3L1MA

Crystal structure of a ni-directed dimer of cytochrome cb562 with a quinolate-histidine hybrid coordination motif
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVCQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Controlled protein dimerization through hybrid coordination motifs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3l1mA00
4U9DA 4CDAA 2XLDA 2J9BA 1E85A 4CX9A 4D4XA 256BA 3C63A 1BBHA 3QVYA 5JT4A 2XLMA 2YLGA 3C62A 3IQ5A 2BC5A 3NMJA 5JSLA 3NMKA 4NC3A 3IQ6A 1MQVA 4N4WA 2XL6A 3M79A 3QW0A 3HNLA 5JS5A 2YL0A 3ZWIA 2YLIA 1NBBA 2XLHA 4IAQA 1YYJA 4JEBA 4JEAA 1CPRA 2XLWA 3DE9A 5AGFA 5JLIA 4IARA 3FOPA 4JKVA 3HNKA 4JE9A 2XLOA 4N6HA 1YZAA 2CCYA 3HNJA 2XM0A 3L1MA 3ZTMA 1M6TA 1RCPA 3M4BA 2YL1A 3M4CA 5JRAA 3FOOA 5JVEA 1GQAA 1YZCA 1E83A 4ER9A 3QVZA 2XL8A 2XLVA 4U9EA 3ZTZA 4CJOA 1EKYA 2J8WA 3DE8A 1CGOA 3TOLA 3TOMA 3U8PA 1E84A 3ZQYA 4CDVA 2XM4A 4EIYA 1CPQA 1QPUA 2YL7A 1APCA 3NMIA 3HNIA 4CDYA 5B3IA 1YYXA 1LM3B 1A7VA 2XLEA 2YKZA 4CIPA 3M15A 4CJGA 1JAFA 1S05A 3VRCA 5JP7A 2YLDA 4IB4A 1E86A 5JUAA 4D4NA 4L6RA 4WGZA 1QQ3A 3QW1A 4ULVA 2QLAA 4WGYA 2YL3A 1CGNA 3ZQVA
chains in the Genus database with same CATH superfamily
4JW1A 4XTKA 3VM6A 2QTVA 2XLDA 4I3MA 1T6IA 1E85A 4AE4A 3S0XA 2NSFA 4P6IC 1W2WA 3RW0A 2DI3A 2OKUA 3B0UX 5T1DB 2LP4A 2EINC 1EQ1A 5BQHA 3Q6NA 2EPNA 3GM3A 4GQHA 5JT4A 2PBEA 4MW3A 4IRUA 1JR8A 5JSLA 5L0FA 2R05A 5A6BD 4MS2A 1V4AA 4N4WA 1O87A 2A6EF 3GANA 3JSZA 5B1AC 3M79A 1VMAA 1OR2A 3RFYA 2BL2A 3LLKA 3H65A 1N1CA 4BJ5A 4CIHA 2IM8A 1NLXA 2OCCC 2HV6A 2QNLA 3EHMA 2O9XA 3ZWIA 5L0HA 3SXYA 1V55C 3DMDA 4JVSA 1JMWA 5AC5A 2XLHA 1LE4A 3DD7A 5IY5C 3AG1C 3SXZA 1I4ZA 3S84A 4G7HF 1PCXA 2OU6A 3FMSA 3MLGA 1T6UA 3RQEA 4DRJB 4ZLCA 1S7ZA 2AWCA 2EIMC 2XLWA 3GM2A 4J30B 5AGFA 3LS1A 1VLTA 3GEEA 3VF0A 1CGME 2V3CC 1FTSA 5F28E 1Z3IX 4IWBA 2KC3A 2LQGA 4XQ1A 1QVXA 4UDVA 3B0PA 2Y3BA 2YWAA 1YZAA 4J7TA 4F4BA 1TWGA 1NFNA 2G3KA 4JZAA 2R7UA 4R32A 2ZXOA 2CNWA 4PJLA 2IXMA 2I8BA 1RMVA 2VCCA 1VOMA 2Y39A 3V5ZA 4M63A 1SF8A 3GODA 4G0HA 2HZ8A 4JJGA 4MW8A 4KNVA 1YLMA 4GYTA 1IW7F 4K7BA 4RD9A 1AUEA 3C8GA 3SXMA 5A6JA 4OD4A 1G4WR 2A69F 3ZIBA 1K40A 2J7PD 1F1MA 1WGWA 4JC7A 5JRAA 2HSBA 4MVMA 1YZCA 2XS8A 1PD0A 3MYFA 1E83A 3I4UA 5BQIA 3JRMO 2MWQA 3FAJA 3DM9B 1MNDA 3A11A 5A69A 2KJGA 5KYXB 1Q0MA 1BR1A 2XL8A 4GEHA 4Z9IA 1KU2A 4MVZA 3TULA 4CJOA 3ABLC 1FFTC 2EPMX 2IXPA 2G62A 3EGXB 2LK4A 3GWLA 4PACA 4P9FA 1WTYA 3TOLA 2OOCA 1IZMA 3NKDA 3U8PA 1E84A 3AGUA 3X2QC 1Z6AA 4EIYA 3SP1A 4C3EA 2R7RA 2VB6A 2EIKC 3DZAA 1WWPA 3GEHA 1G5ZA 2J45A 1ZU5A 2A6HF 3L8IA 1LPEA 1DOWA 3JTLO 4CS9A 2YZSA 2GDCA 1GGQA 3HNIA 4K1OA 4AL0A 3U2MA 4PK4A 5FZTA 3MBGA 1HE1A 3C18A 1A7VA 4NTBA 4I44A 5KYUB 4ONSA 4YL3A 5EK0A 1XWJA 2WL8A 1S05A 1WASA 2WZFA 1RKCA 3PHF2 2OEVA 2YQYA 3AOUA 1E86A 1D0ZA 4XLNF 2LSEA 2R25A 2GFHA 3LNMB 2YRFA 3KMIA 4X0RA 2HFIA 2YL3A 1J8MF 4HE8D 5COGA 5DVWA 3U9MA 4LLCA 3PDMP 1UFBA 5E3AA 4MVOA 3W8IA 3TK0A 1AVOB 5DS6A 3RYLA 1ZZPA 2IXOA 3ZVRA 1JOGA 1LKXA 5GPGB 4A4AA 4WABA 1Y6DA 3O55A 3DKAA 4HFKB 3LEVA 4RBNA 1C03A 1A7DA 1LI5A 2OEXA 3E70C 3K7DA 1HE9A 2IYLD 2H7VC 1MMDA 256BA 4MTOA 2NUTA 3QMKA 4BJ6A 2A1DD 3GWNA 4DVZA 3UGPA 3OEOA 2PNOA 3DI5A 2YLGA 4LDQA 3C62A 3TJ5A 3POVA 1FNTc 2CDQA 4MQ9F 3HJCA 3ZC4A 5DQTA 4LACB 4AK9A 3IPMO 3TJ6A 2HSQA 3TD7A 3DM5A 3PMRA 3HNLA 3SYNA 4NCQA 2GA0A 5B3SC 5KYWB 1NG1A 1TQGA 1E2XA 1TFKB 2YL0A 3A9CA 4RDAA 2XXAB 2ZXWC 3CSKA 4FX5A 1OCZC 2L6HA 2HUJA 2GAQA 4DJ9A 5KYUA 4G7ZF 3EG9A 4XPXA 1QKRA 1U0BB 1R4TA 5L0DA 1YYJA 4FWVA 4JEBA 3LS0A 2C04A 4YN0B 1FFHA 4XEVA 1KNYA 1R5ID 1SZIA 4JTAB 1TWHA 3EHNA 1T6QA 4MTFA 5KYYA 1Z63A 4KI2A 4QI2A 2H8AA 3VYWA 4LDKA 2X0CA 1V74B 4JE9A 3JT1A 4JURI 5DS5A 1MMGA 3UNGC 3DJUB 2Y69C 4CBEA 5E3CA 4FESA 5L0IA 2CGEA 3ZDLA 3OA1A 2JX0A 4YWQA 2A0BA 3IQCA 3L1MA 5A6BA 2OJQA 4YL0A 2IOQA 4E7SA 2BE5F 3S29A 5L0CA 1RJ9A 4E18A 3KH2A 2I15A 2LFDA 1T5OA 3LESA 4G78A 3T6JA 2MHRA 2P61A 1RCPA 1RKEA 3L8JA 3US6A 3M4BA 3B29A 2M4EA 2W4MA 3EFOA 3KYJA 1NFOA 1LI7A 5HSWA 2YL1A 4XEKA 5L3QA 2D5RB 5KYWA 1GQAA 1QLEC 1EA8A 1HW1A 2AWYA 3F47A 1Y4CA 1K05A 2P7VA 1XZQA 4U5FE 4AX2A 3H2VA 1D1AA 2Y3DA 3ITFA 5CI8A 4BEMJ 4EKWA 2W4BA 3UR3C 1D1BA 1Z5ZA 3HLZA 4LDRA 3NRHA 2YHSA 4YK5A 4E7ZA 3LJBA 5F5HA 2DB4A 3ECSA 3DE8A 2L6FA 3ZSUA 3TOMA 1H7IA 3T4RA 1LS1A 3J06A 4CDVA 2XM4A 4CS9C 2EPLX 4C7OA 1I4YA 1M57C 1NU9C 1YA9A 3N0TA 3EGDB 4JTCB 2A68F 2H7BA 3ASOC 1BR2A 2NUTB 3GM1A 3O10A 5L3VA 3NMIA 3PCVA 4CDYA 1ST6A 3QZCA 3ABKC 1HW2A 3JSEO 2B0JA 2XLEA 4YT8A 3EZIA 3O6XA 3EJNA 1VB5A 5DQZA 2R7XA 4KBLA 4C3BA 1JAFA 1FAPB 3L34A 1QSPA 2NUPA 3ZG1A 2J7PA 2ZXPA 4OINF 3O39A 1M2VB 3AG3C 3AQBA 3C8ZA 3NYMA 4XPYA 2HJMA 1NSGB 2QE9A 3KKBA 3FAPB 1QQ3A 3K6BA 4AL1A 4ULVA 1YDIA 1DOVA 2X51A 2XRHA 3G50A 1B68A 1H9TA 4KC9A 2OQMA 4AE4B 1M56C 3T9OA 3EH1A 3NDBB 3AJMA 1QZXA 4CDAA 2KK1A 2P6VA 4BJ6C 5A6AA 5KYYB 1A7EA 2J9BA 2PFDA 5T3WA 1PD1A 1ZYRF 1WATA 3DJNB 3L0IA 4CX9A 1J8YF 2ASRA 2R7SA 2QUPA 3JRTA 3UMIA 2DYSC 2ETSA 2HV7A 1M2OA 1BBHA 4JCZA 4XEFA 5D92A 2ZD9A 3T6GB 1U6HA 1OKKD 2XLMA 3EPVA 4EHPA 3IQ5A 4YT4A 4H4KC 2KW3C 4NC3A 3IQ6A 4PFPA 5TJ5E 3OWTA 2L81A 4U5EE 2EILC 4BJTA 3QW0A 1JPNA 2B0HA 2XL4A 3LUTB 3QTHA 3EFOB 4JJFA 3G4ZA 3SZRA 5JS5A 2RSEB 4OIOF 4MNDA 1AEPA 1VLSA 2R7QA 4XPWA 1OW8A 2WZGA 5BUOA 3WAQA 2MYSA 3Q7GA 1TR2A 2RD9A 4JRZA 1WOLA 4P9TA 5COMA 3FHDA 3JCUQ 4IAQA 2J46A 2EPOA 4JEAA 4IJJA 3RIPA 1CPRA 5JLIA 3T6BA 1OCOC 1SMYF 3C7JA 3FOPA 4PJNA 3RF3A 5HV9A 1Q0DA 2HMZA 5E33A 2XLOA 3K1HA 4N6HA 3S28A 4A2NB 1Z7Qc 2CCYA 3RQGA 3HNJA 4YT2A 1SR2A 2J9UA 4DXWA 1YVIA 4DVYP 4CS8C 3JZ0A 4JIOA 4MVSA 2FGYA 3W2WA 1JPJA 3C8GB 2P0NA 3CZ6A 4E0IA 3U0CA 4W8KA 4E0HA 4MVQA 1U89A 4J7YA 2KNHA 1O5HA 3U3FA 5K0IA 4ANJA 4OIQF 4OIRF 2PF4E 3RVZA 2FFHA 1WN0A 2Q9AA 1YJGA 4J32B 5JVEA 1ZU4A 2XS1A 2Z15A 3MYIA 1GM5A 1TWAA 1I5NA 2KGOA 5FCLA 4CSAA 3E9VA 3CEXA 1FR0A 2M64A 3DWWA 1HMOA 2R02A 2LCHA 1C02A 3F46A 3JYHA 1HY5A 4I1OB 4U9EA 4JTDB 2VCAA 3KPHA 4KNWA 3ZTZA 1D0XA 5AC4A 4LERA 2J8WA 1G8XA 1OW6A 2KSFA 3R7CA 1ORSC 3W2VA 4DBQA 4K0DA 1KTMA 3HKKA 3UGOA 1CGOA 1VK5A 5KYXA 4MVUA 3FDQA 4BJ1A 4IGGA 4BEJA 3IEEA 4OD5A 3EGXA 1CPQA 4DBRA 3X1OA 3GORA 3LAYA 3EH2A 1QPUA 3V7OA 2YL7A 4CS8A 1APCA 3CAXA 2AVKA 3RQFA 4XWJA 3ASNC 1ZHZA 4JCHA 3U9JA 5B3IA 1ZHTA 1HMDA 1Q0GA 1OXKA 1Q0FA 1OCRC 1OCCC 2Q3TA 3GEIA 2VCBA 2ZXRA 5A6KA 3V5XA 2YKZA 4U5DE 3V5YA 3DAGA 1OQCA 1BDJB 5CIVA 4CIPA 3M15A 2J9VA 1RXQA 2WVQA 1ZHYA 3VRCA 2R9RB 2WB7A 4QDLA 2ZPAA 5JP7A 1XZPA 2YLDA 1UG7A 4IB4A 3U3BA 2A0UA 3TQOA 4O79A 2R7VA 2J9WA 2OG2A 3KYIA 2VASA 1JRAA 4D4NA 2NSGA 4EBJA 2QY9A 3BRJA 3QW1A 5EHHA 4WGYA 3U2LA 4ZLDA 1L3PA 1EI7A 5DLJA 1CGNA 3K1IC 3MX3A 3B0VC 1LIHA 4H54A 4NY3A 4EWCA 1K04A 1Q0KA 2LD6A 2L6GA 2ICWG 4NTAA 4U9DA 3WHNA 4DRIB 3RH3A 3RVYA 4YT5A 5KYNA 3K33A 3ABMC 4Z9HA 4QI0A 1TKNA 3DAFA 4D4XA 3IQTA 4W8PA 3C63A 1H9GA 4PFOA 3QVYA 2NPUA 1VTMP 3Q6MA 1BR4A 3B9QA 2CNWD 4MVRA 3SXKA 2BC5A 3W4YA 2DYRC 2F22A 3NMJA 1D0YA 1LVKA 2JPUA 2LFFA 1V54C 2HMQA 3IHUA 1MQVA 3NMKA 2XL6A 4HEAJ 2P1AA 3UMHA 1ZHXA 1FMWA 4HFFB 2DGJA 2V26A 2HJ3A 2YVKA 5DS4A 2G3VA 2VC9A 2XSEA 3C8GD 3EG9B 4U5HA 1ORJA 1YAUO 5BQGA 2AP3A 3RKOF 2CW0F 2YLIA 3NG1A 1H6GA 4YL1A 3I5QA 3MFNA 3S9OA 1YA7O 1NBBA 5B1BC 2IBFA 3JYYA 3K1IA 2J0WA 4Q5SF 4NQFA 1TWCA 2HS5A 2R03A 2XXAA 1T9KA 1L7CA 2JD3A 3DE9A 3N2ZB 4I1MA 4IARA 1ZHWA 4O6NA 1LE2A 3DXJF 5EGYA 4JKVA 2R7TA 1BZ4A 4IAOA 3HNKA 3B71A 2CYDA 2PP4A 2UUIA 3I5PA 4O7GA 2EIJC 4C3DA 1ZVZA 3AG2C 3WODF 1RJ9B 1OKKA 4EBKA 1GS9A 2XM0A 1RKEB 1D1CA 4YJWA 2IXNA 5T3TA 3AGTA 1SYQA 2Q4FA 2EPKX 4U5BE 2OJED 2H7OA 3VAYA 1M6TA 3ZTMA 1LS4A 4CS7A 4EBBA 3NYLA 1A41A 1ORYA 3LLIA 4O6YA 4PJJA 2WVOA 4WJ0A 2Q00A 3LNRA 4FAPB 2YEVA 2NG1A 3G4XA 4U5CE 1FMVA 3M4CA 4CSAC 3FOOA 1O3UA 3HTKC 4O6MA 4EUKB 5L0JA 4Q7CA 2GWWA 4Q4ZF 4BG0A 3FXHA 4ER9A 3S27A 3SNHA 1OR3A 2J0XA 1MNEA 3QVZA 2XLVA 3NKEA 4C7OB 2UUHA 3R2PA 1NZEA 1ZW3A 4LLEA 1EKYA 2KQ9A 1NU7D 2VH3A 2WVNA 2W45A 4N6CA 1OXBA 1TFOB 2Y3GA 3N24A 3AG4C 4PJMA 2KYHA 1YARO 2LIGA 3ZQYA 2TMVP 2L7AA 1VYIA 5F5FA 5L0GA 3Q7LA 1OW7A 1MMNA 3SEOA 5COFA 2Y3HA 1VYKA 1T01A 3LEOA 3KL4A 2PX0A 2Q9BA 4G7OF 4E17A 5CI9A 3EGDA 1YYXA 1LM3B 3BEHA 3K66A 3U5SA 2NUPB 3S90A 3U8VA 2E87A 2C03A 2D4UA 3FVYA 1G4US 1C17M 3EQLF 4CJGA 3NYJA 3AQCA 4U5GA 5E2QA 4DRHB 3H2UA 1ZW2A 3UMKA 2HKVA 4DOZA 4OIPF 5D91A 2R7WA 4PR9A 2FAPB 2AU5A 2PX3A 4NTFA 3M1CB 4BJ5C 3ATPA 4MTGA 5JUAA 4XLPF 2Q9CA 1A0BA 3W8HA 2R7OA 4L6RA 4WGZA 2WZLA 3WG7C 4N06A 1PV3A 2QLAA 3EZHA 1MMAA 4B6IA 4BPMA 1M2VA 3CQZA 2Q7RA 4Z9JA 2L9JA 1Z23A 4ULWA 3ZQVA 2W9YA
chains in the Genus database with same CATH topology
4U9DA 4CDAA 2XLDA 2J9BA 1E85A 4CX9A 4D4XA 256BA 3C63A 1BBHA 3QVYA 5JT4A 2XLMA 2YLGA 3C62A 3IQ5A 2BC5A 3NMJA 5JSLA 3NMKA 4NC3A 3IQ6A 1MQVA 4N4WA 2XL6A 3M79A 3QW0A 3HNLA 5JS5A 2YL0A 3ZWIA 2YLIA 1NBBA 2XLHA 4IAQA 1YYJA 4JEBA 4JEAA 1CPRA 2XLWA 3DE9A 5AGFA 5JLIA 4IARA 3FOPA 4JKVA 3HNKA 4JE9A 2XLOA 4N6HA 1YZAA 2CCYA 3HNJA 2XM0A 3L1MA 3ZTMA 1M6TA 1RCPA 3M4BA 2YL1A 3M4CA 5JRAA 3FOOA 5JVEA 1GQAA 1YZCA 1E83A 4ER9A 3QVZA 2XL8A 2XLVA 4U9EA 3ZTZA 4CJOA 1EKYA 2J8WA 3DE8A 1CGOA 3TOLA 3TOMA 3U8PA 1E84A 3ZQYA 4CDVA 2XM4A 4EIYA 1CPQA 1QPUA 2YL7A 1APCA 3NMIA 3HNIA 4CDYA 5B3IA 1YYXA 1LM3B 1A7VA 2XLEA 2YKZA 4CIPA 3M15A 4CJGA 1JAFA 1S05A 3VRCA 5JP7A 2YLDA 4IB4A 1E86A 5JUAA 4D4NA 4L6RA 4WGZA 1QQ3A 3QW1A 4ULVA 2QLAA 4WGYA 2YL3A 1CGNA 3ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9D A;  4CDA A;  2XLD A;  2J9B A;  1E85 A;  4CX9 A;  4D4X A;  256B A;  3C63 A;  1BBH A;  3QVY A;  5JT4 A;  2XLM A;  2YLG A;  3C62 A;  3IQ5 A;  2BC5 A;  3NMJ A;  5JSL A;  3NMK A;  4NC3 A;  3IQ6 A;  1MQV A;  4N4W A;  2XL6 A;  3M79 A;  3QW0 A;  3HNL A;  5JS5 A;  2YL0 A;  3ZWI A;  2YLI A;  1NBB A;  2XLH A;  4IAQ A;  1YYJ A;  4JEB A;  4JEA A;  1CPR A;  2XLW A;  3DE9 A;  5AGF A;  5JLI A;  4IAR A;  3FOP A;  4JKV A;  3HNK A;  4JE9 A;  2XLO A;  4N6H A;  1YZA A;  2CCY A;  3HNJ A;  2XM0 A;  3L1M A;  3ZTM A;  1M6T A;  1RCP A;  3M4B A;  2YL1 A;  3M4C A;  5JRA A;  3FOO A;  5JVE A;  1GQA A;  1YZC A;  1E83 A;  4ER9 A;  3QVZ A;  2XL8 A;  2XLV A;  4U9E A;  3ZTZ A;  4CJO A;  1EKY A;  2J8W A;  3DE8 A;  1CGO A;  3TOL A;  3TOM A;  3U8P A;  1E84 A;  3ZQY A;  4CDV A;  2XM4 A;  4EIY A;  1CPQ A;  1QPU A;  2YL7 A;  1APC A;  3NMI A;  3HNI A;  4CDY A;  5B3I A;  1YYX A;  1LM3 B;  1A7V A;  2XLE A;  2YKZ A;  4CIP A;  3M15 A;  4CJG A;  1JAF A;  1S05 A;  3VRC A;  5JP7 A;  2YLD A;  4IB4 A;  1E86 A;  5JUA A;  4D4N A;  4L6R A;  4WGZ A;  1QQ3 A;  3QW1 A;  4ULV A;  2QLA A;  4WGY A;  2YL3 A;  1CGN A;  3ZQV A; 
#chains in the Genus database with same CATH topology
 4JW1 A;  4XTK A;  3VM6 A;  2QTV A;  2XLD A;  4I3M A;  1T6I A;  1E85 A;  4AE4 A;  3S0X A;  2NSF A;  4P6I C;  1W2W A;  3RW0 A;  2DI3 A;  2OKU A;  3B0U X;  5T1D B;  2LP4 A;  2EIN C;  1EQ1 A;  5BQH A;  3Q6N A;  2EPN A;  3GM3 A;  4GQH A;  5JT4 A;  2PBE A;  4MW3 A;  4IRU A;  1JR8 A;  5JSL A;  5L0F A;  2R05 A;  5A6B D;  4MS2 A;  1V4A A;  4N4W A;  1O87 A;  2A6E F;  3GAN A;  3JSZ A;  5B1A C;  3M79 A;  1VMA A;  1OR2 A;  3RFY A;  2BL2 A;  3LLK A;  3H65 A;  1N1C A;  4BJ5 A;  4CIH A;  2IM8 A;  1NLX A;  2OCC C;  2HV6 A;  2QNL A;  3EHM A;  2O9X A;  3ZWI A;  5L0H A;  3SXY A;  1V55 C;  3DMD A;  4JVS A;  1JMW A;  5AC5 A;  2XLH A;  1LE4 A;  3DD7 A;  5IY5 C;  3AG1 C;  3SXZ A;  1I4Z A;  3S84 A;  4G7H F;  1PCX A;  2OU6 A;  3FMS A;  3MLG A;  1T6U A;  3RQE A;  4DRJ B;  4ZLC A;  1S7Z A;  2AWC A;  2EIM C;  2XLW A;  3GM2 A;  4J30 B;  5AGF A;  3LS1 A;  1VLT A;  3GEE A;  3VF0 A;  1CGM E;  2V3C C;  1FTS A;  5F28 E;  1Z3I X;  4IWB A;  2KC3 A;  2LQG A;  4XQ1 A;  1QVX A;  4UDV A;  3B0P A;  2Y3B A;  2YWA A;  1YZA A;  4J7T A;  4F4B A;  1TWG A;  1NFN A;  2G3K A;  4JZA A;  2R7U A;  4R32 A;  2ZXO A;  2CNW A;  4PJL A;  2IXM A;  2I8B A;  1RMV A;  2VCC A;  1VOM A;  2Y39 A;  3V5Z A;  4M63 A;  1SF8 A;  3GOD A;  4G0H A;  2HZ8 A;  4JJG A;  4MW8 A;  4KNV A;  1YLM A;  4GYT A;  1IW7 F;  4K7B A;  4RD9 A;  1AUE A;  3C8G A;  3SXM A;  5A6J A;  4OD4 A;  1G4W R;  2A69 F;  3ZIB A;  1K40 A;  2J7P D;  1F1M A;  1WGW A;  4JC7 A;  5JRA A;  2HSB A;  4MVM A;  1YZC A;  2XS8 A;  1PD0 A;  3MYF A;  1E83 A;  3I4U A;  5BQI A;  3JRM O;  2MWQ A;  3FAJ A;  3DM9 B;  1MND A;  3A11 A;  5A69 A;  2KJG A;  5KYX B;  1Q0M A;  1BR1 A;  2XL8 A;  4GEH A;  4Z9I A;  1KU2 A;  4MVZ A;  3TUL A;  4CJO A;  3ABL C;  1FFT C;  2EPM X;  2IXP A;  2G62 A;  3EGX B;  2LK4 A;  3GWL A;  4PAC A;  4P9F A;  1WTY A;  3TOL A;  2OOC A;  1IZM A;  3NKD A;  3U8P A;  1E84 A;  3AGU A;  3X2Q C;  1Z6A A;  4EIY A;  3SP1 A;  4C3E A;  2R7R A;  2VB6 A;  2EIK C;  3DZA A;  1WWP A;  3GEH A;  1G5Z A;  2J45 A;  1ZU5 A;  2A6H F;  3L8I A;  1LPE A;  1DOW A;  3JTL O;  4CS9 A;  2YZS A;  2GDC A;  1GGQ A;  3HNI A;  4K1O A;  4AL0 A;  3U2M A;  4PK4 A;  5FZT A;  3MBG A;  1HE1 A;  3C18 A;  1A7V A;  4NTB A;  4I44 A;  5KYU B;  4ONS A;  4YL3 A;  5EK0 A;  1XWJ A;  2WL8 A;  1S05 A;  1WAS A;  2WZF A;  1RKC A;  3PHF 2;  2OEV A;  2YQY A;  3AOU A;  1E86 A;  1D0Z A;  4XLN F;  2LSE A;  2R25 A;  2GFH A;  3LNM B;  2YRF A;  3KMI A;  4X0R A;  2HFI A;  2YL3 A;  1J8M F;  4HE8 D;  5COG A;  5DVW A;  3U9M A;  4LLC A;  3PDM P;  1UFB A;  5E3A A;  4MVO A;  3W8I A;  3TK0 A;  1AVO B;  5DS6 A;  3RYL A;  1ZZP A;  2IXO A;  3ZVR A;  1JOG A;  1LKX A;  5GPG B;  4A4A A;  4WAB A;  1Y6D A;  3O55 A;  3DKA A;  4HFK B;  3LEV A;  4RBN A;  1C03 A;  1A7D A;  1LI5 A;  2OEX A;  3E70 C;  3K7D A;  1HE9 A;  2IYL D;  2H7V C;  1MMD A;  256B A;  4MTO A;  2NUT A;  3QMK A;  4BJ6 A;  2A1D D;  3GWN A;  4DVZ A;  3UGP A;  3OEO A;  2PNO A;  3DI5 A;  2YLG A;  4LDQ A;  3C62 A;  3TJ5 A;  3POV A;  1FNT c;  2CDQ A;  4MQ9 F;  3HJC A;  3ZC4 A;  5DQT A;  4LAC B;  4AK9 A;  3IPM O;  3TJ6 A;  2HSQ A;  3TD7 A;  3DM5 A;  3PMR A;  3HNL A;  3SYN A;  4NCQ A;  2GA0 A;  5B3S C;  5KYW B;  1NG1 A;  1TQG A;  1E2X A;  1TFK B;  2YL0 A;  3A9C A;  4RDA A;  2XXA B;  2ZXW C;  3CSK A;  4FX5 A;  1OCZ C;  2L6H A;  2HUJ A;  2GAQ A;  4DJ9 A;  5KYU A;  4G7Z F;  3EG9 A;  4XPX A;  1QKR A;  1U0B B;  1R4T A;  5L0D A;  1YYJ A;  4FWV A;  4JEB A;  3LS0 A;  2C04 A;  4YN0 B;  1FFH A;  4XEV A;  1KNY A;  1R5I D;  1SZI A;  4JTA B;  1TWH A;  3EHN A;  1T6Q A;  4MTF A;  5KYY A;  1Z63 A;  4KI2 A;  4QI2 A;  2H8A A;  3VYW A;  4LDK A;  2X0C A;  1V74 B;  4JE9 A;  3JT1 A;  4JUR I;  5DS5 A;  1MMG A;  3UNG C;  3DJU B;  2Y69 C;  4CBE A;  5E3C A;  4FES A;  5L0I A;  2CGE A;  3ZDL A;  3OA1 A;  2JX0 A;  4YWQ A;  2A0B A;  3IQC A;  3L1M A;  5A6B A;  2OJQ A;  4YL0 A;  2IOQ A;  4E7S A;  2BE5 F;  3S29 A;  5L0C A;  1RJ9 A;  4E18 A;  3KH2 A;  2I15 A;  2LFD A;  1T5O A;  3LES A;  4G78 A;  3T6J A;  2MHR A;  2P61 A;  1RCP A;  1RKE A;  3L8J A;  3US6 A;  3M4B A;  3B29 A;  2M4E A;  2W4M A;  3EFO A;  3KYJ A;  1NFO A;  1LI7 A;  5HSW A;  2YL1 A;  4XEK A;  5L3Q A;  2D5R B;  5KYW A;  1GQA A;  1QLE C;  1EA8 A;  1HW1 A;  2AWY A;  3F47 A;  1Y4C A;  1K05 A;  2P7V A;  1XZQ A;  4U5F E;  4AX2 A;  3H2V A;  1D1A A;  2Y3D A;  3ITF A;  5CI8 A;  4BEM J;  4EKW A;  2W4B A;  3UR3 C;  1D1B A;  1Z5Z A;  3HLZ A;  4LDR A;  3NRH A;  2YHS A;  4YK5 A;  4E7Z A;  3LJB A;  5F5H A;  2DB4 A;  3ECS A;  3DE8 A;  2L6F A;  3ZSU A;  3TOM A;  1H7I A;  3T4R A;  1LS1 A;  3J06 A;  4CDV A;  2XM4 A;  4CS9 C;  2EPL X;  4C7O A;  1I4Y A;  1M57 C;  1NU9 C;  1YA9 A;  3N0T A;  3EGD B;  4JTC B;  2A68 F;  2H7B A;  3ASO C;  1BR2 A;  2NUT B;  3GM1 A;  3O10 A;  5L3V A;  3NMI A;  3PCV A;  4CDY A;  1ST6 A;  3QZC A;  3ABK C;  1HW2 A;  3JSE O;  2B0J A;  2XLE A;  4YT8 A;  3EZI A;  3O6X A;  3EJN A;  1VB5 A;  5DQZ A;  2R7X A;  4KBL A;  4C3B A;  1JAF A;  1FAP B;  3L34 A;  1QSP A;  2NUP A;  3ZG1 A;  2J7P A;  2ZXP A;  4OIN F;  3O39 A;  1M2V B;  3AG3 C;  3AQB A;  3C8Z A;  3NYM A;  4XPY A;  2HJM A;  1NSG B;  2QE9 A;  3KKB A;  3FAP B;  1QQ3 A;  3K6B A;  4AL1 A;  4ULV A;  1YDI A;  1DOV A;  2X51 A;  2XRH A;  3G50 A;  1B68 A;  1H9T A;  4KC9 A;  2OQM A;  4AE4 B;  1M56 C;  3T9O A;  3EH1 A;  3NDB B;  3AJM A;  1QZX A;  4CDA A;  2KK1 A;  2P6V A;  4BJ6 C;  5A6A A;  5KYY B;  1A7E A;  2J9B A;  2PFD A;  5T3W A;  1PD1 A;  1ZYR F;  1WAT A;  3DJN B;  3L0I A;  4CX9 A;  1J8Y F;  2ASR A;  2R7S A;  2QUP A;  3JRT A;  3UMI A;  2DYS C;  2ETS A;  2HV7 A;  1M2O A;  1BBH A;  4JCZ A;  4XEF A;  5D92 A;  2ZD9 A;  3T6G B;  1U6H A;  1OKK D;  2XLM A;  3EPV A;  4EHP A;  3IQ5 A;  4YT4 A;  4H4K C;  2KW3 C;  4NC3 A;  3IQ6 A;  4PFP A;  5TJ5 E;  3OWT A;  2L81 A;  4U5E E;  2EIL C;  4BJT A;  3QW0 A;  1JPN A;  2B0H A;  2XL4 A;  3LUT B;  3QTH A;  3EFO B;  4JJF A;  3G4Z A;  3SZR A;  5JS5 A;  2RSE B;  4OIO F;  4MND A;  1AEP A;  1VLS A;  2R7Q A;  4XPW A;  1OW8 A;  2WZG A;  5BUO A;  3WAQ A;  2MYS A;  3Q7G A;  1TR2 A;  2RD9 A;  4JRZ A;  1WOL A;  4P9T A;  5COM A;  3FHD A;  3JCU Q;  4IAQ A;  2J46 A;  2EPO A;  4JEA A;  4IJJ A;  3RIP A;  1CPR A;  5JLI A;  3T6B A;  1OCO C;  1SMY F;  3C7J A;  3FOP A;  4PJN A;  3RF3 A;  5HV9 A;  1Q0D A;  2HMZ A;  5E33 A;  2XLO A;  3K1H A;  4N6H A;  3S28 A;  4A2N B;  1Z7Q c;  2CCY A;  3RQG A;  3HNJ A;  4YT2 A;  1SR2 A;  2J9U A;  4DXW A;  1YVI A;  4DVY P;  4CS8 C;  3JZ0 A;  4JIO A;  4MVS A;  2FGY A;  3W2W A;  1JPJ A;  3C8G B;  2P0N A;  3CZ6 A;  4E0I A;  3U0C A;  4W8K A;  4E0H A;  4MVQ A;  1U89 A;  4J7Y A;  2KNH A;  1O5H A;  3U3F A;  5K0I A;  4ANJ A;  4OIQ F;  4OIR F;  2PF4 E;  3RVZ A;  2FFH A;  1WN0 A;  2Q9A A;  1YJG A;  4J32 B;  5JVE A;  1ZU4 A;  2XS1 A;  2Z15 A;  3MYI A;  1GM5 A;  1TWA A;  1I5N A;  2KGO A;  5FCL A;  4CSA A;  3E9V A;  3CEX A;  1FR0 A;  2M64 A;  3DWW A;  1HMO A;  2R02 A;  2LCH A;  1C02 A;  3F46 A;  3JYH A;  1HY5 A;  4I1O B;  4U9E A;  4JTD B;  2VCA A;  3KPH A;  4KNW A;  3ZTZ A;  1D0X A;  5AC4 A;  4LER A;  2J8W A;  1G8X A;  1OW6 A;  2KSF A;  3R7C A;  1ORS C;  3W2V A;  4DBQ A;  4K0D A;  1KTM A;  3HKK A;  3UGO A;  1CGO A;  1VK5 A;  5KYX A;  4MVU A;  3FDQ A;  4BJ1 A;  4IGG A;  4BEJ A;  3IEE A;  4OD5 A;  3EGX A;  1CPQ A;  4DBR A;  3X1O A;  3GOR A;  3LAY A;  3EH2 A;  1QPU A;  3V7O A;  2YL7 A;  4CS8 A;  1APC A;  3CAX A;  2AVK A;  3RQF A;  4XWJ A;  3ASN C;  1ZHZ A;  4JCH A;  3U9J A;  5B3I A;  1ZHT A;  1HMD A;  1Q0G A;  1OXK A;  1Q0F A;  1OCR C;  1OCC C;  2Q3T A;  3GEI A;  2VCB A;  2ZXR A;  5A6K A;  3V5X A;  2YKZ A;  4U5D E;  3V5Y A;  3DAG A;  1OQC A;  1BDJ B;  5CIV A;  4CIP A;  3M15 A;  2J9V A;  1RXQ A;  2WVQ A;  1ZHY A;  3VRC A;  2R9R B;  2WB7 A;  4QDL A;  2ZPA A;  5JP7 A;  1XZP A;  2YLD A;  1UG7 A;  4IB4 A;  3U3B A;  2A0U A;  3TQO A;  4O79 A;  2R7V A;  2J9W A;  2OG2 A;  3KYI A;  2VAS A;  1JRA A;  4D4N A;  2NSG A;  4EBJ A;  2QY9 A;  3BRJ A;  3QW1 A;  5EHH A;  4WGY A;  3U2L A;  4ZLD A;  1L3P A;  1EI7 A;  5DLJ A;  1CGN A;  3K1I C;  3MX3 A;  3B0V C;  1LIH A;  4H54 A;  4NY3 A;  4EWC A;  1K04 A;  1Q0K A;  2LD6 A;  2L6G A;  2ICW G;  4NTA A;  4U9D A;  3WHN A;  4DRI B;  3RH3 A;  3RVY A;  4YT5 A;  5KYN A;  3K33 A;  3ABM C;  4Z9H A;  4QI0 A;  1TKN A;  3DAF A;  4D4X A;  3IQT A;  4W8P A;  3C63 A;  1H9G A;  4PFO A;  3QVY A;  2NPU A;  1VTM P;  3Q6M A;  1BR4 A;  3B9Q A;  2CNW D;  4MVR A;  3SXK A;  2BC5 A;  3W4Y A;  2DYR C;  2F22 A;  3NMJ A;  1D0Y A;  1LVK A;  2JPU A;  2LFF A;  1V54 C;  2HMQ A;  3IHU A;  1MQV A;  3NMK A;  2XL6 A;  4HEA J;  2P1A A;  3UMH A;  1ZHX A;  1FMW A;  4HFF B;  2DGJ A;  2V26 A;  2HJ3 A;  2YVK A;  5DS4 A;  2G3V A;  2VC9 A;  2XSE A;  3C8G D;  3EG9 B;  4U5H A;  1ORJ A;  1YAU O;  5BQG A;  2AP3 A;  3RKO F;  2CW0 F;  2YLI A;  3NG1 A;  1H6G A;  4YL1 A;  3I5Q A;  3MFN A;  3S9O A;  1YA7 O;  1NBB A;  5B1B C;  2IBF A;  3JYY A;  3K1I A;  2J0W A;  4Q5S F;  4NQF A;  1TWC A;  2HS5 A;  2R03 A;  2XXA A;  1T9K A;  1L7C A;  2JD3 A;  3DE9 A;  3N2Z B;  4I1M A;  4IAR A;  1ZHW A;  4O6N A;  1LE2 A;  3DXJ F;  5EGY A;  4JKV A;  2R7T A;  1BZ4 A;  4IAO A;  3HNK A;  3B71 A;  2CYD A;  2PP4 A;  2UUI A;  3I5P A;  4O7G A;  2EIJ C;  4C3D A;  1ZVZ A;  3AG2 C;  3WOD F;  1RJ9 B;  1OKK A;  4EBK A;  1GS9 A;  2XM0 A;  1RKE B;  1D1C A;  4YJW A;  2IXN A;  5T3T A;  3AGT A;  1SYQ A;  2Q4F A;  2EPK X;  4U5B E;  2OJE D;  2H7O A;  3VAY A;  1M6T A;  3ZTM A;  1LS4 A;  4CS7 A;  4EBB A;  3NYL A;  1A41 A;  1ORY A;  3LLI A;  4O6Y A;  4PJJ A;  2WVO A;  4WJ0 A;  2Q00 A;  3LNR A;  4FAP B;  2YEV A;  2NG1 A;  3G4X A;  4U5C E;  1FMV A;  3M4C A;  4CSA C;  3FOO A;  1O3U A;  3HTK C;  4O6M A;  4EUK B;  5L0J A;  4Q7C A;  2GWW A;  4Q4Z F;  4BG0 A;  3FXH A;  4ER9 A;  3S27 A;  3SNH A;  1OR3 A;  2J0X A;  1MNE A;  3QVZ A;  2XLV A;  3NKE A;  4C7O B;  2UUH A;  3R2P A;  1NZE A;  1ZW3 A;  4LLE A;  1EKY A;  2KQ9 A;  1NU7 D;  2VH3 A;  2WVN A;  2W45 A;  4N6C A;  1OXB A;  1TFO B;  2Y3G A;  3N24 A;  3AG4 C;  4PJM A;  2KYH A;  1YAR O;  2LIG A;  3ZQY A;  2TMV P;  2L7A A;  1VYI A;  5F5F A;  5L0G A;  3Q7L A;  1OW7 A;  1MMN A;  3SEO A;  5COF A;  2Y3H A;  1VYK A;  1T01 A;  3LEO A;  3KL4 A;  2PX0 A;  2Q9B A;  4G7O F;  4E17 A;  5CI9 A;  3EGD A;  1YYX A;  1LM3 B;  3BEH A;  3K66 A;  3U5S A;  2NUP B;  3S90 A;  3U8V A;  2E87 A;  2C03 A;  2D4U A;  3FVY A;  1G4U S;  1C17 M;  3EQL F;  4CJG A;  3NYJ A;  3AQC A;  4U5G A;  5E2Q A;  4DRH B;  3H2U A;  1ZW2 A;  3UMK A;  2HKV A;  4DOZ A;  4OIP F;  5D91 A;  2R7W A;  4PR9 A;  2FAP B;  2AU5 A;  2PX3 A;  4NTF A;  3M1C B;  4BJ5 C;  3ATP A;  4MTG A;  5JUA A;  4XLP F;  2Q9C A;  1A0B A;  3W8H A;  2R7O A;  4L6R A;  4WGZ A;  2WZL A;  3WG7 C;  4N06 A;  1PV3 A;  2QLA A;  3EZH A;  1MMA A;  4B6I A;  4BPM A;  1M2V A;  3CQZ A;  2Q7R A;  4Z9J A;  2L9J A;  1Z23 A;  4ULW A;  3ZQV A;  2W9Y A; 
#chains in the Genus database with same CATH homology
 4U9D A;  4CDA A;  2XLD A;  2J9B A;  1E85 A;  4CX9 A;  4D4X A;  256B A;  3C63 A;  1BBH A;  3QVY A;  5JT4 A;  2XLM A;  2YLG A;  3C62 A;  3IQ5 A;  2BC5 A;  3NMJ A;  5JSL A;  3NMK A;  4NC3 A;  3IQ6 A;  1MQV A;  4N4W A;  2XL6 A;  3M79 A;  3QW0 A;  3HNL A;  5JS5 A;  2YL0 A;  3ZWI A;  2YLI A;  1NBB A;  2XLH A;  4IAQ A;  1YYJ A;  4JEB A;  4JEA A;  1CPR A;  2XLW A;  3DE9 A;  5AGF A;  5JLI A;  4IAR A;  3FOP A;  4JKV A;  3HNK A;  4JE9 A;  2XLO A;  4N6H A;  1YZA A;  2CCY A;  3HNJ A;  2XM0 A;  3L1M A;  3ZTM A;  1M6T A;  1RCP A;  3M4B A;  2YL1 A;  3M4C A;  5JRA A;  3FOO A;  5JVE A;  1GQA A;  1YZC A;  1E83 A;  4ER9 A;  3QVZ A;  2XL8 A;  2XLV A;  4U9E A;  3ZTZ A;  4CJO A;  1EKY A;  2J8W A;  3DE8 A;  1CGO A;  3TOL A;  3TOM A;  3U8P A;  1E84 A;  3ZQY A;  4CDV A;  2XM4 A;  4EIY A;  1CPQ A;  1QPU A;  2YL7 A;  1APC A;  3NMI A;  3HNI A;  4CDY A;  5B3I A;  1YYX A;  1LM3 B;  1A7V A;  2XLE A;  2YKZ A;  4CIP A;  3M15 A;  4CJG A;  1JAF A;  1S05 A;  3VRC A;  5JP7 A;  2YLD A;  4IB4 A;  1E86 A;  5JUA A;  4D4N A;  4L6R A;  4WGZ A;  1QQ3 A;  3QW1 A;  4ULV A;  2QLA A;  4WGY A;  2YL3 A;  1CGN A;  3ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...