3U3FA

Structural basis for the interaction of pyk2 pat domain with paxillin ld motifs
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
TDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 58
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3u3fA00
2KK1A 3C18A 4XEVA 3TULA 3K7DA 1WWPA 1OW8A 4EBJA 1KNYA 1UFBA 3C8GD 2LK4A 3U0CA 1V4AA 1ZZPA 3L8JA 1WOLA 1K04A 3JZ0A 3O10A 3S9OA 2JX0A 1O3UA 2L6HA 4R32A 3U3FA 3GM1A 3MFNA 1WTYA 3JYYA 1JOGA 1K05A 3GM2A 3C8GA 4XEKA 2Q00A 2JPUA 4NQFA 3RQGA 4EBKA 3C8GB 2YWAA 2HSBA 3B71A 3GM3A 3BRJA 1OW6A 3RQEA 2L6GA 1OW7A 2PBEA 1KTMA 3RQFA 1QVXA 3AJMA 3L8IA 2L6FA 1PV3A 5F28E 4XEFA 1K40A
chains in the Genus database with same CATH superfamily
5JT4A 2KK1A 3S90A 2R7WA 2XM0A 1HW1A 4JURI 2OOCA 2IYLD 3T4RA 3M4CA 5KYXA 1I4ZA 2EPMX 2NPUA 1A7EA 2P7VA 3PMRA 4D4NA 5L0DA 4N6CA 1A7VA 4JCZA 4WABA 2J0XA 1Z23A 4AE4B 4CIPA 2UUIA 1YYXA 2ZPAA 3C8ZA 1SR2A 1ORYA 3G4ZA 4XPWA 3WAQA 3I5PA 4Q5SF 2ZXRA 2EIJC 3X1OA 1LE2A 4AL1A 1C02A 2VCCA 4MNDA 4O79A 5L0FA 3DE9A 1K05A 1RKEA 2EPLX 2AVKA 2XL4A 4Z9HA 4C7OA 3M1CB 1H7IA 2WZLA 2J46A 2FAPB 3V5ZA 2L9JA 4RDAA 3AG4C 1TWCA 3TOLA 3E70C 4U5FE 1JAFA 3DKAA 2R25A 3S29A 2CCYA 4W8PA 5COMA 4LERA 1OQCA 3AG3C 1C17M 2UUHA 3MLGA 3DZAA 4IB4A 3AQCA 4DRHB 3K7DA 3U2LA 5FCLA 3VYWA 3W2WA 4YWQA 3PDMP 4MVUA 3LNMB 2IOQA 1L7CA 3LLIA 4MW3A 4U9DA 4AE4A 4ONSA 4U5DE 2AP3A 2YZSA 1O5HA 2J45A 1NU9C 1VMAA 1YARO 2G62A 3QVYA 4X0RA 2OQMA 1EKYA 3LEOA 4A4AA 3QVZA 5JRAA 1VB5A 2XLHA 2GA0A 4YJWA 3ZTMA 4XPYA 4H54A 1KU2A 2YL7A 2YLIA 2HSBA 2Q9CA 2GAQA 2Y69C 2XS8A 1NZEA 3FMSA 3ITFA 3NMIA 3S27A 1TWHA 4GQHA 4CS9A 3DJNB 1OCCC 1ZYRF 3CAXA 4CSAC 2AWCA 4IGGA 3L8IA 1Z6AA 4PJNA 3RH3A 5CIVA 1S7ZA 1Y6DA 2V3CC 4XEFA 4XEVA 4JC7A 4CIHA 4Z9IA 4QI2A 2QUPA 1E85A 2J9BA 5COFA 2IBFA 3NKDA 1C03A 4JTCB 3RVYA 3O10A 1OKKD 4IWBA 1BDJB 2RD9A 1G4WR 4JJFA 1E86A 1Z3IX 3AGTA 2L6HA 4OINF 4NTBA 5TJ5E 5A6BD 2EPNA 2Q7RA 4EBBA 2QY9A 3US6A 3CEXA 4XQ1A 3W8HA 3FOPA 1U89A 2YWAA 2YRFA 1OKKA 3EHNA 3S84A 1LE4A 2TMVP 1FMVA 1JPNA 2R7SA 4G7OF 2YHSA 1LIHA 1G8XA 2I8BA 5A6BA 2DGJA 1LS1A 1LVKA 3KMIA 3PHF2 4OIQF 4C3BA 1BR1A 1MMGA 2HS5A 4KBLA 3UMIA 1XZPA 3HNIA 2LK4A 1JR8A 1ZZPA 1M2OA 3RFYA 2VASA 1QZXA 1YJGA 2X0CA 4ZLCA 3B0PA 1QPUA 4F4BA 2R9RB 3L1MA 1VLSA 1CPQA 1YA9A 3U3FA 1GM5A 3Q7GA 5JP7A 1FFTC 4D4XA 1SYQA 2XLMA 3UGPA 1WTYA 1APCA 1JOGA 1XZQA 2XSEA 4JJGA 3B29A 3U9JA 2Q00A 1D0ZA 4NQFA 256BA 3EZHA 3C8GB 5E3CA 1FR0A 2CW0F 1HE9A 1ZVZA 3BRJA 1V55C 4YK5A 3IQ5A 5EHHA 2HMQA 1M6TA 3FAJA 3M15A 3I5QA 1PD0A 3HLZA 3OEOA 5BQGA 1UG7A 1ZW2A 1LI5A 1MNEA 2XLWA 4NCQA 4YL3A 4BJ6C 4XLPF 4CS7A 3C18A 4HEAJ 2DB4A 5D92A 1BZ4A 4JEAA 1SZIA 4BJ1A 1OW8A 3KYIA 5KYYB 1A0BA 4BPMA 5BQHA 3W4YA 1VLTA 3H2UA 4JZAA 3C8GD 2XL8A 1Q0FA 4CDYA 3QZCA 1L3PA 4KC9A 1WGWA 1I4YA 5L3VA 4BJ6A 3ASOC 1H6GA 3L0IA 3U8PA 5AC5A 1E2XA 3HNLA 3NDBB 3MFNA 3G50A 3O6XA 2NG1A 2WVNA 2ASRA 4JIOA 4YT5A 4YN0B 3SXZA 4BJ5C 2W4MA 3C8GA 1IZMA 2L7AA 3TJ6A 1MMDA 1QLEC 4DOZA 3GM3A 1ORJA 2VB6A 3TOMA 1HY5A 3ZWIA 2R02A 4P9FA 2WZGA 1D1CA 4P6IC 4MTGA 3S28A 4OD4A 2FFHA 4JTAB 4BJ5A 2GDCA 3Q6NA 4JCHA 1VYKA 5KYYA 4XTKA 1VK5A 5L0IA 3X2QC 4DRJB 1CGOA 2A1DD 1GGQA 3ABKC 3KYJA 4C3DA 5K0IA 2XLOA 3ABLC 4UDVA 2A69F 4E0IA 3EGDB 2R7XA 1DOVA 3ASNC 5L0JA 1FAPB 3H65A 4OIRF 1JRAA 1J8YF 4FWVA 3ZG1A 1O3UA 4J7YA 2D5RB 3GM1A 2DI3A 2HZ8A 3A9CA 2A68F 3GWNA 1BBHA 5EK0A 2KGOA 3SEOA 1YAUO 2NUTB 1FMWA 4E7SA 3R7CA 1E83A 2Q3TA 2ETSA 2PX3A 1U6HA 4CBEA 2KJGA 2YQYA 1RKCA 4OIPF 2J9UA 4P9TA 4PFPA 2J9VA 1KTMA 5F5FA 3POVA 2MYSA 3WODF 3TJ5A 4AL0A 1YZAA 3DI5A 1T01A 5BUOA 3M4BA 4JTDB 3TULA 1VTMP 4G7HF 4ER9A 4MTOA 2XLVA 1U0BB 1FFHA 2LD6A 2LP4A 3U3BA 4CS8C 4EKWA 3FXHA 3PCVA 3EGDA 4H4KC 5COGA 3GWLA 2B0HA 1CPRA 4CS9C 1MNDA 3AQBA 2YL3A 1OCOC 3CSKA 2EIKC 4ANJA 2NUTA 1GS9A 3FVYA 3DMDA 2WVQA 3K33A 1TQGA 1YVIA 2ZD9A 2Y3DA 4CS8A 2YEVA 2Y3BA 3HNKA 1Z63A 3E9VA 3ZVRA 2Y3GA 4CX9A 3LEVA 3K1IC 4U5BE 2VC9A 2X51A 2ZXPA 3EHMA 1Q0MA 1R5ID 3FHDA 4LDKA 3JYHA 5DS6A 2I15A 2Z15A 4EIYA 3OWTA 1E84A 1S05A 3DM5A 3HNJA 2G3KA 2XL6A 5CI9A 4G7ZF 3K1IA 4NY3A 2LSEA 1CGME 2KC3A 3R2PA 4CDAA 2A6EF 3JZ0A 2YL0A 3N0TA 4G78A 3TD7A 4DVYP 1GQAA 4MVZA 4HFKB 3FOOA 2IM8A 1DOWA 4IRUA 2M64A 3V5XA 4LDRA 1AEPA 4NTFA 3V5YA 5B3SC 4Q7CA 3NYJA 4OD5A 3B0UX 2C03A 3EH1A 5KYNA 3S0XA 2WVOA 2HV7A 1W2WA 1OR3A 4I3MA 2OEVA 3EZIA 1OW6A 3Q7LA 1RXQA 2VH3A 1OW7A 3U2MA 2ZXOA 5E3AA 1NFNA 2M4EA 3IHUA 1VYIA 2F22A 3K1HA 1AVOB 2P0NA 5HSWA 1G5ZA 4PJLA 5B3IA 4FESA 4CDVA 3SXMA 4JW1A 4EUKB 3UMHA 3EH2A 1MMNA 1Z5ZA 3U0CA 2GWWA 5BQIA 1B68A 2C04A 4DJ9A 3B0VC 4JVSA 3NYLA 4MS2A 1LS4A 2O9XA 3RVZA 2OJQA 3K6BA 3NRHA 4I1MA 3VRCA 1HE1A 3OA1A 3GM2A 4XPXA 3BEHA 3F47A 3UNGC 4J7TA 2W9YA 3N2ZB 5HV9A 1BR4A 2H7VC 2A0BA 2R7OA 5KYWB 5KYUB 1RJ9A 2HJMA 3RQFA 2Q9AA 3ATPA 4E18A 4FAPB 3AG1C 2P6VA 5F28E 3KL4A 3SP1A 3T6GB 1O87A 3MBGA 1WWPA 2CDQA 2QTVA 1M2VB 2KSFA 4I44A 2R7UA 1F1MA 1KNYA 1ZHXA 3M79A 4KNWA 3IQ6A 4IJJA 5E33A 3SXYA 2A6HF 4ULWA 4YT8A 3SXKA 4NC3A 5B1AC 3V7OA 5DQZA 1NG1A 1D1BA 1Y4CA 1MMAA 3MX3A 4K1OA 4O6YA 5DQTA 4NTAA 3KH2A 1PCXA 3AG2C 3DD7A 3GEEA 5IY5C 5L3QA 2RSEB 3FDQA 2KYHA 2NSFA 4CJOA 4XEKA 4YL1A 3JSZA 3EPVA 5KYUA 3B71A 5GPGB 4AX2A 5KYWA 1G4US 1A41A 3RQEA 1QQ3A 5JS5A 1AUEA 1ZHYA 1TWAA 3KKBA 2QNLA 2KW3C 3NG1A 5JUAA 2R7VA 1IW7F 3JRTA 1D1AA 3DAGA 4GEHA 2L6GA 3JCUQ 2IXNA 2OCCC 1M2VA 2WZFA 4MVQA 4U5GA 2J0WA 5T3WA 4O7GA 2Q9BA 3IPMO 2XLDA 4U5HA 5D91A 4HE8D 2HUJA 1WOLA 4RD9A 1V54C 1OCRC 1ZHWA 1NLXA 2W45A 3G4XA 3JRMO 3QTHA 2LQGA 2YLDA 3C63A 4MVOA 3RF3A 4E0HA 5B1BC 4BEMJ 2LFFA 4Q4ZF 2XM4A 3TK0A 3QW1A 2QLAA 3RYLA 3W2VA 3IQCA 3U8VA 1H9GA 2PP4A 5A69A 2YL1A 4N6HA 4N4WA 3C7JA 1ST6A 1M57C 1EQ1A 2XRHA 3T6BA 2BE5F 2E87A 3GANA 1QVXA 3AJMA 1D0YA 4I1OB 1HW2A 4O6NA 3WHNA 2L6FA 3FAPB 1WATA 3HKKA 2HJ3A 4LLEA 3HTKC 2HMZA 3VF0A 3LUTB 2ZXWC 2YKZA 1T6QA 3RW0A 1VOMA 1UFBA 2QE9A 1TFKB 3UGOA 3C62A 3EJNA 1K04A 3T9OA 3H2VA 2D4UA 1N1CA 2LFDA 2R7RA 3S9OA 3RIPA 4MVRA 2CYDA 2Y39A 3UMKA 1LI7A 5E2QA 3JYYA 4J30B 2H7OA 3N24A 4JEBA 3GEIA 4RBNA 3U9MA 2JPUA 1ZW3A 2GFHA 5JLIA 4EHPA 1OR2A 1WN0A 1WASA 4LACB 4DRIB 2J9WA 1EI7A 1PD1A 2J8WA 5FZTA 3AOUA 1HMDA 3B9QA 3LS1A 2MWQA 4DVZA 2OJED 2OEXA 1PV3A 2IXOA 4N06A 3WG7C 1FNTc 3ECSA 1RMVA 5DVWA 5DS4A 4K7BA 1HMOA 1QSPA 4W8KA 4QDLA 2B0JA 4GYTA 1T6IA 4MVSA 1V4AA 2W4BA 2P61A 3LS0A 2JD3A 3Q6MA 5JVEA 1TR2A 3SZRA 1LPEA 1M56C 2ICWG 4R32A 5CI8A 4B6IA 4FX5A 3K66A 4AK9A 1ZHZA 4IAOA 3RKOF 2CNWD 4ZLDA 2VCBA 2BC5A 3DXJF 1JMWA 5T1DB 1RCPA 2EPOA 3KPHA 4PFOA 4YT4A 4KNVA 5AC4A 3DM9B 2NUPB 4LDQA 4WGYA 3HJCA 2CGEA 2R05A 4BEJA 1OCZC 1SMYF 3GEHA 3MYIA 3SNHA 1RJ9B 2WB7A 3ZTZA 2OKUA 1XWJA 2BL2A 2P1AA 2PNOA 2CNWA 2R7QA 2LCHA 3QW0A 2J7PD 3CZ6A 1Q0KA 2G3VA 5DLJA 1LM3B 1SF8A 4QI0A 4J32B 1NFOA 2YLGA 4U9EA 2PF4E 4WJ0A 1ORSC 3O39A 2WL8A 4MQ9F 1YDIA 4OIOF 4CSAA 1MQVA 4C3EA 1NU7D 5L0HA 4IARA 3I4UA 4M63A 5AGFA 4DBQA 2XLEA 1A7DA 3JTLO 3JSEO 1TWGA 2PX0A 1I5NA 2J7PA 3TQOA 2PFDA 3DWWA 3A11A 2Q4FA 1TFOB 2OG2A 3NKEA 3AGUA 2EPKX 3ZIBA 2HFIA 1NBBA 4JKVA 2NUPA 4O6MA 2A0UA 4PJJA 1LKXA 5A6AA 1H9TA 2L81A 2H8AA 3EQLF 3GODA 3LLKA 4K0DA 3ZQVA 1J8MF 4A2NB 3MYFA 4PR9A 2R03A 2EIMC 3DE8A 3ZSUA 3NMKA 2LIGA 2R7TA 3DAFA 1NSGB 1BR2A 3LESA 2HKVA 3EGXB 1YYJA 1Q0GA 4PK4A 3EG9B 4XLNF 1Z7Qc 2DYRC 1T6UA 4EBJA 3LAYA 1JPJA 5T3TA 1T5OA 3NMJA 4MVMA 4YT2A 2JX0A 4DXWA 3GORA 2KQ9A 2H7BA 1ZU4A 1Q0DA 2IXPA 4L6RA 3J06A 3EFOB 3IEEA 2XS1A 1V74B 4CJGA 4MTFA 4EBKA 5EGYA 3RQGA 3U5SA 2EINC 2YVKA 1D0XA 1FTSA 1TKNA 4PACA 3SYNA 4MW8A 1YLMA 4E17A 2PBEA 3VAYA 3DJUB 1YZCA 4U5CE 4WGZA 3LJBA 4BJTA 3CQZA 4YL0A 4Z9JA 2XXAB 4ULVA 5L0CA 5DS5A 1YA7O 1K40A 2OU6A 4U5EE 3EGXA 4DBRA 5A6KA 3EG9A 3NYMA 3W8IA 3JT1A 4E7ZA 2IXMA 2AWYA 2KNHA 1OXBA 5KYXB 2NSGA 3VM6A 3L8JA 3ZQYA 1CGNA 3L34A 1R4TA 4IAQA 2MHRA 3O55A 4LLCA 2Y3HA 2DYSC 1QKRA 4BG0A 2AU5A 4JE9A 1ZHTA 5L0GA 3EFOA 3LNRA 4HFFB 4EWCA 4KI2A 2HSQA 1ZU5A 1T9KA 3F46A 1RKEB 2V26A 4C7OB 3QMKA 3ABMC 3ZC4A 2HV6A 2VCAA 4G0HA 3UR3C 4PJMA 2XXAA 3T6JA 3IQTA 4XWJA 3ZDLA 5JSLA 1OXKA 4JRZA 5F5HA 2EILC 5A6JA 2FGYA 1EA8A
chains in the Genus database with same CATH topology
2KK1A 3C18A 4XEVA 3TULA 3K7DA 1WWPA 1OW8A 4EBJA 1KNYA 1UFBA 3C8GD 2LK4A 3U0CA 1V4AA 1ZZPA 3L8JA 1WOLA 1K04A 3JZ0A 3O10A 3S9OA 2JX0A 1O3UA 2L6HA 4R32A 3U3FA 3GM1A 3MFNA 1WTYA 3JYYA 1JOGA 1K05A 3GM2A 3C8GA 4XEKA 2Q00A 2JPUA 4NQFA 3RQGA 4EBKA 3C8GB 2YWAA 2HSBA 3B71A 3GM3A 3BRJA 1OW6A 3RQEA 2L6GA 1OW7A 2PBEA 1KTMA 3RQFA 1QVXA 3AJMA 3L8IA 2L6FA 1PV3A 5F28E 4XEFA 1K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK1 A;  3C18 A;  4XEV A;  3TUL A;  3K7D A;  1WWP A;  1OW8 A;  4EBJ A;  1KNY A;  1UFB A;  3C8G D;  2LK4 A;  3U0C A;  1V4A A;  1ZZP A;  3L8J A;  1WOL A;  1K04 A;  3JZ0 A;  3O10 A;  3S9O A;  2JX0 A;  1O3U A;  2L6H A;  4R32 A;  3U3F A;  3GM1 A;  3MFN A;  1WTY A;  3JYY A;  1JOG A;  1K05 A;  3GM2 A;  3C8G A;  4XEK A;  2Q00 A;  2JPU A;  4NQF A;  3RQG A;  4EBK A;  3C8G B;  2YWA A;  2HSB A;  3B71 A;  3GM3 A;  3BRJ A;  1OW6 A;  3RQE A;  2L6G A;  1OW7 A;  2PBE A;  1KTM A;  3RQF A;  1QVX A;  3AJM A;  3L8I A;  2L6F A;  1PV3 A;  5F28 E;  4XEF A;  1K40 A; 
#chains in the Genus database with same CATH topology
 5JT4 A;  2KK1 A;  3S90 A;  2R7W A;  2XM0 A;  1HW1 A;  4JUR I;  2OOC A;  2IYL D;  3T4R A;  3M4C A;  5KYX A;  1I4Z A;  2EPM X;  2NPU A;  1A7E A;  2P7V A;  3PMR A;  4D4N A;  5L0D A;  4N6C A;  1A7V A;  4JCZ A;  4WAB A;  2J0X A;  1Z23 A;  4AE4 B;  4CIP A;  2UUI A;  1YYX A;  2ZPA A;  3C8Z A;  1SR2 A;  1ORY A;  3G4Z A;  4XPW A;  3WAQ A;  3I5P A;  4Q5S F;  2ZXR A;  2EIJ C;  3X1O A;  1LE2 A;  4AL1 A;  1C02 A;  2VCC A;  4MND A;  4O79 A;  5L0F A;  3DE9 A;  1K05 A;  1RKE A;  2EPL X;  2AVK A;  2XL4 A;  4Z9H A;  4C7O A;  3M1C B;  1H7I A;  2WZL A;  2J46 A;  2FAP B;  3V5Z A;  2L9J A;  4RDA A;  3AG4 C;  1TWC A;  3TOL A;  3E70 C;  4U5F E;  1JAF A;  3DKA A;  2R25 A;  3S29 A;  2CCY A;  4W8P A;  5COM A;  4LER A;  1OQC A;  3AG3 C;  1C17 M;  2UUH A;  3MLG A;  3DZA A;  4IB4 A;  3AQC A;  4DRH B;  3K7D A;  3U2L A;  5FCL A;  3VYW A;  3W2W A;  4YWQ A;  3PDM P;  4MVU A;  3LNM B;  2IOQ A;  1L7C A;  3LLI A;  4MW3 A;  4U9D A;  4AE4 A;  4ONS A;  4U5D E;  2AP3 A;  2YZS A;  1O5H A;  2J45 A;  1NU9 C;  1VMA A;  1YAR O;  2G62 A;  3QVY A;  4X0R A;  2OQM A;  1EKY A;  3LEO A;  4A4A A;  3QVZ A;  5JRA A;  1VB5 A;  2XLH A;  2GA0 A;  4YJW A;  3ZTM A;  4XPY A;  4H54 A;  1KU2 A;  2YL7 A;  2YLI A;  2HSB A;  2Q9C A;  2GAQ A;  2Y69 C;  2XS8 A;  1NZE A;  3FMS A;  3ITF A;  3NMI A;  3S27 A;  1TWH A;  4GQH A;  4CS9 A;  3DJN B;  1OCC C;  1ZYR F;  3CAX A;  4CSA C;  2AWC A;  4IGG A;  3L8I A;  1Z6A A;  4PJN A;  3RH3 A;  5CIV A;  1S7Z A;  1Y6D A;  2V3C C;  4XEF A;  4XEV A;  4JC7 A;  4CIH A;  4Z9I A;  4QI2 A;  2QUP A;  1E85 A;  2J9B A;  5COF A;  2IBF A;  3NKD A;  1C03 A;  4JTC B;  3RVY A;  3O10 A;  1OKK D;  4IWB A;  1BDJ B;  2RD9 A;  1G4W R;  4JJF A;  1E86 A;  1Z3I X;  3AGT A;  2L6H A;  4OIN F;  4NTB A;  5TJ5 E;  5A6B D;  2EPN A;  2Q7R A;  4EBB A;  2QY9 A;  3US6 A;  3CEX A;  4XQ1 A;  3W8H A;  3FOP A;  1U89 A;  2YWA A;  2YRF A;  1OKK A;  3EHN A;  3S84 A;  1LE4 A;  2TMV P;  1FMV A;  1JPN A;  2R7S A;  4G7O F;  2YHS A;  1LIH A;  1G8X A;  2I8B A;  5A6B A;  2DGJ A;  1LS1 A;  1LVK A;  3KMI A;  3PHF 2;  4OIQ F;  4C3B A;  1BR1 A;  1MMG A;  2HS5 A;  4KBL A;  3UMI A;  1XZP A;  3HNI A;  2LK4 A;  1JR8 A;  1ZZP A;  1M2O A;  3RFY A;  2VAS A;  1QZX A;  1YJG A;  2X0C A;  4ZLC A;  3B0P A;  1QPU A;  4F4B A;  2R9R B;  3L1M A;  1VLS A;  1CPQ A;  1YA9 A;  3U3F A;  1GM5 A;  3Q7G A;  5JP7 A;  1FFT C;  4D4X A;  1SYQ A;  2XLM A;  3UGP A;  1WTY A;  1APC A;  1JOG A;  1XZQ A;  2XSE A;  4JJG A;  3B29 A;  3U9J A;  2Q00 A;  1D0Z A;  4NQF A;  256B A;  3EZH A;  3C8G B;  5E3C A;  1FR0 A;  2CW0 F;  1HE9 A;  1ZVZ A;  3BRJ A;  1V55 C;  4YK5 A;  3IQ5 A;  5EHH A;  2HMQ A;  1M6T A;  3FAJ A;  3M15 A;  3I5Q A;  1PD0 A;  3HLZ A;  3OEO A;  5BQG A;  1UG7 A;  1ZW2 A;  1LI5 A;  1MNE A;  2XLW A;  4NCQ A;  4YL3 A;  4BJ6 C;  4XLP F;  4CS7 A;  3C18 A;  4HEA J;  2DB4 A;  5D92 A;  1BZ4 A;  4JEA A;  1SZI A;  4BJ1 A;  1OW8 A;  3KYI A;  5KYY B;  1A0B A;  4BPM A;  5BQH A;  3W4Y A;  1VLT A;  3H2U A;  4JZA A;  3C8G D;  2XL8 A;  1Q0F A;  4CDY A;  3QZC A;  1L3P A;  4KC9 A;  1WGW A;  1I4Y A;  5L3V A;  4BJ6 A;  3ASO C;  1H6G A;  3L0I A;  3U8P A;  5AC5 A;  1E2X A;  3HNL A;  3NDB B;  3MFN A;  3G50 A;  3O6X A;  2NG1 A;  2WVN A;  2ASR A;  4JIO A;  4YT5 A;  4YN0 B;  3SXZ A;  4BJ5 C;  2W4M A;  3C8G A;  1IZM A;  2L7A A;  3TJ6 A;  1MMD A;  1QLE C;  4DOZ A;  3GM3 A;  1ORJ A;  2VB6 A;  3TOM A;  1HY5 A;  3ZWI A;  2R02 A;  4P9F A;  2WZG A;  1D1C A;  4P6I C;  4MTG A;  3S28 A;  4OD4 A;  2FFH A;  4JTA B;  4BJ5 A;  2GDC A;  3Q6N A;  4JCH A;  1VYK A;  5KYY A;  4XTK A;  1VK5 A;  5L0I A;  3X2Q C;  4DRJ B;  1CGO A;  2A1D D;  1GGQ A;  3ABK C;  3KYJ A;  4C3D A;  5K0I A;  2XLO A;  3ABL C;  4UDV A;  2A69 F;  4E0I A;  3EGD B;  2R7X A;  1DOV A;  3ASN C;  5L0J A;  1FAP B;  3H65 A;  4OIR F;  1JRA A;  1J8Y F;  4FWV A;  3ZG1 A;  1O3U A;  4J7Y A;  2D5R B;  3GM1 A;  2DI3 A;  2HZ8 A;  3A9C A;  2A68 F;  3GWN A;  1BBH A;  5EK0 A;  2KGO A;  3SEO A;  1YAU O;  2NUT B;  1FMW A;  4E7S A;  3R7C A;  1E83 A;  2Q3T A;  2ETS A;  2PX3 A;  1U6H A;  4CBE A;  2KJG A;  2YQY A;  1RKC A;  4OIP F;  2J9U A;  4P9T A;  4PFP A;  2J9V A;  1KTM A;  5F5F A;  3POV A;  2MYS A;  3WOD F;  3TJ5 A;  4AL0 A;  1YZA A;  3DI5 A;  1T01 A;  5BUO A;  3M4B A;  4JTD B;  3TUL A;  1VTM P;  4G7H F;  4ER9 A;  4MTO A;  2XLV A;  1U0B B;  1FFH A;  2LD6 A;  2LP4 A;  3U3B A;  4CS8 C;  4EKW A;  3FXH A;  3PCV A;  3EGD A;  4H4K C;  5COG A;  3GWL A;  2B0H A;  1CPR A;  4CS9 C;  1MND A;  3AQB A;  2YL3 A;  1OCO C;  3CSK A;  2EIK C;  4ANJ A;  2NUT A;  1GS9 A;  3FVY A;  3DMD A;  2WVQ A;  3K33 A;  1TQG A;  1YVI A;  2ZD9 A;  2Y3D A;  4CS8 A;  2YEV A;  2Y3B A;  3HNK A;  1Z63 A;  3E9V A;  3ZVR A;  2Y3G A;  4CX9 A;  3LEV A;  3K1I C;  4U5B E;  2VC9 A;  2X51 A;  2ZXP A;  3EHM A;  1Q0M A;  1R5I D;  3FHD A;  4LDK A;  3JYH A;  5DS6 A;  2I15 A;  2Z15 A;  4EIY A;  3OWT A;  1E84 A;  1S05 A;  3DM5 A;  3HNJ A;  2G3K A;  2XL6 A;  5CI9 A;  4G7Z F;  3K1I A;  4NY3 A;  2LSE A;  1CGM E;  2KC3 A;  3R2P A;  4CDA A;  2A6E F;  3JZ0 A;  2YL0 A;  3N0T A;  4G78 A;  3TD7 A;  4DVY P;  1GQA A;  4MVZ A;  4HFK B;  3FOO A;  2IM8 A;  1DOW A;  4IRU A;  2M64 A;  3V5X A;  4LDR A;  1AEP A;  4NTF A;  3V5Y A;  5B3S C;  4Q7C A;  3NYJ A;  4OD5 A;  3B0U X;  2C03 A;  3EH1 A;  5KYN A;  3S0X A;  2WVO A;  2HV7 A;  1W2W A;  1OR3 A;  4I3M A;  2OEV A;  3EZI A;  1OW6 A;  3Q7L A;  1RXQ A;  2VH3 A;  1OW7 A;  3U2M A;  2ZXO A;  5E3A A;  1NFN A;  2M4E A;  3IHU A;  1VYI A;  2F22 A;  3K1H A;  1AVO B;  2P0N A;  5HSW A;  1G5Z A;  4PJL A;  5B3I A;  4FES A;  4CDV A;  3SXM A;  4JW1 A;  4EUK B;  3UMH A;  3EH2 A;  1MMN A;  1Z5Z A;  3U0C A;  2GWW A;  5BQI A;  1B68 A;  2C04 A;  4DJ9 A;  3B0V C;  4JVS A;  3NYL A;  4MS2 A;  1LS4 A;  2O9X A;  3RVZ A;  2OJQ A;  3K6B A;  3NRH A;  4I1M A;  3VRC A;  1HE1 A;  3OA1 A;  3GM2 A;  4XPX A;  3BEH A;  3F47 A;  3UNG C;  4J7T A;  2W9Y A;  3N2Z B;  5HV9 A;  1BR4 A;  2H7V C;  2A0B A;  2R7O A;  5KYW B;  5KYU B;  1RJ9 A;  2HJM A;  3RQF A;  2Q9A A;  3ATP A;  4E18 A;  4FAP B;  3AG1 C;  2P6V A;  5F28 E;  3KL4 A;  3SP1 A;  3T6G B;  1O87 A;  3MBG A;  1WWP A;  2CDQ A;  2QTV A;  1M2V B;  2KSF A;  4I44 A;  2R7U A;  1F1M A;  1KNY A;  1ZHX A;  3M79 A;  4KNW A;  3IQ6 A;  4IJJ A;  5E33 A;  3SXY A;  2A6H F;  4ULW A;  4YT8 A;  3SXK A;  4NC3 A;  5B1A C;  3V7O A;  5DQZ A;  1NG1 A;  1D1B A;  1Y4C A;  1MMA A;  3MX3 A;  4K1O A;  4O6Y A;  5DQT A;  4NTA A;  3KH2 A;  1PCX A;  3AG2 C;  3DD7 A;  3GEE A;  5IY5 C;  5L3Q A;  2RSE B;  3FDQ A;  2KYH A;  2NSF A;  4CJO A;  4XEK A;  4YL1 A;  3JSZ A;  3EPV A;  5KYU A;  3B71 A;  5GPG B;  4AX2 A;  5KYW A;  1G4U S;  1A41 A;  3RQE A;  1QQ3 A;  5JS5 A;  1AUE A;  1ZHY A;  1TWA A;  3KKB A;  2QNL A;  2KW3 C;  3NG1 A;  5JUA A;  2R7V A;  1IW7 F;  3JRT A;  1D1A A;  3DAG A;  4GEH A;  2L6G A;  3JCU Q;  2IXN A;  2OCC C;  1M2V A;  2WZF A;  4MVQ A;  4U5G A;  2J0W A;  5T3W A;  4O7G A;  2Q9B A;  3IPM O;  2XLD A;  4U5H A;  5D91 A;  4HE8 D;  2HUJ A;  1WOL A;  4RD9 A;  1V54 C;  1OCR C;  1ZHW A;  1NLX A;  2W45 A;  3G4X A;  3JRM O;  3QTH A;  2LQG A;  2YLD A;  3C63 A;  4MVO A;  3RF3 A;  4E0H A;  5B1B C;  4BEM J;  2LFF A;  4Q4Z F;  2XM4 A;  3TK0 A;  3QW1 A;  2QLA A;  3RYL A;  3W2V A;  3IQC A;  3U8V A;  1H9G A;  2PP4 A;  5A69 A;  2YL1 A;  4N6H A;  4N4W A;  3C7J A;  1ST6 A;  1M57 C;  1EQ1 A;  2XRH A;  3T6B A;  2BE5 F;  2E87 A;  3GAN A;  1QVX A;  3AJM A;  1D0Y A;  4I1O B;  1HW2 A;  4O6N A;  3WHN A;  2L6F A;  3FAP B;  1WAT A;  3HKK A;  2HJ3 A;  4LLE A;  3HTK C;  2HMZ A;  3VF0 A;  3LUT B;  2ZXW C;  2YKZ A;  1T6Q A;  3RW0 A;  1VOM A;  1UFB A;  2QE9 A;  1TFK B;  3UGO A;  3C62 A;  3EJN A;  1K04 A;  3T9O A;  3H2V A;  2D4U A;  1N1C A;  2LFD A;  2R7R A;  3S9O A;  3RIP A;  4MVR A;  2CYD A;  2Y39 A;  3UMK A;  1LI7 A;  5E2Q A;  3JYY A;  4J30 B;  2H7O A;  3N24 A;  4JEB A;  3GEI A;  4RBN A;  3U9M A;  2JPU A;  1ZW3 A;  2GFH A;  5JLI A;  4EHP A;  1OR2 A;  1WN0 A;  1WAS A;  4LAC B;  4DRI B;  2J9W A;  1EI7 A;  1PD1 A;  2J8W A;  5FZT A;  3AOU A;  1HMD A;  3B9Q A;  3LS1 A;  2MWQ A;  4DVZ A;  2OJE D;  2OEX A;  1PV3 A;  2IXO A;  4N06 A;  3WG7 C;  1FNT c;  3ECS A;  1RMV A;  5DVW A;  5DS4 A;  4K7B A;  1HMO A;  1QSP A;  4W8K A;  4QDL A;  2B0J A;  4GYT A;  1T6I A;  4MVS A;  1V4A A;  2W4B A;  2P61 A;  3LS0 A;  2JD3 A;  3Q6M A;  5JVE A;  1TR2 A;  3SZR A;  1LPE A;  1M56 C;  2ICW G;  4R32 A;  5CI8 A;  4B6I A;  4FX5 A;  3K66 A;  4AK9 A;  1ZHZ A;  4IAO A;  3RKO F;  2CNW D;  4ZLD A;  2VCB A;  2BC5 A;  3DXJ F;  1JMW A;  5T1D B;  1RCP A;  2EPO A;  3KPH A;  4PFO A;  4YT4 A;  4KNV A;  5AC4 A;  3DM9 B;  2NUP B;  4LDQ A;  4WGY A;  3HJC A;  2CGE A;  2R05 A;  4BEJ A;  1OCZ C;  1SMY F;  3GEH A;  3MYI A;  3SNH A;  1RJ9 B;  2WB7 A;  3ZTZ A;  2OKU A;  1XWJ A;  2BL2 A;  2P1A A;  2PNO A;  2CNW A;  2R7Q A;  2LCH A;  3QW0 A;  2J7P D;  3CZ6 A;  1Q0K A;  2G3V A;  5DLJ A;  1LM3 B;  1SF8 A;  4QI0 A;  4J32 B;  1NFO A;  2YLG A;  4U9E A;  2PF4 E;  4WJ0 A;  1ORS C;  3O39 A;  2WL8 A;  4MQ9 F;  1YDI A;  4OIO F;  4CSA A;  1MQV A;  4C3E A;  1NU7 D;  5L0H A;  4IAR A;  3I4U A;  4M63 A;  5AGF A;  4DBQ A;  2XLE A;  1A7D A;  3JTL O;  3JSE O;  1TWG A;  2PX0 A;  1I5N A;  2J7P A;  3TQO A;  2PFD A;  3DWW A;  3A11 A;  2Q4F A;  1TFO B;  2OG2 A;  3NKE A;  3AGU A;  2EPK X;  3ZIB A;  2HFI A;  1NBB A;  4JKV A;  2NUP A;  4O6M A;  2A0U A;  4PJJ A;  1LKX A;  5A6A A;  1H9T A;  2L81 A;  2H8A A;  3EQL F;  3GOD A;  3LLK A;  4K0D A;  3ZQV A;  1J8M F;  4A2N B;  3MYF A;  4PR9 A;  2R03 A;  2EIM C;  3DE8 A;  3ZSU A;  3NMK A;  2LIG A;  2R7T A;  3DAF A;  1NSG B;  1BR2 A;  3LES A;  2HKV A;  3EGX B;  1YYJ A;  1Q0G A;  4PK4 A;  3EG9 B;  4XLN F;  1Z7Q c;  2DYR C;  1T6U A;  4EBJ A;  3LAY A;  1JPJ A;  5T3T A;  1T5O A;  3NMJ A;  4MVM A;  4YT2 A;  2JX0 A;  4DXW A;  3GOR A;  2KQ9 A;  2H7B A;  1ZU4 A;  1Q0D A;  2IXP A;  4L6R A;  3J06 A;  3EFO B;  3IEE A;  2XS1 A;  1V74 B;  4CJG A;  4MTF A;  4EBK A;  5EGY A;  3RQG A;  3U5S A;  2EIN C;  2YVK A;  1D0X A;  1FTS A;  1TKN A;  4PAC A;  3SYN A;  4MW8 A;  1YLM A;  4E17 A;  2PBE A;  3VAY A;  3DJU B;  1YZC A;  4U5C E;  4WGZ A;  3LJB A;  4BJT A;  3CQZ A;  4YL0 A;  4Z9J A;  2XXA B;  4ULV A;  5L0C A;  5DS5 A;  1YA7 O;  1K40 A;  2OU6 A;  4U5E E;  3EGX A;  4DBR A;  5A6K A;  3EG9 A;  3NYM A;  3W8I A;  3JT1 A;  4E7Z A;  2IXM A;  2AWY A;  2KNH A;  1OXB A;  5KYX B;  2NSG A;  3VM6 A;  3L8J A;  3ZQY A;  1CGN A;  3L34 A;  1R4T A;  4IAQ A;  2MHR A;  3O55 A;  4LLC A;  2Y3H A;  2DYS C;  1QKR A;  4BG0 A;  2AU5 A;  4JE9 A;  1ZHT A;  5L0G A;  3EFO A;  3LNR A;  4HFF B;  4EWC A;  4KI2 A;  2HSQ A;  1ZU5 A;  1T9K A;  3F46 A;  1RKE B;  2V26 A;  4C7O B;  3QMK A;  3ABM C;  3ZC4 A;  2HV6 A;  2VCA A;  4G0H A;  3UR3 C;  4PJM A;  2XXA A;  3T6J A;  3IQT A;  4XWJ A;  3ZDL A;  5JSL A;  1OXK A;  4JRZ A;  5F5H A;  2EIL C;  5A6J A;  2FGY A;  1EA8 A; 
#chains in the Genus database with same CATH homology
 2KK1 A;  3C18 A;  4XEV A;  3TUL A;  3K7D A;  1WWP A;  1OW8 A;  4EBJ A;  1KNY A;  1UFB A;  3C8G D;  2LK4 A;  3U0C A;  1V4A A;  1ZZP A;  3L8J A;  1WOL A;  1K04 A;  3JZ0 A;  3O10 A;  3S9O A;  2JX0 A;  1O3U A;  2L6H A;  4R32 A;  3U3F A;  3GM1 A;  3MFN A;  1WTY A;  3JYY A;  1JOG A;  1K05 A;  3GM2 A;  3C8G A;  4XEK A;  2Q00 A;  2JPU A;  4NQF A;  3RQG A;  4EBK A;  3C8G B;  2YWA A;  2HSB A;  3B71 A;  3GM3 A;  3BRJ A;  1OW6 A;  3RQE A;  2L6G A;  1OW7 A;  2PBE A;  1KTM A;  3RQF A;  1QVX A;  3AJM A;  3L8I A;  2L6F A;  1PV3 A;  5F28 E;  4XEF A;  1K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...