4Z9IA

Asp-tars from e. coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
164
structure length
164
Chain Sequence
LFFSSLHHSQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 71
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9iA00
1JMWA 2ASRA 4H54A 4Z9HA 1WASA 3T9OA 1LIHA 4Z9IA 1WATA 4Z9JA 2LIGA 3ATPA 1VLTA 2D4UA 1VLSA
chains in the Genus database with same CATH superfamily
1J8MF 2PNOA 3M4BA 1WTYA 4Z9JA 3NKDA 3KYIA 3V7OA 1Q0FA 5F5FA 4XQ1A 3N24A 3U8PA 4KNVA 2YQYA 2FAPB 4EIYA 1KTMA 2P6VA 3QTHA 4XTKA 3PDMP 3AGTA 2YL1A 5KYXB 3SXZA 5T3WA 2HSBA 1FMWA 1MMAA 3EZHA 2A6EF 1SZIA 5KYUA 2KSFA 5L3QA 3UMIA 2WZFA 3B29A 3I4UA 1VTMP 1ORSC 4IRUA 5BQIA 4GQHA 1BBHA 4G7OF 4RDAA 4L6RA 3HNIA 1U6HA 2ZXWC 3I5PA 3JT1A 1AUEA 2DYRC 3CSKA 1DOVA 1TWCA 2YLIA 2ZXRA 3QVYA 3TJ6A 3FOPA 3WG7C 3RQGA 2A0UA 4D4NA 4U5HA 5JS5A 2HS5A 4OIPF 1Z23A 3MFNA 1S05A 4MW3A 5D91A 1R5ID 3HNLA 3OA1A 3POVA 1O87A 2LIGA 3K1IC 1TWAA 4HE8D 4OIRF 3LUTB 4CS9A 1ZZPA 2HV7A 1TQGA 1Y6DA 2EPLX 2LP4A 3H2UA 1OXKA 2YZSA 3DE9A 4PR9A 1H7IA 2CYDA 3T4RA 3TOLA 4CS7A 5CIVA 3O10A 4J7TA 5JLIA 1PD0A 2DB4A 2OEVA 1OW7A 2AVKA 1BR2A 2XLEA 3U8VA 1EI7A 1U0BB 3FDQA 3PMRA 3X1OA 4JVSA 4MW8A 4CDAA 2M64A 1RMVA 1G4US 2NUPA 3NMIA 1E83A 2Q9AA 3K33A 4AL0A 3C18A 1A41A 3C8GD 2OQMA 2F22A 3C62A 1E2XA 3SEOA 3VF0A 4CJOA 5L0JA 5BQHA 3U9MA 1VLSA 2J0XA 3Q6NA 4UDVA 3EGXA 5HSWA 3Q6MA 3UMKA 1NZEA 2CCYA 3ZSUA 3FAJA 4HFKB 2NUPB 2CNWD 1ZW2A 4R32A 2YL7A 3SZRA 2XL4A 1EKYA 2EPNA 3CQZA 2AU5A 4KC9A 5DQTA 5IY5C 5DS5A 5E3CA 4MVRA 4AL1A 1WN0A 4WGYA 3W4YA 2C04A 4BJ6C 4YWQA 3US6A 4DOZA 3GODA 3T6GB 1K40A 1N1CA 1RXQA 2R25A 5T1DB 4BJ6A 1GM5A 4XEFA 4F4BA 4DJ9A 4DBRA 5HV9A 2XLVA 2NSFA 3O6XA 4XWJA 5KYWA 2VC9A 1BZ4A 2J7PA 2LSEA 2C03A 4G7ZF 2HJ3A 3OEOA 5EHHA 2IM8A 2JPUA 5L0FA 1HE1A 4CIPA 4XEKA 4C7OA 1JMWA 3X2QC 4MVSA 4JJFA 2A1DD 4RD9A 3DKAA 3KYJA 3I5QA 4U5EE 5T3TA 1QQ3A 1A7EA 1Y4CA 1LS4A 2OJQA 5DQZA 3LEVA 1WATA 4RBNA 5A6BD 4P6IC 4GYTA 3DJNB 3FAPB 4C7OB 1Q0KA 1A0BA 3EFOA 4JIOA 1V74B 4A2NB 3GEIA 1OW8A 4LERA 2W45A 2H7OA 1W2WA 3TD7A 3O55A 4P9FA 3EGDB 3UMHA 2CW0F 3FOOA 3BRJA 3R7CA 1D1BA 3EG9A 3TK0A 2R7VA 3L0IA 1YZAA 4JE9A 4XEVA 4NTFA 3GWNA 1CPRA 1LE2A 4IWBA 2R7RA 2PX3A 3RVZA 4DVYP 1YLMA 2CDQA 1G5ZA 4PJJA 1S7ZA 3LNMB 4EBBA 3MYFA 1LKXA 3Q7LA 1VMAA 3GWLA 4MVZA 3S9OA 2P0NA 3HLZA 2H7VC 4G78A 1T6UA 3ZTZA 4CS8A 4CSAC 5B1AC 2CGEA 4MS2A 4U5CE 3U5SA 1E85A 4DRIB 2V26A 1FR0A 2RD9A 4U5DE 3RW0A 4CSAA 4JTDB 1ORYA 1Z7Qc 2PFDA 2ICWG 5KYYB 1OQCA 3ZWIA 3DZAA 256BA 3ZVRA 4JCHA 2Y3DA 1TFKB 2DGJA 2L6FA 2YHSA 2QE9A 1RJ9A 4JKVA 3W8IA 4P9TA 3W8HA 1K05A 2Q00A 4K1OA 4LDQA 3T6BA 2Q7RA 3DXJF 1MMNA 1VYIA 2Q9BA 1TWHA 2A0BA 3EJNA 2R7UA 2NSGA 4LACB 1RJ9B 1ZW3A 2I15A 3CAXA 4KBLA 3ASNC 5E2QA 1RCPA 4CBEA 3EHNA 2ZPAA 4AX2A 3ZG1A 2NUTB 1E86A 1YYJA 2VCBA 1YDIA 5K0IA 5KYYA 4YT5A 1ZVZA 3M15A 2R7SA 1ZHTA 2A68F 2VH3A 1CGNA 3FVYA 1C03A 4NQFA 1IZMA 3UNGC 5L0IA 2E87A 2Y69C 1T01A 3ASOC 3DE8A 3B0VC 1NBBA 2WZLA 1F1MA 4LDKA 4XLPF 2VCCA 4MTFA 3H2VA 4CDVA 4C3BA 2IOQA 2XLDA 4OD5A 3RF3A 3SNHA 2HJMA 1YZCA 1T6QA 1Z3IX 2FGYA 2J8WA 4JEAA 3W2VA 1WASA 1H6GA 4U9DA 3TULA 2H8AA 2HUJA 2VCAA 3KMIA 4DXWA 1XZPA 1G8XA 1VLTA 4E17A 3C7JA 3ABMC 1YARO 4A4AA 1GQAA 1NLXA 3TJ5A 1ZHXA 3EZIA 3JYHA 3K1IA 4JJGA 2H7BA 4Q7CA 3UR3C 2HFIA 3AQCA 1T6IA 1LM3B 1VOMA 3TOMA 3GEHA 4WGZA 2I8BA 3DWWA 3C8ZA 3LS1A 2Z15A 1JOGA 3T9OA 1M2OA 2IBFA 2OG2A 3JSZA 1MQVA 1OKKA 3V5ZA 3ZC4A 3ZQYA 2W9YA 4U5BE 1L7CA 1C02A 1M56C 1GS9A 3C8GA 2JD3A 2XLMA 1ST6A 2GAQA 1OCOC 1OCRC 2XS8A 1ORJA 4YJWA 5E33A 3RKOF 3GORA 4IJJA 2NPUA 2WVQA 2YWAA 1SF8A 4ER9A 4YT4A 4AE4B 3U9JA 3DI5A 3GM2A 1YYXA 3FMSA 5EGYA 2CNWA 1XZQA 2WVOA 3M4CA 4O6YA 4K0DA 1OW6A 3C8GB 4NTBA 1MMDA 4IARA 5CI8A 2IXOA 1KU2A 2YL3A 2J0WA 2YLDA 4N06A 5COMA 1LS1A 4CJGA 3LESA 3JRMO 3VM6A 3ZIBA 4JEBA 1TWGA 3LAYA 3O39A 1QSPA 1U89A 3AG2C 3JCUQ 3S29A 4BEMJ 1B68A 1NFOA 2YVKA 4NTAA 3AG3C 4I3MA 4MVQA 5F5HA 5A69A 3SXYA 2NG1A 2R7OA 4EBJA 5L0CA 2ZD9A 2L9JA 3ZQVA 2J9UA 2XL6A 1YA9A 1C17M 3CZ6A 2YRFA 4XLNF 1YVIA 4XPWA 4OINF 2MHRA 3NRHA 5A6AA 2X51A 2A6HF 2QTVA 2LK4A 2VASA 3NMKA 4X0RA 4HFFB 2G62A 4CIHA 2GDCA 2X0CA 2L7AA 4U5FE 2R7QA 2KQ9A 5JRAA 4M63A 3V5YA 4O6MA 4ONSA 5JSLA 3VYWA 2EIKC 2EPKX 2LCHA 2OJED 3A9CA 3LNRA 4JURI 4W8PA 4ANJA 3F47A 2J45A 3KKBA 3U3FA 1QVXA 2J46A 4YT8A 2PF4E 3S0XA 3EGDA 3L8IA 5BQGA 3RH3A 2BL2A 3JSEO 5TJ5E 4DRHB 4XPYA 3DJUB 4EWCA 4MNDA 4IAOA 3DM5A 4I1OB 3DMDA 1RKCA 1NU9C 2VB6A 1I5NA 1FFHA 1OR3A 1ZU4A 4I44A 3JTLO 1A7DA 4MVUA 3LLKA 1O3UA 2PBEA 4PK4A 3GM1A 4FWVA 2J7PD 5CI9A 2LQGA 2B0HA 3F46A 4WABA 2L81A 2XSEA 4FX5A 4Z9HA 3U2LA 4DVZA 3T6JA 1HY5A 1HW2A 2ETSA 4MVOA 2Y3HA 1V4AA 1OCZC 3IHUA 2KNHA 5JP7A 2QLAA 3WAQA 1EQ1A 1JR8A 2BC5A 2EINC 2D4UA 3G4XA 3MX3A 3NYLA 3U2MA 1Q0GA 4ZLDA 3L34A 1XWJA 3K1HA 1Z5ZA 4EKWA 3ECSA 2OU6A 4JRZA 4JZAA 3ATPA 1SR2A 1PD1A 2IYLD 2YL0A 3M1CB 2XLWA 3E9VA 4PJLA 1G4WR 2M4EA 3FXHA 2L6HA 1TFOB 4C3DA 2LFFA 5EK0A 1EA8A 5L0GA 4QI2A 1HE9A 3FHDA 1JPNA 1WWPA 3EQLF 3HNJA 4G0HA 2GA0A 3RYLA 5DLJA 3KPHA 2EPMX 3AJMA 4D4XA 4FAPB 2HV6A 4H54A 2NUTA 1CPQA 4KI2A 4U9EA 4YL0A 4YT2A 3TQOA 3K6BA 4BJ5C 2L6GA 3DAFA 3IEEA 3JYYA 1IW7F 3MBGA 4WJ0A 4YL3A 3ZDLA 4EBKA 3LJBA 3ZTMA 2AWCA 3HTKC 2R9RB 1VB5A 2Q4FA 1OCCC 2DI3A 1NSGB 2XRHA 3RVYA 1JAFA 3IQTA 3NYJA 1TKNA 3S84A 4NY3A 1MNEA 4QDLA 2YKZA 5JUAA 2O9XA 2J9VA 3QVZA 4IB4A 2KYHA 3SXMA 3NKEA 5DVWA 4MTGA 3RQEA 3GANA 1VK5A 4BEJA 1UFBA 3NG1A 1D0YA 2Y39A 3G4ZA 1QZXA 4J7YA 3QZCA 4JC7A 2XXAB 4AK9A 4KNWA 1I4YA 1Q0MA 1O5HA 2HMZA 3ITFA 4JCZA 1GGQA 4E0IA 1ZU5A 4QI0A 4ZLCA 1LVKA 3UGOA 3N2ZB 1M57C 2RSEB 3EHMA 3H65A 2HZ8A 3DAGA 3GM3A 3LEOA 4Z9IA 2XLOA 2HKVA 1V55C 3S90A 3U0CA 5COGA 2IXNA 3VRCA 2XM0A 3KH2A 1SMYF 4N6HA 2G3VA 2IXMA 2V3CC 3HNKA 3SP1A 5KYNA 2XS1A 2EIJC 4AE4A 3HJCA 4BJTA 1CGOA 1ZHZA 3KL4A 4MTOA 5B3SC 2R7XA 1YJGA 4JW1A 3EPVA 1OXBA 2PX0A 2QNLA 4J32B 4E7ZA 2P7VA 5DS6A 2FFHA 1WOLA 3LS0A 5KYUB 4B6IA 1DOWA 3DM9B 4YL1A 1FMVA 1R4TA 4CS9C 1Q0DA 1YA7O 4N4WA 3C63A 3IPMO 4BPMA 3NDBB 5L3VA 4PFPA 2R02A 1E84A 1HMDA 4OIQF 1PV3A 3B0PA 4JTCB 3L8JA 2P1AA 5GPGB 1HW1A 2WZGA 3S28A 3RIPA 2ZXPA 4ULWA 5B3IA 1FNTc 1VYKA 2TMVP 2J9BA 1SYQA 3PCVA 2AWYA 1FAPB 3K66A 1ZHWA 1ZYRF 1OKKD 2QUPA 2XL8A 3VAYA 5L0HA 2R7TA 2B0JA 2LFDA 4K7BA 5DS4A 2R7WA 4MQ9F 1D0ZA 1QKRA 4EHPA 1ZHYA 3MLGA 3S27A 3RQFA 3ABLC 3MYIA 3V5XA 4IAQA 2Y3BA 3HKKA 3B0UX 1A7VA 2XXAA 3CEXA 3M79A 2MWQA 3OWTA 4OD4A 4OIOF 5D92A 2PP4A 1FFTC 2XM4A 4E7SA 5AC5A 1J8YF 4GEHA 4G7HF 5E3AA 4Q4ZF 2WL8A 1H9TA 5A6BA 3G50A 4PACA 1WGWA 4Q5SF 1QPUA 2Y3GA 3EGXB 5A6KA 1K04A 3B9QA 2D5RB 2HMQA 3IQ6A 1QLEC 4CDYA 1D0XA 3U3BA 4DBQA 3R2PA 2KGOA 2Q9CA 3AG4C 4JTAB 5JVEA 3DD7A 3WHNA 1JRAA 4HEAJ 1BDJB 4ULVA 1LI5A 4XPXA 4YK5A 3WODF 4EUKB 3AG1C 2GWWA 2KW3C 4LLEA 2OOCA 1JPJA 1AEPA 2YLGA 5AC4A 1M6TA 1D1AA 1LPEA 2KC3A 1H9GA 2HSQA 2MYSA 2Q3TA 4E0HA 1YAUO 2R03A 3AGUA 3L1MA 3IQ5A 4O7GA 1OR2A 4O6NA 3PHF2 3JRTA 1NFNA 1MMGA 2QY9A 3BEHA 5KYWB 3LLIA 2WVNA 2OCCC 5FCLA 1KNYA 1FTSA 2XLHA 2A69F 2EILC 2WB7A 4PJMA 4IGGA 3Q7GA 1UG7A 1T9KA 5L0DA 5B1BC 2ASRA 1CGME 1Z6AA 1LI7A 3B71A 1NU7D 1V54C 2G3KA 4W8KA 4E18A 2ZXOA 1TR2A 3ABKC 4YN0B 3GEEA 3QMKA 2IXPA 3EH2A 4O79A 4FESA 1LE4A 3UGPA 1PCXA 1Z63A 3IQCA 3AQBA 2P61A 3EFOB 4N6CA 5AGFA 2W4BA 2R05A 2W4MA 4PFOA 4NCQA 2OEXA 5FZTA 1BR4A 2YEVA 3SYNA 4CS8C 5JT4A 3RFYA 5F28E 3E70C 2KJGA 2UUHA 2UUIA 3EG9B 3QW1A 1M2VA 2OKUA 1LIHA 2EPOA 1MNDA 1AVOB 3W2WA 1HMOA 1T5OA 1D1CA 4BJ1A 3NYMA 4H4KC 4LLCA 3SXKA 4BJ5A 2J9WA 1APCA 3K7DA 3N0TA 1RKEA 2KK1A 4MVMA 5COFA 4CX9A 5A6JA 2JX0A 1I4ZA 3A11A 4NC3A 2DYSC 4U5GA 2AP3A 4LDRA 4BG0A 4C3EA 3EH1A 3NMJA 4DRJB 1M2VB 4I1MA 1BR1A 2GFHA 5BUOA 1L3PA 3J06A 4J30B 1NG1A 3AOUA 4PJNA 3JZ0A 5KYXA 1RKEB 2BE5F 2LD6A 3QW0A 2EIMC
chains in the Genus database with same CATH topology
1JMWA 2ASRA 4H54A 4Z9HA 1WASA 3T9OA 1LIHA 4Z9IA 1WATA 4Z9JA 2LIGA 3ATPA 1VLTA 2D4UA 1VLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMW A;  2ASR A;  4H54 A;  4Z9H A;  1WAS A;  3T9O A;  1LIH A;  4Z9I A;  1WAT A;  4Z9J A;  2LIG A;  3ATP A;  1VLT A;  2D4U A;  1VLS A; 
#chains in the Genus database with same CATH topology
 1J8M F;  2PNO A;  3M4B A;  1WTY A;  4Z9J A;  3NKD A;  3KYI A;  3V7O A;  1Q0F A;  5F5F A;  4XQ1 A;  3N24 A;  3U8P A;  4KNV A;  2YQY A;  2FAP B;  4EIY A;  1KTM A;  2P6V A;  3QTH A;  4XTK A;  3PDM P;  3AGT A;  2YL1 A;  5KYX B;  3SXZ A;  5T3W A;  2HSB A;  1FMW A;  1MMA A;  3EZH A;  2A6E F;  1SZI A;  5KYU A;  2KSF A;  5L3Q A;  3UMI A;  2WZF A;  3B29 A;  3I4U A;  1VTM P;  1ORS C;  4IRU A;  5BQI A;  4GQH A;  1BBH A;  4G7O F;  4RDA A;  4L6R A;  3HNI A;  1U6H A;  2ZXW C;  3I5P A;  3JT1 A;  1AUE A;  2DYR C;  3CSK A;  1DOV A;  1TWC A;  2YLI A;  2ZXR A;  3QVY A;  3TJ6 A;  3FOP A;  3WG7 C;  3RQG A;  2A0U A;  4D4N A;  4U5H A;  5JS5 A;  2HS5 A;  4OIP F;  1Z23 A;  3MFN A;  1S05 A;  4MW3 A;  5D91 A;  1R5I D;  3HNL A;  3OA1 A;  3POV A;  1O87 A;  2LIG A;  3K1I C;  1TWA A;  4HE8 D;  4OIR F;  3LUT B;  4CS9 A;  1ZZP A;  2HV7 A;  1TQG A;  1Y6D A;  2EPL X;  2LP4 A;  3H2U A;  1OXK A;  2YZS A;  3DE9 A;  4PR9 A;  1H7I A;  2CYD A;  3T4R A;  3TOL A;  4CS7 A;  5CIV A;  3O10 A;  4J7T A;  5JLI A;  1PD0 A;  2DB4 A;  2OEV A;  1OW7 A;  2AVK A;  1BR2 A;  2XLE A;  3U8V A;  1EI7 A;  1U0B B;  3FDQ A;  3PMR A;  3X1O A;  4JVS A;  4MW8 A;  4CDA A;  2M64 A;  1RMV A;  1G4U S;  2NUP A;  3NMI A;  1E83 A;  2Q9A A;  3K33 A;  4AL0 A;  3C18 A;  1A41 A;  3C8G D;  2OQM A;  2F22 A;  3C62 A;  1E2X A;  3SEO A;  3VF0 A;  4CJO A;  5L0J A;  5BQH A;  3U9M A;  1VLS A;  2J0X A;  3Q6N A;  4UDV A;  3EGX A;  5HSW A;  3Q6M A;  3UMK A;  1NZE A;  2CCY A;  3ZSU A;  3FAJ A;  4HFK B;  2NUP B;  2CNW D;  1ZW2 A;  4R32 A;  2YL7 A;  3SZR A;  2XL4 A;  1EKY A;  2EPN A;  3CQZ A;  2AU5 A;  4KC9 A;  5DQT A;  5IY5 C;  5DS5 A;  5E3C A;  4MVR A;  4AL1 A;  1WN0 A;  4WGY A;  3W4Y A;  2C04 A;  4BJ6 C;  4YWQ A;  3US6 A;  4DOZ A;  3GOD A;  3T6G B;  1K40 A;  1N1C A;  1RXQ A;  2R25 A;  5T1D B;  4BJ6 A;  1GM5 A;  4XEF A;  4F4B A;  4DJ9 A;  4DBR A;  5HV9 A;  2XLV A;  2NSF A;  3O6X A;  4XWJ A;  5KYW A;  2VC9 A;  1BZ4 A;  2J7P A;  2LSE A;  2C03 A;  4G7Z F;  2HJ3 A;  3OEO A;  5EHH A;  2IM8 A;  2JPU A;  5L0F A;  1HE1 A;  4CIP A;  4XEK A;  4C7O A;  1JMW A;  3X2Q C;  4MVS A;  4JJF A;  2A1D D;  4RD9 A;  3DKA A;  3KYJ A;  3I5Q A;  4U5E E;  5T3T A;  1QQ3 A;  1A7E A;  1Y4C A;  1LS4 A;  2OJQ A;  5DQZ A;  3LEV A;  1WAT A;  4RBN A;  5A6B D;  4P6I C;  4GYT A;  3DJN B;  3FAP B;  4C7O B;  1Q0K A;  1A0B A;  3EFO A;  4JIO A;  1V74 B;  4A2N B;  3GEI A;  1OW8 A;  4LER A;  2W45 A;  2H7O A;  1W2W A;  3TD7 A;  3O55 A;  4P9F A;  3EGD B;  3UMH A;  2CW0 F;  3FOO A;  3BRJ A;  3R7C A;  1D1B A;  3EG9 A;  3TK0 A;  2R7V A;  3L0I A;  1YZA A;  4JE9 A;  4XEV A;  4NTF A;  3GWN A;  1CPR A;  1LE2 A;  4IWB A;  2R7R A;  2PX3 A;  3RVZ A;  4DVY P;  1YLM A;  2CDQ A;  1G5Z A;  4PJJ A;  1S7Z A;  3LNM B;  4EBB A;  3MYF A;  1LKX A;  3Q7L A;  1VMA A;  3GWL A;  4MVZ A;  3S9O A;  2P0N A;  3HLZ A;  2H7V C;  4G78 A;  1T6U A;  3ZTZ A;  4CS8 A;  4CSA C;  5B1A C;  2CGE A;  4MS2 A;  4U5C E;  3U5S A;  1E85 A;  4DRI B;  2V26 A;  1FR0 A;  2RD9 A;  4U5D E;  3RW0 A;  4CSA A;  4JTD B;  1ORY A;  1Z7Q c;  2PFD A;  2ICW G;  5KYY B;  1OQC A;  3ZWI A;  3DZA A;  256B A;  3ZVR A;  4JCH A;  2Y3D A;  1TFK B;  2DGJ A;  2L6F A;  2YHS A;  2QE9 A;  1RJ9 A;  4JKV A;  3W8I A;  4P9T A;  3W8H A;  1K05 A;  2Q00 A;  4K1O A;  4LDQ A;  3T6B A;  2Q7R A;  3DXJ F;  1MMN A;  1VYI A;  2Q9B A;  1TWH A;  2A0B A;  3EJN A;  2R7U A;  2NSG A;  4LAC B;  1RJ9 B;  1ZW3 A;  2I15 A;  3CAX A;  4KBL A;  3ASN C;  5E2Q A;  1RCP A;  4CBE A;  3EHN A;  2ZPA A;  4AX2 A;  3ZG1 A;  2NUT B;  1E86 A;  1YYJ A;  2VCB A;  1YDI A;  5K0I A;  5KYY A;  4YT5 A;  1ZVZ A;  3M15 A;  2R7S A;  1ZHT A;  2A68 F;  2VH3 A;  1CGN A;  3FVY A;  1C03 A;  4NQF A;  1IZM A;  3UNG C;  5L0I A;  2E87 A;  2Y69 C;  1T01 A;  3ASO C;  3DE8 A;  3B0V C;  1NBB A;  2WZL A;  1F1M A;  4LDK A;  4XLP F;  2VCC A;  4MTF A;  3H2V A;  4CDV A;  4C3B A;  2IOQ A;  2XLD A;  4OD5 A;  3RF3 A;  3SNH A;  2HJM A;  1YZC A;  1T6Q A;  1Z3I X;  2FGY A;  2J8W A;  4JEA A;  3W2V A;  1WAS A;  1H6G A;  4U9D A;  3TUL A;  2H8A A;  2HUJ A;  2VCA A;  3KMI A;  4DXW A;  1XZP A;  1G8X A;  1VLT A;  4E17 A;  3C7J A;  3ABM C;  1YAR O;  4A4A A;  1GQA A;  1NLX A;  3TJ5 A;  1ZHX A;  3EZI A;  3JYH A;  3K1I A;  4JJG A;  2H7B A;  4Q7C A;  3UR3 C;  2HFI A;  3AQC A;  1T6I A;  1LM3 B;  1VOM A;  3TOM A;  3GEH A;  4WGZ A;  2I8B A;  3DWW A;  3C8Z A;  3LS1 A;  2Z15 A;  1JOG A;  3T9O A;  1M2O A;  2IBF A;  2OG2 A;  3JSZ A;  1MQV A;  1OKK A;  3V5Z A;  3ZC4 A;  3ZQY A;  2W9Y A;  4U5B E;  1L7C A;  1C02 A;  1M56 C;  1GS9 A;  3C8G A;  2JD3 A;  2XLM A;  1ST6 A;  2GAQ A;  1OCO C;  1OCR C;  2XS8 A;  1ORJ A;  4YJW A;  5E33 A;  3RKO F;  3GOR A;  4IJJ A;  2NPU A;  2WVQ A;  2YWA A;  1SF8 A;  4ER9 A;  4YT4 A;  4AE4 B;  3U9J A;  3DI5 A;  3GM2 A;  1YYX A;  3FMS A;  5EGY A;  2CNW A;  1XZQ A;  2WVO A;  3M4C A;  4O6Y A;  4K0D A;  1OW6 A;  3C8G B;  4NTB A;  1MMD A;  4IAR A;  5CI8 A;  2IXO A;  1KU2 A;  2YL3 A;  2J0W A;  2YLD A;  4N06 A;  5COM A;  1LS1 A;  4CJG A;  3LES A;  3JRM O;  3VM6 A;  3ZIB A;  4JEB A;  1TWG A;  3LAY A;  3O39 A;  1QSP A;  1U89 A;  3AG2 C;  3JCU Q;  3S29 A;  4BEM J;  1B68 A;  1NFO A;  2YVK A;  4NTA A;  3AG3 C;  4I3M A;  4MVQ A;  5F5H A;  5A69 A;  3SXY A;  2NG1 A;  2R7O A;  4EBJ A;  5L0C A;  2ZD9 A;  2L9J A;  3ZQV A;  2J9U A;  2XL6 A;  1YA9 A;  1C17 M;  3CZ6 A;  2YRF A;  4XLN F;  1YVI A;  4XPW A;  4OIN F;  2MHR A;  3NRH A;  5A6A A;  2X51 A;  2A6H F;  2QTV A;  2LK4 A;  2VAS A;  3NMK A;  4X0R A;  4HFF B;  2G62 A;  4CIH A;  2GDC A;  2X0C A;  2L7A A;  4U5F E;  2R7Q A;  2KQ9 A;  5JRA A;  4M63 A;  3V5Y A;  4O6M A;  4ONS A;  5JSL A;  3VYW A;  2EIK C;  2EPK X;  2LCH A;  2OJE D;  3A9C A;  3LNR A;  4JUR I;  4W8P A;  4ANJ A;  3F47 A;  2J45 A;  3KKB A;  3U3F A;  1QVX A;  2J46 A;  4YT8 A;  2PF4 E;  3S0X A;  3EGD A;  3L8I A;  5BQG A;  3RH3 A;  2BL2 A;  3JSE O;  5TJ5 E;  4DRH B;  4XPY A;  3DJU B;  4EWC A;  4MND A;  4IAO A;  3DM5 A;  4I1O B;  3DMD A;  1RKC A;  1NU9 C;  2VB6 A;  1I5N A;  1FFH A;  1OR3 A;  1ZU4 A;  4I44 A;  3JTL O;  1A7D A;  4MVU A;  3LLK A;  1O3U A;  2PBE A;  4PK4 A;  3GM1 A;  4FWV A;  2J7P D;  5CI9 A;  2LQG A;  2B0H A;  3F46 A;  4WAB A;  2L81 A;  2XSE A;  4FX5 A;  4Z9H A;  3U2L A;  4DVZ A;  3T6J A;  1HY5 A;  1HW2 A;  2ETS A;  4MVO A;  2Y3H A;  1V4A A;  1OCZ C;  3IHU A;  2KNH A;  5JP7 A;  2QLA A;  3WAQ A;  1EQ1 A;  1JR8 A;  2BC5 A;  2EIN C;  2D4U A;  3G4X A;  3MX3 A;  3NYL A;  3U2M A;  1Q0G A;  4ZLD A;  3L34 A;  1XWJ A;  3K1H A;  1Z5Z A;  4EKW A;  3ECS A;  2OU6 A;  4JRZ A;  4JZA A;  3ATP A;  1SR2 A;  1PD1 A;  2IYL D;  2YL0 A;  3M1C B;  2XLW A;  3E9V A;  4PJL A;  1G4W R;  2M4E A;  3FXH A;  2L6H A;  1TFO B;  4C3D A;  2LFF A;  5EK0 A;  1EA8 A;  5L0G A;  4QI2 A;  1HE9 A;  3FHD A;  1JPN A;  1WWP A;  3EQL F;  3HNJ A;  4G0H A;  2GA0 A;  3RYL A;  5DLJ A;  3KPH A;  2EPM X;  3AJM A;  4D4X A;  4FAP B;  2HV6 A;  4H54 A;  2NUT A;  1CPQ A;  4KI2 A;  4U9E A;  4YL0 A;  4YT2 A;  3TQO A;  3K6B A;  4BJ5 C;  2L6G A;  3DAF A;  3IEE A;  3JYY A;  1IW7 F;  3MBG A;  4WJ0 A;  4YL3 A;  3ZDL A;  4EBK A;  3LJB A;  3ZTM A;  2AWC A;  3HTK C;  2R9R B;  1VB5 A;  2Q4F A;  1OCC C;  2DI3 A;  1NSG B;  2XRH A;  3RVY A;  1JAF A;  3IQT A;  3NYJ A;  1TKN A;  3S84 A;  4NY3 A;  1MNE A;  4QDL A;  2YKZ A;  5JUA A;  2O9X A;  2J9V A;  3QVZ A;  4IB4 A;  2KYH A;  3SXM A;  3NKE A;  5DVW A;  4MTG A;  3RQE A;  3GAN A;  1VK5 A;  4BEJ A;  1UFB A;  3NG1 A;  1D0Y A;  2Y39 A;  3G4Z A;  1QZX A;  4J7Y A;  3QZC A;  4JC7 A;  2XXA B;  4AK9 A;  4KNW A;  1I4Y A;  1Q0M A;  1O5H A;  2HMZ A;  3ITF A;  4JCZ A;  1GGQ A;  4E0I A;  1ZU5 A;  4QI0 A;  4ZLC A;  1LVK A;  3UGO A;  3N2Z B;  1M57 C;  2RSE B;  3EHM A;  3H65 A;  2HZ8 A;  3DAG A;  3GM3 A;  3LEO A;  4Z9I A;  2XLO A;  2HKV A;  1V55 C;  3S90 A;  3U0C A;  5COG A;  2IXN A;  3VRC A;  2XM0 A;  3KH2 A;  1SMY F;  4N6H A;  2G3V A;  2IXM A;  2V3C C;  3HNK A;  3SP1 A;  5KYN A;  2XS1 A;  2EIJ C;  4AE4 A;  3HJC A;  4BJT A;  1CGO A;  1ZHZ A;  3KL4 A;  4MTO A;  5B3S C;  2R7X A;  1YJG A;  4JW1 A;  3EPV A;  1OXB A;  2PX0 A;  2QNL A;  4J32 B;  4E7Z A;  2P7V A;  5DS6 A;  2FFH A;  1WOL A;  3LS0 A;  5KYU B;  4B6I A;  1DOW A;  3DM9 B;  4YL1 A;  1FMV A;  1R4T A;  4CS9 C;  1Q0D A;  1YA7 O;  4N4W A;  3C63 A;  3IPM O;  4BPM A;  3NDB B;  5L3V A;  4PFP A;  2R02 A;  1E84 A;  1HMD A;  4OIQ F;  1PV3 A;  3B0P A;  4JTC B;  3L8J A;  2P1A A;  5GPG B;  1HW1 A;  2WZG A;  3S28 A;  3RIP A;  2ZXP A;  4ULW A;  5B3I A;  1FNT c;  1VYK A;  2TMV P;  2J9B A;  1SYQ A;  3PCV A;  2AWY A;  1FAP B;  3K66 A;  1ZHW A;  1ZYR F;  1OKK D;  2QUP A;  2XL8 A;  3VAY A;  5L0H A;  2R7T A;  2B0J A;  2LFD A;  4K7B A;  5DS4 A;  2R7W A;  4MQ9 F;  1D0Z A;  1QKR A;  4EHP A;  1ZHY A;  3MLG A;  3S27 A;  3RQF A;  3ABL C;  3MYI A;  3V5X A;  4IAQ A;  2Y3B A;  3HKK A;  3B0U X;  1A7V A;  2XXA A;  3CEX A;  3M79 A;  2MWQ A;  3OWT A;  4OD4 A;  4OIO F;  5D92 A;  2PP4 A;  1FFT C;  2XM4 A;  4E7S A;  5AC5 A;  1J8Y F;  4GEH A;  4G7H F;  5E3A A;  4Q4Z F;  2WL8 A;  1H9T A;  5A6B A;  3G50 A;  4PAC A;  1WGW A;  4Q5S F;  1QPU A;  2Y3G A;  3EGX B;  5A6K A;  1K04 A;  3B9Q A;  2D5R B;  2HMQ A;  3IQ6 A;  1QLE C;  4CDY A;  1D0X A;  3U3B A;  4DBQ A;  3R2P A;  2KGO A;  2Q9C A;  3AG4 C;  4JTA B;  5JVE A;  3DD7 A;  3WHN A;  1JRA A;  4HEA J;  1BDJ B;  4ULV A;  1LI5 A;  4XPX A;  4YK5 A;  3WOD F;  4EUK B;  3AG1 C;  2GWW A;  2KW3 C;  4LLE A;  2OOC A;  1JPJ A;  1AEP A;  2YLG A;  5AC4 A;  1M6T A;  1D1A A;  1LPE A;  2KC3 A;  1H9G A;  2HSQ A;  2MYS A;  2Q3T A;  4E0H A;  1YAU O;  2R03 A;  3AGU A;  3L1M A;  3IQ5 A;  4O7G A;  1OR2 A;  4O6N A;  3PHF 2;  3JRT A;  1NFN A;  1MMG A;  2QY9 A;  3BEH A;  5KYW B;  3LLI A;  2WVN A;  2OCC C;  5FCL A;  1KNY A;  1FTS A;  2XLH A;  2A69 F;  2EIL C;  2WB7 A;  4PJM A;  4IGG A;  3Q7G A;  1UG7 A;  1T9K A;  5L0D A;  5B1B C;  2ASR A;  1CGM E;  1Z6A A;  1LI7 A;  3B71 A;  1NU7 D;  1V54 C;  2G3K A;  4W8K A;  4E18 A;  2ZXO A;  1TR2 A;  3ABK C;  4YN0 B;  3GEE A;  3QMK A;  2IXP A;  3EH2 A;  4O79 A;  4FES A;  1LE4 A;  3UGP A;  1PCX A;  1Z63 A;  3IQC A;  3AQB A;  2P61 A;  3EFO B;  4N6C A;  5AGF A;  2W4B A;  2R05 A;  2W4M A;  4PFO A;  4NCQ A;  2OEX A;  5FZT A;  1BR4 A;  2YEV A;  3SYN A;  4CS8 C;  5JT4 A;  3RFY A;  5F28 E;  3E70 C;  2KJG A;  2UUH A;  2UUI A;  3EG9 B;  3QW1 A;  1M2V A;  2OKU A;  1LIH A;  2EPO A;  1MND A;  1AVO B;  3W2W A;  1HMO A;  1T5O A;  1D1C A;  4BJ1 A;  3NYM A;  4H4K C;  4LLC A;  3SXK A;  4BJ5 A;  2J9W A;  1APC A;  3K7D A;  3N0T A;  1RKE A;  2KK1 A;  4MVM A;  5COF A;  4CX9 A;  5A6J A;  2JX0 A;  1I4Z A;  3A11 A;  4NC3 A;  2DYS C;  4U5G A;  2AP3 A;  4LDR A;  4BG0 A;  4C3E A;  3EH1 A;  3NMJ A;  4DRJ B;  1M2V B;  4I1M A;  1BR1 A;  2GFH A;  5BUO A;  1L3P A;  3J06 A;  4J30 B;  1NG1 A;  3AOU A;  4PJN A;  3JZ0 A;  5KYX A;  1RKE B;  2BE5 F;  2LD6 A;  3QW0 A;  2EIM C; 
#chains in the Genus database with same CATH homology
 1JMW A;  2ASR A;  4H54 A;  4Z9H A;  1WAS A;  3T9O A;  1LIH A;  4Z9I A;  1WAT A;  4Z9J A;  2LIG A;  3ATP A;  1VLT A;  2D4U A;  1VLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...