3L1MA

Crystal structure of a ni-directed dimer of cytochrome cb562 with a quinolate-histidine hybrid coordination motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVCQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Controlled protein dimerization through hybrid coordination motifs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3l1mA00
2J8WA 5JP7A 3ZTMA 4CX9A 5JUAA 1CGOA 1BBHA 5JS5A 1YYJA 4IARA 2YLGA 3C63A 3NMIA 2XL8A 4N4WA 1M6TA 3QVYA 4IAQA 3ZQVA 4JE9A 2XLVA 3M4BA 4JEBA 1RCPA 5JT4A 1QQ3A 3L1MA 4JKVA 3C62A 3ZWIA 3HNIA 4L6RA 2XM4A 4IB4A 4ULVA 3QVZA 2YLIA 3NMJA 3ZQYA 2XM0A 3IQ6A 1LM3B 2XLMA 4U9EA 3NMKA 4CIPA 4NC3A 1EKYA 5JRAA 5JLIA 4CJOA 2J9BA 3HNJA 2CCYA 2XLEA 2YLDA 3DE9A 1CGNA 5JVEA 1S05A 2XLOA 4U9DA 2XLHA 3TOLA 4WGYA 3TOMA 1APCA 4WGZA 1CPQA 2YL0A 1A7VA 2QLAA 1GQAA 3HNLA 3VRCA 2YL3A 1E86A 3M79A 3FOOA 2XL6A 3QW0A 3M4CA 4N6HA 3QW1A 5JSLA 5B3IA 5AGFA 4EIYA 1MQVA 4CDAA 1CPRA 3IQ5A 3HNKA 3U8PA 3DE8A 1YYXA 3FOPA 2YKZA 2YL1A 2BC5A 4D4NA 1JAFA 1E85A 3ZTZA 256BA 4CJGA 4CDYA 2XLDA 4ER9A 2XLWA 1YZCA 3M15A 1QPUA 1NBBA 1E83A 1E84A 4CDVA 2YL7A 4D4XA 4JEAA 1YZAA
chains in the Genus database with same CATH superfamily
4FAPB 2WB7A 1RJ9A 4KC9A 3E70C 3OA1A 5A69A 1AEPA 3WAQA 1ZHZA 1SR2A 2IM8A 3N0TA 3EPVA 1OQCA 3RKOF 4I3MA 2NSFA 4QI2A 1YYJA 4CS7A 2QE9A 2PNOA 3LESA 5D92A 2R7RA 2W9YA 1ZVZA 2JD3A 3IPMO 4E18A 3NMIA 3MYFA 4W8PA 5CI9A 5BQGA 4DRHB 1VYKA 2YZSA 3ABKC 1M2VA 3GM3A 4XQ1A 1BR2A 1RXQA 3MYIA 4A2NB 2LCHA 1MMGA 3LJBA 5CIVA 1D1AA 1VOMA 3CQZA 3DAGA 3UGOA 3I5PA 1M6TA 3H2UA 2HSQA 4IAQA 2QY9A 1WN0A 1A41A 2XXAB 3MLGA 4JE9A 3U5SA 2H7OA 3TD7A 5GPGB 2L7AA 3M4BA 4JEBA 1H6GA 4BJ6A 5JT4A 1QQ3A 3S9OA 3R2PA 3S29A 3F47A 2P1AA 4JKVA 3C62A 4GYTA 3T6JA 3DZAA 4IB4A 1Z63A 2EIJC 3HKKA 3JTLO 4ULVA 3TJ6A 3QVZA 5F5HA 2ZXPA 3U3FA 1WTYA 4QDLA 1LE4A 4AL0A 2AVKA 2WZGA 3JRTA 1GS9A 4J7TA 2L9JA 2L81A 3ABMC 4LLCA 4CS9A 3RVZA 2KC3A 3NRHA 2HMZA 3RW0A 3S0XA 5KYUB 4CJOA 5D91A 3W2WA 2CCYA 1K05A 1T01A 3DWWA 5IY5C 3CEXA 2PFDA 4W8KA 4Q4ZF 1GGQA 4FX5A 4MNDA 3C8GA 1ZW3A 2BL2A 1JOGA 3PMRA 1OCCC 3RQEA 3FAJA 1CGNA 1UFBA 4PJNA 5E3AA 1S05A 2OEXA 4ONSA 4BEMJ 1TR2A 3VF0A 3B9QA 1APCA 1QSPA 2CW0F 1CPQA 2YL0A 4JTDB 4MVQA 4PJLA 5FZTA 2Q7RA 3JSZA 4XWJA 4YJWA 4MQ9F 1OKKD 3VM6A 3AG4C 3C7JA 3FAPB 3DXJF 3LAYA 2LD6A 3HNLA 4OD5A 1YAUO 3VRCA 2A1DD 1ORYA 5EHHA 2A6HF 4IWBA 4CSAC 2RSEB 2J0XA 1KTMA 3M79A 1O5HA 3FOOA 4J30B 3QW0A 1EI7A 4XEKA 2WVOA 2C04A 3L34A 4N6CA 4MVZA 5AGFA 4JZAA 4N06A 3VAYA 2PX3A 5DQZA 4E0HA 4WJ0A 1KNYA 1FR0A 1I4YA 1L3PA 1I4ZA 2B0HA 3HLZA 1A7EA 1OW7A 2CNWD 4C3DA 4EUKB 3BRJA 5DQTA 3DE8A 4J7YA 3AJMA 1Q0MA 2E87A 4UDVA 2PF4E 2A68F 3O55A 2ZPAA 5K0IA 3DAFA 4JCHA 4LDRA 3ZTZA 3I5QA 3NKDA 1E85A 3RIPA 1AUEA 3Q7LA 4Z9IA 4EWCA 2P6VA 5E33A 3FDQA 5KYWB 2NUTB 4ER9A 2XLWA 5BQIA 2J0WA 3LUTB 4U5GA 3TULA 4YT8A 3DD7A 3LLKA 4H4KC 4EBKA 1D0YA 3M15A 3B29A 1H7IA 1M2OA 1QPUA 2AU5A 4P6IC 4X0RA 3ECSA 4CIHA 1FMWA 3FMSA 2J9UA 1L7CA 3DM5A 5T1DB 4M63A 2G3VA 1LE2A 2DYSC 3RYLA 4DRIB 1NU7D 2G3KA 2YL7A 1TFKB 3EG9B 3K1IA 1NLXA 4YN0B 4BJ5A 1HW1A 2J7PD 2R7QA 4D4XA 4CS8A 2ZXRA 4LACB 4K0DA 2XS1A 3GWNA 1FAPB 2J8WA 3H65A 3ZTMA 4BEJA 3EH1A 2DB4A 4K1OA 4XPYA 3KYIA 5L0CA 2ZXOA 3Q6MA 5KYYA 5JUAA 3ZSUA 5E2QA 5L0JA 1LS1A 3UMKA 1WASA 5JS5A 4IARA 2IXNA 2KQ9A 2P0NA 3QZCA 2LQGA 4HFFB 2H8AA 1NFNA 2YRFA 2VH3A 5KYXB 2Y3HA 3B71A 3T6BA 2EPOA 1OKKA 3K66A 1G4WR 2AWYA 4OIPF 3O39A 1WATA 4A4AA 2FFHA 3NDBB 3T4RA 4HEAJ 2AP3A 3K33A 1RKEB 2OOCA 3ZQVA 4BJ1A 2I8BA 2CGEA 3JT1A 3LEOA 4QI0A 2YHSA 4EHPA 3WG7C 3L1MA 2M64A 1Z7Qc 3SXZA 2EPKX 1JPJA 3MBGA 2MHRA 3SNHA 3HNIA 2NUPA 4L6RA 4DOZA 3ATPA 2A69F 1HY5A 2IYLD 4E0IA 2OJQA 2YVKA 3U8VA 1HW2A 2EIKC 2OEVA 4KI2A 1FFTC 4P9TA 4IGGA 1B68A 2XLMA 3CZ6A 3GM2A 4U9EA 1R4TA 3UGPA 3EGDB 2UUIA 4CIPA 1EKYA 5JRAA 1ZHWA 4PFOA 4AL1A 3DJNB 3SXMA 3HNJA 2M4EA 2P7VA 3LNRA 1QVXA 1JPNA 2L6GA 2J9VA 1Z3IX 2CYDA 1ZU4A 4NQFA 1HE1A 2WL8A 1ZZPA 5COGA 3RH3A 1OCOC 1U0BB 1U89A 4XEFA 2GDCA 3A9CA 4FESA 1OCZC 2VCAA 3US6A 3K1HA 1HMOA 4IJJA 5B3SC 4E7ZA 4JTAB 4HE8D 1W2WA 1T6QA 2J7PA 2QLAA 4Q5SF 1LI7A 2KW3C 1BZ4A 3M1CB 4NTFA 5A6BA 3HTKC 3NYJA 3UR3C 1EA8A 3EG9A 4XLNF 1CGME 4FWVA 4YT5A 1OR3A 3L8JA 3B0VC 3RQFA 4MVUA 2Y3DA 3M4CA 2WZFA 1FTSA 2NSGA 4NCQA 2A0BA 2ETSA 2HS5A 2HZ8A 2L6HA 2W4MA 3S28A 1ST6A 3GODA 5B3IA 4O6MA 1LKXA 2FAPB 2D4UA 1XWJA 3KL4A 4NTBA 1MQVA 1Y4CA 4PFPA 1Z23A 1MNEA 3TK0A 2UUHA 3T9OA 1TWGA 2JX0A 1LI5A 2L6FA 4O6NA 4MTFA 1ZHXA 3ZVRA 1YLMA 1D1BA 1YYXA 1YJGA 3AG2C 3G50A 3RFYA 5AC5A 3B0UX 3RVYA 1J8YF 1XZQA 4GEHA 5KYXA 3DI5A 3MFNA 2YL1A 1C03A 4HFKB 2WVQA 2XRHA 3B0PA 4LERA 4G7ZF 3ZG1A 1ZW2A 3V5XA 2EILC 1U6HA 4C7OB 256BA 2LP4A 3JRMO 4CDYA 4AX2A 5KYNA 3GEHA 4XPWA 1VYIA 1VTMP 4G7OF 3U9MA 1QZXA 1M57C 2PBEA 1N1CA 4PJJA 1AVOB 1QKRA 1T5OA 2EPNA 5EK0A 5TJ5E 2J9WA 4CDVA 2KJGA 3S84A 4JJFA 3WODF 4RBNA 3ASNC 2MWQA 3GANA 4OINF 4JEAA 4YWQA 3O6XA 3NYLA 1H9TA 2I15A 1XZPA 1YZAA 1WOLA 2B0JA 2GA0A 3EGXB 4R32A 3W2VA 1Q0GA 3EGDA 3KPHA 4CX9A 1OXBA 4MVMA 1ORJA 2J46A 2VCCA 4C3EA 5COFA 1PD0A 1RJ9B 2Y39A 1VMAA 4U5BE 1ORSC 1QLEC 1C17M 2R7VA 2XXAA 2R02A 3GEEA 4I1OB 1IW7F 5L0HA 1HE9A 3JCUQ 3EQLF 2R7XA 3OWTA 4ZLCA 1EQ1A 2EINC 1OW8A 2Q00A 4DRJB 2DYRC 4JC7A 4DJ9A 2QNLA 1M2VB 4RDAA 4CBEA 3X2QC 1YARO 1Z6AA 1FFHA 3PCVA 4U5DE 3U0CA 1FNTc 2OG2A 1DOVA 1MNDA 1T6IA 3ZWIA 3ZDLA 2XM4A 1O3UA 2W4BA 2Q3TA 3NG1A 5KYUA 5T3WA 2IXOA 3ZQYA 3AGUA 1RMVA 3KKBA 2XM0A 3U3BA 1NSGB 3IQ6A 4JIOA 2GWWA 2R9RB 3NMKA 4OIRF 3PHF2 3V5YA 3K6BA 2X0CA 2R7TA 3TJ5A 2Q9BA 5JLIA 3W8HA 4F4BA 2XLEA 1BDJB 5DS5A 4EKWA 3BEHA 2YLDA 3RQGA 3KYJA 4BJTA 3I4UA 3IQTA 2R7OA 3DE9A 3GWLA 3C18A 3FHDA 5JVEA 4G7HF 2XLOA 4U9DA 3QTHA 3TOLA 3NKEA 3IQCA 4RD9A 4WGZA 1K40A 3TOMA 5L0GA 1YDIA 4MVOA 3C8GB 3UNGC 1V74B 1A7VA 1IZMA 1PV3A 4PJMA 2GAQA 3JZ0A 4ANJA 4ZLDA 1LIHA 4DXWA 1GQAA 4BJ5C 3A11A 2CNWA 3EFOB 4IAOA 1V54C 4O6YA 3R7CA 4EBJA 4IRUA 1KU2A 5BQHA 4B6IA 2AWCA 3Q7GA 3W8IA 2NG1A 1R5ID 2H7BA 2HV7A 3K7DA 4PR9A 3ABLC 4N6HA 3QW1A 4MTOA 1PCXA 4U5EE 5JSLA 3V5ZA 3V7OA 3EZIA 3JSEO 1OR2A 1ZU5A 2ASRA 3H2VA 3SP1A 3DMDA 4KNVA 3JYYA 3SYNA 5A6JA 3CAXA 1CPRA 3N2ZB 5DVWA 1JMWA 2OQMA 4AE4B 4XLPF 1V4AA 5AC4A 2EIMC 3HNKA 3O10A 3U8PA 1G4US 4GQHA 1D0XA 3E9VA 4I1MA 2R03A 2XS8A 1I5NA 3RF3A 2NUTA 5KYWA 5EGYA 2HUJA 1DOWA 5DS6A 4G0HA 4BG0A 1HMDA 2LK4A 1T9KA 1TWCA 2MYSA 2OKUA 3KMIA 4JCZA 3CSKA 2LFDA 2O9XA 4Q7CA 5L0IA 1M56C 2KSFA 2OU6A 5L3QA 1YZCA 1T6UA 3GEIA 1C02A 4JW1A 4I44A 2Y3GA 2WVNA 5B1BC 2Z15A 5L3VA 3AGTA 4K7BA 1YVIA 3L0IA 4DBQA 1E83A 2R7SA 2R7UA 4DVZA 4MVRA 4BPMA 1D1CA 2KNHA 3Q6NA 5A6KA 4O7GA 3U9JA 1LS4A 2NPUA 4CSAA 1UG7A 2VC9A 3F46A 5JP7A 4YL1A 4YL0A 2IBFA 1PD1A 3DJUB 3G4XA 4YL3A 1Y6DA 4P9FA 5HSWA 1CGOA 2HV6A 1BBHA 1YA7O 3L8IA 1J8MF 4Z9HA 3TQOA 3C8ZA 3KH2A 2YLGA 1JRAA 4NY3A 1NU9C 3POVA 4JVSA 5KYYB 3LLIA 3C63A 1TWHA 2OJED 1RKEA 2XL8A 3JYHA 4BJ6C 2R05A 3HJCA 1O87A 4N4WA 3AOUA 2G62A 2IXMA 5L0DA 2HFIA 3EJNA 1MMDA 4LLEA 2A6EF 2EPLX 1ZYRF 5B1AC 2A0UA 2H7VC 3AQBA 3LS0A 1SMYF 3FXHA 1FMVA 2V26A 3QVYA 4G78A 2XLVA 2HJ3A 3NYMA 1TKNA 4U5FE 4LDQA 4CS9C 1Q0DA 1RCPA 1MMAA 1Q0FA 3EFOA 3OEOA 2FGYA 1E2XA 4NTAA 4OD4A 1OXKA 4YT4A 1Z5ZA 1A0BA 1LPEA 1OCRC 2J45A 2JPUA 4MW3A 2Y69C 2P61A 2YLIA 3IHUA 3NMJA 4PK4A 4LDKA 1VLSA 1VB5A 2HMQA 4C3BA 1LM3B 2Y3BA 3LS1A 4ULWA 3QMKA 2CDQA 2NUPB 3ASOC 4NC3A 3FVYA 4AE4A 4U5CE 1RKCA 2HSBA 1WWPA 2W45A 4PACA 2J9BA 2RD9A 2ZXWC 4E7SA 3PDMP 4JRZA 3WHNA 4JURI 2ICWG 4AK9A 1SZIA 1NG1A 5L0FA 2X51A 2DI3A 4MTGA 4Z9JA 3SXKA 2QUPA 1V55C 2LSEA 4WABA 1ZHTA 4XEVA 3SZRA 2BE5F 3GM1A 1GM5A 4OIOF 3AG3C 3DM9B 3EH2A 2Q9CA 2PX0A 1NFOA 1K04A 2LFFA 3DKAA 3MX3A 1F1MA 1BR4A 2XLHA 1D0ZA 4WGYA 4YT2A 2XL4A 3W4YA 3VYWA 1S7ZA 3AQCA 2HKVA 4OIQF 1YA9A 4KNWA 2KYHA 2Q4FA 2YL3A 4XTKA 4EBBA 1VK5A 3LEVA 1BR1A 1E86A 3N24A 2R7WA 2V3CC 3T6GB 2DGJA 5FCLA 3EZHA 2IOQA 5T3TA 2XL6A 3U2MA 2QTVA 2Q9AA 3AG1C 2VB6A 2YQYA 3EHMA 3ZC4A 5F5FA 4JJGA 1A7DA 2YEVA 3X1OA 4EIYA 5DS4A 1LVKA 2KK1A 3S90A 1SF8A 2WZLA 3S27A 4CDAA 3GORA 4YK5A 3UMHA 3SEOA 5A6BD 2LIGA 3IQ5A 4C7OA 1WGWA 5HV9A 4U5HA 3SXYA 2YWAA 4H54A 4J32B 3FOPA 2F22A 2YKZA 5F28E 2XSEA 5BUOA 2EPMX 2BC5A 1G8XA 2R25A 3EHNA 4KBLA 5COMA 4MW8A 5DLJA 4D4NA 1JAFA 2ZD9A 5CI8A 4O79A 4DVYP 1TFOB 2GFHA 2HJMA 1NZEA 1ZHYA 3K1IC 4XPXA 2XLDA 4CJGA 4E17A 3C8GD 2D5RB 4CS8C 5E3CA 1Q0KA 1TQGA 4MVSA 3U2LA 1MMNA 2C03A 2IXPA 3ZIBA 2PP4A 3LNMB 1H9GA 1NBBA 1SYQA 4DBRA 3EGXA 1E84A 2OCCC 3ITFA 2KGOA 2VCBA 3IEEA 5A6AA 3G4ZA 4JTCB 4MS2A 1VLTA 1TWAA 2VASA 1OW6A 3J06A 3UMIA 2TMVP 1G5ZA 1JR8A
chains in the Genus database with same CATH topology
2J8WA 5JP7A 3ZTMA 4CX9A 5JUAA 1CGOA 1BBHA 5JS5A 1YYJA 4IARA 2YLGA 3C63A 3NMIA 2XL8A 4N4WA 1M6TA 3QVYA 4IAQA 3ZQVA 4JE9A 2XLVA 3M4BA 4JEBA 1RCPA 5JT4A 1QQ3A 3L1MA 4JKVA 3C62A 3ZWIA 3HNIA 4L6RA 2XM4A 4IB4A 4ULVA 3QVZA 2YLIA 3NMJA 3ZQYA 2XM0A 3IQ6A 1LM3B 2XLMA 4U9EA 3NMKA 4CIPA 4NC3A 1EKYA 5JRAA 5JLIA 4CJOA 2J9BA 3HNJA 2CCYA 2XLEA 2YLDA 3DE9A 1CGNA 5JVEA 1S05A 2XLOA 4U9DA 2XLHA 3TOLA 4WGYA 3TOMA 1APCA 4WGZA 1CPQA 2YL0A 1A7VA 2QLAA 1GQAA 3HNLA 3VRCA 2YL3A 1E86A 3M79A 3FOOA 2XL6A 3QW0A 3M4CA 4N6HA 3QW1A 5JSLA 5B3IA 5AGFA 4EIYA 1MQVA 4CDAA 1CPRA 3IQ5A 3HNKA 3U8PA 3DE8A 1YYXA 3FOPA 2YKZA 2YL1A 2BC5A 4D4NA 1JAFA 1E85A 3ZTZA 256BA 4CJGA 4CDYA 2XLDA 4ER9A 2XLWA 1YZCA 3M15A 1QPUA 1NBBA 1E83A 1E84A 4CDVA 2YL7A 4D4XA 4JEAA 1YZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8W A;  5JP7 A;  3ZTM A;  4CX9 A;  5JUA A;  1CGO A;  1BBH A;  5JS5 A;  1YYJ A;  4IAR A;  2YLG A;  3C63 A;  3NMI A;  2XL8 A;  4N4W A;  1M6T A;  3QVY A;  4IAQ A;  3ZQV A;  4JE9 A;  2XLV A;  3M4B A;  4JEB A;  1RCP A;  5JT4 A;  1QQ3 A;  3L1M A;  4JKV A;  3C62 A;  3ZWI A;  3HNI A;  4L6R A;  2XM4 A;  4IB4 A;  4ULV A;  3QVZ A;  2YLI A;  3NMJ A;  3ZQY A;  2XM0 A;  3IQ6 A;  1LM3 B;  2XLM A;  4U9E A;  3NMK A;  4CIP A;  4NC3 A;  1EKY A;  5JRA A;  5JLI A;  4CJO A;  2J9B A;  3HNJ A;  2CCY A;  2XLE A;  2YLD A;  3DE9 A;  1CGN A;  5JVE A;  1S05 A;  2XLO A;  4U9D A;  2XLH A;  3TOL A;  4WGY A;  3TOM A;  1APC A;  4WGZ A;  1CPQ A;  2YL0 A;  1A7V A;  2QLA A;  1GQA A;  3HNL A;  3VRC A;  2YL3 A;  1E86 A;  3M79 A;  3FOO A;  2XL6 A;  3QW0 A;  3M4C A;  4N6H A;  3QW1 A;  5JSL A;  5B3I A;  5AGF A;  4EIY A;  1MQV A;  4CDA A;  1CPR A;  3IQ5 A;  3HNK A;  3U8P A;  3DE8 A;  1YYX A;  3FOP A;  2YKZ A;  2YL1 A;  2BC5 A;  4D4N A;  1JAF A;  1E85 A;  3ZTZ A;  256B A;  4CJG A;  4CDY A;  2XLD A;  4ER9 A;  2XLW A;  1YZC A;  3M15 A;  1QPU A;  1NBB A;  1E83 A;  1E84 A;  4CDV A;  2YL7 A;  4D4X A;  4JEA A;  1YZA A; 
#chains in the Genus database with same CATH topology
 4FAP B;  2WB7 A;  1RJ9 A;  4KC9 A;  3E70 C;  3OA1 A;  5A69 A;  1AEP A;  3WAQ A;  1ZHZ A;  1SR2 A;  2IM8 A;  3N0T A;  3EPV A;  1OQC A;  3RKO F;  4I3M A;  2NSF A;  4QI2 A;  1YYJ A;  4CS7 A;  2QE9 A;  2PNO A;  3LES A;  5D92 A;  2R7R A;  2W9Y A;  1ZVZ A;  2JD3 A;  3IPM O;  4E18 A;  3NMI A;  3MYF A;  4W8P A;  5CI9 A;  5BQG A;  4DRH B;  1VYK A;  2YZS A;  3ABK C;  1M2V A;  3GM3 A;  4XQ1 A;  1BR2 A;  1RXQ A;  3MYI A;  4A2N B;  2LCH A;  1MMG A;  3LJB A;  5CIV A;  1D1A A;  1VOM A;  3CQZ A;  3DAG A;  3UGO A;  3I5P A;  1M6T A;  3H2U A;  2HSQ A;  4IAQ A;  2QY9 A;  1WN0 A;  1A41 A;  2XXA B;  3MLG A;  4JE9 A;  3U5S A;  2H7O A;  3TD7 A;  5GPG B;  2L7A A;  3M4B A;  4JEB A;  1H6G A;  4BJ6 A;  5JT4 A;  1QQ3 A;  3S9O A;  3R2P A;  3S29 A;  3F47 A;  2P1A A;  4JKV A;  3C62 A;  4GYT A;  3T6J A;  3DZA A;  4IB4 A;  1Z63 A;  2EIJ C;  3HKK A;  3JTL O;  4ULV A;  3TJ6 A;  3QVZ A;  5F5H A;  2ZXP A;  3U3F A;  1WTY A;  4QDL A;  1LE4 A;  4AL0 A;  2AVK A;  2WZG A;  3JRT A;  1GS9 A;  4J7T A;  2L9J A;  2L81 A;  3ABM C;  4LLC A;  4CS9 A;  3RVZ A;  2KC3 A;  3NRH A;  2HMZ A;  3RW0 A;  3S0X A;  5KYU B;  4CJO A;  5D91 A;  3W2W A;  2CCY A;  1K05 A;  1T01 A;  3DWW A;  5IY5 C;  3CEX A;  2PFD A;  4W8K A;  4Q4Z F;  1GGQ A;  4FX5 A;  4MND A;  3C8G A;  1ZW3 A;  2BL2 A;  1JOG A;  3PMR A;  1OCC C;  3RQE A;  3FAJ A;  1CGN A;  1UFB A;  4PJN A;  5E3A A;  1S05 A;  2OEX A;  4ONS A;  4BEM J;  1TR2 A;  3VF0 A;  3B9Q A;  1APC A;  1QSP A;  2CW0 F;  1CPQ A;  2YL0 A;  4JTD B;  4MVQ A;  4PJL A;  5FZT A;  2Q7R A;  3JSZ A;  4XWJ A;  4YJW A;  4MQ9 F;  1OKK D;  3VM6 A;  3AG4 C;  3C7J A;  3FAP B;  3DXJ F;  3LAY A;  2LD6 A;  3HNL A;  4OD5 A;  1YAU O;  3VRC A;  2A1D D;  1ORY A;  5EHH A;  2A6H F;  4IWB A;  4CSA C;  2RSE B;  2J0X A;  1KTM A;  3M79 A;  1O5H A;  3FOO A;  4J30 B;  3QW0 A;  1EI7 A;  4XEK A;  2WVO A;  2C04 A;  3L34 A;  4N6C A;  4MVZ A;  5AGF A;  4JZA A;  4N06 A;  3VAY A;  2PX3 A;  5DQZ A;  4E0H A;  4WJ0 A;  1KNY A;  1FR0 A;  1I4Y A;  1L3P A;  1I4Z A;  2B0H A;  3HLZ A;  1A7E A;  1OW7 A;  2CNW D;  4C3D A;  4EUK B;  3BRJ A;  5DQT A;  3DE8 A;  4J7Y A;  3AJM A;  1Q0M A;  2E87 A;  4UDV A;  2PF4 E;  2A68 F;  3O55 A;  2ZPA A;  5K0I A;  3DAF A;  4JCH A;  4LDR A;  3ZTZ A;  3I5Q A;  3NKD A;  1E85 A;  3RIP A;  1AUE A;  3Q7L A;  4Z9I A;  4EWC A;  2P6V A;  5E33 A;  3FDQ A;  5KYW B;  2NUT B;  4ER9 A;  2XLW A;  5BQI A;  2J0W A;  3LUT B;  4U5G A;  3TUL A;  4YT8 A;  3DD7 A;  3LLK A;  4H4K C;  4EBK A;  1D0Y A;  3M15 A;  3B29 A;  1H7I A;  1M2O A;  1QPU A;  2AU5 A;  4P6I C;  4X0R A;  3ECS A;  4CIH A;  1FMW A;  3FMS A;  2J9U A;  1L7C A;  3DM5 A;  5T1D B;  4M63 A;  2G3V A;  1LE2 A;  2DYS C;  3RYL A;  4DRI B;  1NU7 D;  2G3K A;  2YL7 A;  1TFK B;  3EG9 B;  3K1I A;  1NLX A;  4YN0 B;  4BJ5 A;  1HW1 A;  2J7P D;  2R7Q A;  4D4X A;  4CS8 A;  2ZXR A;  4LAC B;  4K0D A;  2XS1 A;  3GWN A;  1FAP B;  2J8W A;  3H65 A;  3ZTM A;  4BEJ A;  3EH1 A;  2DB4 A;  4K1O A;  4XPY A;  3KYI A;  5L0C A;  2ZXO A;  3Q6M A;  5KYY A;  5JUA A;  3ZSU A;  5E2Q A;  5L0J A;  1LS1 A;  3UMK A;  1WAS A;  5JS5 A;  4IAR A;  2IXN A;  2KQ9 A;  2P0N A;  3QZC A;  2LQG A;  4HFF B;  2H8A A;  1NFN A;  2YRF A;  2VH3 A;  5KYX B;  2Y3H A;  3B71 A;  3T6B A;  2EPO A;  1OKK A;  3K66 A;  1G4W R;  2AWY A;  4OIP F;  3O39 A;  1WAT A;  4A4A A;  2FFH A;  3NDB B;  3T4R A;  4HEA J;  2AP3 A;  3K33 A;  1RKE B;  2OOC A;  3ZQV A;  4BJ1 A;  2I8B A;  2CGE A;  3JT1 A;  3LEO A;  4QI0 A;  2YHS A;  4EHP A;  3WG7 C;  3L1M A;  2M64 A;  1Z7Q c;  3SXZ A;  2EPK X;  1JPJ A;  3MBG A;  2MHR A;  3SNH A;  3HNI A;  2NUP A;  4L6R A;  4DOZ A;  3ATP A;  2A69 F;  1HY5 A;  2IYL D;  4E0I A;  2OJQ A;  2YVK A;  3U8V A;  1HW2 A;  2EIK C;  2OEV A;  4KI2 A;  1FFT C;  4P9T A;  4IGG A;  1B68 A;  2XLM A;  3CZ6 A;  3GM2 A;  4U9E A;  1R4T A;  3UGP A;  3EGD B;  2UUI A;  4CIP A;  1EKY A;  5JRA A;  1ZHW A;  4PFO A;  4AL1 A;  3DJN B;  3SXM A;  3HNJ A;  2M4E A;  2P7V A;  3LNR A;  1QVX A;  1JPN A;  2L6G A;  2J9V A;  1Z3I X;  2CYD A;  1ZU4 A;  4NQF A;  1HE1 A;  2WL8 A;  1ZZP A;  5COG A;  3RH3 A;  1OCO C;  1U0B B;  1U89 A;  4XEF A;  2GDC A;  3A9C A;  4FES A;  1OCZ C;  2VCA A;  3US6 A;  3K1H A;  1HMO A;  4IJJ A;  5B3S C;  4E7Z A;  4JTA B;  4HE8 D;  1W2W A;  1T6Q A;  2J7P A;  2QLA A;  4Q5S F;  1LI7 A;  2KW3 C;  1BZ4 A;  3M1C B;  4NTF A;  5A6B A;  3HTK C;  3NYJ A;  3UR3 C;  1EA8 A;  3EG9 A;  4XLN F;  1CGM E;  4FWV A;  4YT5 A;  1OR3 A;  3L8J A;  3B0V C;  3RQF A;  4MVU A;  2Y3D A;  3M4C A;  2WZF A;  1FTS A;  2NSG A;  4NCQ A;  2A0B A;  2ETS A;  2HS5 A;  2HZ8 A;  2L6H A;  2W4M A;  3S28 A;  1ST6 A;  3GOD A;  5B3I A;  4O6M A;  1LKX A;  2FAP B;  2D4U A;  1XWJ A;  3KL4 A;  4NTB A;  1MQV A;  1Y4C A;  4PFP A;  1Z23 A;  1MNE A;  3TK0 A;  2UUH A;  3T9O A;  1TWG A;  2JX0 A;  1LI5 A;  2L6F A;  4O6N A;  4MTF A;  1ZHX A;  3ZVR A;  1YLM A;  1D1B A;  1YYX A;  1YJG A;  3AG2 C;  3G50 A;  3RFY A;  5AC5 A;  3B0U X;  3RVY A;  1J8Y F;  1XZQ A;  4GEH A;  5KYX A;  3DI5 A;  3MFN A;  2YL1 A;  1C03 A;  4HFK B;  2WVQ A;  2XRH A;  3B0P A;  4LER A;  4G7Z F;  3ZG1 A;  1ZW2 A;  3V5X A;  2EIL C;  1U6H A;  4C7O B;  256B A;  2LP4 A;  3JRM O;  4CDY A;  4AX2 A;  5KYN A;  3GEH A;  4XPW A;  1VYI A;  1VTM P;  4G7O F;  3U9M A;  1QZX A;  1M57 C;  2PBE A;  1N1C A;  4PJJ A;  1AVO B;  1QKR A;  1T5O A;  2EPN A;  5EK0 A;  5TJ5 E;  2J9W A;  4CDV A;  2KJG A;  3S84 A;  4JJF A;  3WOD F;  4RBN A;  3ASN C;  2MWQ A;  3GAN A;  4OIN F;  4JEA A;  4YWQ A;  3O6X A;  3NYL A;  1H9T A;  2I15 A;  1XZP A;  1YZA A;  1WOL A;  2B0J A;  2GA0 A;  3EGX B;  4R32 A;  3W2V A;  1Q0G A;  3EGD A;  3KPH A;  4CX9 A;  1OXB A;  4MVM A;  1ORJ A;  2J46 A;  2VCC A;  4C3E A;  5COF A;  1PD0 A;  1RJ9 B;  2Y39 A;  1VMA A;  4U5B E;  1ORS C;  1QLE C;  1C17 M;  2R7V A;  2XXA A;  2R02 A;  3GEE A;  4I1O B;  1IW7 F;  5L0H A;  1HE9 A;  3JCU Q;  3EQL F;  2R7X A;  3OWT A;  4ZLC A;  1EQ1 A;  2EIN C;  1OW8 A;  2Q00 A;  4DRJ B;  2DYR C;  4JC7 A;  4DJ9 A;  2QNL A;  1M2V B;  4RDA A;  4CBE A;  3X2Q C;  1YAR O;  1Z6A A;  1FFH A;  3PCV A;  4U5D E;  3U0C A;  1FNT c;  2OG2 A;  1DOV A;  1MND A;  1T6I A;  3ZWI A;  3ZDL A;  2XM4 A;  1O3U A;  2W4B A;  2Q3T A;  3NG1 A;  5KYU A;  5T3W A;  2IXO A;  3ZQY A;  3AGU A;  1RMV A;  3KKB A;  2XM0 A;  3U3B A;  1NSG B;  3IQ6 A;  4JIO A;  2GWW A;  2R9R B;  3NMK A;  4OIR F;  3PHF 2;  3V5Y A;  3K6B A;  2X0C A;  2R7T A;  3TJ5 A;  2Q9B A;  5JLI A;  3W8H A;  4F4B A;  2XLE A;  1BDJ B;  5DS5 A;  4EKW A;  3BEH A;  2YLD A;  3RQG A;  3KYJ A;  4BJT A;  3I4U A;  3IQT A;  2R7O A;  3DE9 A;  3GWL A;  3C18 A;  3FHD A;  5JVE A;  4G7H F;  2XLO A;  4U9D A;  3QTH A;  3TOL A;  3NKE A;  3IQC A;  4RD9 A;  4WGZ A;  1K40 A;  3TOM A;  5L0G A;  1YDI A;  4MVO A;  3C8G B;  3UNG C;  1V74 B;  1A7V A;  1IZM A;  1PV3 A;  4PJM A;  2GAQ A;  3JZ0 A;  4ANJ A;  4ZLD A;  1LIH A;  4DXW A;  1GQA A;  4BJ5 C;  3A11 A;  2CNW A;  3EFO B;  4IAO A;  1V54 C;  4O6Y A;  3R7C A;  4EBJ A;  4IRU A;  1KU2 A;  5BQH A;  4B6I A;  2AWC A;  3Q7G A;  3W8I A;  2NG1 A;  1R5I D;  2H7B A;  2HV7 A;  3K7D A;  4PR9 A;  3ABL C;  4N6H A;  3QW1 A;  4MTO A;  1PCX A;  4U5E E;  5JSL A;  3V5Z A;  3V7O A;  3EZI A;  3JSE O;  1OR2 A;  1ZU5 A;  2ASR A;  3H2V A;  3SP1 A;  3DMD A;  4KNV A;  3JYY A;  3SYN A;  5A6J A;  3CAX A;  1CPR A;  3N2Z B;  5DVW A;  1JMW A;  2OQM A;  4AE4 B;  4XLP F;  1V4A A;  5AC4 A;  2EIM C;  3HNK A;  3O10 A;  3U8P A;  1G4U S;  4GQH A;  1D0X A;  3E9V A;  4I1M A;  2R03 A;  2XS8 A;  1I5N A;  3RF3 A;  2NUT A;  5KYW A;  5EGY A;  2HUJ A;  1DOW A;  5DS6 A;  4G0H A;  4BG0 A;  1HMD A;  2LK4 A;  1T9K A;  1TWC A;  2MYS A;  2OKU A;  3KMI A;  4JCZ A;  3CSK A;  2LFD A;  2O9X A;  4Q7C A;  5L0I A;  1M56 C;  2KSF A;  2OU6 A;  5L3Q A;  1YZC A;  1T6U A;  3GEI A;  1C02 A;  4JW1 A;  4I44 A;  2Y3G A;  2WVN A;  5B1B C;  2Z15 A;  5L3V A;  3AGT A;  4K7B A;  1YVI A;  3L0I A;  4DBQ A;  1E83 A;  2R7S A;  2R7U A;  4DVZ A;  4MVR A;  4BPM A;  1D1C A;  2KNH A;  3Q6N A;  5A6K A;  4O7G A;  3U9J A;  1LS4 A;  2NPU A;  4CSA A;  1UG7 A;  2VC9 A;  3F46 A;  5JP7 A;  4YL1 A;  4YL0 A;  2IBF A;  1PD1 A;  3DJU B;  3G4X A;  4YL3 A;  1Y6D A;  4P9F A;  5HSW A;  1CGO A;  2HV6 A;  1BBH A;  1YA7 O;  3L8I A;  1J8M F;  4Z9H A;  3TQO A;  3C8Z A;  3KH2 A;  2YLG A;  1JRA A;  4NY3 A;  1NU9 C;  3POV A;  4JVS A;  5KYY B;  3LLI A;  3C63 A;  1TWH A;  2OJE D;  1RKE A;  2XL8 A;  3JYH A;  4BJ6 C;  2R05 A;  3HJC A;  1O87 A;  4N4W A;  3AOU A;  2G62 A;  2IXM A;  5L0D A;  2HFI A;  3EJN A;  1MMD A;  4LLE A;  2A6E F;  2EPL X;  1ZYR F;  5B1A C;  2A0U A;  2H7V C;  3AQB A;  3LS0 A;  1SMY F;  3FXH A;  1FMV A;  2V26 A;  3QVY A;  4G78 A;  2XLV A;  2HJ3 A;  3NYM A;  1TKN A;  4U5F E;  4LDQ A;  4CS9 C;  1Q0D A;  1RCP A;  1MMA A;  1Q0F A;  3EFO A;  3OEO A;  2FGY A;  1E2X A;  4NTA A;  4OD4 A;  1OXK A;  4YT4 A;  1Z5Z A;  1A0B A;  1LPE A;  1OCR C;  2J45 A;  2JPU A;  4MW3 A;  2Y69 C;  2P61 A;  2YLI A;  3IHU A;  3NMJ A;  4PK4 A;  4LDK A;  1VLS A;  1VB5 A;  2HMQ A;  4C3B A;  1LM3 B;  2Y3B A;  3LS1 A;  4ULW A;  3QMK A;  2CDQ A;  2NUP B;  3ASO C;  4NC3 A;  3FVY A;  4AE4 A;  4U5C E;  1RKC A;  2HSB A;  1WWP A;  2W45 A;  4PAC A;  2J9B A;  2RD9 A;  2ZXW C;  4E7S A;  3PDM P;  4JRZ A;  3WHN A;  4JUR I;  2ICW G;  4AK9 A;  1SZI A;  1NG1 A;  5L0F A;  2X51 A;  2DI3 A;  4MTG A;  4Z9J A;  3SXK A;  2QUP A;  1V55 C;  2LSE A;  4WAB A;  1ZHT A;  4XEV A;  3SZR A;  2BE5 F;  3GM1 A;  1GM5 A;  4OIO F;  3AG3 C;  3DM9 B;  3EH2 A;  2Q9C A;  2PX0 A;  1NFO A;  1K04 A;  2LFF A;  3DKA A;  3MX3 A;  1F1M A;  1BR4 A;  2XLH A;  1D0Z A;  4WGY A;  4YT2 A;  2XL4 A;  3W4Y A;  3VYW A;  1S7Z A;  3AQC A;  2HKV A;  4OIQ F;  1YA9 A;  4KNW A;  2KYH A;  2Q4F A;  2YL3 A;  4XTK A;  4EBB A;  1VK5 A;  3LEV A;  1BR1 A;  1E86 A;  3N24 A;  2R7W A;  2V3C C;  3T6G B;  2DGJ A;  5FCL A;  3EZH A;  2IOQ A;  5T3T A;  2XL6 A;  3U2M A;  2QTV A;  2Q9A A;  3AG1 C;  2VB6 A;  2YQY A;  3EHM A;  3ZC4 A;  5F5F A;  4JJG A;  1A7D A;  2YEV A;  3X1O A;  4EIY A;  5DS4 A;  1LVK A;  2KK1 A;  3S90 A;  1SF8 A;  2WZL A;  3S27 A;  4CDA A;  3GOR A;  4YK5 A;  3UMH A;  3SEO A;  5A6B D;  2LIG A;  3IQ5 A;  4C7O A;  1WGW A;  5HV9 A;  4U5H A;  3SXY A;  2YWA A;  4H54 A;  4J32 B;  3FOP A;  2F22 A;  2YKZ A;  5F28 E;  2XSE A;  5BUO A;  2EPM X;  2BC5 A;  1G8X A;  2R25 A;  3EHN A;  4KBL A;  5COM A;  4MW8 A;  5DLJ A;  4D4N A;  1JAF A;  2ZD9 A;  5CI8 A;  4O79 A;  4DVY P;  1TFO B;  2GFH A;  2HJM A;  1NZE A;  1ZHY A;  3K1I C;  4XPX A;  2XLD A;  4CJG A;  4E17 A;  3C8G D;  2D5R B;  4CS8 C;  5E3C A;  1Q0K A;  1TQG A;  4MVS A;  3U2L A;  1MMN A;  2C03 A;  2IXP A;  3ZIB A;  2PP4 A;  3LNM B;  1H9G A;  1NBB A;  1SYQ A;  4DBR A;  3EGX A;  1E84 A;  2OCC C;  3ITF A;  2KGO A;  2VCB A;  3IEE A;  5A6A A;  3G4Z A;  4JTC B;  4MS2 A;  1VLT A;  1TWA A;  2VAS A;  1OW6 A;  3J06 A;  3UMI A;  2TMV P;  1G5Z A;  1JR8 A; 
#chains in the Genus database with same CATH homology
 2J8W A;  5JP7 A;  3ZTM A;  4CX9 A;  5JUA A;  1CGO A;  1BBH A;  5JS5 A;  1YYJ A;  4IAR A;  2YLG A;  3C63 A;  3NMI A;  2XL8 A;  4N4W A;  1M6T A;  3QVY A;  4IAQ A;  3ZQV A;  4JE9 A;  2XLV A;  3M4B A;  4JEB A;  1RCP A;  5JT4 A;  1QQ3 A;  3L1M A;  4JKV A;  3C62 A;  3ZWI A;  3HNI A;  4L6R A;  2XM4 A;  4IB4 A;  4ULV A;  3QVZ A;  2YLI A;  3NMJ A;  3ZQY A;  2XM0 A;  3IQ6 A;  1LM3 B;  2XLM A;  4U9E A;  3NMK A;  4CIP A;  4NC3 A;  1EKY A;  5JRA A;  5JLI A;  4CJO A;  2J9B A;  3HNJ A;  2CCY A;  2XLE A;  2YLD A;  3DE9 A;  1CGN A;  5JVE A;  1S05 A;  2XLO A;  4U9D A;  2XLH A;  3TOL A;  4WGY A;  3TOM A;  1APC A;  4WGZ A;  1CPQ A;  2YL0 A;  1A7V A;  2QLA A;  1GQA A;  3HNL A;  3VRC A;  2YL3 A;  1E86 A;  3M79 A;  3FOO A;  2XL6 A;  3QW0 A;  3M4C A;  4N6H A;  3QW1 A;  5JSL A;  5B3I A;  5AGF A;  4EIY A;  1MQV A;  4CDA A;  1CPR A;  3IQ5 A;  3HNK A;  3U8P A;  3DE8 A;  1YYX A;  3FOP A;  2YKZ A;  2YL1 A;  2BC5 A;  4D4N A;  1JAF A;  1E85 A;  3ZTZ A;  256B A;  4CJG A;  4CDY A;  2XLD A;  4ER9 A;  2XLW A;  1YZC A;  3M15 A;  1QPU A;  1NBB A;  1E83 A;  1E84 A;  4CDV A;  2YL7 A;  4D4X A;  4JEA A;  1YZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...