQMA 2BC5A 3FAJA 2A1DD 3IPMO 5JSLA 1T9KA 3GEIA 2XM4A 3DAFA 4U5DE 1TFOB 2WVNA 4OIRF 3RH3A 3CEXA 5EK0A 5KYYB 4PJJA 3KMIA 2HFIA 4XEVA 3DJNB 2JD3A 2P61A 1H9GA 3B9QA 1D1CA 2A68F 5L0FA 4G7OF 3NMKA 4PJLA 1J8MF 1MQVA 3W2WA 3ZTZA 3Q6NA 1CGME 1PCXA 3EZHA 1UG7A 4O7GA 2PX0A 3N2ZB 3TJ5A 4DVZA 3SZRA 1WOLA 2XLWA 2KGOA 4LDQA 2YL1A 2OEVA 4AL0A 5DS4A 2ETSA 2WZGA 2AU5A 2EPLX 4XTKA 1EI7A 4YN0B 4YT2A 5DS6A 5BUOA 1DOWA 4DBRA 2TMVP 1V4AA 5T3TA 1LKXA 3IQ6A 1WASA 4DRJB 5HV9A 1XZPA 3AQBA 3JSEO 3K6BA 4MVQA 4U5GA 5DQZA 3R7CA 4CS9A 1TR2A 3ABLC 1Z63A 4K7BA 1MNDA 4YL1A 3LNRA 2PX3A 5FZTA 3EPVA 3V5YA 1ZZPA 3B0UX 1TFKB 3W8HA 4DOZA 4C7OA 1T01A 2IOQA 2YL0A 3DJUB 3TQOA 2QY9A 4MVMA 4O6MA 5CIVA 1M2OA 4E7ZA 5JT4A 2KJGA 3KYJA 3S28A 5B3IA 5KYUB 3ABKC 2YL7A 4X0RA 2F22A 5T1DB 2P7VA 4JEBA 2EPMX 3ZIBA 3ABMC 1YAUO 3AGUA 1A7EA 1R5ID 1XZQA 2NPUA 3M1CB 4Q7CA 1L7CA 2OJED 3SEOA 1GM5A 3B29A 3SXYA 4GQHA 2R7WA 3ZQVA 1NZEA 3IQCA 4H54A 2A0UA 1WWPA 1TWHA 1O5HA 1Z6AA 1D1AA 2Y3GA 4XPYA 1ORSC 3AOUA 5A69A 3UR3C 3EH2A 1VMAA 2MWQA 4CSAA 1FTSA 3PCVA 1OCZC 1OW7A 4HFKB 1QVXA 4QDLA 4MS2A 4BEMJ 5EHHA 4FESA 4XEKA 4DXWA 3ATPA 1A0BA 4MQ9F 5AGFA 3JRTA 4U5HA 5JVEA 5KYWB 1D0XA 1FFTC 3EQLF 4NTFA 4CX9A 2AVKA 3R2PA 2RSEB 2J45A 4HFFB 4M63A 3SXMA 1SF8A 4A4AA 4G7HF 3EHMA 3KH2A 3IEEA 3VYWA 2C03A 2LFFA 2IM8A 4UDVA 4EBBA 4O6NA 2Q3TA 3L8IA 1NLXA 3RVYA 3JCUQ 1Z7Qc 5KYUA 2HV6A 2R9RB 2Y3DA 4A2NB 3C8GA 5FCLA 1PD0A 2L7AA 2P6VA 3NRHA 5KYYA 4C7OB 3EFOA 3FXHA 2DI3A 2C04A 2GWWA 2XLVA 3T4RA 1OR3A 2LQGA 3SNHA 2HJ3A 3EGDB 2OOCA 1OR2A 3K7DA 2XRHA 1M56C 3NDBB 3V5XA 1QQ3A 1GGQA 2MHRA 2YHSA 5COMA 2P0NA 5T3WA 2A0BA 4BJ6A 4H4KC 4RBNA 1S7ZA 1LI5A 2OJQA 2YLDA 5AC4A 2WZFA 3DAGA 2CNWA 2OU6A 4JW1A 3S9OA 2EILC 3NKDA 4BEJA 1YYXA 5L0IA 5L0DA 2R7SA 2Q4FA 3AG4C 2EPNA 3F47A 1WATA 3KPHA 2LFDA 3JYHA 4HEAJ 3X2QC 2HS5A 2E87A 1FMWA 3FMSA 3ZWIA 4KBLA 1Y6DA 1RJ9B 4KC9A 2O9XA 1JOGA 5K0IA 1G4WR 1GQAA 4JIOA 4N4WA 2KK1A 1RMVA 4U9DA 3H2VA 4K0DA 2QUPA 2R7QA 4ZLDA 4YL0A 4E0HA 3FAPB 2Q9AA 3V7OA 2J9WA 1BR4A 1TQGA 2IXOA 3ASOC 5EGYA 3O6XA 4G7ZF 2CGEA 2XLMA 2YZSA 3WG7C 3EGDA 1OKKD 2NSGA 1K40A 2DGJA 3GM1A 3RW0A 4W8KA 1LVKA 1LIHA 3AJMA 3C8GB 2XLDA 3OEOA 2G3VA 2JPUA 3M15A 1NU7D 3TOLA 4NTBA 2H7OA 3NMIA 3G4XA 4Z9JA 3C8GD 2VC9A 4IRUA 4AK9A 1CPQA 1OKKA 4ONSA 3O55A 5B1AC 4FWVA 4N06A 5DS5A 4NTAA 4CS8C 2QTVA 2ZXPA 4BJTA 2HZ8A 3M79A 4XQ1A 4CDVA 2JX0A 3H65A 3EG9B 2DYRC 3DWWA 4JKVA 2UUIA 4QI0A 5E3AA 3MBGA 5A6BD 2Q00A 4OINF 4AL1A 4XLPF 4YT4A 2VH3A 3L34A 2QNLA 1HE9A 3KL4A 1VOMA 3FOPA 3QMKA 3E70C 5DLJA 5F5HA 1V55C 1G8XA 1RKEB 4NY3A 4IAQA 2R03A 1R4TA 2WB7A 5L0GA 2DB4A 1NSGB 5BQIA 2J7PD 3QVZA 2V26A 4IWBA 3ZG1A 1Q0MA 4CS9C 3C18A 5D92A 3VAYA 3NKEA 3E9VA 1TWCA 3QVYA 1JRAA 4OD5A 2CDQA 1HE1A 2WVOA 4WGYA 4HE8D 2R7OA 1HMOA 1QZXA 3HNLA 2R7UA 2LSEA 1Y4CA 2H7VC 1NFOA 2Y3BA 1O3UA 3HNJA 4OIPF 2H7BA 3CQZA 2KQ9A 3QW1A 1HY5A 2IXMA 1CPRA 3RIPA 3CZ6A 3POVA 2G62A 3C63A 4YT8A 3H2UA 4JZAA 3PDMP 4LLEA 4XPWA 2XL8A 4NC3A 4EBKA 2EIJC 3U8VA 3B0VC 4F4BA 1EKYA 4JE9A 4CJGA 1MMDA 1RJ9A 3GWLA 3GWNA 3AGTA 4WABA 4DRIB 2PFDA 4DVYP 1HW2A 1ORYA 1BBHA 2YKZA 2XS8A 4E0IA 1K05A 2L6FA 3UGOA 2XLOA 3GORA 4JC7A 2YVKA 2B0JA 1RCPA 3TJ6A 4QI2A 1H6GA 2GAQA 2L9JA 4JRZA 2A6HF 1YJGA 2W4MA 4LACB 3DE9A 1EA8A 3LS0A 3M4BA 2ZXWC 3U2MA 5JS5A 2V3CC 2BL2A 4EIYA 3I5QA 1BZ4A 1JPNA 1VYKA 2HSQA 2NSFA 2YQYA 5JP7A 4B6IA 2L6GA 3LEOA 1I4ZA 1SYQA 4PACA 5B3SC 2DYSC 2AWYA 2XL6A 2ZXOA 2M64A 1SZIA 1RXQA 2XL4A 4MTFA 3K33A 4CIHA 4JCZA 4J30B 4CJOA 1AVOB 4PJNA 3U8PA 1XWJA 3LLKA 3QTHA 2EPOA 1I5NA 3LS1A 2EIMC 4BG0A 3CSKA 1H7IA 1PV3A 2Y3HA 3NYMA 5E33A 3LESA 5JUAA 5KYXA 1ZVZA 2QLAA 3DI5A 2PP4A 5CI8A 1LM3B 2ICWG 3N0TA 2VCCA 1T5OA 4N6CA 2WVQA 2IXPA 3W4YA 4GYTA 4MVSA 4YK5A 1E83A 4P9FA 3WODF 2J9UA 4CIPA 4Q5SF 1APCA 2W45A 3S0XA 1YVIA 3C8ZA 3EGXB 5E3CA 1T6QA 4JJFA 2UUHA 2CYDA 2ZD9A 1B68A 1VK5A 4XWJA 1C03A 4RD9A 1JR8A 1ZHTA 1T6IA 3KYIA 1MMGA 4XLNF 4L6RA 3W2VA 3Q7LA 2L81A 4KNVA 1A7DA 2IBFA 3FHDA 4R32A 1M57C 1E85A 2Q7RA 3ZTMA 3L0IA 1KNYA 5B1BC 3ZVRA 1W2WA 1FNTc 1ZW2A 2FAPB 1SR2A 2VCBA 4MNDA 3WAQA 1OW8A 3L1MA 4E7SA 1VYIA 3O10A 4DJ9A 3RF3A 1U0BB 3AQCA 3IQTA 2LIGA 4JURI 1ORJA 1U89A 1LPEA 2KC3A 5L0JA 4O79A 3O39A 2YL3A 3LNMB 3GEEA 1U6HA 2ASRA 2OG2A 4PJMA 1NFNA 2NUTA 2AP3A 3SXKA 3JTLO 2EPKX 2ZXRA 2LK4A 2VCAA 3PMRA 4J32B 3K1IA 2X51A 1WTYA 4JVSA 5F5FA 2X0CA 1OCOC 1Q0FA 4J7YA 1JMWA 2IXNA 4RDAA 5AC5A 2A69F 3MLGA 1UFBA 2I8BA 4IGGA 3EH1A 1T6UA 3VRCA 3GM3A 4LDRA 1TWAA 2Y69C 2YEVA 3JYYA 3RYLA 1G4US 1MMNA 3T6GB 3J06A 2P1AA 5GPGB 1LS4A 2XS1A 2Y39A 2NUTB 2WL8A 4ER9A 3TULA 3GODA 4Q4ZF 3JT1A 1RKCA 3SYNA 3I5PA 5TJ5E 4E17A 2OEXA 3UMHA 1FR0A 4GEHA 3BEHA 3EFOB 2A6EF 1BR2A 3LJBA 1QLEC 1G5ZA 3LEVA 3HKKA 4FAPB 4C3EA 3PHF2 5JLIA 3HLZA 3AG1C 1E2XA 1IZMA 1FMVA 3B0PA 2PBEA 1VLSA 3IQ5A 3QW0A 3K1HA 1I4YA 4PK4A 2OKUA 1C17M 3S27A 1OQCA 2PF4E 4ULWA 3BRJA 2OCCC 2EIKC 1NU9C 2LD6A 4O6YA 3G50A 5L3QA 2NG1A 4MTGA 4E18A 5A6AA 3FOOA 3LLIA 1HW1A 5KYWA 4PFOA 3JZ0A 1O87A 1PD1A 4G0HA 3S29A 3SP1A 5L3VA 4IB4A 1V74B 3T6BA 3K1IC 2M4EA 2XLHA 3HTKC 3JSZA 3LUTB 2VASA 5CI9A 3RQFA 1ST6A 3EGXA 4EUKB 2BE5F 3UMKA 2R7VA 2XXAA 1YZAA 3RQGA 2LCHA 1M2VA 2XSEA 2KNHA 1DOVA 2R02A 3RQEA 4CS8A 4MW8A 4DBQA 2I15A 4I1OB 2J8WA 4JJGA 1Q0KA 3V5ZA 1OCRC 3TOMA 4WJ0A 3SXZA 4U9EA 1BR1A 2NUPA 2R7XA 1D0YA 4U5CE 2XLEA 1LE2A 2FFHA 3RFYA 4CDYA 1NG1A 1J8YF 3S90A 2J7PA 3GM2A 4OD4A 2RD9A 2H8AA 1CGOA 2KW3C 2HMQA 4LERA 3T9OA 4EBJA 2R25A 4IAOA 1FAPB 2HUJA 2KYHA 3ZDLA 4W8PA 4PR9A 2Z15A 3UNGC 4IARA 3ZSUA 4AE4A 3F46A 3S84A 3UGPA 1RKEA 2YRFA 1N1CA 2GA0A 4EWCA 4D4XA 4I3MA 2B0HA 1H9TA 1ZHXA 3EJNA 3DM5A 3A11A 1M2VB 2G3KA 1QKRA 3L8JA 5A6BA 1ZHZA 2VB6A 5DVWA 2L6HA 4U5BE 1NBBA 4BJ1A 3EG9A 1SMYF 3U9MA 5DQTA 4CDAA 4C3BA 3DXJF 4MVOA 3VM6A 3DKAA 3FVYA 1YARO 3NYLA 4N6HA 3U5SA 2YWAA 4LDKA 4JTAB 3EHNA 3QZCA 2WZLA 3EZIA 3W8IA 1IW7F 2W9YA 4CS7A 2HMZA 3N24A 2R7TA 1GS9A 1YLMA 1ZHYA 5L0HA 4FX5A 4MVZA 3I4UA 1VB5A 1ZYRF 4NCQA 4BJ6C 3U3FA 3KKBA 3NYJA 4MVUA 4U5FE 1QSPA 3NMJA 4XPXA 5L0CA 1K04A 4MTOA 1E84A 4PFPA 4ANJA 5D91A 4OIOF 2R7RA 1F1MA 2KSFA 1YA9A 1Q0GA 2ZPAA 4U5EE 3ASNC 3Q7GA 1V54C 2J9BA 1D1BA 3DD7A 3US6A 1JAFA 3DE8A 4EKWA 2GFHA 2YLGA 1MMAA 5COGA 2Q9BA 1ZW3A 3ITFA 2W4BA 4P9TA 4JTCB 2Q9CA 1ZU4A 3ECSA 5BQHA 3LAYA 4JCHA 3K66A 3MFNA 4KNWA 3GANA 4P6IC 1A7VA 4CBEA 5JRAA 2HKVA 3AG3C 4WGZA 1AUEA 2CCYA 4Z9IA 4BPMA 4D4NA 5A6KA 4BJ5A 4LLCA 2GDCA 1L3PA 2CNWD 1LI7A 1KU2A 1C02A 2D5RB 2HSBA 1YYJA 2J0XA 3UMIA 4EHPA 4MVRA 4OIQF 4G78A 2QE9A 256BA 1Z3IX 3DMDA 3HNIA 2J46A 1BDJB 2IYLD 3WHNA 4YL3A 2J0WA 4AX2A 4I1MA 3U0CA 4CSAC 4BJ5C 1JPJA 4YT5A 3HNKA 4XEFA 3FDQA 3U3BA 4JTDB 5F28E 4DRHB 4AE4B 3DZAA 4IJJA 5HSWA 3C7JA 5A6JA 1CGNA 4KI2A 1ZHWA 5BQGA 2AWCA 2HV7A 3U2LA 2NUPB 3B71A 4J7TA 3Q6MA 5KYNA 1S05A 2MYSA 3TK0A 3ZC4A 2FGYA 3C62A 1ZU5A 3IHUA 5E2QA 1LS1A 1OXBA 1HMDA 4JEAA 1Z5ZA 3AG2C 3T6JA 3GEHA 3G4ZA 2J9VA 4I44A 1Q0DA 3OWTA 2HJMA 3JRMO 2LP4A 3NG1A 1QPUA 1WGWA 3ZQYA 2R05A 1LE4A 3A9CA 1FFHA 1TKNA 3MX3A 5IY5C 3MYIA 2XXAB 1M6TA 3TD7A 1VTMP 1MNEA 2XM0A 1KTMA 1D0ZA 4C3DA 2YLIA 3VF0A 5KYXB 4K1OA 1OXKA 3MYFA 3RVZA 2EINC 1WN0A 1Z23A 1OW6A 4Z9HA 1YA7O 4NQFA 4YJWA 1VLTA 4ZLCA 4MW3A 1YZCA 1EQ1A 4ULVA 3RKOF
chains in the Genus database with same CATH topology
1KNYA 2L6FA 3JYYA 3L8IA 3MFNA 3GM2A 1JOGA 3TULA 3C8GA 3RQFA 4EBJA 1OW8A 1WWPA 2KK1A 1V4AA 3O10A 3U3FA 2HSBA 2JX0A 1K04A 3RQGA 3K7DA 2Q00A 2L6GA 1O3UA 1OW7A 3U0CA 1QVXA 4XEVA 3RQEA 3L8JA 4XEKA 2L6HA 1K40A 1ZZPA 2LK4A 2PBEA 3GM1A 4XEFA 1KTMA 5F28E 3S9OA 3AJMA 4EBKA 3C8GB 1WTYA 3GM3A 3BRJA 2JPUA 4R32A 3B71A 1UFBA 2YWAA 1WOLA 1OW6A 3C8GD 4NQFA 3C18A 1PV3A 1K05A 3JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNY A;  2L6F A;  3JYY A;  3L8I A;  3MFN A;  3GM2 A;  1JOG A;  3TUL A;  3C8G A;  3RQF A;  4EBJ A;  1OW8 A;  1WWP A;  2KK1 A;  1V4A A;  3O10 A;  3U3F A;  2HSB A;  2JX0 A;  1K04 A;  3RQG A;  3K7D A;  2Q00 A;  2L6G A;  1O3U A;  1OW7 A;  3U0C A;  1QVX A;  4XEV A;  3RQE A;  3L8J A;  4XEK A;  2L6H A;  1K40 A;  1ZZP A;  2LK4 A;  2PBE A;  3GM1 A;  4XEF A;  1KTM A;  5F28 E;  3S9O A;  3AJM A;  4EBK A;  3C8G B;  1WTY A;  3GM3 A;  3BRJ A;  2JPU A;  4R32 A;  3B71 A;  1UFB A;  2YWA A;  1WOL A;  1OW6 A;  3C8G D;  4NQF A;  3C18 A;  1PV3 A;  1K05 A;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 3DM9 B;  1A41 A;  1TWG A;  5COF A;  1AEP A;  1E86 A;  3CAX A;  3U9J A;  2CW0 F;  3OA1 A;  1YDI A;  1OCC C;  2PNO A;  3M4C A;  3X1O A;  3HJC A;  2D4U A;  4YWQ A;  2OQM A;  2BC5 A;  3FAJ A;  2A1D D;  3IPM O;  5JSL A;  1T9K A;  3GEI A;  2XM4 A;  3DAF A;  4U5D E;  1TFO B;  2WVN A;  4OIR F;  3RH3 A;  3CEX A;  5EK0 A;  5KYY B;  4PJJ A;  3KMI A;  2HFI A;  4XEV A;  3DJN B;  2JD3 A;  2P61 A;  1H9G A;  3B9Q A;  1D1C A;  2A68 F;  5L0F A;  4G7O F;  3NMK A;  4PJL A;  1J8M F;  1MQV A;  3W2W A;  3ZTZ A;  3Q6N A;  1CGM E;  1PCX A;  3EZH A;  1UG7 A;  4O7G A;  2PX0 A;  3N2Z B;  3TJ5 A;  4DVZ A;  3SZR A;  1WOL A;  2XLW A;  2KGO A;  4LDQ A;  2YL1 A;  2OEV A;  4AL0 A;  5DS4 A;  2ETS A;  2WZG A;  2AU5 A;  2EPL X;  4XTK A;  1EI7 A;  4YN0 B;  4YT2 A;  5DS6 A;  5BUO A;  1DOW A;  4DBR A;  2TMV P;  1V4A A;  5T3T A;  1LKX A;  3IQ6 A;  1WAS A;  4DRJ B;  5HV9 A;  1XZP A;  3AQB A;  3JSE O;  3K6B A;  4MVQ A;  4U5G A;  5DQZ A;  3R7C A;  4CS9 A;  1TR2 A;  3ABL C;  1Z63 A;  4K7B A;  1MND A;  4YL1 A;  3LNR A;  2PX3 A;  5FZT A;  3EPV A;  3V5Y A;  1ZZP A;  3B0U X;  1TFK B;  3W8H A;  4DOZ A;  4C7O A;  1T01 A;  2IOQ A;  2YL0 A;  3DJU B;  3TQO A;  2QY9 A;  4MVM A;  4O6M A;  5CIV A;  1M2O A;  4E7Z A;  5JT4 A;  2KJG A;  3KYJ A;  3S28 A;  5B3I A;  5KYU B;  3ABK C;  2YL7 A;  4X0R A;  2F22 A;  5T1D B;  2P7V A;  4JEB A;  2EPM X;  3ZIB A;  3ABM C;  1YAU O;  3AGU A;  1A7E A;  1R5I D;  1XZQ A;  2NPU A;  3M1C B;  4Q7C A;  1L7C A;  2OJE D;  3SEO A;  1GM5 A;  3B29 A;  3SXY A;  4GQH A;  2R7W A;  3ZQV A;  1NZE A;  3IQC A;  4H54 A;  2A0U A;  1WWP A;  1TWH A;  1O5H A;  1Z6A A;  1D1A A;  2Y3G A;  4XPY A;  1ORS C;  3AOU A;  5A69 A;  3UR3 C;  3EH2 A;  1VMA A;  2MWQ A;  4CSA A;  1FTS A;  3PCV A;  1OCZ C;  1OW7 A;  4HFK B;  1QVX A;  4QDL A;  4MS2 A;  4BEM J;  5EHH A;  4FES A;  4XEK A;  4DXW A;  3ATP A;  1A0B A;  4MQ9 F;  5AGF A;  3JRT A;  4U5H A;  5JVE A;  5KYW B;  1D0X A;  1FFT C;  3EQL F;  4NTF A;  4CX9 A;  2AVK A;  3R2P A;  2RSE B;  2J45 A;  4HFF B;  4M63 A;  3SXM A;  1SF8 A;  4A4A A;  4G7H F;  3EHM A;  3KH2 A;  3IEE A;  3VYW A;  2C03 A;  2LFF A;  2IM8 A;  4UDV A;  4EBB A;  4O6N A;  2Q3T A;  3L8I A;  1NLX A;  3RVY A;  3JCU Q;  1Z7Q c;  5KYU A;  2HV6 A;  2R9R B;  2Y3D A;  4A2N B;  3C8G A;  5FCL A;  1PD0 A;  2L7A A;  2P6V A;  3NRH A;  5KYY A;  4C7O B;  3EFO A;  3FXH A;  2DI3 A;  2C04 A;  2GWW A;  2XLV A;  3T4R A;  1OR3 A;  2LQG A;  3SNH A;  2HJ3 A;  3EGD B;  2OOC A;  1OR2 A;  3K7D A;  2XRH A;  1M56 C;  3NDB B;  3V5X A;  1QQ3 A;  1GGQ A;  2MHR A;  2YHS A;  5COM A;  2P0N A;  5T3W A;  2A0B A;  4BJ6 A;  4H4K C;  4RBN A;  1S7Z A;  1LI5 A;  2OJQ A;  2YLD A;  5AC4 A;  2WZF A;  3DAG A;  2CNW A;  2OU6 A;  4JW1 A;  3S9O A;  2EIL C;  3NKD A;  4BEJ A;  1YYX A;  5L0I A;  5L0D A;  2R7S A;  2Q4F A;  3AG4 C;  2EPN A;  3F47 A;  1WAT A;  3KPH A;  2LFD A;  3JYH A;  4HEA J;  3X2Q C;  2HS5 A;  2E87 A;  1FMW A;  3FMS A;  3ZWI A;  4KBL A;  1Y6D A;  1RJ9 B;  4KC9 A;  2O9X A;  1JOG A;  5K0I A;  1G4W R;  1GQA A;  4JIO A;  4N4W A;  2KK1 A;  1RMV A;  4U9D A;  3H2V A;  4K0D A;  2QUP A;  2R7Q A;  4ZLD A;  4YL0 A;  4E0H A;  3FAP B;  2Q9A A;  3V7O A;  2J9W A;  1BR4 A;  1TQG A;  2IXO A;  3ASO C;  5EGY A;  3O6X A;  4G7Z F;  2CGE A;  2XLM A;  2YZS A;  3WG7 C;  3EGD A;  1OKK D;  2NSG A;  1K40 A;  2DGJ A;  3GM1 A;  3RW0 A;  4W8K A;  1LVK A;  1LIH A;  3AJM A;  3C8G B;  2XLD A;  3OEO A;  2G3V A;  2JPU A;  3M15 A;  1NU7 D;  3TOL A;  4NTB A;  2H7O A;  3NMI A;  3G4X A;  4Z9J A;  3C8G D;  2VC9 A;  4IRU A;  4AK9 A;  1CPQ A;  1OKK A;  4ONS A;  3O55 A;  5B1A C;  4FWV A;  4N06 A;  5DS5 A;  4NTA A;  4CS8 C;  2QTV A;  2ZXP A;  4BJT A;  2HZ8 A;  3M79 A;  4XQ1 A;  4CDV A;  2JX0 A;  3H65 A;  3EG9 B;  2DYR C;  3DWW A;  4JKV A;  2UUI A;  4QI0 A;  5E3A A;  3MBG A;  5A6B D;  2Q00 A;  4OIN F;  4AL1 A;  4XLP F;  4YT4 A;  2VH3 A;  3L34 A;  2QNL A;  1HE9 A;  3KL4 A;  1VOM A;  3FOP A;  3QMK A;  3E70 C;  5DLJ A;  5F5H A;  1V55 C;  1G8X A;  1RKE B;  4NY3 A;  4IAQ A;  2R03 A;  1R4T A;  2WB7 A;  5L0G A;  2DB4 A;  1NSG B;  5BQI A;  2J7P D;  3QVZ A;  2V26 A;  4IWB A;  3ZG1 A;  1Q0M A;  4CS9 C;  3C18 A;  5D92 A;  3VAY A;  3NKE A;  3E9V A;  1TWC A;  3QVY A;  1JRA A;  4OD5 A;  2CDQ A;  1HE1 A;  2WVO A;  4WGY A;  4HE8 D;  2R7O A;  1HMO A;  1QZX A;  3HNL A;  2R7U A;  2LSE A;  1Y4C A;  2H7V C;  1NFO A;  2Y3B A;  1O3U A;  3HNJ A;  4OIP F;  2H7B A;  3CQZ A;  2KQ9 A;  3QW1 A;  1HY5 A;  2IXM A;  1CPR A;  3RIP A;  3CZ6 A;  3POV A;  2G62 A;  3C63 A;  4YT8 A;  3H2U A;  4JZA A;  3PDM P;  4LLE A;  4XPW A;  2XL8 A;  4NC3 A;  4EBK A;  2EIJ C;  3U8V A;  3B0V C;  4F4B A;  1EKY A;  4JE9 A;  4CJG A;  1MMD A;  1RJ9 A;  3GWL A;  3GWN A;  3AGT A;  4WAB A;  4DRI B;  2PFD A;  4DVY P;  1HW2 A;  1ORY A;  1BBH A;  2YKZ A;  2XS8 A;  4E0I A;  1K05 A;  2L6F A;  3UGO A;  2XLO A;  3GOR A;  4JC7 A;  2YVK A;  2B0J A;  1RCP A;  3TJ6 A;  4QI2 A;  1H6G A;  2GAQ A;  2L9J A;  4JRZ A;  2A6H F;  1YJG A;  2W4M A;  4LAC B;  3DE9 A;  1EA8 A;  3LS0 A;  3M4B A;  2ZXW C;  3U2M A;  5JS5 A;  2V3C C;  2BL2 A;  4EIY A;  3I5Q A;  1BZ4 A;  1JPN A;  1VYK A;  2HSQ A;  2NSF A;  2YQY A;  5JP7 A;  4B6I A;  2L6G A;  3LEO A;  1I4Z A;  1SYQ A;  4PAC A;  5B3S C;  2DYS C;  2AWY A;  2XL6 A;  2ZXO A;  2M64 A;  1SZI A;  1RXQ A;  2XL4 A;  4MTF A;  3K33 A;  4CIH A;  4JCZ A;  4J30 B;  4CJO A;  1AVO B;  4PJN A;  3U8P A;  1XWJ A;  3LLK A;  3QTH A;  2EPO A;  1I5N A;  3LS1 A;  2EIM C;  4BG0 A;  3CSK A;  1H7I A;  1PV3 A;  2Y3H A;  3NYM A;  5E33 A;  3LES A;  5JUA A;  5KYX A;  1ZVZ A;  2QLA A;  3DI5 A;  2PP4 A;  5CI8 A;  1LM3 B;  2ICW G;  3N0T A;  2VCC A;  1T5O A;  4N6C A;  2WVQ A;  2IXP A;  3W4Y A;  4GYT A;  4MVS A;  4YK5 A;  1E83 A;  4P9F A;  3WOD F;  2J9U A;  4CIP A;  4Q5S F;  1APC A;  2W45 A;  3S0X A;  1YVI A;  3C8Z A;  3EGX B;  5E3C A;  1T6Q A;  4JJF A;  2UUH A;  2CYD A;  2ZD9 A;  1B68 A;  1VK5 A;  4XWJ A;  1C03 A;  4RD9 A;  1JR8 A;  1ZHT A;  1T6I A;  3KYI A;  1MMG A;  4XLN F;  4L6R A;  3W2V A;  3Q7L A;  2L81 A;  4KNV A;  1A7D A;  2IBF A;  3FHD A;  4R32 A;  1M57 C;  1E85 A;  2Q7R A;  3ZTM A;  3L0I A;  1KNY A;  5B1B C;  3ZVR A;  1W2W A;  1FNT c;  1ZW2 A;  2FAP B;  1SR2 A;  2VCB A;  4MND A;  3WAQ A;  1OW8 A;  3L1M A;  4E7S A;  1VYI A;  3O10 A;  4DJ9 A;  3RF3 A;  1U0B B;  3AQC A;  3IQT A;  2LIG A;  4JUR I;  1ORJ A;  1U89 A;  1LPE A;  2KC3 A;  5L0J A;  4O79 A;  3O39 A;  2YL3 A;  3LNM B;  3GEE A;  1U6H A;  2ASR A;  2OG2 A;  4PJM A;  1NFN A;  2NUT A;  2AP3 A;  3SXK A;  3JTL O;  2EPK X;  2ZXR A;  2LK4 A;  2VCA A;  3PMR A;  4J32 B;  3K1I A;  2X51 A;  1WTY A;  4JVS A;  5F5F A;  2X0C A;  1OCO C;  1Q0F A;  4J7Y A;  1JMW A;  2IXN A;  4RDA A;  5AC5 A;  2A69 F;  3MLG A;  1UFB A;  2I8B A;  4IGG A;  3EH1 A;  1T6U A;  3VRC A;  3GM3 A;  4LDR A;  1TWA A;  2Y69 C;  2YEV A;  3JYY A;  3RYL A;  1G4U S;  1MMN A;  3T6G B;  3J06 A;  2P1A A;  5GPG B;  1LS4 A;  2XS1 A;  2Y39 A;  2NUT B;  2WL8 A;  4ER9 A;  3TUL A;  3GOD A;  4Q4Z F;  3JT1 A;  1RKC A;  3SYN A;  3I5P A;  5TJ5 E;  4E17 A;  2OEX A;  3UMH A;  1FR0 A;  4GEH A;  3BEH A;  3EFO B;  2A6E F;  1BR2 A;  3LJB A;  1QLE C;  1G5Z A;  3LEV A;  3HKK A;  4FAP B;  4C3E A;  3PHF 2;  5JLI A;  3HLZ A;  3AG1 C;  1E2X A;  1IZM A;  1FMV A;  3B0P A;  2PBE A;  1VLS A;  3IQ5 A;  3QW0 A;  3K1H A;  1I4Y A;  4PK4 A;  2OKU A;  1C17 M;  3S27 A;  1OQC A;  2PF4 E;  4ULW A;  3BRJ A;  2OCC C;  2EIK C;  1NU9 C;  2LD6 A;  4O6Y A;  3G50 A;  5L3Q A;  2NG1 A;  4MTG A;  4E18 A;  5A6A A;  3FOO A;  3LLI A;  1HW1 A;  5KYW A;  4PFO A;  3JZ0 A;  1O87 A;  1PD1 A;  4G0H A;  3S29 A;  3SP1 A;  5L3V A;  4IB4 A;  1V74 B;  3T6B A;  3K1I C;  2M4E A;  2XLH A;  3HTK C;  3JSZ A;  3LUT B;  2VAS A;  5CI9 A;  3RQF A;  1ST6 A;  3EGX A;  4EUK B;  2BE5 F;  3UMK A;  2R7V A;  2XXA A;  1YZA A;  3RQG A;  2LCH A;  1M2V A;  2XSE A;  2KNH A;  1DOV A;  2R02 A;  3RQE A;  4CS8 A;  4MW8 A;  4DBQ A;  2I15 A;  4I1O B;  2J8W A;  4JJG A;  1Q0K A;  3V5Z A;  1OCR C;  3TOM A;  4WJ0 A;  3SXZ A;  4U9E A;  1BR1 A;  2NUP A;  2R7X A;  1D0Y A;  4U5C E;  2XLE A;  1LE2 A;  2FFH A;  3RFY A;  4CDY A;  1NG1 A;  1J8Y F;  3S90 A;  2J7P A;  3GM2 A;  4OD4 A;  2RD9 A;  2H8A A;  1CGO A;  2KW3 C;  2HMQ A;  4LER A;  3T9O A;  4EBJ A;  2R25 A;  4IAO A;  1FAP B;  2HUJ A;  2KYH A;  3ZDL A;  4W8P A;  4PR9 A;  2Z15 A;  3UNG C;  4IAR A;  3ZSU A;  4AE4 A;  3F46 A;  3S84 A;  3UGP A;  1RKE A;  2YRF A;  1N1C A;  2GA0 A;  4EWC A;  4D4X A;  4I3M A;  2B0H A;  1H9T A;  1ZHX A;  3EJN A;  3DM5 A;  3A11 A;  1M2V B;  2G3K A;  1QKR A;  3L8J A;  5A6B A;  1ZHZ A;  2VB6 A;  5DVW A;  2L6H A;  4U5B E;  1NBB A;  4BJ1 A;  3EG9 A;  1SMY F;  3U9M A;  5DQT A;  4CDA A;  4C3B A;  3DXJ F;  4MVO A;  3VM6 A;  3DKA A;  3FVY A;  1YAR O;  3NYL A;  4N6H A;  3U5S A;  2YWA A;  4LDK A;  4JTA B;  3EHN A;  3QZC A;  2WZL A;  3EZI A;  3W8I A;  1IW7 F;  2W9Y A;  4CS7 A;  2HMZ A;  3N24 A;  2R7T A;  1GS9 A;  1YLM A;  1ZHY A;  5L0H A;  4FX5 A;  4MVZ A;  3I4U A;  1VB5 A;  1ZYR F;  4NCQ A;  4BJ6 C;  3U3F A;  3KKB A;  3NYJ A;  4MVU A;  4U5F E;  1QSP A;  3NMJ A;  4XPX A;  5L0C A;  1K04 A;  4MTO A;  1E84 A;  4PFP A;  4ANJ A;  5D91 A;  4OIO F;  2R7R A;  1F1M A;  2KSF A;  1YA9 A;  1Q0G A;  2ZPA A;  4U5E E;  3ASN C;  3Q7G A;  1V54 C;  2J9B A;  1D1B A;  3DD7 A;  3US6 A;  1JAF A;  3DE8 A;  4EKW A;  2GFH A;  2YLG A;  1MMA A;  5COG A;  2Q9B A;  1ZW3 A;  3ITF A;  2W4B A;  4P9T A;  4JTC B;  2Q9C A;  1ZU4 A;  3ECS A;  5BQH A;  3LAY A;  4JCH A;  3K66 A;  3MFN A;  4KNW A;  3GAN A;  4P6I C;  1A7V A;  4CBE A;  5JRA A;  2HKV A;  3AG3 C;  4WGZ A;  1AUE A;  2CCY A;  4Z9I A;  4BPM A;  4D4N A;  5A6K A;  4BJ5 A;  4LLC A;  2GDC A;  1L3P A;  2CNW D;  1LI7 A;  1KU2 A;  1C02 A;  2D5R B;  2HSB A;  1YYJ A;  2J0X A;  3UMI A;  4EHP A;  4MVR A;  4OIQ F;  4G78 A;  2QE9 A;  256B A;  1Z3I X;  3DMD A;  3HNI A;  2J46 A;  1BDJ B;  2IYL D;  3WHN A;  4YL3 A;  2J0W A;  4AX2 A;  4I1M A;  3U0C A;  4CSA C;  4BJ5 C;  1JPJ A;  4YT5 A;  3HNK A;  4XEF A;  3FDQ A;  3U3B A;  4JTD B;  5F28 E;  4DRH B;  4AE4 B;  3DZA A;  4IJJ A;  5HSW A;  3C7J A;  5A6J A;  1CGN A;  4KI2 A;  1ZHW A;  5BQG A;  2AWC A;  2HV7 A;  3U2L A;  2NUP B;  3B71 A;  4J7T A;  3Q6M A;  5KYN A;  1S05 A;  2MYS A;  3TK0 A;  3ZC4 A;  2FGY A;  3C62 A;  1ZU5 A;  3IHU A;  5E2Q A;  1LS1 A;  1OXB A;  1HMD A;  4JEA A;  1Z5Z A;  3AG2 C;  3T6J A;  3GEH A;  3G4Z A;  2J9V A;  4I44 A;  1Q0D A;  3OWT A;  2HJM A;  3JRM O;  2LP4 A;  3NG1 A;  1QPU A;  1WGW A;  3ZQY A;  2R05 A;  1LE4 A;  3A9C A;  1FFH A;  1TKN A;  3MX3 A;  5IY5 C;  3MYI A;  2XXA B;  1M6T A;  3TD7 A;  1VTM P;  1MNE A;  2XM0 A;  1KTM A;  1D0Z A;  4C3D A;  2YLI A;  3VF0 A;  5KYX B;  4K1O A;  1OXK A;  3MYF A;  3RVZ A;  2EIN C;  1WN0 A;  1Z23 A;  1OW6 A;  4Z9H A;  1YA7 O;  4NQF A;  4YJW A;  1VLT A;  4ZLC A;  4MW3 A;  1YZC A;  1EQ1 A;  4ULV A;  3RKO F; 
#chains in the Genus database with same CATH homology
 1KNY A;  2L6F A;  3JYY A;  3L8I A;  3MFN A;  3GM2 A;  1JOG A;  3TUL A;  3C8G A;  3RQF A;  4EBJ A;  1OW8 A;  1WWP A;  2KK1 A;  1V4A A;  3O10 A;  3U3F A;  2HSB A;  2JX0 A;  1K04 A;  3RQG A;  3K7D A;  2Q00 A;  2L6G A;  1O3U A;  1OW7 A;  3U0C A;  1QVX A;  4XEV A;  3RQE A;  3L8J A;  4XEK A;  2L6H A;  1K40 A;  1ZZP A;  2LK4 A;  2PBE A;  3GM1 A;  4XEF A;  1KTM A;  5F28 E;  3S9O A;  3AJM A;  4EBK A;  3C8G B;  1WTY A;  3GM3 A;  3BRJ A;  2JPU A;  4R32 A;  3B71 A;  1UFB A;  2YWA A;  1WOL A;  1OW6 A;  3C8G D;  4NQF A;  3C18 A;  1PV3 A;  1K05 A;  3JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...