3L1MA

Crystal structure of a ni-directed dimer of cytochrome cb562 with a quinolate-histidine hybrid coordination motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVCQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Controlled protein dimerization through hybrid coordination motifs.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3l1mA00
3IQ6A 1CPRA 3HNLA 3QVZA 1EKYA 3ZTMA 1CGOA 1CPQA 3HNIA 1YZCA 1YYXA 4CDYA 1BBHA 3FOPA 2XLHA 4CDVA 3VRCA 2YL1A 4JKVA 3C63A 1APCA 3M79A 2XLEA 1YYJA 2YLDA 4WGYA 3IQ5A 1QPUA 1E85A 3TOLA 4WGZA 4D4XA 3QW1A 3QW0A 5JUAA 3NMIA 1YZAA 4ULVA 3ZWIA 5JP7A 3ZQYA 1JAFA 4CJGA 3M4BA 5JS5A 2YLGA 3C62A 4JE9A 2J8WA 4CIPA 4U9DA 4EIYA 4L6RA 2YL0A 3NMKA 1RCPA 4CJOA 5JRAA 1E84A 3HNJA 1A7VA 4IAQA 3TOMA 3M15A 3ZQVA 2BC5A 2XM0A 2XLVA 4JEAA 4D4NA 1E86A 1M6TA 2YL7A 1MQVA 2XL8A 2XLMA 3DE9A 3QVYA 2XLDA 5JSLA 3U8PA 3NMJA 1E83A 2YKZA 3L1MA 4CDAA 4IB4A 5JLIA 4NC3A 1CGNA 5JT4A 1GQAA 1LM3B 2CCYA 1NBBA 5B3IA 2XLOA 2YLIA 5JVEA 3M4CA 4ER9A 4IARA 4U9EA 1S05A 3ZTZA 3DE8A 4N6HA 2XL6A 3FOOA 1QQ3A 5AGFA 2XM4A 2QLAA 2XLWA 4CX9A 2J9BA 2YL3A 3HNKA 4N4WA 4JEBA 256BA
chains in the Genus database with same CATH superfamily
4U5DE 5A6BD 3X1OA 3UR3C 2OU6A 3O39A 1ZHZA 1TWGA 1EKYA 4ULWA 1VYIA 2Y3HA 2LFFA 3EJNA 1I5NA 1YA7O 1CPQA 4BJTA 4U5EE 3FVYA 5KYNA 3IQCA 4Z9HA 1ZU5A 3R7CA 2UUHA 3K1IC 3MYFA 1Z63A 2XLHA 2A1DD 1I4ZA 3RIPA 2H7BA 4I3MA 1LS1A 2YL1A 4N06A 1SZIA 2P61A 5A6AA 3KYIA 2A0BA 2WB7A 1Q0KA 1Q0FA 2HMQA 4NTBA 1PD1A 3M79A 1RXQA 5KYYA 1LI5A 1FNTc 5L3VA 2B0HA 2XLEA 2UUIA 2KK1A 2R25A 4U5FE 3ITFA 3JCUQ 4BJ6C 3HLZA 2R7OA 3DXJF 2J0WA 3OA1A 4O6YA 4ONSA 4LERA 1T6UA 4YL3A 3IQ5A 4R32A 4YT8A 2IXMA 2LP4A 3K1IA 3LNMB 4IAOA 4WGZA 3GM1A 3ABMC 3LS1A 1VOMA 3T4RA 3QW0A 1OW8A 4MVOA 3JRMO 5JUAA 3NMIA 2R7XA 4PJLA 1K04A 1Z23A 4P9TA 1FFHA 1MNDA 4XEFA 4LACB 1T6QA 3TJ5A 3EZHA 2EPOA 2NSGA 1A7DA 1Q0MA 1U6HA 3F47A 3M4BA 2YLGA 3Q6MA 4BJ6A 2J8WA 4HFKB 3N2ZB 4L6RA 3S28A 1MMAA 2W4BA 3EHMA 3NMKA 1RCPA 2Q7RA 4CJOA 5L3QA 1MMNA 2R7UA 3RVZA 4A4AA 1AEPA 3K7DA 1ZW2A 3Q7GA 2G3KA 3U9MA 5DS4A 2FFHA 3KL4A 3GODA 1K40A 3DM5A 5KYWB 2C03A 2I8BA 3JT1A 1IZMA 2MHRA 3ZQVA 3US6A 1VK5A 3K1HA 1Z3IX 4E7SA 4MTOA 2EPMX 4OIPF 2XXAB 3AJMA 3VF0A 4E0HA 3VAYA 4O79A 4YN0B 3EFOB 2R05A 5L0CA 4CS8C 3UGPA 2A69F 4AX2A 3AQBA 4JCHA 2OJQA 3U3BA 2HJ3A 3CSKA 3O55A 1T6IA 3U8PA 1PD0A 4AE4B 4GQHA 3H2VA 3ZC4A 4DRHB 3W2VA 5E3AA 4DVYP 2HSQA 3QTHA 5A6KA 4CIHA 2DYRC 2LIGA 4KI2A 1H9GA 4DXWA 1G4WR 4MTGA 3DAGA 2KNHA 4CS8A 5JLIA 1GM5A 3W2WA 1L7CA 4U5CE 3RKOF 1FMVA 2ETSA 3UMIA 3BRJA 4DOZA 2QTVA 3ECSA 3NYLA 2OQMA 5B3IA 1SR2A 4XEVA 3FXHA 1OKKA 4E18A 4MVSA 2FGYA 4NTAA 4ER9A 4KC9A 1ZW3A 4IARA 3NDBB 4U9EA 1LE4A 3DJUB 2ZXRA 3DM9B 2EPKX 5B1BC 4YT4A 4ZLDA 4G78A 3FOOA 3HTKC 2XM4A 3NYJA 3A9CA 4U5BE 4C3EA 2VH3A 2KC3A 2A0UA 1D1CA 2YL3A 3C18A 2OJED 3DZAA 3G50A 3DD7A 4JEBA 4N4WA 5BUOA 3I4UA 2IM8A 4OIQF 4JC7A 2Q4FA 3S90A 3W8IA 2WVOA 5DQZA 3EGDB 3S0XA 1OW7A 1JPNA 3FAJA 4I1MA 1FR0A 2EIKC 2EPLX 4QI2A 1CPRA 3HNLA 3QVZA 3RQEA 5FCLA 3RQFA 1SF8A 1C03A 2ZD9A 3U3FA 1G5ZA 1N1CA 1VMAA 3LJBA 3HNIA 1YZCA 3PMRA 3GEIA 4E7ZA 3T6JA 5L0GA 1JPJA 2LQGA 3FOPA 4KBLA 1UG7A 1FTSA 4J7YA 3NG1A 2XL4A 2MYSA 3MX3A 1QKRA 4JKVA 1YJGA 1ORYA 1M56C 1LIHA 1G8XA 2L9JA 4JJFA 5CI8A 1Q0DA 2IBFA 3S29A 2KSFA 3LESA 1SMYF 3V5YA 1YYJA 2NG1A 4MW8A 1NFNA 2L6HA 3DWWA 3EHNA 1RJ9B 3GORA 2DI3A 4DBQA 5KYWA 1O87A 2R7SA 2R02A 4GEHA 2Y3DA 1ZVZA 1VYKA 2EIJC 1C02A 2HV7A 3GANA 3SNHA 4H54A 1BR4A 1NG1A 1YZAA 4LDRA 4ULVA 3SP1A 3U2MA 3ZWIA 2XXAA 1JAFA 4JW1A 3RQGA 3EFOA 4G0HA 1TWCA 4KNWA 1OR2A 4MVQA 5JS5A 2HV6A 1FMWA 1OR3A 4BEJA 4EWCA 4GYTA 2X51A 4CIPA 4MS2A 3IHUA 4U9DA 4XPWA 1J8MF 3U5SA 2XSEA 3A11A 5GPGB 2YL0A 1TWAA 2XRHA 2AWYA 1GS9A 3LUTB 4E17A 3J06A 4AE4A 3X2QC 2Y3BA 4NTFA 1TQGA 4BPMA 1TFKB 2ZXOA 4I44A 4C3DA 2LCHA 3B9QA 2BL2A 5BQHA 1Q0GA 2D4UA 1A0BA 1RKEB 5E2QA 1TKNA 2NUTB 5A69A 4G7OF 3M15A 3CAXA 2CDQA 4FESA 2HKVA 5IY5C 2D5RB 1OXBA 4MQ9F 4RBNA 1LI7A 1LPEA 4JEAA 2IXPA 4D4NA 3EG9B 3SXZA 3N0TA 1E86A 4PFOA 4BG0A 1C17M 2PFDA 4NQFA 3GEEA 2AU5A 2LFDA 2YL7A 2HJMA 2WVQA 1ZYRF 2EILC 4JIOA 1WASA 5T3WA 2XLMA 4A2NB 2F22A 3SEOA 1LS4A 4PJMA 5DVWA 1M2VB 1YARO 4X0RA 2YKZA 2P7VA 1OCOC 2VCAA 1BDJB 1DOWA 3EGXB 3G4ZA 3SXMA 3WODF 1ZZPA 3MLGA 4JTCB 1YLMA 4OINF 2CYDA 2WVNA 2HFIA 5EGYA 5L0JA 4IB4A 4ANJA 1ZHXA 3O6XA 5JT4A 1QLEC 1XWJA 1YA9A 2AWCA 1GQAA 4O6MA 3SYNA 5DLJA 3EGDA 1V55C 1AUEA 2VCCA 2L81A 4FX5A 1LM3B 4OIOF 2R9RB 1NBBA 2DYSC 2J9UA 2MWQA 2DGJA 2YLIA 3LNRA 3B71A 2Q3TA 1WOLA 3KPHA 4LLCA 2KYHA 1OQCA 2OEVA 1R5ID 1S05A 2ZXPA 3K6BA 3UGOA 3POVA 4AL1A 1H9TA 3AGTA 3CQZA 2YZSA 3ZTZA 3WG7C 1NZEA 2XL6A 2W4MA 3EH2A 2J0XA 3JYHA 4CS7A 2XLWA 1WGWA 4XTKA 1RKCA 4K7BA 5BQIA 2OKUA 4E0IA 2PBEA 3GWLA 4MVMA 2YEVA 3T6GB 3C8GA 4YK5A 3O10A 3ZVRA 1D1BA 2Y3GA 2YVKA 1JR8A 3HKKA 4K1OA 4XPXA 3I5PA 1NLXA 1EI7A 3QZCA 3IQTA 5T1DB 3EQLF 3IQ6A 1RJ9A 2M64A 1D1AA 1TWHA 4JRZA 4JURI 3ZTMA 1Z6AA 3V7OA 2ICWG 2YHSA 3AG2C 3ZG1A 5KYUA 3UNGC 4F4BA 5EHHA 1YYXA 2R03A 3DMDA 3GWNA 2J9VA 4J7TA 1BBHA 4CDYA 3EH1A 3B0UX 1T01A 3K33A 4CBEA 2L6GA 3AQCA 1RMVA 5F5FA 4HEAJ 2O9XA 1NSGB 3UMHA 2FAPB 3LEVA 3TQOA 2HMZA 3OWTA 1OKKD 1TR2A 4PJJA 3LAYA 3VRCA 5KYXB 2ZXWC 4FAPB 2H7VC 4OD5A 3GEHA 3C63A 3U8VA 2TMVP 2P1AA 1V4AA 2OOCA 2VC9A 4RD9A 5AC5A 3WHNA 2YLDA 4JJGA 4XLPF 1B68A 2IXOA 4O6NA 1VTMP 5EK0A 1RKEA 4WGYA 1QPUA 4YJWA 3NKEA 2NUTA 3TOLA 1QVXA 2H7OA 5K0IA 2I15A 3F46A 1PV3A 1OW6A 3QW1A 3AGUA 3E70C 4NCQA 2A6HF 3JSEO 3EG9A 4JZAA 1HW1A 5JP7A 2CW0F 2DB4A 3FAPB 5L0HA 3FHDA 4IGGA 1JOGA 1NU9C 2GA0A 3DI5A 3K66A 1H7IA 1MMGA 1MNEA 3DJNB 3ZIBA 4JE9A 5TJ5E 3KH2A 3OEOA 4EIYA 1JMWA 4U5HA 1A7EA 4BJ1A 1H6GA 2PNOA 5JRAA 1M2VA 2ASRA 2LSEA 4PACA 3AG4C 3NYMA 1OCCC 1WTYA 3HNJA 3EGXA 2A6EF 1A7VA 3C8GB 1SYQA 2X0CA 1XZQA 2J7PA 4PFPA 3DAFA 2G3VA 5L0DA 4P9FA 2R7RA 2YQYA 4M63A 2Q9AA 1Z5ZA 2XM0A 2CNWA 1QZXA 1ORSC 3ABLC 2IOQA 3B0PA 1WN0A 2XLVA 2A68F 4XQ1A 3GM2A 3JYYA 1M6TA 1W2WA 1PCXA 2OEXA 1FFTC 5KYUB 2C04A 1ST6A 2NUPB 1KTMA 3B29A 3U9JA 3RW0A 1MQVA 4CSAA 2XL8A 2AVKA 4C7OB 5HV9A 1YAUO 4Z9JA 3Q7LA 3QVYA 1VB5A 4EBKA 2KGOA 1XZPA 2R7WA 4WABA 3FMSA 3GM3A 2VCBA 5JSLA 3V5ZA 3RVYA 4DVZA 2YWAA 3CEXA 3W8HA 3EPVA 5A6BA 3L1MA 1Y4CA 5CIVA 2J9WA 2NPUA 1FAPB 1I4YA 1O5HA 3MBGA 3PCVA 4HFFB 2PX3A 3IEEA 2R7VA 4NC3A 1UFBA 2GWWA 2OG2A 3ABKC 3MYIA 4FWVA 4IWBA 4JVSA 4U5GA 3TD7A 2WZLA 3SXYA 4W8PA 2QUPA 2CCYA 2KW3C 3JSZA 4QDLA 5A6JA 2HUJA 4XEKA 2XLOA 1D0ZA 1D0XA 3DKAA 1F1MA 1M2OA 3C8ZA 4G7ZF 1NU7D 1OCZC 2PX0A 4I1OB 2WZGA 1HE9A 2ZPAA 4BEMJ 3DE8A 3LLKA 4Q4ZF 2VASA 2R7TA 3L8JA 5COGA 4JCZA 1J8YF 5AGFA 2HSBA 2HZ8A 2Q9CA 2QLAA 3TJ6A 2RD9A 4DJ9A 2J9BA 4G7HF 2B0JA 5E3CA 1WATA 3HNKA 4YL1A 4HE8D 3G4XA 2WZFA 4IJJA 3ZDLA 2EIMC 2XS1A 3VM6A 4DBRA 4UDVA 3C7JA 1Z7Qc 3W4YA 2OCCC 5CI9A 3L34A 2W45A 1BZ4A 3AOUA 2Y39A 1HY5A 4EKWA 3UMKA 3KYJA 4AK9A 4MVZA 4XPYA 3T9OA 3R2PA 4J32B 4JTDB 1CGOA 1R4TA 3L0IA 4EBJA 1HE1A 3KKBA 4Z9IA 2XS8A 3RF3A 1GGQA 1K05A 2J45A 3IPMO 3U0CA 5F28E 3LEOA 5DS5A 3S84A 4CDVA 1EQ1A 2PP4A 4EUKB 4JTAB 1OCRC 3AG3C 4P6IC 2QNLA 1APCA 2P0NA 2PF4E 4IRUA 4XWJA 4AL0A 1ZU4A 4DRIB 3L8IA 3QMKA 2JD3A 4OD4A 5DQTA 4J30B 1EA8A 5COFA 1CGME 1NFOA 1YVIA 2P6VA 2Q9BA 4PR9A 5COMA 1E85A 4D4XA 4CS9C 4Q5SF 3TULA 1S7ZA 1E2XA 3SXKA 3JTLO 5B3SC 3N24A 2HS5A 3C8GD 1LKXA 3ZQYA 3M1CB 4CJGA 2R7QA 2GDCA 2NUPA 3I5QA 2BE5F 3C62A 4LLEA 2KJGA 4LDQA 4MVUA 4C7OA 2VB6A 3Q6NA 5FZTA 3CZ6A 2E87A 2IXNA 4EHPA 5HSWA 4OIRF 4CS9A 1YDIA 3RYLA 5AC4A 1V74B 5KYXA 5KYYB 5T3TA 1E84A 4H4KC 5D91A 3NKDA 4WJ0A 2CGEA 3JRTA 4IAQA 1JRAA 4YT2A 4EBBA 3TOMA 4BJ5C 1A41A 5B1AC 1ORJA 2V26A 3ZSUA 2BC5A 3KMIA 4XLNF 4MW3A 4NY3A 4PK4A 5E33A 1Y6DA 2W9YA 1O3UA 4MNDA 5L0IA 1U89A 3S27A 2LD6A 2Y69C 4K0DA 1IW7F 3T6BA 3ATPA 5DS6A 3PHF2 1AVOB 3LS0A 3VYWA 1TFOB 2L6FA 3PDMP 1BR1A 1L3PA 2JPUA 1BR2A 1ZHYA 3TK0A 3DE9A 4LDKA 4MTFA 4MVRA 3FDQA 3HJCA 4BJ5A 2XLDA 4C3BA 4DRJB 1V54C 1HW2A 1M57C 1E83A 3B0VC 3NMJA 5D92A 3RFYA 1ZHWA 2JX0A 1WWPA 3BEHA 3WAQA 5BQGA 1DOVA 3MFNA 4O7GA 1U0BB 4CDAA 4CSAC 2H8AA 4PJNA 3RH3A 3S9OA 1D0YA 1CGNA 2EINC 1KNYA 2J46A 1QSPA 4Q7CA 3H65A 2WL8A 2QY9A 2LK4A 2YRFA 1KU2A 5F5HA 2M4EA 3ASOC 1VLSA 3LLIA 3NRHA 5JVEA 1HMOA 2QE9A 3M4CA 1T9KA 3SZRA 2J7PD 4RDAA 1T5OA 2NSFA 1LE2A 2GAQA 3U2LA 3V5XA 2GFHA 1MMDA 2IYLD 2CNWD 4B6IA 4W8KA 2EPNA 4N6HA 5L0FA 2AP3A 3JZ0A 2RSEB 4N6CA 4YWQA 1QQ3A 2G62A 2Q00A 2Z15A 4CX9A 4KNVA 1OXKA 1ZHTA 3EZIA 4QI0A 3ASNC 4YL0A 2KQ9A 256BA 1LVKA 3E9VA 1VLTA 4YT5A 3AG1C 3H2UA 4ZLCA 2L7AA 1HMDA 1G4US 2V3CC
chains in the Genus database with same CATH topology
3IQ6A 1CPRA 3HNLA 3QVZA 1EKYA 3ZTMA 1CGOA 1CPQA 3HNIA 1YZCA 1YYXA 4CDYA 1BBHA 3FOPA 2XLHA 4CDVA 3VRCA 2YL1A 4JKVA 3C63A 1APCA 3M79A 2XLEA 1YYJA 2YLDA 4WGYA 3IQ5A 1QPUA 1E85A 3TOLA 4WGZA 4D4XA 3QW1A 3QW0A 5JUAA 3NMIA 1YZAA 4ULVA 3ZWIA 5JP7A 3ZQYA 1JAFA 4CJGA 3M4BA 5JS5A 2YLGA 3C62A 4JE9A 2J8WA 4CIPA 4U9DA 4EIYA 4L6RA 2YL0A 3NMKA 1RCPA 4CJOA 5JRAA 1E84A 3HNJA 1A7VA 4IAQA 3TOMA 3M15A 3ZQVA 2BC5A 2XM0A 2XLVA 4JEAA 4D4NA 1E86A 1M6TA 2YL7A 1MQVA 2XL8A 2XLMA 3DE9A 3QVYA 2XLDA 5JSLA 3U8PA 3NMJA 1E83A 2YKZA 3L1MA 4CDAA 4IB4A 5JLIA 4NC3A 1CGNA 5JT4A 1GQAA 1LM3B 2CCYA 1NBBA 5B3IA 2XLOA 2YLIA 5JVEA 3M4CA 4ER9A 4IARA 4U9EA 1S05A 3ZTZA 3DE8A 4N6HA 2XL6A 3FOOA 1QQ3A 5AGFA 2XM4A 2QLAA 2XLWA 4CX9A 2J9BA 2YL3A 3HNKA 4N4WA 4JEBA 256BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ6 A;  1CPR A;  3HNL A;  3QVZ A;  1EKY A;  3ZTM A;  1CGO A;  1CPQ A;  3HNI A;  1YZC A;  1YYX A;  4CDY A;  1BBH A;  3FOP A;  2XLH A;  4CDV A;  3VRC A;  2YL1 A;  4JKV A;  3C63 A;  1APC A;  3M79 A;  2XLE A;  1YYJ A;  2YLD A;  4WGY A;  3IQ5 A;  1QPU A;  1E85 A;  3TOL A;  4WGZ A;  4D4X A;  3QW1 A;  3QW0 A;  5JUA A;  3NMI A;  1YZA A;  4ULV A;  3ZWI A;  5JP7 A;  3ZQY A;  1JAF A;  4CJG A;  3M4B A;  5JS5 A;  2YLG A;  3C62 A;  4JE9 A;  2J8W A;  4CIP A;  4U9D A;  4EIY A;  4L6R A;  2YL0 A;  3NMK A;  1RCP A;  4CJO A;  5JRA A;  1E84 A;  3HNJ A;  1A7V A;  4IAQ A;  3TOM A;  3M15 A;  3ZQV A;  2BC5 A;  2XM0 A;  2XLV A;  4JEA A;  4D4N A;  1E86 A;  1M6T A;  2YL7 A;  1MQV A;  2XL8 A;  2XLM A;  3DE9 A;  3QVY A;  2XLD A;  5JSL A;  3U8P A;  3NMJ A;  1E83 A;  2YKZ A;  3L1M A;  4CDA A;  4IB4 A;  5JLI A;  4NC3 A;  1CGN A;  5JT4 A;  1GQA A;  1LM3 B;  2CCY A;  1NBB A;  5B3I A;  2XLO A;  2YLI A;  5JVE A;  3M4C A;  4ER9 A;  4IAR A;  4U9E A;  1S05 A;  3ZTZ A;  3DE8 A;  4N6H A;  2XL6 A;  3FOO A;  1QQ3 A;  5AGF A;  2XM4 A;  2QLA A;  2XLW A;  4CX9 A;  2J9B A;  2YL3 A;  3HNK A;  4N4W A;  4JEB A;  256B A; 
#chains in the Genus database with same CATH topology
 4U5D E;  5A6B D;  3X1O A;  3UR3 C;  2OU6 A;  3O39 A;  1ZHZ A;  1TWG A;  1EKY A;  4ULW A;  1VYI A;  2Y3H A;  2LFF A;  3EJN A;  1I5N A;  1YA7 O;  1CPQ A;  4BJT A;  4U5E E;  3FVY A;  5KYN A;  3IQC A;  4Z9H A;  1ZU5 A;  3R7C A;  2UUH A;  3K1I C;  3MYF A;  1Z63 A;  2XLH A;  2A1D D;  1I4Z A;  3RIP A;  2H7B A;  4I3M A;  1LS1 A;  2YL1 A;  4N06 A;  1SZI A;  2P61 A;  5A6A A;  3KYI A;  2A0B A;  2WB7 A;  1Q0K A;  1Q0F A;  2HMQ A;  4NTB A;  1PD1 A;  3M79 A;  1RXQ A;  5KYY A;  1LI5 A;  1FNT c;  5L3V A;  2B0H A;  2XLE A;  2UUI A;  2KK1 A;  2R25 A;  4U5F E;  3ITF A;  3JCU Q;  4BJ6 C;  3HLZ A;  2R7O A;  3DXJ F;  2J0W A;  3OA1 A;  4O6Y A;  4ONS A;  4LER A;  1T6U A;  4YL3 A;  3IQ5 A;  4R32 A;  4YT8 A;  2IXM A;  2LP4 A;  3K1I A;  3LNM B;  4IAO A;  4WGZ A;  3GM1 A;  3ABM C;  3LS1 A;  1VOM A;  3T4R A;  3QW0 A;  1OW8 A;  4MVO A;  3JRM O;  5JUA A;  3NMI A;  2R7X A;  4PJL A;  1K04 A;  1Z23 A;  4P9T A;  1FFH A;  1MND A;  4XEF A;  4LAC B;  1T6Q A;  3TJ5 A;  3EZH A;  2EPO A;  2NSG A;  1A7D A;  1Q0M A;  1U6H A;  3F47 A;  3M4B A;  2YLG A;  3Q6M A;  4BJ6 A;  2J8W A;  4HFK B;  3N2Z B;  4L6R A;  3S28 A;  1MMA A;  2W4B A;  3EHM A;  3NMK A;  1RCP A;  2Q7R A;  4CJO A;  5L3Q A;  1MMN A;  2R7U A;  3RVZ A;  4A4A A;  1AEP A;  3K7D A;  1ZW2 A;  3Q7G A;  2G3K A;  3U9M A;  5DS4 A;  2FFH A;  3KL4 A;  3GOD A;  1K40 A;  3DM5 A;  5KYW B;  2C03 A;  2I8B A;  3JT1 A;  1IZM A;  2MHR A;  3ZQV A;  3US6 A;  1VK5 A;  3K1H A;  1Z3I X;  4E7S A;  4MTO A;  2EPM X;  4OIP F;  2XXA B;  3AJM A;  3VF0 A;  4E0H A;  3VAY A;  4O79 A;  4YN0 B;  3EFO B;  2R05 A;  5L0C A;  4CS8 C;  3UGP A;  2A69 F;  4AX2 A;  3AQB A;  4JCH A;  2OJQ A;  3U3B A;  2HJ3 A;  3CSK A;  3O55 A;  1T6I A;  3U8P A;  1PD0 A;  4AE4 B;  4GQH A;  3H2V A;  3ZC4 A;  4DRH B;  3W2V A;  5E3A A;  4DVY P;  2HSQ A;  3QTH A;  5A6K A;  4CIH A;  2DYR C;  2LIG A;  4KI2 A;  1H9G A;  4DXW A;  1G4W R;  4MTG A;  3DAG A;  2KNH A;  4CS8 A;  5JLI A;  1GM5 A;  3W2W A;  1L7C A;  4U5C E;  3RKO F;  1FMV A;  2ETS A;  3UMI A;  3BRJ A;  4DOZ A;  2QTV A;  3ECS A;  3NYL A;  2OQM A;  5B3I A;  1SR2 A;  4XEV A;  3FXH A;  1OKK A;  4E18 A;  4MVS A;  2FGY A;  4NTA A;  4ER9 A;  4KC9 A;  1ZW3 A;  4IAR A;  3NDB B;  4U9E A;  1LE4 A;  3DJU B;  2ZXR A;  3DM9 B;  2EPK X;  5B1B C;  4YT4 A;  4ZLD A;  4G78 A;  3FOO A;  3HTK C;  2XM4 A;  3NYJ A;  3A9C A;  4U5B E;  4C3E A;  2VH3 A;  2KC3 A;  2A0U A;  1D1C A;  2YL3 A;  3C18 A;  2OJE D;  3DZA A;  3G50 A;  3DD7 A;  4JEB A;  4N4W A;  5BUO A;  3I4U A;  2IM8 A;  4OIQ F;  4JC7 A;  2Q4F A;  3S90 A;  3W8I A;  2WVO A;  5DQZ A;  3EGD B;  3S0X A;  1OW7 A;  1JPN A;  3FAJ A;  4I1M A;  1FR0 A;  2EIK C;  2EPL X;  4QI2 A;  1CPR A;  3HNL A;  3QVZ A;  3RQE A;  5FCL A;  3RQF A;  1SF8 A;  1C03 A;  2ZD9 A;  3U3F A;  1G5Z A;  1N1C A;  1VMA A;  3LJB A;  3HNI A;  1YZC A;  3PMR A;  3GEI A;  4E7Z A;  3T6J A;  5L0G A;  1JPJ A;  2LQG A;  3FOP A;  4KBL A;  1UG7 A;  1FTS A;  4J7Y A;  3NG1 A;  2XL4 A;  2MYS A;  3MX3 A;  1QKR A;  4JKV A;  1YJG A;  1ORY A;  1M56 C;  1LIH A;  1G8X A;  2L9J A;  4JJF A;  5CI8 A;  1Q0D A;  2IBF A;  3S29 A;  2KSF A;  3LES A;  1SMY F;  3V5Y A;  1YYJ A;  2NG1 A;  4MW8 A;  1NFN A;  2L6H A;  3DWW A;  3EHN A;  1RJ9 B;  3GOR A;  2DI3 A;  4DBQ A;  5KYW A;  1O87 A;  2R7S A;  2R02 A;  4GEH A;  2Y3D A;  1ZVZ A;  1VYK A;  2EIJ C;  1C02 A;  2HV7 A;  3GAN A;  3SNH A;  4H54 A;  1BR4 A;  1NG1 A;  1YZA A;  4LDR A;  4ULV A;  3SP1 A;  3U2M A;  3ZWI A;  2XXA A;  1JAF A;  4JW1 A;  3RQG A;  3EFO A;  4G0H A;  1TWC A;  4KNW A;  1OR2 A;  4MVQ A;  5JS5 A;  2HV6 A;  1FMW A;  1OR3 A;  4BEJ A;  4EWC A;  4GYT A;  2X51 A;  4CIP A;  4MS2 A;  3IHU A;  4U9D A;  4XPW A;  1J8M F;  3U5S A;  2XSE A;  3A11 A;  5GPG B;  2YL0 A;  1TWA A;  2XRH A;  2AWY A;  1GS9 A;  3LUT B;  4E17 A;  3J06 A;  4AE4 A;  3X2Q C;  2Y3B A;  4NTF A;  1TQG A;  4BPM A;  1TFK B;  2ZXO A;  4I44 A;  4C3D A;  2LCH A;  3B9Q A;  2BL2 A;  5BQH A;  1Q0G A;  2D4U A;  1A0B A;  1RKE B;  5E2Q A;  1TKN A;  2NUT B;  5A69 A;  4G7O F;  3M15 A;  3CAX A;  2CDQ A;  4FES A;  2HKV A;  5IY5 C;  2D5R B;  1OXB A;  4MQ9 F;  4RBN A;  1LI7 A;  1LPE A;  4JEA A;  2IXP A;  4D4N A;  3EG9 B;  3SXZ A;  3N0T A;  1E86 A;  4PFO A;  4BG0 A;  1C17 M;  2PFD A;  4NQF A;  3GEE A;  2AU5 A;  2LFD A;  2YL7 A;  2HJM A;  2WVQ A;  1ZYR F;  2EIL C;  4JIO A;  1WAS A;  5T3W A;  2XLM A;  4A2N B;  2F22 A;  3SEO A;  1LS4 A;  4PJM A;  5DVW A;  1M2V B;  1YAR O;  4X0R A;  2YKZ A;  2P7V A;  1OCO C;  2VCA A;  1BDJ B;  1DOW A;  3EGX B;  3G4Z A;  3SXM A;  3WOD F;  1ZZP A;  3MLG A;  4JTC B;  1YLM A;  4OIN F;  2CYD A;  2WVN A;  2HFI A;  5EGY A;  5L0J A;  4IB4 A;  4ANJ A;  1ZHX A;  3O6X A;  5JT4 A;  1QLE C;  1XWJ A;  1YA9 A;  2AWC A;  1GQA A;  4O6M A;  3SYN A;  5DLJ A;  3EGD A;  1V55 C;  1AUE A;  2VCC A;  2L81 A;  4FX5 A;  1LM3 B;  4OIO F;  2R9R B;  1NBB A;  2DYS C;  2J9U A;  2MWQ A;  2DGJ A;  2YLI A;  3LNR A;  3B71 A;  2Q3T A;  1WOL A;  3KPH A;  4LLC A;  2KYH A;  1OQC A;  2OEV A;  1R5I D;  1S05 A;  2ZXP A;  3K6B A;  3UGO A;  3POV A;  4AL1 A;  1H9T A;  3AGT A;  3CQZ A;  2YZS A;  3ZTZ A;  3WG7 C;  1NZE A;  2XL6 A;  2W4M A;  3EH2 A;  2J0X A;  3JYH A;  4CS7 A;  2XLW A;  1WGW A;  4XTK A;  1RKC A;  4K7B A;  5BQI A;  2OKU A;  4E0I A;  2PBE A;  3GWL A;  4MVM A;  2YEV A;  3T6G B;  3C8G A;  4YK5 A;  3O10 A;  3ZVR A;  1D1B A;  2Y3G A;  2YVK A;  1JR8 A;  3HKK A;  4K1O A;  4XPX A;  3I5P A;  1NLX A;  1EI7 A;  3QZC A;  3IQT A;  5T1D B;  3EQL F;  3IQ6 A;  1RJ9 A;  2M64 A;  1D1A A;  1TWH A;  4JRZ A;  4JUR I;  3ZTM A;  1Z6A A;  3V7O A;  2ICW G;  2YHS A;  3AG2 C;  3ZG1 A;  5KYU A;  3UNG C;  4F4B A;  5EHH A;  1YYX A;  2R03 A;  3DMD A;  3GWN A;  2J9V A;  4J7T A;  1BBH A;  4CDY A;  3EH1 A;  3B0U X;  1T01 A;  3K33 A;  4CBE A;  2L6G A;  3AQC A;  1RMV A;  5F5F A;  4HEA J;  2O9X A;  1NSG B;  3UMH A;  2FAP B;  3LEV A;  3TQO A;  2HMZ A;  3OWT A;  1OKK D;  1TR2 A;  4PJJ A;  3LAY A;  3VRC A;  5KYX B;  2ZXW C;  4FAP B;  2H7V C;  4OD5 A;  3GEH A;  3C63 A;  3U8V A;  2TMV P;  2P1A A;  1V4A A;  2OOC A;  2VC9 A;  4RD9 A;  5AC5 A;  3WHN A;  2YLD A;  4JJG A;  4XLP F;  1B68 A;  2IXO A;  4O6N A;  1VTM P;  5EK0 A;  1RKE A;  4WGY A;  1QPU A;  4YJW A;  3NKE A;  2NUT A;  3TOL A;  1QVX A;  2H7O A;  5K0I A;  2I15 A;  3F46 A;  1PV3 A;  1OW6 A;  3QW1 A;  3AGU A;  3E70 C;  4NCQ A;  2A6H F;  3JSE O;  3EG9 A;  4JZA A;  1HW1 A;  5JP7 A;  2CW0 F;  2DB4 A;  3FAP B;  5L0H A;  3FHD A;  4IGG A;  1JOG A;  1NU9 C;  2GA0 A;  3DI5 A;  3K66 A;  1H7I A;  1MMG A;  1MNE A;  3DJN B;  3ZIB A;  4JE9 A;  5TJ5 E;  3KH2 A;  3OEO A;  4EIY A;  1JMW A;  4U5H A;  1A7E A;  4BJ1 A;  1H6G A;  2PNO A;  5JRA A;  1M2V A;  2ASR A;  2LSE A;  4PAC A;  3AG4 C;  3NYM A;  1OCC C;  1WTY A;  3HNJ A;  3EGX A;  2A6E F;  1A7V A;  3C8G B;  1SYQ A;  2X0C A;  1XZQ A;  2J7P A;  4PFP A;  3DAF A;  2G3V A;  5L0D A;  4P9F A;  2R7R A;  2YQY A;  4M63 A;  2Q9A A;  1Z5Z A;  2XM0 A;  2CNW A;  1QZX A;  1ORS C;  3ABL C;  2IOQ A;  3B0P A;  1WN0 A;  2XLV A;  2A68 F;  4XQ1 A;  3GM2 A;  3JYY A;  1M6T A;  1W2W A;  1PCX A;  2OEX A;  1FFT C;  5KYU B;  2C04 A;  1ST6 A;  2NUP B;  1KTM A;  3B29 A;  3U9J A;  3RW0 A;  1MQV A;  4CSA A;  2XL8 A;  2AVK A;  4C7O B;  5HV9 A;  1YAU O;  4Z9J A;  3Q7L A;  3QVY A;  1VB5 A;  4EBK A;  2KGO A;  1XZP A;  2R7W A;  4WAB A;  3FMS A;  3GM3 A;  2VCB A;  5JSL A;  3V5Z A;  3RVY A;  4DVZ A;  2YWA A;  3CEX A;  3W8H A;  3EPV A;  5A6B A;  3L1M A;  1Y4C A;  5CIV A;  2J9W A;  2NPU A;  1FAP B;  1I4Y A;  1O5H A;  3MBG A;  3PCV A;  4HFF B;  2PX3 A;  3IEE A;  2R7V A;  4NC3 A;  1UFB A;  2GWW A;  2OG2 A;  3ABK C;  3MYI A;  4FWV A;  4IWB A;  4JVS A;  4U5G A;  3TD7 A;  2WZL A;  3SXY A;  4W8P A;  2QUP A;  2CCY A;  2KW3 C;  3JSZ A;  4QDL A;  5A6J A;  2HUJ A;  4XEK A;  2XLO A;  1D0Z A;  1D0X A;  3DKA A;  1F1M A;  1M2O A;  3C8Z A;  4G7Z F;  1NU7 D;  1OCZ C;  2PX0 A;  4I1O B;  2WZG A;  1HE9 A;  2ZPA A;  4BEM J;  3DE8 A;  3LLK A;  4Q4Z F;  2VAS A;  2R7T A;  3L8J A;  5COG A;  4JCZ A;  1J8Y F;  5AGF A;  2HSB A;  2HZ8 A;  2Q9C A;  2QLA A;  3TJ6 A;  2RD9 A;  4DJ9 A;  2J9B A;  4G7H F;  2B0J A;  5E3C A;  1WAT A;  3HNK A;  4YL1 A;  4HE8 D;  3G4X A;  2WZF A;  4IJJ A;  3ZDL A;  2EIM C;  2XS1 A;  3VM6 A;  4DBR A;  4UDV A;  3C7J A;  1Z7Q c;  3W4Y A;  2OCC C;  5CI9 A;  3L34 A;  2W45 A;  1BZ4 A;  3AOU A;  2Y39 A;  1HY5 A;  4EKW A;  3UMK A;  3KYJ A;  4AK9 A;  4MVZ A;  4XPY A;  3T9O A;  3R2P A;  4J32 B;  4JTD B;  1CGO A;  1R4T A;  3L0I A;  4EBJ A;  1HE1 A;  3KKB A;  4Z9I A;  2XS8 A;  3RF3 A;  1GGQ A;  1K05 A;  2J45 A;  3IPM O;  3U0C A;  5F28 E;  3LEO A;  5DS5 A;  3S84 A;  4CDV A;  1EQ1 A;  2PP4 A;  4EUK B;  4JTA B;  1OCR C;  3AG3 C;  4P6I C;  2QNL A;  1APC A;  2P0N A;  2PF4 E;  4IRU A;  4XWJ A;  4AL0 A;  1ZU4 A;  4DRI B;  3L8I A;  3QMK A;  2JD3 A;  4OD4 A;  5DQT A;  4J30 B;  1EA8 A;  5COF A;  1CGM E;  1NFO A;  1YVI A;  2P6V A;  2Q9B A;  4PR9 A;  5COM A;  1E85 A;  4D4X A;  4CS9 C;  4Q5S F;  3TUL A;  1S7Z A;  1E2X A;  3SXK A;  3JTL O;  5B3S C;  3N24 A;  2HS5 A;  3C8G D;  1LKX A;  3ZQY A;  3M1C B;  4CJG A;  2R7Q A;  2GDC A;  2NUP A;  3I5Q A;  2BE5 F;  3C62 A;  4LLE A;  2KJG A;  4LDQ A;  4MVU A;  4C7O A;  2VB6 A;  3Q6N A;  5FZT A;  3CZ6 A;  2E87 A;  2IXN A;  4EHP A;  5HSW A;  4OIR F;  4CS9 A;  1YDI A;  3RYL A;  5AC4 A;  1V74 B;  5KYX A;  5KYY B;  5T3T A;  1E84 A;  4H4K C;  5D91 A;  3NKD A;  4WJ0 A;  2CGE A;  3JRT A;  4IAQ A;  1JRA A;  4YT2 A;  4EBB A;  3TOM A;  4BJ5 C;  1A41 A;  5B1A C;  1ORJ A;  2V26 A;  3ZSU A;  2BC5 A;  3KMI A;  4XLN F;  4MW3 A;  4NY3 A;  4PK4 A;  5E33 A;  1Y6D A;  2W9Y A;  1O3U A;  4MND A;  5L0I A;  1U89 A;  3S27 A;  2LD6 A;  2Y69 C;  4K0D A;  1IW7 F;  3T6B A;  3ATP A;  5DS6 A;  3PHF 2;  1AVO B;  3LS0 A;  3VYW A;  1TFO B;  2L6F A;  3PDM P;  1BR1 A;  1L3P A;  2JPU A;  1BR2 A;  1ZHY A;  3TK0 A;  3DE9 A;  4LDK A;  4MTF A;  4MVR A;  3FDQ A;  3HJC A;  4BJ5 A;  2XLD A;  4C3B A;  4DRJ B;  1V54 C;  1HW2 A;  1M57 C;  1E83 A;  3B0V C;  3NMJ A;  5D92 A;  3RFY A;  1ZHW A;  2JX0 A;  1WWP A;  3BEH A;  3WAQ A;  5BQG A;  1DOV A;  3MFN A;  4O7G A;  1U0B B;  4CDA A;  4CSA C;  2H8A A;  4PJN A;  3RH3 A;  3S9O A;  1D0Y A;  1CGN A;  2EIN C;  1KNY A;  2J46 A;  1QSP A;  4Q7C A;  3H65 A;  2WL8 A;  2QY9 A;  2LK4 A;  2YRF A;  1KU2 A;  5F5H A;  2M4E A;  3ASO C;  1VLS A;  3LLI A;  3NRH A;  5JVE A;  1HMO A;  2QE9 A;  3M4C A;  1T9K A;  3SZR A;  2J7P D;  4RDA A;  1T5O A;  2NSF A;  1LE2 A;  2GAQ A;  3U2L A;  3V5X A;  2GFH A;  1MMD A;  2IYL D;  2CNW D;  4B6I A;  4W8K A;  2EPN A;  4N6H A;  5L0F A;  2AP3 A;  3JZ0 A;  2RSE B;  4N6C A;  4YWQ A;  1QQ3 A;  2G62 A;  2Q00 A;  2Z15 A;  4CX9 A;  4KNV A;  1OXK A;  1ZHT A;  3EZI A;  4QI0 A;  3ASN C;  4YL0 A;  2KQ9 A;  256B A;  1LVK A;  3E9V A;  1VLT A;  4YT5 A;  3AG1 C;  3H2U A;  4ZLC A;  2L7A A;  1HMD A;  1G4U S;  2V3C C; 
#chains in the Genus database with same CATH homology
 3IQ6 A;  1CPR A;  3HNL A;  3QVZ A;  1EKY A;  3ZTM A;  1CGO A;  1CPQ A;  3HNI A;  1YZC A;  1YYX A;  4CDY A;  1BBH A;  3FOP A;  2XLH A;  4CDV A;  3VRC A;  2YL1 A;  4JKV A;  3C63 A;  1APC A;  3M79 A;  2XLE A;  1YYJ A;  2YLD A;  4WGY A;  3IQ5 A;  1QPU A;  1E85 A;  3TOL A;  4WGZ A;  4D4X A;  3QW1 A;  3QW0 A;  5JUA A;  3NMI A;  1YZA A;  4ULV A;  3ZWI A;  5JP7 A;  3ZQY A;  1JAF A;  4CJG A;  3M4B A;  5JS5 A;  2YLG A;  3C62 A;  4JE9 A;  2J8W A;  4CIP A;  4U9D A;  4EIY A;  4L6R A;  2YL0 A;  3NMK A;  1RCP A;  4CJO A;  5JRA A;  1E84 A;  3HNJ A;  1A7V A;  4IAQ A;  3TOM A;  3M15 A;  3ZQV A;  2BC5 A;  2XM0 A;  2XLV A;  4JEA A;  4D4N A;  1E86 A;  1M6T A;  2YL7 A;  1MQV A;  2XL8 A;  2XLM A;  3DE9 A;  3QVY A;  2XLD A;  5JSL A;  3U8P A;  3NMJ A;  1E83 A;  2YKZ A;  3L1M A;  4CDA A;  4IB4 A;  5JLI A;  4NC3 A;  1CGN A;  5JT4 A;  1GQA A;  1LM3 B;  2CCY A;  1NBB A;  5B3I A;  2XLO A;  2YLI A;  5JVE A;  3M4C A;  4ER9 A;  4IAR A;  4U9E A;  1S05 A;  3ZTZ A;  3DE8 A;  4N6H A;  2XL6 A;  3FOO A;  1QQ3 A;  5AGF A;  2XM4 A;  2QLA A;  2XLW A;  4CX9 A;  2J9B A;  2YL3 A;  3HNK A;  4N4W A;  4JEB A;  256B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...