3L1MA

Crystal structure of a ni-directed dimer of cytochrome cb562 with a quinolate-histidine hybrid coordination motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVCQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Controlled protein dimerization through hybrid coordination motifs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3l1mA00
1CPRA 3C63A 2XL6A 1S05A 2XM4A 1RCPA 5JP7A 4CIPA 5JT4A 4IAQA 1E83A 4CDVA 4ER9A 1YYXA 4D4NA 3TOMA 3ZQYA 5JS5A 3QVYA 3ZQVA 4NC3A 5JUAA 1JAFA 4CDAA 2QLAA 4WGYA 3QVZA 1M6TA 2XLDA 4CJGA 1QPUA 3DE8A 3HNKA 3NMIA 3TOLA 4CJOA 4JEAA 3DE9A 1QQ3A 3M79A 2YLDA 1E86A 1BBHA 3L1MA 5AGFA 3VRCA 4L6RA 3U8PA 1E85A 1MQVA 2YL0A 2YKZA 2YLGA 4IARA 3FOOA 5JLIA 1YZAA 1A7VA 2XLWA 3IQ5A 4U9DA 1YZCA 1CPQA 1LM3B 2XL8A 4CX9A 3QW0A 5B3IA 3HNIA 5JRAA 3NMKA 256BA 3HNLA 4IB4A 5JSLA 3M4CA 3NMJA 2YL7A 3IQ6A 2XLMA 3QW1A 3ZTMA 1E84A 2YLIA 4D4XA 2XM0A 4JKVA 3ZWIA 3C62A 2CCYA 1YYJA 4ULVA 2YL1A 3M4BA 2XLVA 2XLEA 4EIYA 4N6HA 1CGOA 4JE9A 1APCA 3HNJA 2J8WA 2XLHA 1CGNA 4U9EA 4N4WA 3ZTZA 4CDYA 1EKYA 2BC5A 1GQAA 3M15A 1NBBA 4JEBA 2XLOA 2J9BA 5JVEA 4WGZA 3FOPA 2YL3A
chains in the Genus database with same CATH superfamily
2PBEA 2DYSC 4MTOA 3DD7A 4GQHA 1S05A 3B29A 1OW7A 3C7JA 4MTFA 3TQOA 2HJ3A 3ECSA 4U5HA 1L3PA 4I1MA 2OJED 4OD5A 4EBKA 3SYNA 2YZSA 3MLGA 1AEPA 1ZYRF 3ZC4A 2J9VA 4DVYP 4ER9A 3AG3C 1L7CA 1TWAA 3US6A 4C3BA 2LP4A 2OEXA 3CZ6A 2ASRA 4O6MA 4X0RA 5JS5A 2B0JA 5L0DA 3NKEA 2OQMA 1FMWA 2OOCA 4H54A 4DOZA 3UNGC 4DBRA 3RIPA 2KSFA 1MNEA 2LSEA 3MX3A 4YT5A 4W8PA 2L6HA 5DQTA 4CDAA 4P9TA 3SXKA 1G4US 3CAXA 4XEVA 4OIRF 2NUTA 3PDMP 3U9JA 2H7OA 2CGEA 3QVZA 1XZPA 4MW8A 4XPYA 5DVWA 4PFOA 1D0ZA 2PX0A 1NSGB 2XLDA 4BG0A 1VYIA 3GEHA 2J9WA 3HNKA 1GS9A 1LE2A 3EHNA 1HE1A 5L0HA 2VC9A 1XWJA 3VAYA 3AOUA 3M79A 2YLDA 4BJ1A 3L34A 3AJMA 2WZGA 2A69F 4AE4B 4JURI 3U2LA 5KYUA 2WVOA 5L0GA 1V54C 3UMIA 3B0VC 3G4ZA 4J30B 2HSBA 3O39A 3DAGA 2R7UA 5AC4A 3S0XA 1CGME 2ZXRA 2Y39A 1SYQA 1F1MA 2LK4A 5KYYB 1A7VA 3BRJA 3MFNA 1T5OA 1SMYF 1YARO 4U9DA 3TULA 2J46A 2QNLA 2IOQA 2J9UA 2Y3GA 4BPMA 4PJNA 3DWWA 4KNVA 2FAPB 5A69A 1T6QA 3MYIA 4QDLA 4XEKA 4EWCA 1NG1A 4NQFA 1QVXA 1ZZPA 3U3BA 2XXAA 4PJJA 3W8IA 3EH2A 1EA8A 3NMKA 2O9XA 4G7OF 4AX2A 2OG2A 4PR9A 4MVZA 1HW1A 1R5ID 1KU2A 3L0IA 1FNTc 4E17A 4O79A 1U89A 5T1DB 1ZW3A 2OKUA 1JOGA 4DRIB 2J45A 2XM0A 4JKVA 3K7DA 4ULWA 1GGQA 5DS5A 3C62A 4H4KC 4N06A 4NCQA 4FAPB 4GYTA 3C8GA 3EGDA 3Q6NA 2VH3A 1QSPA 4FESA 2BE5F 3FMSA 3LEOA 4LACB 4EHPA 5L0IA 1XZQA 1JMWA 2P7VA 3GM1A 4ULVA 2H7VC 2YL1A 3JT1A 2NUTB 4YL0A 5COMA 4BJ6A 5EHHA 3N0TA 5L3VA 2FGYA 2GA0A 2OJQA 2XLVA 4EBBA 4RBNA 1EQ1A 5K0IA 4BEJA 3PCVA 3PHF2 3X1OA 4MVOA 4FWVA 4YN0B 2R7WA 2AWYA 3V5YA 4JE9A 3EZHA 1APCA 3C8ZA 3N24A 4OINF 1NLXA 2EPKX 2C04A 1OR3A 4N4WA 1VK5A 4G7ZF 4PJMA 5A6AA 2CW0F 1GQAA 1Z63A 2ZXWC 1NBBA 1NU9C 2L6FA 3LJBA 2NUPA 3JYYA 2RSEB 5F5HA 3FHDA 5KYUB 3SNHA 1YA9A 2WZLA 4U5FE 3LUTB 3LLIA 3EGXA 4Z9HA 3U9MA 2Y3HA 2XL6A 4CS9C 1V4AA 4IWBA 3SXZA 1MMAA 3K1IC 2XM4A 1VTMP 1Y4CA 2EIJC 5JT4A 3B71A 3CEXA 2KJGA 3AQBA 5E3AA 3DZAA 2CNWD 3OEOA 1E83A 2EILC 3AG2C 4EKWA 1C17M 1RKEA 2V3CC 4AE4A 1YYXA 3NKDA 5BQHA 2XXAB 2FFHA 4ONSA 3QZCA 3EJNA 4EBJA 4LDQA 4K1OA 3J06A 1LVKA 1OCRC 2NG1A 1LI7A 4DJ9A 2A1DD 2YQYA 3L8JA 4YT8A 2GWWA 4M63A 1ZVZA 5KYYA 2IXMA 4NY3A 1JAFA 2Q9CA 2A6EF 2PX3A 1WOLA 2XRHA 2R25A 3T4RA 3VF0A 1JRAA 3EZIA 3GEEA 2Y3BA 3S84A 2EPOA 2WZFA 1I4YA 2C03A 5KYXA 2CDQA 1WN0A 5T3WA 5HV9A 3EPVA 3TJ6A 1HMDA 2H7BA 3NYJA 1M6TA 2IXPA 3AQCA 1Q0FA 1G4WR 2J7PD 3DE8A 3JRMO 3C8GB 4LDRA 3EGDB 3SEOA 4E18A 3NMIA 3RQFA 3O10A 3TOLA 3JCUQ 1WWPA 1OW8A 5E2QA 2W45A 4B6IA 1QQ3A 4JIOA 4CIHA 1Q0MA 1E86A 4W8KA 1ORYA 4PJLA 3WODF 2MHRA 5CIVA 5AGFA 4XPWA 4E7SA 4FX5A 4LDKA 2VB6A 4MTGA 4E7ZA 1MQVA 2YKZA 3DJUB 3JRTA 2YVKA 4RD9A 3GWLA 1U0BB 2ETSA 4JW1A 5T3TA 1B68A 4JCHA 2LFDA 3WG7C 2IXOA 3IQ5A 4Z9IA 1CPQA 1LM3B 4HEAJ 3T6GB 1TR2A 4P6IC 1HMOA 2NUPB 3TD7A 4CX9A 2AP3A 3I5PA 3NG1A 3QW0A 5E33A 5EK0A 5KYNA 3GEIA 3EGXB 2QE9A 2HS5A 3S9OA 5L0CA 4JTCB 1ZU5A 2A0BA 2AVKA 3W2VA 3R2PA 2R7VA 2ZPAA 3ASNC 3HLZA 2ZXPA 3HTKC 1QZXA 2QUPA 3FAPB 3K6BA 3L8IA 4JJFA 2HKVA 2WVQA 4IB4A 2LD6A 5JSLA 3WHNA 2R7SA 3LS1A 3NMJA 1IZMA 2YL7A 1TWCA 5TJ5E 2Q00A 1MMNA 1RKEB 2W4MA 2HV7A 2XLMA 2M64A 3QW1A 2HV6A 2LCHA 4D4XA 1A7DA 1O87A 2AWCA 1VB5A 4MNDA 2HMQA 3ZWIA 2XSEA 1G8XA 3TK0A 3RF3A 1EI7A 2M4EA 2BL2A 2CCYA 3LNRA 3EQLF 3KYIA 1Q0KA 2NSFA 1YYJA 4MS2A 4RDAA 4K0DA 3DKAA 3U2MA 2TMVP 4YL3A 1GM5A 5KYXB 1PCXA 1PV3A 2WL8A 2XS1A 3M1CB 1RKCA 3SP1A 5D92A 2YHSA 4Q5SF 4EIYA 3SZRA 4R32A 5A6BD 1DOWA 3AG1C 2MWQA 1CGOA 4I1OB 2J0WA 2UUIA 3UR3C 2CNWA 5L0FA 5DLJA 3HNJA 2J8WA 3W4YA 1CGNA 1M56C 2EIKC 4CBEA 1NFNA 1W2WA 2L6GA 4U5DE 2DGJA 3DM9B 1OW6A 4Q7CA 1N1CA 1JPNA 1H9TA 1O3UA 1KNYA 4KNWA 3TJ5A 5COGA 4WGZA 2D4UA 3FOPA 2YL3A 2UUHA 4CS8A 5DS4A 4JC7A 1CPRA 2GFHA 2H8AA 3AG4C 3C63A 3LNMB 2RD9A 4KC9A 4LERA 3U5SA 4AL0A 4P9FA 1RCPA 3FAJA 4U5EE 3W2WA 3HJCA 4IAQA 5B3IA 2GAQA 4IAOA 2R05A 2R7OA 3H2VA 3KH2A 1Q0DA 4Z9JA 2IXNA 3RQGA 2G3KA 1BR4A 1KTMA 1Z5ZA 1IW7F 2J0XA 4HFFB 2P61A 3RH3A 4AL1A 4BJ6C 1C03A 2J7PA 1LI5A 3TOMA 5FCLA 3DAFA 3ZQYA 3GWNA 3Q7GA 3KPHA 4U5CE 1VYKA 3T6BA 2F22A 3QVYA 1H6GA 3LLKA 3ZG1A 4YWQA 3ZQVA 1VMAA 1ST6A 1O5HA 2R7TA 2ZXOA 3EG9B 3LS0A 2KC3A 1OCZC 3OWTA 3E9VA 1ORSC 4WGYA 4U5BE 3IPMO 1MMGA 2NPUA 3RFYA 4CJGA 3F46A 5KYWA 4C7OA 1YA7O 2DB4A 3K66A 1K40A 4JEAA 2VASA 3T9OA 3ZIBA 3DE9A 3S27A 4EUKB 1Y6DA 2R7QA 5CI8A 1FAPB 4PACA 2OCCC 1FMVA 3IQTA 2W4BA 1UG7A 2HSQA 1OKKD 3Q6MA 4JZAA 3L1MA 3VRCA 3S90A 2IM8A 5COFA 1S7ZA 1BDJB 4LLCA 1PD1A 3RVZA 4JTDB 1SF8A 2QTVA 1K04A 1D0YA 1WGWA 1T9KA 3O55A 4L6RA 1TFOB 3U8PA 1WASA 1E85A 2KYHA 2YLGA 4HE8D 4CSAA 3NRHA 4IARA 4MVSA 2VCBA 2Y69C 4J32B 3GANA 1FTSA 1LKXA 5BQGA 4BJ5A 4E0IA 4QI2A 3NYMA 3ZSUA 4ANJA 2Q4FA 3PMRA 1M57C 1YJGA 2AU5A 1YZCA 2XL8A 3BEHA 3FDQA 5B1AC 2PNOA 1SR2A 2IYLD 1RXQA 3IEEA 4XEFA 1HW2A 4G0HA 5D91A 1BR1A 1R4TA 4XQ1A 5JRAA 2L81A 256BA 4IRUA 1C02A 4MVRA 2Z15A 2NSGA 4G7HF 1WATA 1A0BA 1LS1A 2JPUA 5CI9A 2KNHA 3RVYA 2V26A 3ASOC 2YRFA 1T01A 3JSEO 3IQ6A 4JVSA 3ZVRA 4BEMJ 4CS7A 2OEVA 3K1HA 3ZTMA 5A6BA 2KQ9A 4WABA 1E84A 1VLSA 2YLIA 3LEVA 1LE4A 1VLTA 1VOMA 3F47A 3KL4A 4YJWA 4QI0A 4JRZA 3RQEA 5A6JA 2R03A 1OXBA 2EINC 2VCAA 5AC5A 3IQCA 3DM5A 1OCCC 2A0UA 3DMDA 1H9GA 3AGTA 4OIOF 3QTHA 2KGOA 3QMKA 1ZU4A 2XLEA 1OCOC 4C7OB 5KYWB 1UFBA 4IJJA 4YT2A 2LFFA 2LQGA 3CSKA 4LLEA 4UDVA 1BR2A 3EG9A 1TQGA 3MYFA 2XLHA 4XWJA 3ZTZA 4CDYA 1EKYA 2BC5A 2Q3TA 3DXJF 2PP4A 1G5ZA 4XLPF 1DOVA 2R7RA 1ZHZA 1K05A 4JEBA 1OXKA 2XLOA 5JVEA 3N2ZB 3S28A 2A6HF 4JTAB 4A2NB 3C18A 3UGPA 1T6IA 1D0XA 2KK1A 3Q7LA 4N6CA 2DYRC 2X0CA 4ZLCA 3JYHA 5F28E 3R7CA 3ABMC 4I3MA 4WJ0A 2QY9A 5JP7A 4AK9A 4CIPA 5BQIA 1E2XA 1YDIA 3EH1A 1ZHYA 2L7AA 3ATPA 3G4XA 4CDVA 5IY5C 4OIPF 4PFPA 3A9CA 3UMHA 4D4NA 1OQCA 2G3VA 2JD3A 1T6UA 3GORA 3V5ZA 1RMVA 3GM2A 4DVZA 2I8BA 1JR8A 3RYLA 5A6KA 1QLEC 2ZD9A 3ABKC 3GM3A 1LS4A 1RJ9B 1V55C 2D5RB 3JZ0A 3UMKA 1LPEA 1A7EA 1PD0A 1Z23A 4NC3A 2E87A 1OKKA 4NTAA 5B1BC 4MQ9F 5JUAA 2A68F 1TWHA 2KW3C 2G62A 1FR0A 1J8YF 1ORJA 3ITFA 2IBFA 2LIGA 1BZ4A 1M2OA 2ICWG 2QLAA 2Y3DA 4MVQA 4PK4A 5GPGB 3H2UA 3U0CA 1V74B 3ABLC 4KBLA 3EFOA 5BUOA 2OU6A 3JTLO 1YAUO 2CYDA 4CS8C 4A4AA 3B0UX 1M2VA 1D1AA 1QPUA 3UGOA 4MVMA 2B0HA 4CJOA 4E0HA 1WTYA 1A41A 2HZ8A 3LESA 4OD4A 4YL1A 3B9QA 4Q4ZF 2EPNA 5F5FA 3GODA 4HFKB 2XS8A 3U3FA 3FXHA 4JJGA 4C3EA 3FVYA 1BBHA 5FZTA 4DBQA 1NU7D 3AGUA 1YVIA 2P6VA 3NYLA 1Z6AA 3T6JA 3RW0A 5DS6A 1ZHWA 3WAQA 4XLNF 5HSWA 2JX0A 1Z3IX 2YL0A 4KI2A 2GDCA 1U6HA 4MVUA 4C3DA 3FOOA 5JLIA 1YZAA 2R02A 3V5XA 1LIHA 4NTFA 3LAYA 2L9JA 1FFTC 2XLWA 3HKKA 3W8HA 4G78A 1H7IA 4BJTA 3CQZA 2EIMC 3KYJA 1HY5A 2VCCA 5E3CA 4JCZA 4YT4A 1I4ZA 1SZIA 4DRJB 3IHUA 3HNIA 1TKNA 3H65A 3I5QA 3KMIA 2EPLX 2P0NA 1QKRA 2PFDA 2Q7RA 3U8VA 3G50A 2HUJA 1ZHTA 3E70C 5B3SC 3HNLA 5DQZA 5L0JA 4NTBA 1FFHA 3MBGA 1JPJA 2EPMX 4J7TA 5EGYA 3X2QC 3NDBB 3M4CA 1HE9A 3DJNB 3V7OA 2DI3A 2P1AA 2XL4A 1NZEA 1ZHXA 1MMDA 1D1CA 3KKBA 2YEVA 4U5GA 1YLMA 4O6NA 4XTKA 3RKOF 4OIQF 3DI5A 3I4UA 4O6YA 3S29A 4CS9A 4CSAC 2MYSA 3K1IA 2YWAA 1MNDA 3OA1A 2WVNA 1TWGA 2I15A 4BJ5C 1AVOB 3K33A 3SXMA 3VM6A 4YK5A 2R7XA 2PF4E 3ZDLA 1I5NA 2R9RB 3M4BA 4K7BA 3JSZA 3EFOB 4DXWA 2X51A 1J8MF 3EHMA 4XPXA 4GEHA 1ZW2A 4N6HA 3POVA 4ZLDA 4DRHB 3O6XA 1M2VB 2HFIA 1RJ9A 4MW3A 1OR2A 1Z7Qc 4IGGA 1TFKB 2HJMA 2W9YA 3VYWA 3SXYA 4U9EA 2WB7A 4F4BA 2Q9BA 3C8GD 3A11A 3M15A 4I44A 1AUEA 1NFOA 2HMZA 3B0PA 2Q9AA 4O7GA 2J9BA 5L3QA 1Q0GA 1D1BA 4J7YA
chains in the Genus database with same CATH topology
1CPRA 3C63A 2XL6A 1S05A 2XM4A 1RCPA 5JP7A 4CIPA 5JT4A 4IAQA 1E83A 4CDVA 4ER9A 1YYXA 4D4NA 3TOMA 3ZQYA 5JS5A 3QVYA 3ZQVA 4NC3A 5JUAA 1JAFA 4CDAA 2QLAA 4WGYA 3QVZA 1M6TA 2XLDA 4CJGA 1QPUA 3DE8A 3HNKA 3NMIA 3TOLA 4CJOA 4JEAA 3DE9A 1QQ3A 3M79A 2YLDA 1E86A 1BBHA 3L1MA 5AGFA 3VRCA 4L6RA 3U8PA 1E85A 1MQVA 2YL0A 2YKZA 2YLGA 4IARA 3FOOA 5JLIA 1YZAA 1A7VA 2XLWA 3IQ5A 4U9DA 1YZCA 1CPQA 1LM3B 2XL8A 4CX9A 3QW0A 5B3IA 3HNIA 5JRAA 3NMKA 256BA 3HNLA 4IB4A 5JSLA 3M4CA 3NMJA 2YL7A 3IQ6A 2XLMA 3QW1A 3ZTMA 1E84A 2YLIA 4D4XA 2XM0A 4JKVA 3ZWIA 3C62A 2CCYA 1YYJA 4ULVA 2YL1A 3M4BA 2XLVA 2XLEA 4EIYA 4N6HA 1CGOA 4JE9A 1APCA 3HNJA 2J8WA 2XLHA 1CGNA 4U9EA 4N4WA 3ZTZA 4CDYA 1EKYA 2BC5A 1GQAA 3M15A 1NBBA 4JEBA 2XLOA 2J9BA 5JVEA 4WGZA 3FOPA 2YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  3C63 A;  2XL6 A;  1S05 A;  2XM4 A;  1RCP A;  5JP7 A;  4CIP A;  5JT4 A;  4IAQ A;  1E83 A;  4CDV A;  4ER9 A;  1YYX A;  4D4N A;  3TOM A;  3ZQY A;  5JS5 A;  3QVY A;  3ZQV A;  4NC3 A;  5JUA A;  1JAF A;  4CDA A;  2QLA A;  4WGY A;  3QVZ A;  1M6T A;  2XLD A;  4CJG A;  1QPU A;  3DE8 A;  3HNK A;  3NMI A;  3TOL A;  4CJO A;  4JEA A;  3DE9 A;  1QQ3 A;  3M79 A;  2YLD A;  1E86 A;  1BBH A;  3L1M A;  5AGF A;  3VRC A;  4L6R A;  3U8P A;  1E85 A;  1MQV A;  2YL0 A;  2YKZ A;  2YLG A;  4IAR A;  3FOO A;  5JLI A;  1YZA A;  1A7V A;  2XLW A;  3IQ5 A;  4U9D A;  1YZC A;  1CPQ A;  1LM3 B;  2XL8 A;  4CX9 A;  3QW0 A;  5B3I A;  3HNI A;  5JRA A;  3NMK A;  256B A;  3HNL A;  4IB4 A;  5JSL A;  3M4C A;  3NMJ A;  2YL7 A;  3IQ6 A;  2XLM A;  3QW1 A;  3ZTM A;  1E84 A;  2YLI A;  4D4X A;  2XM0 A;  4JKV A;  3ZWI A;  3C62 A;  2CCY A;  1YYJ A;  4ULV A;  2YL1 A;  3M4B A;  2XLV A;  2XLE A;  4EIY A;  4N6H A;  1CGO A;  4JE9 A;  1APC A;  3HNJ A;  2J8W A;  2XLH A;  1CGN A;  4U9E A;  4N4W A;  3ZTZ A;  4CDY A;  1EKY A;  2BC5 A;  1GQA A;  3M15 A;  1NBB A;  4JEB A;  2XLO A;  2J9B A;  5JVE A;  4WGZ A;  3FOP A;  2YL3 A; 
#chains in the Genus database with same CATH topology
 2PBE A;  2DYS C;  4MTO A;  3DD7 A;  4GQH A;  1S05 A;  3B29 A;  1OW7 A;  3C7J A;  4MTF A;  3TQO A;  2HJ3 A;  3ECS A;  4U5H A;  1L3P A;  4I1M A;  2OJE D;  4OD5 A;  4EBK A;  3SYN A;  2YZS A;  3MLG A;  1AEP A;  1ZYR F;  3ZC4 A;  2J9V A;  4DVY P;  4ER9 A;  3AG3 C;  1L7C A;  1TWA A;  3US6 A;  4C3B A;  2LP4 A;  2OEX A;  3CZ6 A;  2ASR A;  4O6M A;  4X0R A;  5JS5 A;  2B0J A;  5L0D A;  3NKE A;  2OQM A;  1FMW A;  2OOC A;  4H54 A;  4DOZ A;  3UNG C;  4DBR A;  3RIP A;  2KSF A;  1MNE A;  2LSE A;  3MX3 A;  4YT5 A;  4W8P A;  2L6H A;  5DQT A;  4CDA A;  4P9T A;  3SXK A;  1G4U S;  3CAX A;  4XEV A;  4OIR F;  2NUT A;  3PDM P;  3U9J A;  2H7O A;  2CGE A;  3QVZ A;  1XZP A;  4MW8 A;  4XPY A;  5DVW A;  4PFO A;  1D0Z A;  2PX0 A;  1NSG B;  2XLD A;  4BG0 A;  1VYI A;  3GEH A;  2J9W A;  3HNK A;  1GS9 A;  1LE2 A;  3EHN A;  1HE1 A;  5L0H A;  2VC9 A;  1XWJ A;  3VAY A;  3AOU A;  3M79 A;  2YLD A;  4BJ1 A;  3L34 A;  3AJM A;  2WZG A;  2A69 F;  4AE4 B;  4JUR I;  3U2L A;  5KYU A;  2WVO A;  5L0G A;  1V54 C;  3UMI A;  3B0V C;  3G4Z A;  4J30 B;  2HSB A;  3O39 A;  3DAG A;  2R7U A;  5AC4 A;  3S0X A;  1CGM E;  2ZXR A;  2Y39 A;  1SYQ A;  1F1M A;  2LK4 A;  5KYY B;  1A7V A;  3BRJ A;  3MFN A;  1T5O A;  1SMY F;  1YAR O;  4U9D A;  3TUL A;  2J46 A;  2QNL A;  2IOQ A;  2J9U A;  2Y3G A;  4BPM A;  4PJN A;  3DWW A;  4KNV A;  2FAP B;  5A69 A;  1T6Q A;  3MYI A;  4QDL A;  4XEK A;  4EWC A;  1NG1 A;  4NQF A;  1QVX A;  1ZZP A;  3U3B A;  2XXA A;  4PJJ A;  3W8I A;  3EH2 A;  1EA8 A;  3NMK A;  2O9X A;  4G7O F;  4AX2 A;  2OG2 A;  4PR9 A;  4MVZ A;  1HW1 A;  1R5I D;  1KU2 A;  3L0I A;  1FNT c;  4E17 A;  4O79 A;  1U89 A;  5T1D B;  1ZW3 A;  2OKU A;  1JOG A;  4DRI B;  2J45 A;  2XM0 A;  4JKV A;  3K7D A;  4ULW A;  1GGQ A;  5DS5 A;  3C62 A;  4H4K C;  4N06 A;  4NCQ A;  4FAP B;  4GYT A;  3C8G A;  3EGD A;  3Q6N A;  2VH3 A;  1QSP A;  4FES A;  2BE5 F;  3FMS A;  3LEO A;  4LAC B;  4EHP A;  5L0I A;  1XZQ A;  1JMW A;  2P7V A;  3GM1 A;  4ULV A;  2H7V C;  2YL1 A;  3JT1 A;  2NUT B;  4YL0 A;  5COM A;  4BJ6 A;  5EHH A;  3N0T A;  5L3V A;  2FGY A;  2GA0 A;  2OJQ A;  2XLV A;  4EBB A;  4RBN A;  1EQ1 A;  5K0I A;  4BEJ A;  3PCV A;  3PHF 2;  3X1O A;  4MVO A;  4FWV A;  4YN0 B;  2R7W A;  2AWY A;  3V5Y A;  4JE9 A;  3EZH A;  1APC A;  3C8Z A;  3N24 A;  4OIN F;  1NLX A;  2EPK X;  2C04 A;  1OR3 A;  4N4W A;  1VK5 A;  4G7Z F;  4PJM A;  5A6A A;  2CW0 F;  1GQA A;  1Z63 A;  2ZXW C;  1NBB A;  1NU9 C;  2L6F A;  3LJB A;  2NUP A;  3JYY A;  2RSE B;  5F5H A;  3FHD A;  5KYU B;  3SNH A;  1YA9 A;  2WZL A;  4U5F E;  3LUT B;  3LLI A;  3EGX A;  4Z9H A;  3U9M A;  2Y3H A;  2XL6 A;  4CS9 C;  1V4A A;  4IWB A;  3SXZ A;  1MMA A;  3K1I C;  2XM4 A;  1VTM P;  1Y4C A;  2EIJ C;  5JT4 A;  3B71 A;  3CEX A;  2KJG A;  3AQB A;  5E3A A;  3DZA A;  2CNW D;  3OEO A;  1E83 A;  2EIL C;  3AG2 C;  4EKW A;  1C17 M;  1RKE A;  2V3C C;  4AE4 A;  1YYX A;  3NKD A;  5BQH A;  2XXA B;  2FFH A;  4ONS A;  3QZC A;  3EJN A;  4EBJ A;  4LDQ A;  4K1O A;  3J06 A;  1LVK A;  1OCR C;  2NG1 A;  1LI7 A;  4DJ9 A;  2A1D D;  2YQY A;  3L8J A;  4YT8 A;  2GWW A;  4M63 A;  1ZVZ A;  5KYY A;  2IXM A;  4NY3 A;  1JAF A;  2Q9C A;  2A6E F;  2PX3 A;  1WOL A;  2XRH A;  2R25 A;  3T4R A;  3VF0 A;  1JRA A;  3EZI A;  3GEE A;  2Y3B A;  3S84 A;  2EPO A;  2WZF A;  1I4Y A;  2C03 A;  5KYX A;  2CDQ A;  1WN0 A;  5T3W A;  5HV9 A;  3EPV A;  3TJ6 A;  1HMD A;  2H7B A;  3NYJ A;  1M6T A;  2IXP A;  3AQC A;  1Q0F A;  1G4W R;  2J7P D;  3DE8 A;  3JRM O;  3C8G B;  4LDR A;  3EGD B;  3SEO A;  4E18 A;  3NMI A;  3RQF A;  3O10 A;  3TOL A;  3JCU Q;  1WWP A;  1OW8 A;  5E2Q A;  2W45 A;  4B6I A;  1QQ3 A;  4JIO A;  4CIH A;  1Q0M A;  1E86 A;  4W8K A;  1ORY A;  4PJL A;  3WOD F;  2MHR A;  5CIV A;  5AGF A;  4XPW A;  4E7S A;  4FX5 A;  4LDK A;  2VB6 A;  4MTG A;  4E7Z A;  1MQV A;  2YKZ A;  3DJU B;  3JRT A;  2YVK A;  4RD9 A;  3GWL A;  1U0B B;  2ETS A;  4JW1 A;  5T3T A;  1B68 A;  4JCH A;  2LFD A;  3WG7 C;  2IXO A;  3IQ5 A;  4Z9I A;  1CPQ A;  1LM3 B;  4HEA J;  3T6G B;  1TR2 A;  4P6I C;  1HMO A;  2NUP B;  3TD7 A;  4CX9 A;  2AP3 A;  3I5P A;  3NG1 A;  3QW0 A;  5E33 A;  5EK0 A;  5KYN A;  3GEI A;  3EGX B;  2QE9 A;  2HS5 A;  3S9O A;  5L0C A;  4JTC B;  1ZU5 A;  2A0B A;  2AVK A;  3W2V A;  3R2P A;  2R7V A;  2ZPA A;  3ASN C;  3HLZ A;  2ZXP A;  3HTK C;  1QZX A;  2QUP A;  3FAP B;  3K6B A;  3L8I A;  4JJF A;  2HKV A;  2WVQ A;  4IB4 A;  2LD6 A;  5JSL A;  3WHN A;  2R7S A;  3LS1 A;  3NMJ A;  1IZM A;  2YL7 A;  1TWC A;  5TJ5 E;  2Q00 A;  1MMN A;  1RKE B;  2W4M A;  2HV7 A;  2XLM A;  2M64 A;  3QW1 A;  2HV6 A;  2LCH A;  4D4X A;  1A7D A;  1O87 A;  2AWC A;  1VB5 A;  4MND A;  2HMQ A;  3ZWI A;  2XSE A;  1G8X A;  3TK0 A;  3RF3 A;  1EI7 A;  2M4E A;  2BL2 A;  2CCY A;  3LNR A;  3EQL F;  3KYI A;  1Q0K A;  2NSF A;  1YYJ A;  4MS2 A;  4RDA A;  4K0D A;  3DKA A;  3U2M A;  2TMV P;  4YL3 A;  1GM5 A;  5KYX B;  1PCX A;  1PV3 A;  2WL8 A;  2XS1 A;  3M1C B;  1RKC A;  3SP1 A;  5D92 A;  2YHS A;  4Q5S F;  4EIY A;  3SZR A;  4R32 A;  5A6B D;  1DOW A;  3AG1 C;  2MWQ A;  1CGO A;  4I1O B;  2J0W A;  2UUI A;  3UR3 C;  2CNW A;  5L0F A;  5DLJ A;  3HNJ A;  2J8W A;  3W4Y A;  1CGN A;  1M56 C;  2EIK C;  4CBE A;  1NFN A;  1W2W A;  2L6G A;  4U5D E;  2DGJ A;  3DM9 B;  1OW6 A;  4Q7C A;  1N1C A;  1JPN A;  1H9T A;  1O3U A;  1KNY A;  4KNW A;  3TJ5 A;  5COG A;  4WGZ A;  2D4U A;  3FOP A;  2YL3 A;  2UUH A;  4CS8 A;  5DS4 A;  4JC7 A;  1CPR A;  2GFH A;  2H8A A;  3AG4 C;  3C63 A;  3LNM B;  2RD9 A;  4KC9 A;  4LER A;  3U5S A;  4AL0 A;  4P9F A;  1RCP A;  3FAJ A;  4U5E E;  3W2W A;  3HJC A;  4IAQ A;  5B3I A;  2GAQ A;  4IAO A;  2R05 A;  2R7O A;  3H2V A;  3KH2 A;  1Q0D A;  4Z9J A;  2IXN A;  3RQG A;  2G3K A;  1BR4 A;  1KTM A;  1Z5Z A;  1IW7 F;  2J0X A;  4HFF B;  2P61 A;  3RH3 A;  4AL1 A;  4BJ6 C;  1C03 A;  2J7P A;  1LI5 A;  3TOM A;  5FCL A;  3DAF A;  3ZQY A;  3GWN A;  3Q7G A;  3KPH A;  4U5C E;  1VYK A;  3T6B A;  2F22 A;  3QVY A;  1H6G A;  3LLK A;  3ZG1 A;  4YWQ A;  3ZQV A;  1VMA A;  1ST6 A;  1O5H A;  2R7T A;  2ZXO A;  3EG9 B;  3LS0 A;  2KC3 A;  1OCZ C;  3OWT A;  3E9V A;  1ORS C;  4WGY A;  4U5B E;  3IPM O;  1MMG A;  2NPU A;  3RFY A;  4CJG A;  3F46 A;  5KYW A;  4C7O A;  1YA7 O;  2DB4 A;  3K66 A;  1K40 A;  4JEA A;  2VAS A;  3T9O A;  3ZIB A;  3DE9 A;  3S27 A;  4EUK B;  1Y6D A;  2R7Q A;  5CI8 A;  1FAP B;  4PAC A;  2OCC C;  1FMV A;  3IQT A;  2W4B A;  1UG7 A;  2HSQ A;  1OKK D;  3Q6M A;  4JZA A;  3L1M A;  3VRC A;  3S90 A;  2IM8 A;  5COF A;  1S7Z A;  1BDJ B;  4LLC A;  1PD1 A;  3RVZ A;  4JTD B;  1SF8 A;  2QTV A;  1K04 A;  1D0Y A;  1WGW A;  1T9K A;  3O55 A;  4L6R A;  1TFO B;  3U8P A;  1WAS A;  1E85 A;  2KYH A;  2YLG A;  4HE8 D;  4CSA A;  3NRH A;  4IAR A;  4MVS A;  2VCB A;  2Y69 C;  4J32 B;  3GAN A;  1FTS A;  1LKX A;  5BQG A;  4BJ5 A;  4E0I A;  4QI2 A;  3NYM A;  3ZSU A;  4ANJ A;  2Q4F A;  3PMR A;  1M57 C;  1YJG A;  2AU5 A;  1YZC A;  2XL8 A;  3BEH A;  3FDQ A;  5B1A C;  2PNO A;  1SR2 A;  2IYL D;  1RXQ A;  3IEE A;  4XEF A;  1HW2 A;  4G0H A;  5D91 A;  1BR1 A;  1R4T A;  4XQ1 A;  5JRA A;  2L81 A;  256B A;  4IRU A;  1C02 A;  4MVR A;  2Z15 A;  2NSG A;  4G7H F;  1WAT A;  1A0B A;  1LS1 A;  2JPU A;  5CI9 A;  2KNH A;  3RVY A;  2V26 A;  3ASO C;  2YRF A;  1T01 A;  3JSE O;  3IQ6 A;  4JVS A;  3ZVR A;  4BEM J;  4CS7 A;  2OEV A;  3K1H A;  3ZTM A;  5A6B A;  2KQ9 A;  4WAB A;  1E84 A;  1VLS A;  2YLI A;  3LEV A;  1LE4 A;  1VLT A;  1VOM A;  3F47 A;  3KL4 A;  4YJW A;  4QI0 A;  4JRZ A;  3RQE A;  5A6J A;  2R03 A;  1OXB A;  2EIN C;  2VCA A;  5AC5 A;  3IQC A;  3DM5 A;  1OCC C;  2A0U A;  3DMD A;  1H9G A;  3AGT A;  4OIO F;  3QTH A;  2KGO A;  3QMK A;  1ZU4 A;  2XLE A;  1OCO C;  4C7O B;  5KYW B;  1UFB A;  4IJJ A;  4YT2 A;  2LFF A;  2LQG A;  3CSK A;  4LLE A;  4UDV A;  1BR2 A;  3EG9 A;  1TQG A;  3MYF A;  2XLH A;  4XWJ A;  3ZTZ A;  4CDY A;  1EKY A;  2BC5 A;  2Q3T A;  3DXJ F;  2PP4 A;  1G5Z A;  4XLP F;  1DOV A;  2R7R A;  1ZHZ A;  1K05 A;  4JEB A;  1OXK A;  2XLO A;  5JVE A;  3N2Z B;  3S28 A;  2A6H F;  4JTA B;  4A2N B;  3C18 A;  3UGP A;  1T6I A;  1D0X A;  2KK1 A;  3Q7L A;  4N6C A;  2DYR C;  2X0C A;  4ZLC A;  3JYH A;  5F28 E;  3R7C A;  3ABM C;  4I3M A;  4WJ0 A;  2QY9 A;  5JP7 A;  4AK9 A;  4CIP A;  5BQI A;  1E2X A;  1YDI A;  3EH1 A;  1ZHY A;  2L7A A;  3ATP A;  3G4X A;  4CDV A;  5IY5 C;  4OIP F;  4PFP A;  3A9C A;  3UMH A;  4D4N A;  1OQC A;  2G3V A;  2JD3 A;  1T6U A;  3GOR A;  3V5Z A;  1RMV A;  3GM2 A;  4DVZ A;  2I8B A;  1JR8 A;  3RYL A;  5A6K A;  1QLE C;  2ZD9 A;  3ABK C;  3GM3 A;  1LS4 A;  1RJ9 B;  1V55 C;  2D5R B;  3JZ0 A;  3UMK A;  1LPE A;  1A7E A;  1PD0 A;  1Z23 A;  4NC3 A;  2E87 A;  1OKK A;  4NTA A;  5B1B C;  4MQ9 F;  5JUA A;  2A68 F;  1TWH A;  2KW3 C;  2G62 A;  1FR0 A;  1J8Y F;  1ORJ A;  3ITF A;  2IBF A;  2LIG A;  1BZ4 A;  1M2O A;  2ICW G;  2QLA A;  2Y3D A;  4MVQ A;  4PK4 A;  5GPG B;  3H2U A;  3U0C A;  1V74 B;  3ABL C;  4KBL A;  3EFO A;  5BUO A;  2OU6 A;  3JTL O;  1YAU O;  2CYD A;  4CS8 C;  4A4A A;  3B0U X;  1M2V A;  1D1A A;  1QPU A;  3UGO A;  4MVM A;  2B0H A;  4CJO A;  4E0H A;  1WTY A;  1A41 A;  2HZ8 A;  3LES A;  4OD4 A;  4YL1 A;  3B9Q A;  4Q4Z F;  2EPN A;  5F5F A;  3GOD A;  4HFK B;  2XS8 A;  3U3F A;  3FXH A;  4JJG A;  4C3E A;  3FVY A;  1BBH A;  5FZT A;  4DBQ A;  1NU7 D;  3AGU A;  1YVI A;  2P6V A;  3NYL A;  1Z6A A;  3T6J A;  3RW0 A;  5DS6 A;  1ZHW A;  3WAQ A;  4XLN F;  5HSW A;  2JX0 A;  1Z3I X;  2YL0 A;  4KI2 A;  2GDC A;  1U6H A;  4MVU A;  4C3D A;  3FOO A;  5JLI A;  1YZA A;  2R02 A;  3V5X A;  1LIH A;  4NTF A;  3LAY A;  2L9J A;  1FFT C;  2XLW A;  3HKK A;  3W8H A;  4G78 A;  1H7I A;  4BJT A;  3CQZ A;  2EIM C;  3KYJ A;  1HY5 A;  2VCC A;  5E3C A;  4JCZ A;  4YT4 A;  1I4Z A;  1SZI A;  4DRJ B;  3IHU A;  3HNI A;  1TKN A;  3H65 A;  3I5Q A;  3KMI A;  2EPL X;  2P0N A;  1QKR A;  2PFD A;  2Q7R A;  3U8V A;  3G50 A;  2HUJ A;  1ZHT A;  3E70 C;  5B3S C;  3HNL A;  5DQZ A;  5L0J A;  4NTB A;  1FFH A;  3MBG A;  1JPJ A;  2EPM X;  4J7T A;  5EGY A;  3X2Q C;  3NDB B;  3M4C A;  1HE9 A;  3DJN B;  3V7O A;  2DI3 A;  2P1A A;  2XL4 A;  1NZE A;  1ZHX A;  1MMD A;  1D1C A;  3KKB A;  2YEV A;  4U5G A;  1YLM A;  4O6N A;  4XTK A;  3RKO F;  4OIQ F;  3DI5 A;  3I4U A;  4O6Y A;  3S29 A;  4CS9 A;  4CSA C;  2MYS A;  3K1I A;  2YWA A;  1MND A;  3OA1 A;  2WVN A;  1TWG A;  2I15 A;  4BJ5 C;  1AVO B;  3K33 A;  3SXM A;  3VM6 A;  4YK5 A;  2R7X A;  2PF4 E;  3ZDL A;  1I5N A;  2R9R B;  3M4B A;  4K7B A;  3JSZ A;  3EFO B;  4DXW A;  2X51 A;  1J8M F;  3EHM A;  4XPX A;  4GEH A;  1ZW2 A;  4N6H A;  3POV A;  4ZLD A;  4DRH B;  3O6X A;  1M2V B;  2HFI A;  1RJ9 A;  4MW3 A;  1OR2 A;  1Z7Q c;  4IGG A;  1TFK B;  2HJM A;  2W9Y A;  3VYW A;  3SXY A;  4U9E A;  2WB7 A;  4F4B A;  2Q9B A;  3C8G D;  3A11 A;  3M15 A;  4I44 A;  1AUE A;  1NFO A;  2HMZ A;  3B0P A;  2Q9A A;  4O7G A;  2J9B A;  5L3Q A;  1Q0G A;  1D1B A;  4J7Y A; 
#chains in the Genus database with same CATH homology
 1CPR A;  3C63 A;  2XL6 A;  1S05 A;  2XM4 A;  1RCP A;  5JP7 A;  4CIP A;  5JT4 A;  4IAQ A;  1E83 A;  4CDV A;  4ER9 A;  1YYX A;  4D4N A;  3TOM A;  3ZQY A;  5JS5 A;  3QVY A;  3ZQV A;  4NC3 A;  5JUA A;  1JAF A;  4CDA A;  2QLA A;  4WGY A;  3QVZ A;  1M6T A;  2XLD A;  4CJG A;  1QPU A;  3DE8 A;  3HNK A;  3NMI A;  3TOL A;  4CJO A;  4JEA A;  3DE9 A;  1QQ3 A;  3M79 A;  2YLD A;  1E86 A;  1BBH A;  3L1M A;  5AGF A;  3VRC A;  4L6R A;  3U8P A;  1E85 A;  1MQV A;  2YL0 A;  2YKZ A;  2YLG A;  4IAR A;  3FOO A;  5JLI A;  1YZA A;  1A7V A;  2XLW A;  3IQ5 A;  4U9D A;  1YZC A;  1CPQ A;  1LM3 B;  2XL8 A;  4CX9 A;  3QW0 A;  5B3I A;  3HNI A;  5JRA A;  3NMK A;  256B A;  3HNL A;  4IB4 A;  5JSL A;  3M4C A;  3NMJ A;  2YL7 A;  3IQ6 A;  2XLM A;  3QW1 A;  3ZTM A;  1E84 A;  2YLI A;  4D4X A;  2XM0 A;  4JKV A;  3ZWI A;  3C62 A;  2CCY A;  1YYJ A;  4ULV A;  2YL1 A;  3M4B A;  2XLV A;  2XLE A;  4EIY A;  4N6H A;  1CGO A;  4JE9 A;  1APC A;  3HNJ A;  2J8W A;  2XLH A;  1CGN A;  4U9E A;  4N4W A;  3ZTZ A;  4CDY A;  1EKY A;  2BC5 A;  1GQA A;  3M15 A;  1NBB A;  4JEB A;  2XLO A;  2J9B A;  5JVE A;  4WGZ A;  3FOP A;  2YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...