2JPUA

Solution structure of nesg target ssr10, orf c02003 protein
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
b'MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
publication title Solution structure of NESG target SsR10, Orf c02003 protein
rcsb
source organism Sulfolobus solfataricus
molecule tags Structural genomics
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2jpuA00
3JYYA 3RQGA 3C18A 2L6FA 3MFNA 3C8GA 1V4AA 1ZZPA 1QVXA 4XEFA 2YWAA 1K40A 1WOLA 3GM3A 1K05A 3RQFA 3RQEA 1UFBA 2JPUA 2HSBA 2JX0A 1OW7A 1KNYA 2KK1A 4EBKA 3GM2A 3B71A 3C8GD 2LK4A 1O3UA 2L6HA 1K04A 1OW6A 4R32A 1PV3A 4XEVA 5F28E 3S9OA 3L8IA 3U0CA 3JZ0A 4EBJA 4XEKA 3K7DA 1OW8A 2PBEA 1KTMA 3BRJA 3O10A 3TULA 3C8GB 3GM1A 1WTYA 2Q00A 3AJMA 2L6GA 1WWPA 4NQFA 3U3FA 1JOGA 3L8JA
chains in the Genus database with same CATH superfamily
3JYYA 3RQGA 4I1MA 3S29A 4NTBA 1QZXA 2H7BA 4EIYA 1JMWA 3FOPA 3C8GA 4CX9A 3RQFA 2XL4A 3S90A 4HFFB 4CDVA 3TK0A 2P61A 1FFHA 1T6UA 1TFOB 1QKRA 2NUPB 3HKKA 4MS2A 4YN0B 4EBKA 5JLIA 2YLGA 3LNRA 3IHUA 2D5RB 1S05A 4A4AA 2KSFA 4XQ1A 4AE4B 3PDMP 4ONSA 4PFPA 1HW2A 2MHRA 1ST6A 1FFTC 5FZTA 2XS1A 1S7ZA 1G4US 1G5ZA 4MVSA 1V55C 1T9KA 1F1MA 2J9UA 4O7GA 2CNWD 3SNHA 4D4NA 3B0VC 3C8GB 1U0BB 1NFNA 2L7AA 3PHF2 2KQ9A 1JOGA 3CAXA 3DAGA 3C7JA 1L7CA 2Y3HA 2A68F 1OCCC 2XLMA 2MYSA 2GWWA 3M15A 3T4RA 2YRFA 4PJLA 3T6BA 3AG1C 3MX3A 4WJ0A 2R7SA 3LJBA 2HSBA 2Y3DA 1A41A 3K6BA 2HZ8A 4KI2A 3RIPA 3TJ6A 5AC4A 2AU5A 1G8XA 2ZPAA 4FAPB 1ZW2A 2UUHA 2RSEB 1GQAA 3DJUB 1ORYA 3GWLA 1DOVA 1WATA 1YYXA 2XS8A 4KNVA 1NZEA 5L0DA 2OCCC 4YT4A 4EWCA 4ZLCA 1YAUO 2AWCA 1GM5A 1CPRA 1LM3B 3RKOF 1I4ZA 4LLCA 3DE9A 2WVNA 1WTYA 1M2VA 3ABMC 2EPKX 1ORJA 3LESA 4D4XA 2KNHA 4IAQA 2ASRA 1D1BA 1MMNA 4IRUA 3J06A 5JRAA 4OIPF 3G50A 2J45A 4DVYP 4G78A 4WGZA 3W4YA 1E2XA 3F47A 4Q7CA 1ZHYA 3ZC4A 5IY5C 1T01A 4FESA 1OW7A 3V5YA 1FNTc 3NKDA 2XM4A 3DI5A 2ZXWC 1HE9A 2J46A 1YARO 1JR8A 4MNDA 2HFIA 4P9FA 1D1AA 4HEAJ 4QI0A 2R03A 2WVOA 1Y4CA 2Y3GA 3FAJA 4YL3A 5F28E 4XEVA 3V5ZA 4JRZA 3WG7C 3JZ0A 1CGME 1M2VB 1LVKA 2OKUA 3WHNA 2BE5F 3JTLO 4CJOA 5COMA 4N4WA 5BQGA 2WL8A 4DXWA 5T3TA 3KKBA 2WZLA 4BJ6A 2NG1A 1YZCA 4U5BE 3N24A 3E70C 1VYKA 1L3PA 2LD6A 3HNKA 2LFFA 4XPXA 3L0IA 4DJ9A 2Y39A 4EUKB 2HMZA 1OCRC 3SXMA 1D0YA 3MFNA 5T3WA 1J8MF 1A7VA 2LQGA 4P9TA 1AEPA 1R4TA 2XSEA 4JTAB 1QVXA 1V74B 3I5QA 1K40A 4MTFA 2BC5A 4JKVA 3K1HA 1OXKA 3O55A 3U8PA 3W2VA 3H65A 1T6QA 2NPUA 2JX0A 1VLSA 2YZSA 4JCZA 4YT5A 2KK1A 4QI2A 2EILC 3JRMO 3LS1A 3QVYA 1TWCA 1O5HA 3L34A 4BJ5A 3IQ5A 2P6VA 2YVKA 3DWWA 4RDAA 5BQHA 3EGDB 3PCVA 3X2QC 3KYJA 1U89A 4WABA 1D0XA 3FOOA 1YA7O 4YT8A 2XLOA 2LIGA 4YL0A 2R7UA 4G7OF 2IYLD 2MWQA 5HSWA 5CI8A 5L3VA 1ZHZA 4XTKA 3M4CA 2YL3A 2LFDA 3LLKA 3ABKC 3IQCA 2IXNA 3FDQA 1KTMA 1E85A 4O6NA 3A9CA 1BR4A 4CS8A 5JS5A 2W45A 1BBHA 1V4AA 4OIRF 3RYLA 4PK4A 3MBGA 4MW3A 2RD9A 1I4YA 2PP4A 4P6IC 3UGPA 2E87A 2HSQA 1VOMA 3O6XA 2HUJA 2JD3A 3AG3C 5GPGB 4A2NB 4CS9C 3UGOA 3C8GD 1JPJA 3HTKC 3O39A 3PMRA 4JE9A 4JTDB 2HV6A 3B0PA 3RVYA 1FTSA 4W8PA 4M63A 3ABLC 2R7WA 3C8ZA 1O87A 1YLMA 1A7DA 3NMKA 2IXPA 1PD1A 2HJMA 4JURI 4LERA 2LP4A 3ZQYA 5HV9A 3QTHA 1OCZC 4H4KC 3HJCA 3GM1A 3JT1A 5D92A 1CPQA 1TFKB 3GEEA 1QQ3A 5B1BC 4C3BA 2TMVP 4CSAA 3I4UA 2A6HF 4JTCB 2B0HA 1WOLA 3HLZA 1RXQA 1UFBA 3ASNC 2EIMC 1H6GA 1LE2A 3DM5A 2C03A 3RW0A 1KNYA 3T6GB 4RBNA 4CIPA 1YVIA 3AG4C 3F46A 2PNOA 4I1OB 5L3QA 3L1MA 1T6IA 2XLDA 3S28A 3MLGA 3CZ6A 1A7EA 1Z7Qc 3LNMB 3TOLA 2ETSA 3AQBA 5COFA 1EKYA 5DQTA 2KC3A 2ICWG 1SF8A 4Z9JA 2A1DD 1ZVZA 2YLDA 3DXJF 3SXKA 4CS7A 1RKCA 2FAPB 4JEBA 4QDLA 3TD7A 4WGYA 3K66A 4ZLDA 4XPWA 3EHNA 1YZAA 1WASA 5A69A 1BZ4A 2Y3BA 4FWVA 2Q9CA 4U9DA 2OU6A 1NLXA 1ZW3A 1ZU5A 2J7PA 5E3CA 4BJTA 1NU9C 3UMKA 4YT2A 3IEEA 4MTOA 4PR9A 4BG0A 3N2ZB 3NMJA 2PX3A 5KYWA 2VC9A 3GEHA 2YLIA 1D1CA 1LKXA 1TKNA 1SMYF 1HMDA 1QLEC 1BR1A 2L6HA 1VK5A 4X0RA 5L0IA 2EIJC 1RJ9A 2OG2A 3GODA 3G4XA 3VM6A 2V3CC 1MMDA 3MYFA 1HE1A 1ZYRF 2A69F 2R7TA 3EJNA 3LAYA 4JIOA 5EGYA 1JRAA 1VB5A 3EHMA 5A6JA 1Y6DA 3FMSA 2ZXPA 4AK9A 1M6TA 4NY3A 1CGNA 1Z5ZA 4JZAA 2VCCA 5E33A 4G7HF 4G7ZF 4GEHA 2ZXRA 1H9TA 5JT4A 1EQ1A 5COGA 5KYWB 4OD4A 4F4BA 3ITFA 2IM8A 2M4EA 2EPNA 4JW1A 1LPEA 3QW1A 3Q6MA 3OEOA 2HS5A 2GAQA 2I15A 2WB7A 1RJ9B 3M1CB 3HNLA 4AL1A 2QLAA 3A11A 2R7RA 3ATPA 2EINC 4NTAA 2R7XA 1FR0A 3EFOA 1BR2A 2DGJA 1NU7D 1GS9A 2VASA 5E3AA 4E18A 2KYHA 5JUAA 5KYYA 3DAFA 3C63A 4IGGA 3EPVA 4EBJA 1SYQA 3NDBB 3RF3A 4FX5A 1LI7A 3U2MA 5DLJA 2XL6A 5L0GA 2O9XA 1APCA 3EZHA 4Z9IA 3K1IC 2W4BA 3NYMA 5KYNA 3JCUQ 3EG9A 2L9JA 3IPMO 1WWPA 3NYLA 3Q7LA 4K7BA 1SZIA 2F22A 4PFOA 4N06A 3U8VA 3FXHA 5EK0A 1ORSC 2OJQA 1VYIA 2H7OA 4XEFA 2R05A 2D4UA 3GM3A 4U5DE 3EFOB 3LUTB 2GDCA 2JPUA 1TWGA 5KYYB 3HNIA 3B9QA 1ZHXA 3FVYA 4IB4A 3B71A 3SXZA 4LDQA 4LDKA 256BA 4U5GA 2J9WA 3ASOC 2UUIA 4CS9A 1EA8A 2L81A 3TOMA 5K0IA 3H2UA 1RMVA 1CGOA 3JSZA 1BDJB 3EG9B 3V5XA 4C3DA 1ZHTA 3T9OA 2PBEA 4MTGA 3UMIA 2CCYA 3W8HA 2OEVA 2YKZA 4ER9A 5A6KA 5A6AA 4RD9A 1H9GA 3DKAA 4XLNF 3ECSA 1J8YF 1A0BA 1HY5A 5AC5A 3DE8A 5KYXA 4EHPA 1AUEA 3U3FA 3ZIBA 2IXOA 3FHDA 3DJNB 3G4ZA 1ZZPA 2B0JA 3QW0A 1W2WA 1XZQA 2R9RB 4G0HA 1SR2A 3VAYA 2XXAA 1TWHA 2M64A 3WAQA 3IQTA 2YL7A 3GM2A 3LS0A 3ZDLA 4YJWA 1MNEA 1K04A 1QSPA 2EPMX 3EH1A 5B1AC 2J9BA 3K33A 4MW8A 4U9EA 2V26A 2GA0A 5KYXB 1IW7F 1N1CA 3V7OA 4HE8D 4C7OA 3AQCA 1OW8A 1I5NA 4Z9HA 3GANA 3M79A 1ZHWA 5A6BA 3VRCA 2LCHA 2XLEA 2L6GA 3Q7GA 1WGWA 3RFYA 2XXAB 1MNDA 2G3VA 4LDRA 5E2QA 1OR2A 3N0TA 2H7VC 2PF4E 1WN0A 1PD0A 3UR3C 4B6IA 1Q0KA 2R7VA 3WODF 1UG7A 1C17M 1IZMA 4LACB 3U5SA 1Z6AA 4O79A 3KMIA 4JC7A 2VCAA 4MVRA 2A0UA 2Z15A 2LK4A 1O3UA 1M2OA 2J7PD 4N6HA 1ZU4A 4YK5A 2P7VA 4C7OB 2J8WA 2OJED 1PV3A 5CIVA 2KW3C 1MMGA 3NYJA 1GGQA 2FGYA 2Y69C 3GEIA 4L6RA 5F5FA 3ZWIA 1OQCA 3DD7A 3S27A 3K7DA 4I44A 4O6MA 2XLHA 1U6HA 1NSGB 2DI3A 4W8KA 3AJMA 3OWTA 2R7OA 4C3EA 2ZXOA 4E7SA 1Q0GA 4OIOF 1AVOB 2PX0A 5BUOA 4H54A 3DM9B 2L6FA 4MVQA 2Q9AA 4DRJB 4NCQA 3LEVA 2GFHA 4CBEA 1NBBA 2OQMA 4MVOA 1K05A 4CJGA 4JJGA 2PFDA 2QE9A 4JCHA 4KNWA 4J7TA 2J9VA 3U9MA 4J7YA 1OKKA 1XWJA 5FCLA 3R7CA 1JAFA 2YHSA 2CYDA 1V54C 3POVA 4KBLA 4MQ9F 4E0HA 5JP7A 3S9OA 4EKWA 4DRIB 3U0CA 3EZIA 4U5EE 2VB6A 4ULVA 4DOZA 2Q4FA 1H7IA 2WZFA 5KYUA 2YL1A 4MVZA 1FMVA 2X51A 1LIHA 2KJGA 3U2LA 4CSAC 1HMOA 1QPUA 3W8IA 1TQGA 2Q00A 3ZG1A 2XM0A 4IARA 2G62A 4MVMA 3L8JA 5DVWA 1R5ID 4DRHB 2XLVA 3K1IA 1YJGA 3JYHA 4EBBA 1G4WR 2DYSC 4Q4ZF 1D0ZA 3HNJA 1LE4A 4O6YA 3KL4A 4PJJA 2I8BA 4BPMA 4DBRA 1E83A 2ZD9A 1Z23A 5KYUB 3VYWA 4UDVA 2CDQA 2CNWA 2G3KA 2VCBA 4JVSA 5D91A 3LEOA 4DBQA 1E86A 3M4BA 3T6JA 1TR2A 3L8IA 4GYTA 3C62A 2LSEA 4JJFA 4XPYA 4YL1A 3NKEA 3QZCA 3SP1A 2QNLA 3CQZA 5BQIA 2W4MA 3H2VA 3DZAA 5DS4A 2AWYA 2Q9BA 1VLTA 2R02A 2VH3A 4NQFA 1MQVA 1Q0MA 3NG1A 3EQLF 2NUTA 3C18A 3JRTA 3Q6NA 3ZSUA 2P1AA 4JEAA 4CDYA 4U5FE 1XZPA 3NMIA 3RVZA 4OD5A 2XRHA 4XWJA 1M57C 1MMAA 3VF0A 4YWQA 1EI7A 3B29A 3SYNA 2X0CA 4CIHA 1T5OA 2C04A 3CEXA 5B3IA 1LS4A 5DS5A 1OW6A 1FAPB 3S0XA 4PJMA 1JPNA 1OXBA 3GORA 4LLEA 1C03A 5TJ5E 1LS1A 2CGEA 2NUTB 2QY9A 4J30B 1LI5A 3SZRA 3B0UX 1Q0DA 3EGDA 3BRJA 3GWNA 3O10A 3OA1A 4DVZA 1VTMP 3QMKA 5DQZA 4PJNA 4HFKB 4NTFA 5JSLA 2NSFA 2YL0A 2FFHA 1YA9A 4BEMJ 1M56C 2KGOA 2IBFA 3ZTZA 1E84A 1OCOC 4IWBA 1RKEA 2R25A 3RQEA 1NG1A 1YYJA 4BJ1A 2P0NA 5A6BD 5L0CA 3S84A 2DYRC 3DMDA 4MVUA 2EIKC 3TQOA 1FMWA 3EGXA 4U5CE 2A0BA 2HMQA 4IJJA 5L0JA 2J0WA 3JSEO 4K0DA 4R32A 3UMHA 3I5PA 4ANJA 5L0HA 4BJ6C 5JVEA 5L0FA 4XEKA 2WZGA 3UNGC 1KU2A 4XLPF 1Z63A 2DB4A 3FAPB 3U9JA 3ZQVA 3ZTMA 1DOWA 1RKEB 4E17A 3CSKA 1OR3A 2AP3A 4K1OA 3IQ6A 3W2WA 1YDIA 2YQYA 1Q0FA 1TWAA 3EH2A 4OINF 1RCPA 3SXYA 4CDAA 5B3SC 2H8AA 2IOQA 4AX2A 3AOUA 2AVKA 2OEXA 3EGXB 3KPHA 2A6EF 2YEVA 4GQHA 4E0IA 1B68A 4U5HA 4BEJA 2YWAA 1C02A 5DS6A 1HW1A 4Q5SF 4BJ5C 2QUPA 2EPLX 3LLIA 2XL8A 3KH2A 3R2PA 2OOCA 2CW0F 5AGFA 4NC3A 3RH3A 3AGTA 3US6A 3MYIA 3TJ5A 3KYIA 3U3BA 4AL0A 3ZVRA 2IXMA 2BL2A 1Z3IX 5F5HA 5T1DB 2Q7RA 1VMAA 3AG2C 5CI9A 2NUPA 5EHHA 1PCXA 3QVZA 2W9YA 2WVQA 2HKVA 2HV7A 1OKKD 2Q3TA 2XLWA 4I3MA 4J32B 2QTVA 4PACA 2HJ3A 4OIQF 4ULWA 3TULA 2R7QA 3E9VA 4E7ZA 2NSGA 4AE4A 4KC9A 3NRHA 4CS8C 1NFOA 4N6CA 2EPOA 4IAOA 3SEOA 2J0XA 3BEHA 3AGUA 3X1OA
chains in the Genus database with same CATH topology
3JYYA 3RQGA 3C18A 2L6FA 3MFNA 3C8GA 1V4AA 1ZZPA 1QVXA 4XEFA 2YWAA 1K40A 1WOLA 3GM3A 1K05A 3RQFA 3RQEA 1UFBA 2JPUA 2HSBA 2JX0A 1OW7A 1KNYA 2KK1A 4EBKA 3GM2A 3B71A 3C8GD 2LK4A 1O3UA 2L6HA 1K04A 1OW6A 4R32A 1PV3A 4XEVA 5F28E 3S9OA 3L8IA 3U0CA 3JZ0A 4EBJA 4XEKA 3K7DA 1OW8A 2PBEA 1KTMA 3BRJA 3O10A 3TULA 3C8GB 3GM1A 1WTYA 2Q00A 3AJMA 2L6GA 1WWPA 4NQFA 3U3FA 1JOGA 3L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYY A;  3RQG A;  3C18 A;  2L6F A;  3MFN A;  3C8G A;  1V4A A;  1ZZP A;  1QVX A;  4XEF A;  2YWA A;  1K40 A;  1WOL A;  3GM3 A;  1K05 A;  3RQF A;  3RQE A;  1UFB A;  2JPU A;  2HSB A;  2JX0 A;  1OW7 A;  1KNY A;  2KK1 A;  4EBK A;  3GM2 A;  3B71 A;  3C8G D;  2LK4 A;  1O3U A;  2L6H A;  1K04 A;  1OW6 A;  4R32 A;  1PV3 A;  4XEV A;  5F28 E;  3S9O A;  3L8I A;  3U0C A;  3JZ0 A;  4EBJ A;  4XEK A;  3K7D A;  1OW8 A;  2PBE A;  1KTM A;  3BRJ A;  3O10 A;  3TUL A;  3C8G B;  3GM1 A;  1WTY A;  2Q00 A;  3AJM A;  2L6G A;  1WWP A;  4NQF A;  3U3F A;  1JOG A;  3L8J A; 
#chains in the Genus database with same CATH topology
 3JYY A;  3RQG A;  4I1M A;  3S29 A;  4NTB A;  1QZX A;  2H7B A;  4EIY A;  1JMW A;  3FOP A;  3C8G A;  4CX9 A;  3RQF A;  2XL4 A;  3S90 A;  4HFF B;  4CDV A;  3TK0 A;  2P61 A;  1FFH A;  1T6U A;  1TFO B;  1QKR A;  2NUP B;  3HKK A;  4MS2 A;  4YN0 B;  4EBK A;  5JLI A;  2YLG A;  3LNR A;  3IHU A;  2D5R B;  1S05 A;  4A4A A;  2KSF A;  4XQ1 A;  4AE4 B;  3PDM P;  4ONS A;  4PFP A;  1HW2 A;  2MHR A;  1ST6 A;  1FFT C;  5FZT A;  2XS1 A;  1S7Z A;  1G4U S;  1G5Z A;  4MVS A;  1V55 C;  1T9K A;  1F1M A;  2J9U A;  4O7G A;  2CNW D;  3SNH A;  4D4N A;  3B0V C;  3C8G B;  1U0B B;  1NFN A;  2L7A A;  3PHF 2;  2KQ9 A;  1JOG A;  3CAX A;  3DAG A;  3C7J A;  1L7C A;  2Y3H A;  2A68 F;  1OCC C;  2XLM A;  2MYS A;  2GWW A;  3M15 A;  3T4R A;  2YRF A;  4PJL A;  3T6B A;  3AG1 C;  3MX3 A;  4WJ0 A;  2R7S A;  3LJB A;  2HSB A;  2Y3D A;  1A41 A;  3K6B A;  2HZ8 A;  4KI2 A;  3RIP A;  3TJ6 A;  5AC4 A;  2AU5 A;  1G8X A;  2ZPA A;  4FAP B;  1ZW2 A;  2UUH A;  2RSE B;  1GQA A;  3DJU B;  1ORY A;  3GWL A;  1DOV A;  1WAT A;  1YYX A;  2XS8 A;  4KNV A;  1NZE A;  5L0D A;  2OCC C;  4YT4 A;  4EWC A;  4ZLC A;  1YAU O;  2AWC A;  1GM5 A;  1CPR A;  1LM3 B;  3RKO F;  1I4Z A;  4LLC A;  3DE9 A;  2WVN A;  1WTY A;  1M2V A;  3ABM C;  2EPK X;  1ORJ A;  3LES A;  4D4X A;  2KNH A;  4IAQ A;  2ASR A;  1D1B A;  1MMN A;  4IRU A;  3J06 A;  5JRA A;  4OIP F;  3G50 A;  2J45 A;  4DVY P;  4G78 A;  4WGZ A;  3W4Y A;  1E2X A;  3F47 A;  4Q7C A;  1ZHY A;  3ZC4 A;  5IY5 C;  1T01 A;  4FES A;  1OW7 A;  3V5Y A;  1FNT c;  3NKD A;  2XM4 A;  3DI5 A;  2ZXW C;  1HE9 A;  2J46 A;  1YAR O;  1JR8 A;  4MND A;  2HFI A;  4P9F A;  1D1A A;  4HEA J;  4QI0 A;  2R03 A;  2WVO A;  1Y4C A;  2Y3G A;  3FAJ A;  4YL3 A;  5F28 E;  4XEV A;  3V5Z A;  4JRZ A;  3WG7 C;  3JZ0 A;  1CGM E;  1M2V B;  1LVK A;  2OKU A;  3WHN A;  2BE5 F;  3JTL O;  4CJO A;  5COM A;  4N4W A;  5BQG A;  2WL8 A;  4DXW A;  5T3T A;  3KKB A;  2WZL A;  4BJ6 A;  2NG1 A;  1YZC A;  4U5B E;  3N24 A;  3E70 C;  1VYK A;  1L3P A;  2LD6 A;  3HNK A;  2LFF A;  4XPX A;  3L0I A;  4DJ9 A;  2Y39 A;  4EUK B;  2HMZ A;  1OCR C;  3SXM A;  1D0Y A;  3MFN A;  5T3W A;  1J8M F;  1A7V A;  2LQG A;  4P9T A;  1AEP A;  1R4T A;  2XSE A;  4JTA B;  1QVX A;  1V74 B;  3I5Q A;  1K40 A;  4MTF A;  2BC5 A;  4JKV A;  3K1H A;  1OXK A;  3O55 A;  3U8P A;  3W2V A;  3H65 A;  1T6Q A;  2NPU A;  2JX0 A;  1VLS A;  2YZS A;  4JCZ A;  4YT5 A;  2KK1 A;  4QI2 A;  2EIL C;  3JRM O;  3LS1 A;  3QVY A;  1TWC A;  1O5H A;  3L34 A;  4BJ5 A;  3IQ5 A;  2P6V A;  2YVK A;  3DWW A;  4RDA A;  5BQH A;  3EGD B;  3PCV A;  3X2Q C;  3KYJ A;  1U89 A;  4WAB A;  1D0X A;  3FOO A;  1YA7 O;  4YT8 A;  2XLO A;  2LIG A;  4YL0 A;  2R7U A;  4G7O F;  2IYL D;  2MWQ A;  5HSW A;  5CI8 A;  5L3V A;  1ZHZ A;  4XTK A;  3M4C A;  2YL3 A;  2LFD A;  3LLK A;  3ABK C;  3IQC A;  2IXN A;  3FDQ A;  1KTM A;  1E85 A;  4O6N A;  3A9C A;  1BR4 A;  4CS8 A;  5JS5 A;  2W45 A;  1BBH A;  1V4A A;  4OIR F;  3RYL A;  4PK4 A;  3MBG A;  4MW3 A;  2RD9 A;  1I4Y A;  2PP4 A;  4P6I C;  3UGP A;  2E87 A;  2HSQ A;  1VOM A;  3O6X A;  2HUJ A;  2JD3 A;  3AG3 C;  5GPG B;  4A2N B;  4CS9 C;  3UGO A;  3C8G D;  1JPJ A;  3HTK C;  3O39 A;  3PMR A;  4JE9 A;  4JTD B;  2HV6 A;  3B0P A;  3RVY A;  1FTS A;  4W8P A;  4M63 A;  3ABL C;  2R7W A;  3C8Z A;  1O87 A;  1YLM A;  1A7D A;  3NMK A;  2IXP A;  1PD1 A;  2HJM A;  4JUR I;  4LER A;  2LP4 A;  3ZQY A;  5HV9 A;  3QTH A;  1OCZ C;  4H4K C;  3HJC A;  3GM1 A;  3JT1 A;  5D92 A;  1CPQ A;  1TFK B;  3GEE A;  1QQ3 A;  5B1B C;  4C3B A;  2TMV P;  4CSA A;  3I4U A;  2A6H F;  4JTC B;  2B0H A;  1WOL A;  3HLZ A;  1RXQ A;  1UFB A;  3ASN C;  2EIM C;  1H6G A;  1LE2 A;  3DM5 A;  2C03 A;  3RW0 A;  1KNY A;  3T6G B;  4RBN A;  4CIP A;  1YVI A;  3AG4 C;  3F46 A;  2PNO A;  4I1O B;  5L3Q A;  3L1M A;  1T6I A;  2XLD A;  3S28 A;  3MLG A;  3CZ6 A;  1A7E A;  1Z7Q c;  3LNM B;  3TOL A;  2ETS A;  3AQB A;  5COF A;  1EKY A;  5DQT A;  2KC3 A;  2ICW G;  1SF8 A;  4Z9J A;  2A1D D;  1ZVZ A;  2YLD A;  3DXJ F;  3SXK A;  4CS7 A;  1RKC A;  2FAP B;  4JEB A;  4QDL A;  3TD7 A;  4WGY A;  3K66 A;  4ZLD A;  4XPW A;  3EHN A;  1YZA A;  1WAS A;  5A69 A;  1BZ4 A;  2Y3B A;  4FWV A;  2Q9C A;  4U9D A;  2OU6 A;  1NLX A;  1ZW3 A;  1ZU5 A;  2J7P A;  5E3C A;  4BJT A;  1NU9 C;  3UMK A;  4YT2 A;  3IEE A;  4MTO A;  4PR9 A;  4BG0 A;  3N2Z B;  3NMJ A;  2PX3 A;  5KYW A;  2VC9 A;  3GEH A;  2YLI A;  1D1C A;  1LKX A;  1TKN A;  1SMY F;  1HMD A;  1QLE C;  1BR1 A;  2L6H A;  1VK5 A;  4X0R A;  5L0I A;  2EIJ C;  1RJ9 A;  2OG2 A;  3GOD A;  3G4X A;  3VM6 A;  2V3C C;  1MMD A;  3MYF A;  1HE1 A;  1ZYR F;  2A69 F;  2R7T A;  3EJN A;  3LAY A;  4JIO A;  5EGY A;  1JRA A;  1VB5 A;  3EHM A;  5A6J A;  1Y6D A;  3FMS A;  2ZXP A;  4AK9 A;  1M6T A;  4NY3 A;  1CGN A;  1Z5Z A;  4JZA A;  2VCC A;  5E33 A;  4G7H F;  4G7Z F;  4GEH A;  2ZXR A;  1H9T A;  5JT4 A;  1EQ1 A;  5COG A;  5KYW B;  4OD4 A;  4F4B A;  3ITF A;  2IM8 A;  2M4E A;  2EPN A;  4JW1 A;  1LPE A;  3QW1 A;  3Q6M A;  3OEO A;  2HS5 A;  2GAQ A;  2I15 A;  2WB7 A;  1RJ9 B;  3M1C B;  3HNL A;  4AL1 A;  2QLA A;  3A11 A;  2R7R A;  3ATP A;  2EIN C;  4NTA A;  2R7X A;  1FR0 A;  3EFO A;  1BR2 A;  2DGJ A;  1NU7 D;  1GS9 A;  2VAS A;  5E3A A;  4E18 A;  2KYH A;  5JUA A;  5KYY A;  3DAF A;  3C63 A;  4IGG A;  3EPV A;  4EBJ A;  1SYQ A;  3NDB B;  3RF3 A;  4FX5 A;  1LI7 A;  3U2M A;  5DLJ A;  2XL6 A;  5L0G A;  2O9X A;  1APC A;  3EZH A;  4Z9I A;  3K1I C;  2W4B A;  3NYM A;  5KYN A;  3JCU Q;  3EG9 A;  2L9J A;  3IPM O;  1WWP A;  3NYL A;  3Q7L A;  4K7B A;  1SZI A;  2F22 A;  4PFO A;  4N06 A;  3U8V A;  3FXH A;  5EK0 A;  1ORS C;  2OJQ A;  1VYI A;  2H7O A;  4XEF A;  2R05 A;  2D4U A;  3GM3 A;  4U5D E;  3EFO B;  3LUT B;  2GDC A;  2JPU A;  1TWG A;  5KYY B;  3HNI A;  3B9Q A;  1ZHX A;  3FVY A;  4IB4 A;  3B71 A;  3SXZ A;  4LDQ A;  4LDK A;  256B A;  4U5G A;  2J9W A;  3ASO C;  2UUI A;  4CS9 A;  1EA8 A;  2L81 A;  3TOM A;  5K0I A;  3H2U A;  1RMV A;  1CGO A;  3JSZ A;  1BDJ B;  3EG9 B;  3V5X A;  4C3D A;  1ZHT A;  3T9O A;  2PBE A;  4MTG A;  3UMI A;  2CCY A;  3W8H A;  2OEV A;  2YKZ A;  4ER9 A;  5A6K A;  5A6A A;  4RD9 A;  1H9G A;  3DKA A;  4XLN F;  3ECS A;  1J8Y F;  1A0B A;  1HY5 A;  5AC5 A;  3DE8 A;  5KYX A;  4EHP A;  1AUE A;  3U3F A;  3ZIB A;  2IXO A;  3FHD A;  3DJN B;  3G4Z A;  1ZZP A;  2B0J A;  3QW0 A;  1W2W A;  1XZQ A;  2R9R B;  4G0H A;  1SR2 A;  3VAY A;  2XXA A;  1TWH A;  2M64 A;  3WAQ A;  3IQT A;  2YL7 A;  3GM2 A;  3LS0 A;  3ZDL A;  4YJW A;  1MNE A;  1K04 A;  1QSP A;  2EPM X;  3EH1 A;  5B1A C;  2J9B A;  3K33 A;  4MW8 A;  4U9E A;  2V26 A;  2GA0 A;  5KYX B;  1IW7 F;  1N1C A;  3V7O A;  4HE8 D;  4C7O A;  3AQC A;  1OW8 A;  1I5N A;  4Z9H A;  3GAN A;  3M79 A;  1ZHW A;  5A6B A;  3VRC A;  2LCH A;  2XLE A;  2L6G A;  3Q7G A;  1WGW A;  3RFY A;  2XXA B;  1MND A;  2G3V A;  4LDR A;  5E2Q A;  1OR2 A;  3N0T A;  2H7V C;  2PF4 E;  1WN0 A;  1PD0 A;  3UR3 C;  4B6I A;  1Q0K A;  2R7V A;  3WOD F;  1UG7 A;  1C17 M;  1IZM A;  4LAC B;  3U5S A;  1Z6A A;  4O79 A;  3KMI A;  4JC7 A;  2VCA A;  4MVR A;  2A0U A;  2Z15 A;  2LK4 A;  1O3U A;  1M2O A;  2J7P D;  4N6H A;  1ZU4 A;  4YK5 A;  2P7V A;  4C7O B;  2J8W A;  2OJE D;  1PV3 A;  5CIV A;  2KW3 C;  1MMG A;  3NYJ A;  1GGQ A;  2FGY A;  2Y69 C;  3GEI A;  4L6R A;  5F5F A;  3ZWI A;  1OQC A;  3DD7 A;  3S27 A;  3K7D A;  4I44 A;  4O6M A;  2XLH A;  1U6H A;  1NSG B;  2DI3 A;  4W8K A;  3AJM A;  3OWT A;  2R7O A;  4C3E A;  2ZXO A;  4E7S A;  1Q0G A;  4OIO F;  1AVO B;  2PX0 A;  5BUO A;  4H54 A;  3DM9 B;  2L6F A;  4MVQ A;  2Q9A A;  4DRJ B;  4NCQ A;  3LEV A;  2GFH A;  4CBE A;  1NBB A;  2OQM A;  4MVO A;  1K05 A;  4CJG A;  4JJG A;  2PFD A;  2QE9 A;  4JCH A;  4KNW A;  4J7T A;  2J9V A;  3U9M A;  4J7Y A;  1OKK A;  1XWJ A;  5FCL A;  3R7C A;  1JAF A;  2YHS A;  2CYD A;  1V54 C;  3POV A;  4KBL A;  4MQ9 F;  4E0H A;  5JP7 A;  3S9O A;  4EKW A;  4DRI B;  3U0C A;  3EZI A;  4U5E E;  2VB6 A;  4ULV A;  4DOZ A;  2Q4F A;  1H7I A;  2WZF A;  5KYU A;  2YL1 A;  4MVZ A;  1FMV A;  2X51 A;  1LIH A;  2KJG A;  3U2L A;  4CSA C;  1HMO A;  1QPU A;  3W8I A;  1TQG A;  2Q00 A;  3ZG1 A;  2XM0 A;  4IAR A;  2G62 A;  4MVM A;  3L8J A;  5DVW A;  1R5I D;  4DRH B;  2XLV A;  3K1I A;  1YJG A;  3JYH A;  4EBB A;  1G4W R;  2DYS C;  4Q4Z F;  1D0Z A;  3HNJ A;  1LE4 A;  4O6Y A;  3KL4 A;  4PJJ A;  2I8B A;  4BPM A;  4DBR A;  1E83 A;  2ZD9 A;  1Z23 A;  5KYU B;  3VYW A;  4UDV A;  2CDQ A;  2CNW A;  2G3K A;  2VCB A;  4JVS A;  5D91 A;  3LEO A;  4DBQ A;  1E86 A;  3M4B A;  3T6J A;  1TR2 A;  3L8I A;  4GYT A;  3C62 A;  2LSE A;  4JJF A;  4XPY A;  4YL1 A;  3NKE A;  3QZC A;  3SP1 A;  2QNL A;  3CQZ A;  5BQI A;  2W4M A;  3H2V A;  3DZA A;  5DS4 A;  2AWY A;  2Q9B A;  1VLT A;  2R02 A;  2VH3 A;  4NQF A;  1MQV A;  1Q0M A;  3NG1 A;  3EQL F;  2NUT A;  3C18 A;  3JRT A;  3Q6N A;  3ZSU A;  2P1A A;  4JEA A;  4CDY A;  4U5F E;  1XZP A;  3NMI A;  3RVZ A;  4OD5 A;  2XRH A;  4XWJ A;  1M57 C;  1MMA A;  3VF0 A;  4YWQ A;  1EI7 A;  3B29 A;  3SYN A;  2X0C A;  4CIH A;  1T5O A;  2C04 A;  3CEX A;  5B3I A;  1LS4 A;  5DS5 A;  1OW6 A;  1FAP B;  3S0X A;  4PJM A;  1JPN A;  1OXB A;  3GOR A;  4LLE A;  1C03 A;  5TJ5 E;  1LS1 A;  2CGE A;  2NUT B;  2QY9 A;  4J30 B;  1LI5 A;  3SZR A;  3B0U X;  1Q0D A;  3EGD A;  3BRJ A;  3GWN A;  3O10 A;  3OA1 A;  4DVZ A;  1VTM P;  3QMK A;  5DQZ A;  4PJN A;  4HFK B;  4NTF A;  5JSL A;  2NSF A;  2YL0 A;  2FFH A;  1YA9 A;  4BEM J;  1M56 C;  2KGO A;  2IBF A;  3ZTZ A;  1E84 A;  1OCO C;  4IWB A;  1RKE A;  2R25 A;  3RQE A;  1NG1 A;  1YYJ A;  4BJ1 A;  2P0N A;  5A6B D;  5L0C A;  3S84 A;  2DYR C;  3DMD A;  4MVU A;  2EIK C;  3TQO A;  1FMW A;  3EGX A;  4U5C E;  2A0B A;  2HMQ A;  4IJJ A;  5L0J A;  2J0W A;  3JSE O;  4K0D A;  4R32 A;  3UMH A;  3I5P A;  4ANJ A;  5L0H A;  4BJ6 C;  5JVE A;  5L0F A;  4XEK A;  2WZG A;  3UNG C;  1KU2 A;  4XLP F;  1Z63 A;  2DB4 A;  3FAP B;  3U9J A;  3ZQV A;  3ZTM A;  1DOW A;  1RKE B;  4E17 A;  3CSK A;  1OR3 A;  2AP3 A;  4K1O A;  3IQ6 A;  3W2W A;  1YDI A;  2YQY A;  1Q0F A;  1TWA A;  3EH2 A;  4OIN F;  1RCP A;  3SXY A;  4CDA A;  5B3S C;  2H8A A;  2IOQ A;  4AX2 A;  3AOU A;  2AVK A;  2OEX A;  3EGX B;  3KPH A;  2A6E F;  2YEV A;  4GQH A;  4E0I A;  1B68 A;  4U5H A;  4BEJ A;  2YWA A;  1C02 A;  5DS6 A;  1HW1 A;  4Q5S F;  4BJ5 C;  2QUP A;  2EPL X;  3LLI A;  2XL8 A;  3KH2 A;  3R2P A;  2OOC A;  2CW0 F;  5AGF A;  4NC3 A;  3RH3 A;  3AGT A;  3US6 A;  3MYI A;  3TJ5 A;  3KYI A;  3U3B A;  4AL0 A;  3ZVR A;  2IXM A;  2BL2 A;  1Z3I X;  5F5H A;  5T1D B;  2Q7R A;  1VMA A;  3AG2 C;  5CI9 A;  2NUP A;  5EHH A;  1PCX A;  3QVZ A;  2W9Y A;  2WVQ A;  2HKV A;  2HV7 A;  1OKK D;  2Q3T A;  2XLW A;  4I3M A;  4J32 B;  2QTV A;  4PAC A;  2HJ3 A;  4OIQ F;  4ULW A;  3TUL A;  2R7Q A;  3E9V A;  4E7Z A;  2NSG A;  4AE4 A;  4KC9 A;  3NRH A;  4CS8 C;  1NFO A;  4N6C A;  2EPO A;  4IAO A;  3SEO A;  2J0X A;  3BEH A;  3AGU A;  3X1O A; 
#chains in the Genus database with same CATH homology
 3JYY A;  3RQG A;  3C18 A;  2L6F A;  3MFN A;  3C8G A;  1V4A A;  1ZZP A;  1QVX A;  4XEF A;  2YWA A;  1K40 A;  1WOL A;  3GM3 A;  1K05 A;  3RQF A;  3RQE A;  1UFB A;  2JPU A;  2HSB A;  2JX0 A;  1OW7 A;  1KNY A;  2KK1 A;  4EBK A;  3GM2 A;  3B71 A;  3C8G D;  2LK4 A;  1O3U A;  2L6H A;  1K04 A;  1OW6 A;  4R32 A;  1PV3 A;  4XEV A;  5F28 E;  3S9O A;  3L8I A;  3U0C A;  3JZ0 A;  4EBJ A;  4XEK A;  3K7D A;  1OW8 A;  2PBE A;  1KTM A;  3BRJ A;  3O10 A;  3TUL A;  3C8G B;  3GM1 A;  1WTY A;  2Q00 A;  3AJM A;  2L6G A;  1WWP A;  4NQF A;  3U3F A;  1JOG A;  3L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...