3U3FA

Structural basis for the interaction of pyk2 pat domain with paxillin ld motifs
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
130
structure length
130
Chain Sequence
TDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural and Mechanistic Insights into the Interaction between Pyk2 and Paxillin LD Motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3u3fA00
1OW6A 1PV3A 2JX0A 1WOLA 2L6HA 3GM2A 3L8JA 2L6GA 1WTYA 3AJMA 2Q00A 3U3FA 3S9OA 4XEVA 4EBJA 2JPUA 3RQGA 3B71A 4XEFA 4NQFA 1OW8A 3U0CA 2HSBA 1WWPA 3C8GB 1V4AA 1KNYA 2LK4A 3O10A 4XEKA 5F28E 1KTMA 2PBEA 2KK1A 1ZZPA 2L6FA 1K05A 1K04A 3L8IA 1JOGA 2YWAA 3GM3A 3GM1A 3MFNA 3C8GD 3TULA 3JZ0A 4R32A 1OW7A 1UFBA 1K40A 3K7DA 3RQEA 3C18A 3BRJA 3JYYA 1QVXA 3RQFA 1O3UA 4EBKA 3C8GA
chains in the Genus database with same CATH superfamily
4U5HA 5D91A 1RJ9A 2H7BA 5KYXB 3T6GB 2QTVA 3L8JA 2DI3A 3HNIA 4D4XA 2P6VA 1TWGA 2LQGA 1EI7A 3AQBA 3M15A 2PFDA 4Z9JA 5L0JA 3KYJA 3K33A 2ZXOA 1ORJA 3LAYA 2CGEA 5AC5A 4JIOA 1FAPB 2KJGA 4JVSA 3ZTZA 1E86A 3ZWIA 1KTMA 1C03A 4IAQA 1ZZPA 3M79A 4BJTA 4M63A 4NTAA 2R7VA 2XLVA 1JMWA 1HMOA 1YDIA 2G3VA 1R5ID 1C17M 2PX3A 2YRFA 4PJLA 1A7EA 2IBFA 2WVQA 3DAFA 1ZHYA 3FOPA 3KYIA 4LLCA 3NKEA 1D1AA 4C3BA 4U9EA 3FOOA 2H8AA 1UG7A 2H7OA 4XEVA 3RVYA 1S7ZA 2GA0A 3GANA 1PD0A 1VK5A 5L0GA 3I4UA 2O9XA 1NFOA 1VB5A 4O79A 3DMDA 3WHNA 3CEXA 1NG1A 1L7CA 2EINC 2B0HA 2Q4FA 5E3CA 4OIOF 3VYWA 1YVIA 1O87A 4IWBA 3LS1A 2XXAA 3LNRA 4HFKB 2IOQA 1J8MF 4KBLA 2ZXRA 2LK4A 2A68F 1TFKB 4JCZA 3AGUA 1QSPA 4MVUA 3PHF2 1IZMA 2QUPA 1A0BA 1K04A 1T6UA 2FAPB 3QW0A 2ASRA 1M6TA 3DAGA 3NRHA 3MX3A 3O6XA 4XPWA 1ZU5A 2QY9A 1OW7A 1WGWA 4MTOA 1SMYF 3QW1A 4N4WA 1EQ1A 1QVXA 1GQAA 2YKZA 2CW0F 4JTAB 1YYXA 1HW1A 4EBKA 4UDVA 1GGQA 1AEPA 3UR3C 3S0XA 4LERA 2BC5A 4JE9A 2ETSA 2MYSA 2L6HA 1T01A 1D1BA 2B0JA 4PJNA 5JLIA 1SF8A 1BDJB 2HKVA 3RF3A 3U9JA 4O6YA 1JPNA 5EHHA 3ASOC 3HLZA 3RQGA 4FWVA 3M1CB 5KYYA 5DLJA 4JRZA 4N6HA 3B0VC 1GS9A 4JKVA 2EPKX 2J0XA 2UUHA 3IHUA 4A2NB 1W2WA 2Y3GA 4DRIB 2R7TA 1HW2A 1CPQA 4U9DA 2KGOA 4EIYA 3S84A 3IQ6A 2HJ3A 1RXQA 4C3EA 2L9JA 5IY5C 1RKEA 1I5NA 2PNOA 3NYLA 3US6A 4PK4A 2VB6A 5TJ5E 1R4TA 1ST6A 3GEEA 5A6JA 3V5XA 2HSQA 3NMJA 2R7XA 2C04A 2HFIA 3B9QA 4E0IA 2HJMA 2EIKC 2ICWG 3HNJA 2AP3A 4U5EE 3JYHA 2R7UA 3RKOF 4MVRA 1VLSA 5DQTA 1JAFA 3KPHA 2DYRC 1WTYA 3ZQVA 2WVOA 3O39A 1A41A 1Y4CA 3S9OA 3EH1A 5BQHA 2WZFA 4XEFA 5KYYB 3KH2A 4O6MA 4YL3A 3OEOA 1Q0KA 4E0HA 4Z9IA 5AC4A 3EFOA 1G4US 2GWWA 1YA9A 4HEAJ 1LIHA 4QI0A 4XQ1A 3TK0A 2AU5A 4MTGA 3KL4A 1RKEB 4MVOA 4IRUA 4AK9A 4RD9A 1S05A 5BQIA 3I5QA 1OCOC 3RH3A 4OD5A 3ITFA 1OXKA 4BG0A 4B6IA 4U5GA 4PJJA 5BQGA 4PACA 1ZHZA 3HNKA 5KYXA 2YVKA 2XRHA 3CSKA 4FX5A 1TWHA 2NSFA 3AG1C 5L3QA 2Q9BA 1D1CA 1YJGA 1T6IA 2J9WA 4KC9A 3ABLC 3ZC4A 4ZLCA 2XM0A 5T3WA 4MQ9F 3TOLA 2P0NA 3U3BA 3GORA 3ATPA 4P6IC 1AUEA 4LDQA 4E17A 1MNEA 4BJ5A 3SP1A 3NMIA 4G7ZF 3J06A 2W45A 2G62A 3EFOB 2KYHA 4CS9A 2I8BA 1WN0A 2BE5F 3LLKA 4CDVA 1GM5A 2OEXA 1OCCC 2OCCC 1CGME 1NZEA 4G0HA 5COMA 3K7DA 3RW0A 5COFA 3DWWA 5T3TA 4BJ6C 1SZIA 3EGXB 4NTFA 1HMDA 2ZXWC 4H54A 3C63A 4ONSA 4CS7A 1PD1A 1VYIA 2L81A 4CJGA 3V5YA 3W8IA 5JP7A 2L6GA 1ZHTA 4YK5A 3GWNA 1LVKA 2YEVA 3K66A 1O5HA 1RMVA 3HTKC 4EBJA 4JEAA 1F1MA 2D4UA 1L3PA 3W2VA 1V4AA 5L0IA 3F46A 4RDAA 5DS6A 1T9KA 2J8WA 3GEHA 1U6HA 4XLPF 1CGNA 3UNGC 5B3SC 2JD3A 2H7VC 3C7JA 3MFNA 4K1OA 2CDQA 3LLIA 3LEVA 3U8PA 3R2PA 3JYYA 5A6KA 2PF4E 1RKCA 1Y6DA 2L7AA 1VMAA 2XLOA 3C8GB 3OWTA 2YZSA 4CSAA 3CAXA 1OW6A 1WOLA 3UMHA 1RCPA 1TFOB 1HE9A 2KC3A 3LNMB 2J7PA 3E9VA 4MS2A 2EIMC 5DS4A 3FDQA 2GDCA 1BR1A 1Q0DA 2UUIA 2ZPAA 4DRJB 2JPUA 1YZCA 2HV7A 1B68A 2EPOA 3ZDLA 4CS8A 3R7CA 4DXWA 2YL7A 1V74B 3U0CA 3FAPB 3DE9A 4I44A 1MMGA 1ZU4A 2NPUA 5B1AC 3U5SA 3O10A 2EPMX 1J8YF 1Z5ZA 2PBEA 4HFFB 5E3AA 2CNWA 1NFNA 1TR2A 2QNLA 2R03A 4F4BA 1ORSC 2F22A 5KYWA 4U5DE 1OXBA 2GFHA 3L34A 256BA 3N24A 3SNHA 1OCRC 3JTLO 3B0PA 3LS0A 4BPMA 2J9UA 2Y69C 1LE2A 1NU7D 3BRJA 4FESA 4GQHA 5E2QA 3B0UX 1OR2A 1ZYRF 3UGPA 3GWLA 3N2ZB 3AOUA 4YN0B 3LUTB 1TKNA 3G4ZA 1VLTA 5E33A 2AWCA 4ZLDA 4PFOA 5BUOA 2R05A 3F47A 3PMRA 3B29A 1D0XA 1MNDA 2CNWD 5L0DA 2E87A 3BEHA 5L0FA 2EPLX 3NKDA 3N0TA 3U8VA 3W4YA 3LEOA 4G7HF 4HE8D 1Z7Qc 4E7SA 4J7YA 3DE8A 3LESA 4I1OB 5JUAA 2KW3C 2NG1A 1JPJA 1M2VA 1HY5A 5KYWB 4WGZA 1JRAA 4A4AA 3A9CA 3DI5A 4DBQA 4YT2A 2HMZA 4CSAC 2R7OA 2DB4A 2J46A 3K1HA 4H4KC 1KU2A 3TOMA 1MQVA 4NTBA 1FR0A 1VTMP 4Q5SF 1ORYA 1SYQA 4XPYA 5T1DB 4ULWA 1Q0GA 1TWAA 4MVZA 3DJUB 2HS5A 2KNHA 3PCVA 1A7VA 2AWYA 3UMIA 3M4BA 1D0ZA 4NC3A 4DBRA 1FTSA 3FXHA 4JZAA 2FFHA 2DGJA 3IPMO 4EHPA 3UGOA 3WG7C 3GM1A 1M2VB 2VCBA 5EGYA 5D92A 2AVKA 2ZXPA 3IQTA 4R32A 1ZHWA 3HNLA 4CDYA 2LIGA 2VC9A 3RQEA 2XLHA 3EHNA 4J30B 3QZCA 3NYMA 1YLMA 3EGXA 1O3UA 1BBHA 1Z3IX 2XL6A 3DM5A 3RVZA 2X51A 4CX9A 2LCHA 3HKKA 3Q6NA 1EKYA 5GPGB 1C02A 4CIPA 2G3KA 1E84A 2Z15A 4N6CA 4XWJA 2YLGA 4DRHB 1XZPA 2J9VA 5B1BC 2J45A 2HUJA 3AQCA 2X0CA 4E7ZA 5K0IA 4NQFA 3MYIA 1NU9C 2OOCA 2VASA 5L3VA 2R7RA 2OJED 1NBBA 3Q7LA 4Q7CA 1I4ZA 1YAUO 2LD6A 1H9GA 2KK1A 2NUPA 3EGDA 3DKAA 3IQ5A 3AG4C 3S28A 1K05A 3EPVA 3SYNA 1H6GA 1XWJA 5CI8A 3SXMA 4JC7A 2LFFA 3SZRA 1TQGA 3EHMA 1UFBA 1VOMA 5DQZA 1OKKA 5EK0A 4EUKB 4W8KA 4IARA 4BJ1A 4YL1A 4CIHA 2R7SA 3C8GA 2KSFA 3T6JA 1QKRA 4YL0A 1SR2A 2OG2A 3GM2A 1U89A 4IJJA 1VYKA 3U9MA 2XLDA 2OKUA 2A0UA 4U5FE 3U3FA 2D5RB 2WZLA 2LP4A 4J7TA 4AE4B 2HMQA 4OIPF 1OW8A 5KYUB 2HSBA 3NDBB 3O55A 3ECSA 3JSZA 1OKKD 2DYSC 2IXOA 3EGDB 3QVYA 4W8PA 3DJNB 2NUPB 3WAQA 1LE4A 1ZVZA 2YWAA 3LJBA 2Q9AA 4KNVA 1FNTc 1CGOA 2Q9CA 2YHSA 3C8GD 3FAJA 4JW1A 3EZIA 4O6NA 4KNWA 4E18A 2HV6A 4ULVA 2IXNA 3K1IA 4IAOA 2LFDA 3C18A 3OA1A 1FFTC 2XLMA 3S29A 5JS5A 4D4NA 1NSGB 2OU6A 3NMKA 1U0BB 3C8ZA 5JRAA 2OEVA 5COGA 1FMWA 3S90A 3FHDA 2A69F 1JR8A 3EQLF 3JT1A 4U5CE 5HSWA 4OIRF 5A6BA 5F5HA 3X1OA 3ABKC 3DD7A 1AVOB 4YT8A 4MVMA 2W4BA 2NUTB 1MMNA 3H65A 3JCUQ 4MW8A 5AGFA 4BJ5C 1E83A 1ZW3A 4DVZA 4P9TA 3U2MA 4EKWA 4YJWA 2FGYA 4CS9C 1I4YA 1E85A 1M2OA 5A6AA 2VH3A 3MBGA 4OD4A 3EH2A 3RIPA 2R7QA 2XLEA 1FMVA 3L0IA 1FFHA 3JRMO 4GYTA 2J0WA 1LPEA 3FVYA 3M4CA 4OINF 4JCHA 3ABMC 4ER9A 3SEOA 2WVNA 1QPUA 5B3IA 1Z23A 4I3MA 3G50A 2YLIA 2P1AA 2J7PD 1RJ9B 2YLDA 4Z9HA 4CBEA 4EBBA 1PV3A 1G5ZA 3IEEA 4DOZA 2R25A 3AG3C 4Q4ZF 4MVQA 2NSGA 2IXMA 4GEHA 4XPXA 3T4RA 5L0HA 5KYNA 5CI9A 2V26A 3KMIA 5DVWA 4JJFA 3RFYA 3TJ6A 4LDRA 1YZAA 1DOWA 4K7BA 4IGGA 4OIQF 3DZAA 1MMDA 3FMSA 2RSEB 4LACB 1HE1A 1KNYA 3E70C 3L1MA 4YWQA 1LI5A 4PR9A 1YARO 1Z6AA 2WB7A 5F28E 3RYLA 1PCXA 5JVEA 1H9TA 2P61A 3H2UA 5DS5A 2Y3HA 3GM3A 4I1MA 2M64A 2PP4A 2A1DD 4RBNA 2IM8A 3SXZA 3K1IC 1V54C 3EJNA 2TMVP 4PFPA 4JTDB 4C7OA 2Y39A 3UMKA 1E2XA 2J9BA 3RQFA 1V55C 3HJCA 4DJ9A 3W8HA 3CQZA 4IB4A 4XTKA 1BR4A 2ZD9A 2PX0A 1Q0MA 3ZG1A 5JT4A 1M56C 4G7OF 1LKXA 3PDMP 1QZXA 2M4EA 3DXJF 4MTFA 5A6BD 3AJMA 2QE9A 3Q6MA 1Z63A 1WASA 4NY3A 3U2LA 2V3CC 3JSEO 2A6HF 4PJMA 4CS8C 2Y3DA 2R7WA 2XXAB 4DVYP 2BL2A 4LLEA 3MLGA 1QLEC 3EG9A 1MMAA 4WGYA 3ZVRA 3ZQYA 3W2WA 1OCZC 4XEKA 3H2VA 2VCAA 3ASNC 3S27A 2L6FA 4YT5A 3QMKA 4L6RA 4ANJA 3DM9B 1JOGA 1LI7A 1BZ4A 1YYJA 1IW7F 2W9YA 4X0RA 1ZW2A 2KQ9A 4CJOA 3NG1A 3TULA 1TWCA 3POVA 3V7OA 1BR2A 2IXPA 4C7OB 3VRCA 4BJ6A 3EZHA 4K0DA 2EPNA 2LSEA 5A69A 2VCCA 2IYLD 4JURI 3ZSUA 5HV9A 3TD7A 1M57C 1WATA 2A6EF 3V5ZA 3WODF 3VAYA 4AL1A 2HZ8A 4MVSA 2QLAA 3VM6A 4FAPB 1A7DA 2P7VA 3CZ6A 1YA7O 3MYFA 1H7IA 2XM4A 3QVZA 4BEMJ 4EWCA 4AE4A 3AG2C 3AGTA 4NCQA 3TQOA 3GODA 2YQYA 1APCA 3GEIA 5KYUA 3NYJA 3EG9B 2CYDA 4AX2A 1QQ3A 4J32B 1LS1A 1XZQA 4U5BE 4KI2A 3G4XA 3C62A 3IQCA 3JRTA 5F5FA 4LDKA 1LM3B 3T6BA 1G4WR 5JSLA 2R9RB 1T6QA 5CIVA 4C3DA 2XL4A 2OJQA 2Q7RA 2XS1A 4N06A 1DOVA 4WABA 5L0CA 3K6BA 2MHRA 2Q00A 4MW3A 2XLWA 2JX0A 2EIJC 1OQCA 2YL0A 2W4MA 4MNDA 2WZGA 2YL3A 1Q0FA 4YT4A 2R02A 2I15A 4QI2A 3KKBA 2GAQA 3QTHA 4JEBA 3SXYA 1CPRA 5FZTA 4G78A 3A11A 3B71A 1N1CA 3Q7GA 3TJ5A 4P9FA 2Q3TA 2NUTA 2XL8A 1OR3A 1WWPA 4O7GA 1NLXA 4CDAA 2Y3BA 3X2QC 4BEJA 2XS8A 2XSEA 4WJ0A 3T9OA 1D0YA 2YL1A 3L8IA 2A0BA 1T5OA 2OQMA 1G8XA 3I5PA 4JTCB 1LS4A 3JZ0A 4QDLA 4XLNF 2RD9A 1K40A 2C03A 2CCYA 1ZHXA 2WL8A 4JJGA 1EA8A 2MWQA 4AL0A 3SXKA 3VF0A 3ZIBA 2EILC 5FCLA 3ZTMA
chains in the Genus database with same CATH topology
1OW6A 1PV3A 2JX0A 1WOLA 2L6HA 3GM2A 3L8JA 2L6GA 1WTYA 3AJMA 2Q00A 3U3FA 3S9OA 4XEVA 4EBJA 2JPUA 3RQGA 3B71A 4XEFA 4NQFA 1OW8A 3U0CA 2HSBA 1WWPA 3C8GB 1V4AA 1KNYA 2LK4A 3O10A 4XEKA 5F28E 1KTMA 2PBEA 2KK1A 1ZZPA 2L6FA 1K05A 1K04A 3L8IA 1JOGA 2YWAA 3GM3A 3GM1A 3MFNA 3C8GD 3TULA 3JZ0A 4R32A 1OW7A 1UFBA 1K40A 3K7DA 3RQEA 3C18A 3BRJA 3JYYA 1QVXA 3RQFA 1O3UA 4EBKA 3C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW6 A;  1PV3 A;  2JX0 A;  1WOL A;  2L6H A;  3GM2 A;  3L8J A;  2L6G A;  1WTY A;  3AJM A;  2Q00 A;  3U3F A;  3S9O A;  4XEV A;  4EBJ A;  2JPU A;  3RQG A;  3B71 A;  4XEF A;  4NQF A;  1OW8 A;  3U0C A;  2HSB A;  1WWP A;  3C8G B;  1V4A A;  1KNY A;  2LK4 A;  3O10 A;  4XEK A;  5F28 E;  1KTM A;  2PBE A;  2KK1 A;  1ZZP A;  2L6F A;  1K05 A;  1K04 A;  3L8I A;  1JOG A;  2YWA A;  3GM3 A;  3GM1 A;  3MFN A;  3C8G D;  3TUL A;  3JZ0 A;  4R32 A;  1OW7 A;  1UFB A;  1K40 A;  3K7D A;  3RQE A;  3C18 A;  3BRJ A;  3JYY A;  1QVX A;  3RQF A;  1O3U A;  4EBK A;  3C8G A; 
#chains in the Genus database with same CATH topology
 4U5H A;  5D91 A;  1RJ9 A;  2H7B A;  5KYX B;  3T6G B;  2QTV A;  3L8J A;  2DI3 A;  3HNI A;  4D4X A;  2P6V A;  1TWG A;  2LQG A;  1EI7 A;  3AQB A;  3M15 A;  2PFD A;  4Z9J A;  5L0J A;  3KYJ A;  3K33 A;  2ZXO A;  1ORJ A;  3LAY A;  2CGE A;  5AC5 A;  4JIO A;  1FAP B;  2KJG A;  4JVS A;  3ZTZ A;  1E86 A;  3ZWI A;  1KTM A;  1C03 A;  4IAQ A;  1ZZP A;  3M79 A;  4BJT A;  4M63 A;  4NTA A;  2R7V A;  2XLV A;  1JMW A;  1HMO A;  1YDI A;  2G3V A;  1R5I D;  1C17 M;  2PX3 A;  2YRF A;  4PJL A;  1A7E A;  2IBF A;  2WVQ A;  3DAF A;  1ZHY A;  3FOP A;  3KYI A;  4LLC A;  3NKE A;  1D1A A;  4C3B A;  4U9E A;  3FOO A;  2H8A A;  1UG7 A;  2H7O A;  4XEV A;  3RVY A;  1S7Z A;  2GA0 A;  3GAN A;  1PD0 A;  1VK5 A;  5L0G A;  3I4U A;  2O9X A;  1NFO A;  1VB5 A;  4O79 A;  3DMD A;  3WHN A;  3CEX A;  1NG1 A;  1L7C A;  2EIN C;  2B0H A;  2Q4F A;  5E3C A;  4OIO F;  3VYW A;  1YVI A;  1O87 A;  4IWB A;  3LS1 A;  2XXA A;  3LNR A;  4HFK B;  2IOQ A;  1J8M F;  4KBL A;  2ZXR A;  2LK4 A;  2A68 F;  1TFK B;  4JCZ A;  3AGU A;  1QSP A;  4MVU A;  3PHF 2;  1IZM A;  2QUP A;  1A0B A;  1K04 A;  1T6U A;  2FAP B;  3QW0 A;  2ASR A;  1M6T A;  3DAG A;  3NRH A;  3MX3 A;  3O6X A;  4XPW A;  1ZU5 A;  2QY9 A;  1OW7 A;  1WGW A;  4MTO A;  1SMY F;  3QW1 A;  4N4W A;  1EQ1 A;  1QVX A;  1GQA A;  2YKZ A;  2CW0 F;  4JTA B;  1YYX A;  1HW1 A;  4EBK A;  4UDV A;  1GGQ A;  1AEP A;  3UR3 C;  3S0X A;  4LER A;  2BC5 A;  4JE9 A;  2ETS A;  2MYS A;  2L6H A;  1T01 A;  1D1B A;  2B0J A;  4PJN A;  5JLI A;  1SF8 A;  1BDJ B;  2HKV A;  3RF3 A;  3U9J A;  4O6Y A;  1JPN A;  5EHH A;  3ASO C;  3HLZ A;  3RQG A;  4FWV A;  3M1C B;  5KYY A;  5DLJ A;  4JRZ A;  4N6H A;  3B0V C;  1GS9 A;  4JKV A;  2EPK X;  2J0X A;  2UUH A;  3IHU A;  4A2N B;  1W2W A;  2Y3G A;  4DRI B;  2R7T A;  1HW2 A;  1CPQ A;  4U9D A;  2KGO A;  4EIY A;  3S84 A;  3IQ6 A;  2HJ3 A;  1RXQ A;  4C3E A;  2L9J A;  5IY5 C;  1RKE A;  1I5N A;  2PNO A;  3NYL A;  3US6 A;  4PK4 A;  2VB6 A;  5TJ5 E;  1R4T A;  1ST6 A;  3GEE A;  5A6J A;  3V5X A;  2HSQ A;  3NMJ A;  2R7X A;  2C04 A;  2HFI A;  3B9Q A;  4E0I A;  2HJM A;  2EIK C;  2ICW G;  3HNJ A;  2AP3 A;  4U5E E;  3JYH A;  2R7U A;  3RKO F;  4MVR A;  1VLS A;  5DQT A;  1JAF A;  3KPH A;  2DYR C;  1WTY A;  3ZQV A;  2WVO A;  3O39 A;  1A41 A;  1Y4C A;  3S9O A;  3EH1 A;  5BQH A;  2WZF A;  4XEF A;  5KYY B;  3KH2 A;  4O6M A;  4YL3 A;  3OEO A;  1Q0K A;  4E0H A;  4Z9I A;  5AC4 A;  3EFO A;  1G4U S;  2GWW A;  1YA9 A;  4HEA J;  1LIH A;  4QI0 A;  4XQ1 A;  3TK0 A;  2AU5 A;  4MTG A;  3KL4 A;  1RKE B;  4MVO A;  4IRU A;  4AK9 A;  4RD9 A;  1S05 A;  5BQI A;  3I5Q A;  1OCO C;  3RH3 A;  4OD5 A;  3ITF A;  1OXK A;  4BG0 A;  4B6I A;  4U5G A;  4PJJ A;  5BQG A;  4PAC A;  1ZHZ A;  3HNK A;  5KYX A;  2YVK A;  2XRH A;  3CSK A;  4FX5 A;  1TWH A;  2NSF A;  3AG1 C;  5L3Q A;  2Q9B A;  1D1C A;  1YJG A;  1T6I A;  2J9W A;  4KC9 A;  3ABL C;  3ZC4 A;  4ZLC A;  2XM0 A;  5T3W A;  4MQ9 F;  3TOL A;  2P0N A;  3U3B A;  3GOR A;  3ATP A;  4P6I C;  1AUE A;  4LDQ A;  4E17 A;  1MNE A;  4BJ5 A;  3SP1 A;  3NMI A;  4G7Z F;  3J06 A;  2W45 A;  2G62 A;  3EFO B;  2KYH A;  4CS9 A;  2I8B A;  1WN0 A;  2BE5 F;  3LLK A;  4CDV A;  1GM5 A;  2OEX A;  1OCC C;  2OCC C;  1CGM E;  1NZE A;  4G0H A;  5COM A;  3K7D A;  3RW0 A;  5COF A;  3DWW A;  5T3T A;  4BJ6 C;  1SZI A;  3EGX B;  4NTF A;  1HMD A;  2ZXW C;  4H54 A;  3C63 A;  4ONS A;  4CS7 A;  1PD1 A;  1VYI A;  2L81 A;  4CJG A;  3V5Y A;  3W8I A;  5JP7 A;  2L6G A;  1ZHT A;  4YK5 A;  3GWN A;  1LVK A;  2YEV A;  3K66 A;  1O5H A;  1RMV A;  3HTK C;  4EBJ A;  4JEA A;  1F1M A;  2D4U A;  1L3P A;  3W2V A;  1V4A A;  5L0I A;  3F46 A;  4RDA A;  5DS6 A;  1T9K A;  2J8W A;  3GEH A;  1U6H A;  4XLP F;  1CGN A;  3UNG C;  5B3S C;  2JD3 A;  2H7V C;  3C7J A;  3MFN A;  4K1O A;  2CDQ A;  3LLI A;  3LEV A;  3U8P A;  3R2P A;  3JYY A;  5A6K A;  2PF4 E;  1RKC A;  1Y6D A;  2L7A A;  1VMA A;  2XLO A;  3C8G B;  3OWT A;  2YZS A;  4CSA A;  3CAX A;  1OW6 A;  1WOL A;  3UMH A;  1RCP A;  1TFO B;  1HE9 A;  2KC3 A;  3LNM B;  2J7P A;  3E9V A;  4MS2 A;  2EIM C;  5DS4 A;  3FDQ A;  2GDC A;  1BR1 A;  1Q0D A;  2UUI A;  2ZPA A;  4DRJ B;  2JPU A;  1YZC A;  2HV7 A;  1B68 A;  2EPO A;  3ZDL A;  4CS8 A;  3R7C A;  4DXW A;  2YL7 A;  1V74 B;  3U0C A;  3FAP B;  3DE9 A;  4I44 A;  1MMG A;  1ZU4 A;  2NPU A;  5B1A C;  3U5S A;  3O10 A;  2EPM X;  1J8Y F;  1Z5Z A;  2PBE A;  4HFF B;  5E3A A;  2CNW A;  1NFN A;  1TR2 A;  2QNL A;  2R03 A;  4F4B A;  1ORS C;  2F22 A;  5KYW A;  4U5D E;  1OXB A;  2GFH A;  3L34 A;  256B A;  3N24 A;  3SNH A;  1OCR C;  3JTL O;  3B0P A;  3LS0 A;  4BPM A;  2J9U A;  2Y69 C;  1LE2 A;  1NU7 D;  3BRJ A;  4FES A;  4GQH A;  5E2Q A;  3B0U X;  1OR2 A;  1ZYR F;  3UGP A;  3GWL A;  3N2Z B;  3AOU A;  4YN0 B;  3LUT B;  1TKN A;  3G4Z A;  1VLT A;  5E33 A;  2AWC A;  4ZLD A;  4PFO A;  5BUO A;  2R05 A;  3F47 A;  3PMR A;  3B29 A;  1D0X A;  1MND A;  2CNW D;  5L0D A;  2E87 A;  3BEH A;  5L0F A;  2EPL X;  3NKD A;  3N0T A;  3U8V A;  3W4Y A;  3LEO A;  4G7H F;  4HE8 D;  1Z7Q c;  4E7S A;  4J7Y A;  3DE8 A;  3LES A;  4I1O B;  5JUA A;  2KW3 C;  2NG1 A;  1JPJ A;  1M2V A;  1HY5 A;  5KYW B;  4WGZ A;  1JRA A;  4A4A A;  3A9C A;  3DI5 A;  4DBQ A;  4YT2 A;  2HMZ A;  4CSA C;  2R7O A;  2DB4 A;  2J46 A;  3K1H A;  4H4K C;  1KU2 A;  3TOM A;  1MQV A;  4NTB A;  1FR0 A;  1VTM P;  4Q5S F;  1ORY A;  1SYQ A;  4XPY A;  5T1D B;  4ULW A;  1Q0G A;  1TWA A;  4MVZ A;  3DJU B;  2HS5 A;  2KNH A;  3PCV A;  1A7V A;  2AWY A;  3UMI A;  3M4B A;  1D0Z A;  4NC3 A;  4DBR A;  1FTS A;  3FXH A;  4JZA A;  2FFH A;  2DGJ A;  3IPM O;  4EHP A;  3UGO A;  3WG7 C;  3GM1 A;  1M2V B;  2VCB A;  5EGY A;  5D92 A;  2AVK A;  2ZXP A;  3IQT A;  4R32 A;  1ZHW A;  3HNL A;  4CDY A;  2LIG A;  2VC9 A;  3RQE A;  2XLH A;  3EHN A;  4J30 B;  3QZC A;  3NYM A;  1YLM A;  3EGX A;  1O3U A;  1BBH A;  1Z3I X;  2XL6 A;  3DM5 A;  3RVZ A;  2X51 A;  4CX9 A;  2LCH A;  3HKK A;  3Q6N A;  1EKY A;  5GPG B;  1C02 A;  4CIP A;  2G3K A;  1E84 A;  2Z15 A;  4N6C A;  4XWJ A;  2YLG A;  4DRH B;  1XZP A;  2J9V A;  5B1B C;  2J45 A;  2HUJ A;  3AQC A;  2X0C A;  4E7Z A;  5K0I A;  4NQF A;  3MYI A;  1NU9 C;  2OOC A;  2VAS A;  5L3V A;  2R7R A;  2OJE D;  1NBB A;  3Q7L A;  4Q7C A;  1I4Z A;  1YAU O;  2LD6 A;  1H9G A;  2KK1 A;  2NUP A;  3EGD A;  3DKA A;  3IQ5 A;  3AG4 C;  3S28 A;  1K05 A;  3EPV A;  3SYN A;  1H6G A;  1XWJ A;  5CI8 A;  3SXM A;  4JC7 A;  2LFF A;  3SZR A;  1TQG A;  3EHM A;  1UFB A;  1VOM A;  5DQZ A;  1OKK A;  5EK0 A;  4EUK B;  4W8K A;  4IAR A;  4BJ1 A;  4YL1 A;  4CIH A;  2R7S A;  3C8G A;  2KSF A;  3T6J A;  1QKR A;  4YL0 A;  1SR2 A;  2OG2 A;  3GM2 A;  1U89 A;  4IJJ A;  1VYK A;  3U9M A;  2XLD A;  2OKU A;  2A0U A;  4U5F E;  3U3F A;  2D5R B;  2WZL A;  2LP4 A;  4J7T A;  4AE4 B;  2HMQ A;  4OIP F;  1OW8 A;  5KYU B;  2HSB A;  3NDB B;  3O55 A;  3ECS A;  3JSZ A;  1OKK D;  2DYS C;  2IXO A;  3EGD B;  3QVY A;  4W8P A;  3DJN B;  2NUP B;  3WAQ A;  1LE4 A;  1ZVZ A;  2YWA A;  3LJB A;  2Q9A A;  4KNV A;  1FNT c;  1CGO A;  2Q9C A;  2YHS A;  3C8G D;  3FAJ A;  4JW1 A;  3EZI A;  4O6N A;  4KNW A;  4E18 A;  2HV6 A;  4ULV A;  2IXN A;  3K1I A;  4IAO A;  2LFD A;  3C18 A;  3OA1 A;  1FFT C;  2XLM A;  3S29 A;  5JS5 A;  4D4N A;  1NSG B;  2OU6 A;  3NMK A;  1U0B B;  3C8Z A;  5JRA A;  2OEV A;  5COG A;  1FMW A;  3S90 A;  3FHD A;  2A69 F;  1JR8 A;  3EQL F;  3JT1 A;  4U5C E;  5HSW A;  4OIR F;  5A6B A;  5F5H A;  3X1O A;  3ABK C;  3DD7 A;  1AVO B;  4YT8 A;  4MVM A;  2W4B A;  2NUT B;  1MMN A;  3H65 A;  3JCU Q;  4MW8 A;  5AGF A;  4BJ5 C;  1E83 A;  1ZW3 A;  4DVZ A;  4P9T A;  3U2M A;  4EKW A;  4YJW A;  2FGY A;  4CS9 C;  1I4Y A;  1E85 A;  1M2O A;  5A6A A;  2VH3 A;  3MBG A;  4OD4 A;  3EH2 A;  3RIP A;  2R7Q A;  2XLE A;  1FMV A;  3L0I A;  1FFH A;  3JRM O;  4GYT A;  2J0W A;  1LPE A;  3FVY A;  3M4C A;  4OIN F;  4JCH A;  3ABM C;  4ER9 A;  3SEO A;  2WVN A;  1QPU A;  5B3I A;  1Z23 A;  4I3M A;  3G50 A;  2YLI A;  2P1A A;  2J7P D;  1RJ9 B;  2YLD A;  4Z9H A;  4CBE A;  4EBB A;  1PV3 A;  1G5Z A;  3IEE A;  4DOZ A;  2R25 A;  3AG3 C;  4Q4Z F;  4MVQ A;  2NSG A;  2IXM A;  4GEH A;  4XPX A;  3T4R A;  5L0H A;  5KYN A;  5CI9 A;  2V26 A;  3KMI A;  5DVW A;  4JJF A;  3RFY A;  3TJ6 A;  4LDR A;  1YZA A;  1DOW A;  4K7B A;  4IGG A;  4OIQ F;  3DZA A;  1MMD A;  3FMS A;  2RSE B;  4LAC B;  1HE1 A;  1KNY A;  3E70 C;  3L1M A;  4YWQ A;  1LI5 A;  4PR9 A;  1YAR O;  1Z6A A;  2WB7 A;  5F28 E;  3RYL A;  1PCX A;  5JVE A;  1H9T A;  2P61 A;  3H2U A;  5DS5 A;  2Y3H A;  3GM3 A;  4I1M A;  2M64 A;  2PP4 A;  2A1D D;  4RBN A;  2IM8 A;  3SXZ A;  3K1I C;  1V54 C;  3EJN A;  2TMV P;  4PFP A;  4JTD B;  4C7O A;  2Y39 A;  3UMK A;  1E2X A;  2J9B A;  3RQF A;  1V55 C;  3HJC A;  4DJ9 A;  3W8H A;  3CQZ A;  4IB4 A;  4XTK A;  1BR4 A;  2ZD9 A;  2PX0 A;  1Q0M A;  3ZG1 A;  5JT4 A;  1M56 C;  4G7O F;  1LKX A;  3PDM P;  1QZX A;  2M4E A;  3DXJ F;  4MTF A;  5A6B D;  3AJM A;  2QE9 A;  3Q6M A;  1Z63 A;  1WAS A;  4NY3 A;  3U2L A;  2V3C C;  3JSE O;  2A6H F;  4PJM A;  4CS8 C;  2Y3D A;  2R7W A;  2XXA B;  4DVY P;  2BL2 A;  4LLE A;  3MLG A;  1QLE C;  3EG9 A;  1MMA A;  4WGY A;  3ZVR A;  3ZQY A;  3W2W A;  1OCZ C;  4XEK A;  3H2V A;  2VCA A;  3ASN C;  3S27 A;  2L6F A;  4YT5 A;  3QMK A;  4L6R A;  4ANJ A;  3DM9 B;  1JOG A;  1LI7 A;  1BZ4 A;  1YYJ A;  1IW7 F;  2W9Y A;  4X0R A;  1ZW2 A;  2KQ9 A;  4CJO A;  3NG1 A;  3TUL A;  1TWC A;  3POV A;  3V7O A;  1BR2 A;  2IXP A;  4C7O B;  3VRC A;  4BJ6 A;  3EZH A;  4K0D A;  2EPN A;  2LSE A;  5A69 A;  2VCC A;  2IYL D;  4JUR I;  3ZSU A;  5HV9 A;  3TD7 A;  1M57 C;  1WAT A;  2A6E F;  3V5Z A;  3WOD F;  3VAY A;  4AL1 A;  2HZ8 A;  4MVS A;  2QLA A;  3VM6 A;  4FAP B;  1A7D A;  2P7V A;  3CZ6 A;  1YA7 O;  3MYF A;  1H7I A;  2XM4 A;  3QVZ A;  4BEM J;  4EWC A;  4AE4 A;  3AG2 C;  3AGT A;  4NCQ A;  3TQO A;  3GOD A;  2YQY A;  1APC A;  3GEI A;  5KYU A;  3NYJ A;  3EG9 B;  2CYD A;  4AX2 A;  1QQ3 A;  4J32 B;  1LS1 A;  1XZQ A;  4U5B E;  4KI2 A;  3G4X A;  3C62 A;  3IQC A;  3JRT A;  5F5F A;  4LDK A;  1LM3 B;  3T6B A;  1G4W R;  5JSL A;  2R9R B;  1T6Q A;  5CIV A;  4C3D A;  2XL4 A;  2OJQ A;  2Q7R A;  2XS1 A;  4N06 A;  1DOV A;  4WAB A;  5L0C A;  3K6B A;  2MHR A;  2Q00 A;  4MW3 A;  2XLW A;  2JX0 A;  2EIJ C;  1OQC A;  2YL0 A;  2W4M A;  4MND A;  2WZG A;  2YL3 A;  1Q0F A;  4YT4 A;  2R02 A;  2I15 A;  4QI2 A;  3KKB A;  2GAQ A;  3QTH A;  4JEB A;  3SXY A;  1CPR A;  5FZT A;  4G78 A;  3A11 A;  3B71 A;  1N1C A;  3Q7G A;  3TJ5 A;  4P9F A;  2Q3T A;  2NUT A;  2XL8 A;  1OR3 A;  1WWP A;  4O7G A;  1NLX A;  4CDA A;  2Y3B A;  3X2Q C;  4BEJ A;  2XS8 A;  2XSE A;  4WJ0 A;  3T9O A;  1D0Y A;  2YL1 A;  3L8I A;  2A0B A;  1T5O A;  2OQM A;  1G8X A;  3I5P A;  4JTC B;  1LS4 A;  3JZ0 A;  4QDL A;  4XLN F;  2RD9 A;  1K40 A;  2C03 A;  2CCY A;  1ZHX A;  2WL8 A;  4JJG A;  1EA8 A;  2MWQ A;  4AL0 A;  3SXK A;  3VF0 A;  3ZIB A;  2EIL C;  5FCL A;  3ZTM A; 
#chains in the Genus database with same CATH homology
 1OW6 A;  1PV3 A;  2JX0 A;  1WOL A;  2L6H A;  3GM2 A;  3L8J A;  2L6G A;  1WTY A;  3AJM A;  2Q00 A;  3U3F A;  3S9O A;  4XEV A;  4EBJ A;  2JPU A;  3RQG A;  3B71 A;  4XEF A;  4NQF A;  1OW8 A;  3U0C A;  2HSB A;  1WWP A;  3C8G B;  1V4A A;  1KNY A;  2LK4 A;  3O10 A;  4XEK A;  5F28 E;  1KTM A;  2PBE A;  2KK1 A;  1ZZP A;  2L6F A;  1K05 A;  1K04 A;  3L8I A;  1JOG A;  2YWA A;  3GM3 A;  3GM1 A;  3MFN A;  3C8G D;  3TUL A;  3JZ0 A;  4R32 A;  1OW7 A;  1UFB A;  1K40 A;  3K7D A;  3RQE A;  3C18 A;  3BRJ A;  3JYY A;  1QVX A;  3RQF A;  1O3U A;  4EBK A;  3C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...