2JPUA

Solution structure of nesg target ssr10, orf c02003 protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Orf c02003 protein
publication title Solution structure of NESG target SsR10, Orf c02003 protein
rcsb
source organism Sulfolobus solfataricus
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jpuA00
4R32A 2PBEA 2L6FA 1PV3A 2YWAA 4XEFA 2L6HA 3GM2A 3L8IA 3GM1A 5F28E 1QVXA 3K7DA 3C8GB 1UFBA 1KNYA 1K40A 4EBJA 3C8GA 3O10A 3RQEA 2L6GA 3RQGA 1OW7A 3U0CA 3TULA 3U3FA 1JOGA 3C18A 3JZ0A 1KTMA 3B71A 2Q00A 1K04A 2JPUA 1WOLA 1WWPA 4XEVA 4EBKA 2JX0A 1OW8A 3L8JA 4XEKA 4NQFA 3MFNA 3AJMA 2LK4A 3RQFA 1K05A 1O3UA 2HSBA 3C8GD 1WTYA 3JYYA 3S9OA 3GM3A 2KK1A 1V4AA 1ZZPA 3BRJA 1OW6A
chains in the Genus database with same CATH superfamily
3HNLA 4NTBA 3ZQVA 4CIHA 3SYNA 3F47A 1ZHWA 3F46A 2HZ8A 2VCAA 3FAPB 4PK4A 3NKEA 3RF3A 4XLPF 3RQGA 3S84A 1OW7A 3KH2A 2WL8A 3NYMA 3E9VA 1VK5A 2J8WA 1QLEC 2KYHA 2Z15A 3Q7LA 3AQCA 3EZHA 4GYTA 4XEKA 2A6EF 1MMAA 4WGZA 3GANA 1LIHA 2J46A 3EZIA 1J8MF 2DB4A 2YL1A 1J8YF 2HSBA 3NRHA 4FX5A 4OIRF 3ZTMA 4EKWA 256BA 4ULVA 3DJNB 4YN0B 3LS1A 4MVOA 4CS9A 1LI5A 2EIMC 1Z6AA 2XL6A 5E3CA 4XLNF 2IM8A 4DJ9A 3U9JA 1VB5A 4JIOA 2YQYA 4ZLCA 5BUOA 2J0XA 3K1HA 5JT4A 4JKVA 1TR2A 2YWAA 3GWLA 4D4NA 3CQZA 1BR1A 1Z3IX 3U2LA 2QE9A 2P7VA 2IXOA 3LS0A 2LIGA 3B0VC 1WGWA 3IQTA 3X1OA 2H7OA 1OKKD 3AG4C 4PFOA 3UR3C 1YA7O 1JOGA 2J45A 1MQVA 3VRCA 2ZXWC 3B71A 4IAOA 3TOMA 2J9VA 3ABLC 2ASRA 3TK0A 2XLMA 2LD6A 1ORSC 1Q0FA 1RKEA 2CNWD 4J32B 4IGGA 2OU6A 4CSAC 3ITFA 5T1DB 3B0UX 2X51A 3M79A 1L3PA 3EFOB 2EILC 2Y39A 1CPRA 3ECSA 3EQLF 4ONSA 1EA8A 2LP4A 4D4XA 5AC5A 1IW7F 1Z5ZA 3NYJA 3TJ5A 4WABA 4P9FA 1U6HA 3RIPA 1PD0A 1RXQA 2L6HA 2YLGA 3L8IA 1NSGB 2L9JA 3S28A 5HSWA 1Q0MA 3RQEA 1PCXA 4K7BA 2WB7A 4MNDA 2B0HA 2OOCA 3MX3A 1Z63A 1LS1A 3QW0A 3EGXA 4P6IC 1Y6DA 3JT1A 3U9MA 3HTKC 3IQ5A 1G5ZA 1GGQA 1ZW2A 1KTMA 3DZAA 2MWQA 1U89A 5K0IA 4OIQF 4DVYP 5KYXA 2LK4A 1NFOA 1LKXA 1QQ3A 4YWQA 4U5FE 1HE9A 1TQGA 3I5PA 4JJGA 2A68F 3ABKC 4XTKA 2H7BA 4MS2A 2HV6A 2KK1A 3ASNC 2PX3A 2H7VC 3B9QA 3UMHA 2YLIA 2EPOA 2HJMA 4PJMA 3JCUQ 1SMYF 3DM5A 3OEOA 1H9TA 1FNTc 5F28E 1A7DA 2LFFA 5BQIA 2CCYA 5AC4A 4DBRA 3EHNA 1NG1A 4BJTA 1G8XA 1KU2A 1HMDA 2LCHA 3L34A 1F1MA 2XSEA 4O6NA 1K04A 1NU7D 2AU5A 2HMZA 1I4YA 2ZXRA 3AOUA 3HJCA 2EPKX 4O79A 2I15A 3LEVA 4P9TA 3L8JA 4WJ0A 4YJWA 5L0CA 5L0HA 3NDBB 1JRAA 1O3UA 4HE8D 3H65A 5GPGB 2W9YA 2J7PD 2QLAA 4BJ6C 5D92A 3W4YA 1S05A 1GS9A 3DWWA 2DYRC 3FHDA 1D1BA 3T6BA 5DS6A 2Q7RA 1ZZPA 4CS8A 4CSAA 5B3IA 3C62A 1O87A 1TWAA 2VCBA 4XEFA 4Z9HA 2KGOA 2XRHA 2DGJA 3HKKA 1ZYRF 4U5HA 1OXKA 4JCZA 2A6HF 4WGYA 5A6BA 4N4WA 4W8PA 1UG7A 2X0CA 3WODF 3TULA 2ICWG 1TFOB 3EGXB 3EH2A 3C18A 5DS4A 3EHMA 2P1AA 3DAFA 3LUTB 3X2QC 3AGUA 1EKYA 4OD5A 2V26A 1QKRA 3JRTA 4QDLA 2HKVA 2R02A 5KYYB 3PDMP 1FMWA 4KNVA 1TWHA 1E85A 2Y3BA 3QVYA 2P6VA 3TJ6A 2KQ9A 3DMDA 2WZLA 5L0GA 2R7VA 3KYJA 2J9UA 2DYSC 3LESA 4CBEA 1HW1A 1YLMA 1OW6A 4MVSA 4JRZA 4AL0A 2W4BA 1VMAA 2L6FA 2FGYA 1FFTC 4BEMJ 5DQZA 2XLVA 3UGOA 1LS4A 4C3BA 2GFHA 1A7EA 5B1BC 1MNDA 1NU9C 2R7UA 3CZ6A 1Q0DA 4JZAA 4YL0A 4LLEA 2D4UA 2ZXOA 3C8GA 3QVZA 4YL1A 3DI5A 3JTLO 5DQTA 4CDYA 1VTMP 5A6KA 4AL1A 2P0NA 2W4MA 2R7RA 4PJJA 3UGPA 3K33A 1TKNA 2NPUA 3HLZA 4JCHA 1GQAA 4K1OA 3AG2C 3K6BA 4FESA 3JRMO 2AWCA 2IOQA 4JEAA 3RKOF 3W2VA 5A69A 1QPUA 3MFNA 5JS5A 1T6QA 1RMVA 1N1CA 1D0YA 2ETSA 4NTFA 3LAYA 1YDIA 3HNIA 3G4ZA 1OKKA 3MBGA 4K0DA 2KW3C 3VM6A 1CGNA 2MYSA 3LNRA 1VOMA 3NKDA 5BQHA 2E87A 3RVZA 1H6GA 3I4UA 3SNHA 4U9EA 2R7SA 2VB6A 1M2OA 1OCCC 2ZPAA 5E3AA 3LNMB 1PV3A 1H7IA 2Y3HA 2CNWA 2WVQA 4LLCA 3G4XA 3GM2A 4I44A 4BJ6A 3AG3C 3FAJA 1JR8A 1UFBA 4EUKB 2M64A 4NC3A 5FZTA 4RDAA 4ER9A 2PP4A 4EBBA 2F22A 4G7ZF 3ZVRA 2Y69C 3UMIA 1BR4A 3N0TA 1SF8A 4G78A 4U9DA 2GDCA 4J7TA 1YARO 3B0PA 3C7JA 3K66A 4XPXA 4Z9JA 5F5HA 5AGFA 4CS8C 2R7TA 3U5SA 1EQ1A 3L0IA 1QSPA 1XZPA 1ZVZA 4KNWA 5JRAA 5L3VA 4AX2A 4G7HF 3DJUB 1NZEA 3K1IC 1V4AA 3IQCA 1XZQA 1ZW3A 1NLXA 3FMSA 4U5EE 5CIVA 2XXAA 2UUIA 1AVOB 2QY9A 3FXHA 2J9WA 3NMKA 1TWCA 1MMDA 1D0XA 2KJGA 2AWYA 2XLEA 3C8GB 1KNYA 1LE2A 1V55C 1ZHYA 1W2WA 1IZMA 1AEPA 4MVRA 5L0DA 1M57C 1YZAA 2GA0A 3AG1C 1G4WR 3WG7C 4C7OA 3ZIBA 1SZIA 3KKBA 4MW3A 2CYDA 5JP7A 3SEOA 4XWJA 2EPLX 1C03A 3A9CA 2QTVA 4DRJB 2KSFA 3DE8A 4O6YA 2YKZA 3POVA 1OCRC 5A6JA 2B0JA 3MLGA 2NUPA 3LLKA 1JPJA 2RSEB 4OINF 5IY5C 2EIJC 2HJ3A 2CW0F 2OG2A 4IB4A 1G4US 4R32A 1LPEA 1WATA 3DE9A 5EK0A 2OJQA 3DKAA 1FMVA 3GODA 4U5GA 3NMJA 4XPWA 1OXBA 2A0BA 1YAUO 2KNHA 1FTSA 1D1AA 2ZD9A 3DD7A 4H4KC 5L0JA 4PFPA 4EBJA 4N06A 2IYLD 3GEEA 2XLOA 5E33A 4YK5A 3V5XA 3FOPA 4XEVA 1MMNA 5E2QA 4H54A 4IJJA 5L0IA 2CGEA 1RKEB 4Z9IA 3AJMA 3M4BA 3S29A 2Q4FA 1K05A 4M63A 1MNEA 2IXPA 2NSFA 1ST6A 3EG9A 2UUHA 4MVMA 3UNGC 4CS7A 4IWBA 4Q5SF 2OQMA 3VF0A 2Q9BA 4ZLDA 3QMKA 3V7OA 1ZU4A 3Q7GA 2KC3A 3E70C 4N6CA 3U3BA 4LDRA 4LDQA 4EHPA 2YL0A 2XXAB 2XL8A 2RD9A 3NYLA 4AE4A 3KYIA 2HFIA 1L7CA 2YL7A 2R25A 2XS1A 3DXJF 4JTDB 3SXMA 4JC7A 2R7WA 2NUTA 4BEJA 2BE5F 1EI7A 3MYIA 3GWNA 5HV9A 4UDVA 3K1IA 4PACA 2OJED 3UMKA 1T01A 1CGME 3T9OA 1VLSA 3U8PA 5COFA 1H9GA 4OIPF 4HFFB 3WAQA 3FDQA 4OIOF 2Q00A 2JPUA 1VYIA 1QZXA 4CX9A 1MMGA 2R9RB 5KYXB 4NY3A 5JVEA 3AGTA 3RFYA 4DRIB 3PHF2 3R2PA 3LEOA 1D0ZA 4PR9A 3EH1A 1HE1A 2NSGA 2FFHA 2NUPB 1FAPB 4XQ1A 3IEEA 1BBHA 3S9OA 3GM3A 1A7VA 3HNKA 2O9XA 4JE9A 1Q0KA 3DM9B 1NFNA 2D5RB 2IXMA 1E2XA 2Q9CA 5DS5A 1V54C 1DOVA 2FAPB 4JTAB 3ATPA 3Q6MA 2R03A 4A2NB 4B6IA 2CDQA 1OR3A 1OCOC 2JD3A 2XL4A 4O7GA 1VLTA 3TQOA 1FR0A 2HSQA 3RYLA 1M2VA 4MQ9F 3GEHA 5COGA 1VYKA 2G3KA 1JPNA 1BZ4A 2NG1A 3IQ6A 1U0BB 2QUPA 2OKUA 4Q7CA 5T3WA 1YJGA 2A0UA 2OEXA 3EFOA 3JYHA 4O6MA 3T6JA 2LFDA 2A1DD 4RBNA 5DVWA 1LE4A 1YA9A 3ASOC 2YRFA 3ZTZA 2G62A 4ANJA 4AE4B 2PFDA 1JMWA 3BRJA 3O39A 1RKCA 4DVZA 4F4BA 1A41A 1T9KA 1O5HA 2NUTB 2VH3A 2EINC 1Y4CA 3BEHA 4I1OB 3SXZA 3W8IA 1I4ZA 2QNLA 1XWJA 4CJOA 1DOWA 2L7AA 3KMIA 2DI3A 2HMQA 1A0BA 2L6GA 3O10A 3O55A 1B68A 3U0CA 1YZCA 3DAGA 2HUJA 4QI0A 4MTOA 5KYNA 3IPMO 3JZ0A 3N24A 5T3TA 1AUEA 1T6UA 4PJLA 2L81A 3JSEO 2YL3A 1Z7Qc 3S27A 2EPMX 4I3MA 4AK9A 4EBKA 4EWCA 3RW0A 3ZDLA 5A6AA 2XLHA 3Q6NA 3M1CB 4NQFA 3W8HA 4CDVA 5DLJA 2A69F 2OCCC 1SYQA 1T6IA 2WZGA 2H8AA 2GAQA 3C8GD 3QZCA 3J06A 5BQGA 2OEVA 4DOZA 4W8KA 1TWGA 2GWWA 2AP3A 1APCA 1RJ9A 2HS5A 2J9BA 2PBEA 2WZFA 2J0WA 4U5BE 4KI2A 4GEHA 1LM3B 3GM1A 3PCVA 2LQGA 4L6RA 4CJGA 4DBQA 4G7OF 1OR2A 3O6XA 4FAPB 2HV7A 5KYUA 4E0HA 2ZXPA 1I5NA 1ORYA 4LERA 2C04A 3VYWA 4E0IA 4QI2A 4BPMA 5KYWA 4X0RA 5EHHA 1M2VB 3VAYA 4MVUA 1RCPA 1WOLA 3HNJA 1Q0GA 5JLIA 1LVKA 3NG1A 1WN0A 4KBLA 2PNOA 3GEIA 2Q3TA 4G0HA 2R05A 4MW8A 5F5FA 1JAFA 4JURI 1HY5A 4HEAJ 4U5CE 1D1CA 3M15A 4LACB 4CIPA 5JUAA 1OCZC 3JYYA 1HMOA 3TD7A 3T4RA 3AQBA 3WHNA 2IXNA 4MVZA 3US6A 1ZHXA 3EGDA 4BJ1A 4E17A 2AVKA 4BJ5C 1ORJA 1TFKB 3CAXA 3C8ZA 3ZG1A 4DXWA 2TMVP 4E7SA 1QVXA 5CI8A 2J7PA 2WVNA 1Z23A 3LJBA 3ZWIA 4C3DA 4JTCB 1CPQA 4OD4A 3U3FA 1V74B 1ZU5A 2EIKC 2PX0A 2YHSA 3CSKA 4YT8A 1OQCA 2YEVA 5KYYA 3H2UA 3N2ZB 4GQHA 2R7OA 1R5ID 2Y3DA 4MVQA 3RQFA 4LDKA 5EGYA 4IARA 3PMRA 2WVOA 2XM4A 1YYXA 1C17M 2VASA 2EPNA 4XPYA 2BC5A 4A4AA 1YYJA 2G3VA 2XLWA 1RJ9B 1SR2A 5L0FA 4C3EA 2I8BA 3A11A 5JSLA 2XS8A 1YVIA 5FCLA 4Q4ZF 4JEBA 4PJNA 3U8VA 4N6HA 1PD1A 4JVSA 3W2WA 3U2MA 2XLDA 3QTHA 3B29A 4RD9A 2C03A 1K40A 3SXYA 3LLIA 5KYUB 2LSEA 3JSZA 4YL3A 4ULWA 3RH3A 5KYWB 3V5ZA 3SXKA 5B3SC 4C7OB 3G50A 3OA1A 4IRUA 2YZSA 4NTAA 1E84A 4CS9C 2JX0A 2YVKA 1E86A 1OW8A 3QW1A 4HFKB 4YT5A 3SP1A 3ABMC 4CDAA 3S0XA 3L1MA 4YT4A 4MTGA 2V3CC 1T5OA 1M56C 4JJFA 4E7ZA 3ZSUA 2Y3GA 3M4CA 3TOLA 3V5YA 1FFHA 1LI7A 3EGDB 3OWTA 1NBBA 3CEXA 4E18A 4YT2A 4DRHB 2BL2A 2VC9A 1CGOA 5COMA 3ZQYA 2IBFA 2P61A 2YLDA 3K7DA 4MTFA 2MHRA 4JW1A 2XM0A 3R7CA 4J30B 3SZRA 3GORA 4KC9A 4I1MA 3T6GB 3S90A 2W45A 1ZHZA 3FOOA 5B1AC 1BDJB 1BR2A 4BG0A 5TJ5E 2Q9AA 4BJ5A 1HW2A 1R4TA 1C02A 1WWPA 3ZC4A 5L3QA 2R7XA 3KL4A 4EIYA 1M6TA 2VCCA 1S7ZA 3IHUA 4J7YA 1GM5A 2M4EA 3H2VA 2PF4E 3MYFA 3EJNA 4FWVA 5D91A 3EG9B 4NCQA 5A6BD 1WTYA 3I5QA 3NMIA 1WASA 4U5DE 5CI9A 3C63A 3FVYA 3RVYA 3EPVA 2R7QA 4IAQA 3KPHA 1ZHTA 1E83A
chains in the Genus database with same CATH topology
4R32A 2PBEA 2L6FA 1PV3A 2YWAA 4XEFA 2L6HA 3GM2A 3L8IA 3GM1A 5F28E 1QVXA 3K7DA 3C8GB 1UFBA 1KNYA 1K40A 4EBJA 3C8GA 3O10A 3RQEA 2L6GA 3RQGA 1OW7A 3U0CA 3TULA 3U3FA 1JOGA 3C18A 3JZ0A 1KTMA 3B71A 2Q00A 1K04A 2JPUA 1WOLA 1WWPA 4XEVA 4EBKA 2JX0A 1OW8A 3L8JA 4XEKA 4NQFA 3MFNA 3AJMA 2LK4A 3RQFA 1K05A 1O3UA 2HSBA 3C8GD 1WTYA 3JYYA 3S9OA 3GM3A 2KK1A 1V4AA 1ZZPA 3BRJA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R32 A;  2PBE A;  2L6F A;  1PV3 A;  2YWA A;  4XEF A;  2L6H A;  3GM2 A;  3L8I A;  3GM1 A;  5F28 E;  1QVX A;  3K7D A;  3C8G B;  1UFB A;  1KNY A;  1K40 A;  4EBJ A;  3C8G A;  3O10 A;  3RQE A;  2L6G A;  3RQG A;  1OW7 A;  3U0C A;  3TUL A;  3U3F A;  1JOG A;  3C18 A;  3JZ0 A;  1KTM A;  3B71 A;  2Q00 A;  1K04 A;  2JPU A;  1WOL A;  1WWP A;  4XEV A;  4EBK A;  2JX0 A;  1OW8 A;  3L8J A;  4XEK A;  4NQF A;  3MFN A;  3AJM A;  2LK4 A;  3RQF A;  1K05 A;  1O3U A;  2HSB A;  3C8G D;  1WTY A;  3JYY A;  3S9O A;  3GM3 A;  2KK1 A;  1V4A A;  1ZZP A;  3BRJ A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 3HNL A;  4NTB A;  3ZQV A;  4CIH A;  3SYN A;  3F47 A;  1ZHW A;  3F46 A;  2HZ8 A;  2VCA A;  3FAP B;  4PK4 A;  3NKE A;  3RF3 A;  4XLP F;  3RQG A;  3S84 A;  1OW7 A;  3KH2 A;  2WL8 A;  3NYM A;  3E9V A;  1VK5 A;  2J8W A;  1QLE C;  2KYH A;  2Z15 A;  3Q7L A;  3AQC A;  3EZH A;  4GYT A;  4XEK A;  2A6E F;  1MMA A;  4WGZ A;  3GAN A;  1LIH A;  2J46 A;  3EZI A;  1J8M F;  2DB4 A;  2YL1 A;  1J8Y F;  2HSB A;  3NRH A;  4FX5 A;  4OIR F;  3ZTM A;  4EKW A;  256B A;  4ULV A;  3DJN B;  4YN0 B;  3LS1 A;  4MVO A;  4CS9 A;  1LI5 A;  2EIM C;  1Z6A A;  2XL6 A;  5E3C A;  4XLN F;  2IM8 A;  4DJ9 A;  3U9J A;  1VB5 A;  4JIO A;  2YQY A;  4ZLC A;  5BUO A;  2J0X A;  3K1H A;  5JT4 A;  4JKV A;  1TR2 A;  2YWA A;  3GWL A;  4D4N A;  3CQZ A;  1BR1 A;  1Z3I X;  3U2L A;  2QE9 A;  2P7V A;  2IXO A;  3LS0 A;  2LIG A;  3B0V C;  1WGW A;  3IQT A;  3X1O A;  2H7O A;  1OKK D;  3AG4 C;  4PFO A;  3UR3 C;  1YA7 O;  1JOG A;  2J45 A;  1MQV A;  3VRC A;  2ZXW C;  3B71 A;  4IAO A;  3TOM A;  2J9V A;  3ABL C;  2ASR A;  3TK0 A;  2XLM A;  2LD6 A;  1ORS C;  1Q0F A;  1RKE A;  2CNW D;  4J32 B;  4IGG A;  2OU6 A;  4CSA C;  3ITF A;  5T1D B;  3B0U X;  2X51 A;  3M79 A;  1L3P A;  3EFO B;  2EIL C;  2Y39 A;  1CPR A;  3ECS A;  3EQL F;  4ONS A;  1EA8 A;  2LP4 A;  4D4X A;  5AC5 A;  1IW7 F;  1Z5Z A;  3NYJ A;  3TJ5 A;  4WAB A;  4P9F A;  1U6H A;  3RIP A;  1PD0 A;  1RXQ A;  2L6H A;  2YLG A;  3L8I A;  1NSG B;  2L9J A;  3S28 A;  5HSW A;  1Q0M A;  3RQE A;  1PCX A;  4K7B A;  2WB7 A;  4MND A;  2B0H A;  2OOC A;  3MX3 A;  1Z63 A;  1LS1 A;  3QW0 A;  3EGX A;  4P6I C;  1Y6D A;  3JT1 A;  3U9M A;  3HTK C;  3IQ5 A;  1G5Z A;  1GGQ A;  1ZW2 A;  1KTM A;  3DZA A;  2MWQ A;  1U89 A;  5K0I A;  4OIQ F;  4DVY P;  5KYX A;  2LK4 A;  1NFO A;  1LKX A;  1QQ3 A;  4YWQ A;  4U5F E;  1HE9 A;  1TQG A;  3I5P A;  4JJG A;  2A68 F;  3ABK C;  4XTK A;  2H7B A;  4MS2 A;  2HV6 A;  2KK1 A;  3ASN C;  2PX3 A;  2H7V C;  3B9Q A;  3UMH A;  2YLI A;  2EPO A;  2HJM A;  4PJM A;  3JCU Q;  1SMY F;  3DM5 A;  3OEO A;  1H9T A;  1FNT c;  5F28 E;  1A7D A;  2LFF A;  5BQI A;  2CCY A;  5AC4 A;  4DBR A;  3EHN A;  1NG1 A;  4BJT A;  1G8X A;  1KU2 A;  1HMD A;  2LCH A;  3L34 A;  1F1M A;  2XSE A;  4O6N A;  1K04 A;  1NU7 D;  2AU5 A;  2HMZ A;  1I4Y A;  2ZXR A;  3AOU A;  3HJC A;  2EPK X;  4O79 A;  2I15 A;  3LEV A;  4P9T A;  3L8J A;  4WJ0 A;  4YJW A;  5L0C A;  5L0H A;  3NDB B;  1JRA A;  1O3U A;  4HE8 D;  3H65 A;  5GPG B;  2W9Y A;  2J7P D;  2QLA A;  4BJ6 C;  5D92 A;  3W4Y A;  1S05 A;  1GS9 A;  3DWW A;  2DYR C;  3FHD A;  1D1B A;  3T6B A;  5DS6 A;  2Q7R A;  1ZZP A;  4CS8 A;  4CSA A;  5B3I A;  3C62 A;  1O87 A;  1TWA A;  2VCB A;  4XEF A;  4Z9H A;  2KGO A;  2XRH A;  2DGJ A;  3HKK A;  1ZYR F;  4U5H A;  1OXK A;  4JCZ A;  2A6H F;  4WGY A;  5A6B A;  4N4W A;  4W8P A;  1UG7 A;  2X0C A;  3WOD F;  3TUL A;  2ICW G;  1TFO B;  3EGX B;  3EH2 A;  3C18 A;  5DS4 A;  3EHM A;  2P1A A;  3DAF A;  3LUT B;  3X2Q C;  3AGU A;  1EKY A;  4OD5 A;  2V26 A;  1QKR A;  3JRT A;  4QDL A;  2HKV A;  2R02 A;  5KYY B;  3PDM P;  1FMW A;  4KNV A;  1TWH A;  1E85 A;  2Y3B A;  3QVY A;  2P6V A;  3TJ6 A;  2KQ9 A;  3DMD A;  2WZL A;  5L0G A;  2R7V A;  3KYJ A;  2J9U A;  2DYS C;  3LES A;  4CBE A;  1HW1 A;  1YLM A;  1OW6 A;  4MVS A;  4JRZ A;  4AL0 A;  2W4B A;  1VMA A;  2L6F A;  2FGY A;  1FFT C;  4BEM J;  5DQZ A;  2XLV A;  3UGO A;  1LS4 A;  4C3B A;  2GFH A;  1A7E A;  5B1B C;  1MND A;  1NU9 C;  2R7U A;  3CZ6 A;  1Q0D A;  4JZA A;  4YL0 A;  4LLE A;  2D4U A;  2ZXO A;  3C8G A;  3QVZ A;  4YL1 A;  3DI5 A;  3JTL O;  5DQT A;  4CDY A;  1VTM P;  5A6K A;  4AL1 A;  2P0N A;  2W4M A;  2R7R A;  4PJJ A;  3UGP A;  3K33 A;  1TKN A;  2NPU A;  3HLZ A;  4JCH A;  1GQA A;  4K1O A;  3AG2 C;  3K6B A;  4FES A;  3JRM O;  2AWC A;  2IOQ A;  4JEA A;  3RKO F;  3W2V A;  5A69 A;  1QPU A;  3MFN A;  5JS5 A;  1T6Q A;  1RMV A;  1N1C A;  1D0Y A;  2ETS A;  4NTF A;  3LAY A;  1YDI A;  3HNI A;  3G4Z A;  1OKK A;  3MBG A;  4K0D A;  2KW3 C;  3VM6 A;  1CGN A;  2MYS A;  3LNR A;  1VOM A;  3NKD A;  5BQH A;  2E87 A;  3RVZ A;  1H6G A;  3I4U A;  3SNH A;  4U9E A;  2R7S A;  2VB6 A;  1M2O A;  1OCC C;  2ZPA A;  5E3A A;  3LNM B;  1PV3 A;  1H7I A;  2Y3H A;  2CNW A;  2WVQ A;  4LLC A;  3G4X A;  3GM2 A;  4I44 A;  4BJ6 A;  3AG3 C;  3FAJ A;  1JR8 A;  1UFB A;  4EUK B;  2M64 A;  4NC3 A;  5FZT A;  4RDA A;  4ER9 A;  2PP4 A;  4EBB A;  2F22 A;  4G7Z F;  3ZVR A;  2Y69 C;  3UMI A;  1BR4 A;  3N0T A;  1SF8 A;  4G78 A;  4U9D A;  2GDC A;  4J7T A;  1YAR O;  3B0P A;  3C7J A;  3K66 A;  4XPX A;  4Z9J A;  5F5H A;  5AGF A;  4CS8 C;  2R7T A;  3U5S A;  1EQ1 A;  3L0I A;  1QSP A;  1XZP A;  1ZVZ A;  4KNW A;  5JRA A;  5L3V A;  4AX2 A;  4G7H F;  3DJU B;  1NZE A;  3K1I C;  1V4A A;  3IQC A;  1XZQ A;  1ZW3 A;  1NLX A;  3FMS A;  4U5E E;  5CIV A;  2XXA A;  2UUI A;  1AVO B;  2QY9 A;  3FXH A;  2J9W A;  3NMK A;  1TWC A;  1MMD A;  1D0X A;  2KJG A;  2AWY A;  2XLE A;  3C8G B;  1KNY A;  1LE2 A;  1V55 C;  1ZHY A;  1W2W A;  1IZM A;  1AEP A;  4MVR A;  5L0D A;  1M57 C;  1YZA A;  2GA0 A;  3AG1 C;  1G4W R;  3WG7 C;  4C7O A;  3ZIB A;  1SZI A;  3KKB A;  4MW3 A;  2CYD A;  5JP7 A;  3SEO A;  4XWJ A;  2EPL X;  1C03 A;  3A9C A;  2QTV A;  4DRJ B;  2KSF A;  3DE8 A;  4O6Y A;  2YKZ A;  3POV A;  1OCR C;  5A6J A;  2B0J A;  3MLG A;  2NUP A;  3LLK A;  1JPJ A;  2RSE B;  4OIN F;  5IY5 C;  2EIJ C;  2HJ3 A;  2CW0 F;  2OG2 A;  4IB4 A;  1G4U S;  4R32 A;  1LPE A;  1WAT A;  3DE9 A;  5EK0 A;  2OJQ A;  3DKA A;  1FMV A;  3GOD A;  4U5G A;  3NMJ A;  4XPW A;  1OXB A;  2A0B A;  1YAU O;  2KNH A;  1FTS A;  1D1A A;  2ZD9 A;  3DD7 A;  4H4K C;  5L0J A;  4PFP A;  4EBJ A;  4N06 A;  2IYL D;  3GEE A;  2XLO A;  5E33 A;  4YK5 A;  3V5X A;  3FOP A;  4XEV A;  1MMN A;  5E2Q A;  4H54 A;  4IJJ A;  5L0I A;  2CGE A;  1RKE B;  4Z9I A;  3AJM A;  3M4B A;  3S29 A;  2Q4F A;  1K05 A;  4M63 A;  1MNE A;  2IXP A;  2NSF A;  1ST6 A;  3EG9 A;  2UUH A;  4MVM A;  3UNG C;  4CS7 A;  4IWB A;  4Q5S F;  2OQM A;  3VF0 A;  2Q9B A;  4ZLD A;  3QMK A;  3V7O A;  1ZU4 A;  3Q7G A;  2KC3 A;  3E70 C;  4N6C A;  3U3B A;  4LDR A;  4LDQ A;  4EHP A;  2YL0 A;  2XXA B;  2XL8 A;  2RD9 A;  3NYL A;  4AE4 A;  3KYI A;  2HFI A;  1L7C A;  2YL7 A;  2R25 A;  2XS1 A;  3DXJ F;  4JTD B;  3SXM A;  4JC7 A;  2R7W A;  2NUT A;  4BEJ A;  2BE5 F;  1EI7 A;  3MYI A;  3GWN A;  5HV9 A;  4UDV A;  3K1I A;  4PAC A;  2OJE D;  3UMK A;  1T01 A;  1CGM E;  3T9O A;  1VLS A;  3U8P A;  5COF A;  1H9G A;  4OIP F;  4HFF B;  3WAQ A;  3FDQ A;  4OIO F;  2Q00 A;  2JPU A;  1VYI A;  1QZX A;  4CX9 A;  1MMG A;  2R9R B;  5KYX B;  4NY3 A;  5JVE A;  3AGT A;  3RFY A;  4DRI B;  3PHF 2;  3R2P A;  3LEO A;  1D0Z A;  4PR9 A;  3EH1 A;  1HE1 A;  2NSG A;  2FFH A;  2NUP B;  1FAP B;  4XQ1 A;  3IEE A;  1BBH A;  3S9O A;  3GM3 A;  1A7V A;  3HNK A;  2O9X A;  4JE9 A;  1Q0K A;  3DM9 B;  1NFN A;  2D5R B;  2IXM A;  1E2X A;  2Q9C A;  5DS5 A;  1V54 C;  1DOV A;  2FAP B;  4JTA B;  3ATP A;  3Q6M A;  2R03 A;  4A2N B;  4B6I A;  2CDQ A;  1OR3 A;  1OCO C;  2JD3 A;  2XL4 A;  4O7G A;  1VLT A;  3TQO A;  1FR0 A;  2HSQ A;  3RYL A;  1M2V A;  4MQ9 F;  3GEH A;  5COG A;  1VYK A;  2G3K A;  1JPN A;  1BZ4 A;  2NG1 A;  3IQ6 A;  1U0B B;  2QUP A;  2OKU A;  4Q7C A;  5T3W A;  1YJG A;  2A0U A;  2OEX A;  3EFO A;  3JYH A;  4O6M A;  3T6J A;  2LFD A;  2A1D D;  4RBN A;  5DVW A;  1LE4 A;  1YA9 A;  3ASO C;  2YRF A;  3ZTZ A;  2G62 A;  4ANJ A;  4AE4 B;  2PFD A;  1JMW A;  3BRJ A;  3O39 A;  1RKC A;  4DVZ A;  4F4B A;  1A41 A;  1T9K A;  1O5H A;  2NUT B;  2VH3 A;  2EIN C;  1Y4C A;  3BEH A;  4I1O B;  3SXZ A;  3W8I A;  1I4Z A;  2QNL A;  1XWJ A;  4CJO A;  1DOW A;  2L7A A;  3KMI A;  2DI3 A;  2HMQ A;  1A0B A;  2L6G A;  3O10 A;  3O55 A;  1B68 A;  3U0C A;  1YZC A;  3DAG A;  2HUJ A;  4QI0 A;  4MTO A;  5KYN A;  3IPM O;  3JZ0 A;  3N24 A;  5T3T A;  1AUE A;  1T6U A;  4PJL A;  2L81 A;  3JSE O;  2YL3 A;  1Z7Q c;  3S27 A;  2EPM X;  4I3M A;  4AK9 A;  4EBK A;  4EWC A;  3RW0 A;  3ZDL A;  5A6A A;  2XLH A;  3Q6N A;  3M1C B;  4NQF A;  3W8H A;  4CDV A;  5DLJ A;  2A69 F;  2OCC C;  1SYQ A;  1T6I A;  2WZG A;  2H8A A;  2GAQ A;  3C8G D;  3QZC A;  3J06 A;  5BQG A;  2OEV A;  4DOZ A;  4W8K A;  1TWG A;  2GWW A;  2AP3 A;  1APC A;  1RJ9 A;  2HS5 A;  2J9B A;  2PBE A;  2WZF A;  2J0W A;  4U5B E;  4KI2 A;  4GEH A;  1LM3 B;  3GM1 A;  3PCV A;  2LQG A;  4L6R A;  4CJG A;  4DBQ A;  4G7O F;  1OR2 A;  3O6X A;  4FAP B;  2HV7 A;  5KYU A;  4E0H A;  2ZXP A;  1I5N A;  1ORY A;  4LER A;  2C04 A;  3VYW A;  4E0I A;  4QI2 A;  4BPM A;  5KYW A;  4X0R A;  5EHH A;  1M2V B;  3VAY A;  4MVU A;  1RCP A;  1WOL A;  3HNJ A;  1Q0G A;  5JLI A;  1LVK A;  3NG1 A;  1WN0 A;  4KBL A;  2PNO A;  3GEI A;  2Q3T A;  4G0H A;  2R05 A;  4MW8 A;  5F5F A;  1JAF A;  4JUR I;  1HY5 A;  4HEA J;  4U5C E;  1D1C A;  3M15 A;  4LAC B;  4CIP A;  5JUA A;  1OCZ C;  3JYY A;  1HMO A;  3TD7 A;  3T4R A;  3AQB A;  3WHN A;  2IXN A;  4MVZ A;  3US6 A;  1ZHX A;  3EGD A;  4BJ1 A;  4E17 A;  2AVK A;  4BJ5 C;  1ORJ A;  1TFK B;  3CAX A;  3C8Z A;  3ZG1 A;  4DXW A;  2TMV P;  4E7S A;  1QVX A;  5CI8 A;  2J7P A;  2WVN A;  1Z23 A;  3LJB A;  3ZWI A;  4C3D A;  4JTC B;  1CPQ A;  4OD4 A;  3U3F A;  1V74 B;  1ZU5 A;  2EIK C;  2PX0 A;  2YHS A;  3CSK A;  4YT8 A;  1OQC A;  2YEV A;  5KYY A;  3H2U A;  3N2Z B;  4GQH A;  2R7O A;  1R5I D;  2Y3D A;  4MVQ A;  3RQF A;  4LDK A;  5EGY A;  4IAR A;  3PMR A;  2WVO A;  2XM4 A;  1YYX A;  1C17 M;  2VAS A;  2EPN A;  4XPY A;  2BC5 A;  4A4A A;  1YYJ A;  2G3V A;  2XLW A;  1RJ9 B;  1SR2 A;  5L0F A;  4C3E A;  2I8B A;  3A11 A;  5JSL A;  2XS8 A;  1YVI A;  5FCL A;  4Q4Z F;  4JEB A;  4PJN A;  3U8V A;  4N6H A;  1PD1 A;  4JVS A;  3W2W A;  3U2M A;  2XLD A;  3QTH A;  3B29 A;  4RD9 A;  2C03 A;  1K40 A;  3SXY A;  3LLI A;  5KYU B;  2LSE A;  3JSZ A;  4YL3 A;  4ULW A;  3RH3 A;  5KYW B;  3V5Z A;  3SXK A;  5B3S C;  4C7O B;  3G50 A;  3OA1 A;  4IRU A;  2YZS A;  4NTA A;  1E84 A;  4CS9 C;  2JX0 A;  2YVK A;  1E86 A;  1OW8 A;  3QW1 A;  4HFK B;  4YT5 A;  3SP1 A;  3ABM C;  4CDA A;  3S0X A;  3L1M A;  4YT4 A;  4MTG A;  2V3C C;  1T5O A;  1M56 C;  4JJF A;  4E7Z A;  3ZSU A;  2Y3G A;  3M4C A;  3TOL A;  3V5Y A;  1FFH A;  1LI7 A;  3EGD B;  3OWT A;  1NBB A;  3CEX A;  4E18 A;  4YT2 A;  4DRH B;  2BL2 A;  2VC9 A;  1CGO A;  5COM A;  3ZQY A;  2IBF A;  2P61 A;  2YLD A;  3K7D A;  4MTF A;  2MHR A;  4JW1 A;  2XM0 A;  3R7C A;  4J30 B;  3SZR A;  3GOR A;  4KC9 A;  4I1M A;  3T6G B;  3S90 A;  2W45 A;  1ZHZ A;  3FOO A;  5B1A C;  1BDJ B;  1BR2 A;  4BG0 A;  5TJ5 E;  2Q9A A;  4BJ5 A;  1HW2 A;  1R4T A;  1C02 A;  1WWP A;  3ZC4 A;  5L3Q A;  2R7X A;  3KL4 A;  4EIY A;  1M6T A;  2VCC A;  1S7Z A;  3IHU A;  4J7Y A;  1GM5 A;  2M4E A;  3H2V A;  2PF4 E;  3MYF A;  3EJN A;  4FWV A;  5D91 A;  3EG9 B;  4NCQ A;  5A6B D;  1WTY A;  3I5Q A;  3NMI A;  1WAS A;  4U5D E;  5CI9 A;  3C63 A;  3FVY A;  3RVY A;  3EPV A;  2R7Q A;  4IAQ A;  3KPH A;  1ZHT A;  1E83 A; 
#chains in the Genus database with same CATH homology
 4R32 A;  2PBE A;  2L6F A;  1PV3 A;  2YWA A;  4XEF A;  2L6H A;  3GM2 A;  3L8I A;  3GM1 A;  5F28 E;  1QVX A;  3K7D A;  3C8G B;  1UFB A;  1KNY A;  1K40 A;  4EBJ A;  3C8G A;  3O10 A;  3RQE A;  2L6G A;  3RQG A;  1OW7 A;  3U0C A;  3TUL A;  3U3F A;  1JOG A;  3C18 A;  3JZ0 A;  1KTM A;  3B71 A;  2Q00 A;  1K04 A;  2JPU A;  1WOL A;  1WWP A;  4XEV A;  4EBK A;  2JX0 A;  1OW8 A;  3L8J A;  4XEK A;  4NQF A;  3MFN A;  3AJM A;  2LK4 A;  3RQF A;  1K05 A;  1O3U A;  2HSB A;  3C8G D;  1WTY A;  3JYY A;  3S9O A;  3GM3 A;  2KK1 A;  1V4A A;  1ZZP A;  3BRJ A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...