4Z9IA

Asp-tars from e. coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
164
structure length
164
Chain Sequence
LFFSSLHHSQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 71
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9iA00
4Z9JA 1LIHA 1WASA 2LIGA 4H54A 2ASRA 4Z9IA 3ATPA 1VLTA 4Z9HA 3T9OA 1VLSA 1JMWA 1WATA 2D4UA
chains in the Genus database with same CATH superfamily
3RQFA 3U2LA 1U89A 4CS7A 4U5EE 3ZVRA 5JVEA 1FNTc 2W9YA 3HJCA 2X51A 3LNRA 3RFYA 3V5YA 3CEXA 2J9VA 3RW0A 5L0IA 1TFOB 1Y6DA 3B29A 4XEFA 1NU7D 4HE8D 3TK0A 2J9UA 3B0VC 5DS5A 1BDJB 3S27A 1JOGA 3DMDA 1E85A 3L8IA 2IXOA 4PJMA 1LM3B 3ZG1A 1WWPA 4FESA 3RIPA 3TQOA 4GYTA 4BJ6C 4CIPA 4GEHA 3MYIA 1LS4A 4WJ0A 3TD7A 2J7PD 2AU5A 2ASRA 1QSPA 2XLDA 4OD5A 4XQ1A 3G4ZA 1GGQA 3RYLA 3HLZA 4G0HA 4DVYP 3X1OA 2YVKA 3JTLO 2VCAA 4PJLA 1VB5A 5D91A 3RVZA 5BQGA 4DBRA 2XXAA 2EPNA 3LJBA 4JZAA 4YL0A 1YA9A 2EPLX 4MVQA 1LVKA 4MTFA 3SNHA 3WHNA 5BQHA 5A6BD 1A7DA 4C7OB 3UMIA 4N06A 4JC7A 5KYYB 3NKDA 1O87A 2A68F 2KJGA 2VCBA 5L0FA 1HE1A 1HW2A 5COGA 1NU9C 2B0JA 2PFDA 3EHMA 5A69A 5L3QA 1VLTA 5EGYA 3H2UA 1G5ZA 5EHHA 4YL1A 5T3TA 2LP4A 3EZIA 4BG0A 4PR9A 5B3SC 5DS4A 5KYNA 2XL6A 2WL8A 1NFNA 2H7BA 2KC3A 3ITFA 3QTHA 1OXKA 5EK0A 3V7OA 2EIKC 3T9OA 3EGDA 1WGWA 5JT4A 1Z7Qc 1EI7A 3FXHA 2M64A 2H7OA 3X2QC 3W4YA 2AVKA 2H8AA 1C03A 3LS1A 3DAFA 2ZPAA 4JJFA 1JR8A 1ZW3A 4FX5A 1CGOA 1FMWA 2P6VA 2YLGA 4JCHA 3T6GB 4AE4A 4E17A 3HKKA 3VYWA 1CGME 1XZQA 1YYJA 1T01A 4CS8A 1A7EA 2YL0A 4KNWA 5AC5A 2EPOA 3G4XA 2R7SA 3KMIA 4DJ9A 5L0CA 1NG1A 1ZHYA 1KU2A 4I44A 4KNVA 3NMKA 3JZ0A 2R7QA 3R2PA 4O7GA 1ORJA 3HNIA 4CSAA 2JX0A 2JPUA 1YJGA 1E84A 2YHSA 4PJJA 2V26A 4OIOF 5A6JA 1ZYRF 2QY9A 5AC4A 1E83A 1YZCA 2HV6A 4JURI 4OIRF 2R7UA 2OKUA 1VTMP 4PK4A 3C18A 3C8ZA 4YN0B 1WTYA 2P7VA 2XS1A 2C03A 3JYYA 3AQBA 1GM5A 2XLWA 1G4WR 2ZXRA 3WG7C 4BJ6A 5L0GA 2EINC 2W45A 3K1HA 4G7ZF 2IXNA 4Q5SF 3KPHA 3T6JA 4U5DE 1KTMA 4YT2A 3ASOC 1TQGA 3JYHA 3LUTB 3QVZA 2XLVA 2AWYA 3O39A 2NUTB 5T1DB 3IQ5A 2NPUA 3W2WA 2J0WA 3EPVA 3EFOA 3FDQA 4EBKA 4WGYA 1AVOB 2WVQA 2KNHA 3EGDB 4ULVA 1MMDA 3SEOA 1D0ZA 2WZGA 4AL0A 3EGXA 4YT4A 1XZPA 4CS9C 5JLIA 1RJ9B 3GM1A 2LFDA 4EBBA 2AP3A 1W2WA 4XTKA 2XL8A 4BJ1A 4C3EA 3FAJA 1QVXA 1OW6A 3T6BA 1I4ZA 2IXMA 2XM4A 3NMJA 4D4XA 4IAQA 1A0BA 1Q0KA 1C17M 2R25A 5BQIA 4AE4B 4EBJA 3AJMA 4G7HF 3TJ5A 3Q7GA 5JS5A 2WVNA 2A0UA 3L0IA 1MQVA 2KQ9A 3AGUA 1VLSA 1M56C 2UUHA 4MVSA 4AX2A 5JRAA 2RSEB 1T6IA 1WASA 3U8VA 4C3DA 4A2NB 3ASNC 4RD9A 4WGZA 1DOWA 4ZLDA 3RKOF 1Q0GA 1Q0FA 3JSZA 2DYSC 1OR3A 2A69F 2KW3C 3GEHA 4LLCA 2FAPB 1M2OA 2R9RB 5L0HA 5A6KA 3KYJA 2OG2A 2OU6A 1E86A 2CGEA 4JW1A 1TWHA 4NQFA 3UMHA 4K0DA 3EH1A 3TOMA 4E7ZA 3QVYA 1OCZC 3EZHA 3ATPA 3U0CA 4O79A 3C8GD 2CCYA 3CQZA 4G7OF 1Z23A 1N1CA 1ZHTA 4U5FE 1D0YA 5KYUA 4W8PA 1LI5A 2PNOA 3DM9B 3S90A 1EA8A 1GQAA 3IPMO 3OA1A 4MVRA 2QE9A 3MFNA 1Z5ZA 2GDCA 2XL4A 3M4BA 3OWTA 1WN0A 3Q6NA 4U5CE 2R7XA 1APCA 2DI3A 4YWQA 2CNWD 2YZSA 3AG2C 4E0IA 1MNEA 2GAQA 2YLIA 3EFOB 3EG9A 1YYXA 5DLJA 3KH2A 2I15A 4LERA 1JPJA 3K1IA 3N24A 4Z9IA 3V5XA 3VAYA 3M79A 1OCCC 2Z15A 1CGNA 3DAGA 3EGXB 4EHPA 4MTOA 1NBBA 2W4MA 2HS5A 3QW1A 4OD4A 2BC5A 1ZVZA 1XWJA 4Z9JA 4F4BA 1U0BB 2OJED 3DE9A 1R5ID 3VRCA 3ZSUA 1GS9A 1OQCA 3C8GA 4QDLA 3B0PA 4LDQA 4NTBA 3OEOA 3RF3A 3MLGA 1V74B 1LKXA 4BEJA 1MMGA 1ZU4A 4K1OA 4XPYA 1YZAA 2IYLD 3UNGC 4BJ5A 4JEBA 1RKEA 5CI8A 2CNWA 4EUKB 4HFKB 3DI5A 4LDKA 1D1AA 3PCVA 2XM0A 3K6BA 4MVOA 3M15A 3KYIA 5F28E 3IEEA 1SMYF 3NRHA 3NDBB 2HJMA 3DD7A 4I1OB 4JTCB 3SXKA 3KL4A 1RXQA 2C04A 2HKVA 1LI7A 3DJUB 2G62A 4J7TA 3LEOA 3B9QA 2OQMA 4U5BE 2PBEA 4KC9A 1Q0MA 3VF0A 3ECSA 1U6HA 5L0DA 3NMIA 4MW3A 5T3WA 2YEVA 4N6HA 1FMVA 3FAPB 2CDQA 1VYIA 2LSEA 2KSFA 4IWBA 3ZWIA 2EPMX 2L6HA 2KYHA 2L9JA 2L81A 1RKCA 2LQGA 2WB7A 2XRHA 3MX3A 4LLEA 4O6NA 4P9TA 3SP1A 5B3IA 1LS1A 1OW8A 3DE8A 2PP4A 2PF4E 3EQLF 4IAOA 2AWCA 2J0XA 5D92A 1NSGB 3EG9B 4FWVA 4L6RA 5A6AA 4FAPB 3W8HA 1OXBA 2EILC 2FGYA 1OR2A 4YK5A 2QNLA 3T4RA 4I3MA 2BE5F 256BA 4MTGA 1T6UA 4LACB 3ABLC 1CPRA 3S9OA 1SYQA 1MMNA 4DRIB 2Q9CA 1JPNA 1IZMA 2FFHA 2J8WA 2YKZA 3C8GB 3O55A 5DVWA 3TJ6A 2XXAB 3F47A 4PJNA 2IOQA 2ETSA 3S0XA 2XLOA 4JTAB 3G50A 3KKBA 1SF8A 4CIHA 3JSEO 4CJOA 3AG1C 2Q7RA 2HUJA 3L1MA 3I5PA 3ABMC 3PMRA 3HNLA 2A6HF 3RQGA 3QW0A 3LEVA 1RKEB 4KI2A 1J8MF 3PHF2 3FMSA 2YL7A 4O6MA 4C3BA 4CX9A 1FTSA 1G8XA 4JTDB 4P9FA 1HMOA 4U9DA 3F46A 2R7TA 4IGGA 1OW7A 3CSKA 3S28A 3NYMA 1FFHA 4MW8A 1Y4CA 1H9TA 1LPEA 2XLHA 4M63A 1TWAA 5TJ5E 1EQ1A 2GWWA 1D0XA 1YAUO 1TWGA 2OOCA 1FFTC 3B0UX 2Y3DA 1F1MA 2HSBA 5COFA 3U2MA 2YLDA 4E7SA 2R02A 3K66A 4U5GA 1ZHWA 2LFFA 1S05A 4YT5A 5IY5C 2YQYA 5DQTA 4NCQA 2OEXA 2VCCA 4XLNF 4UDVA 4EWCA 4NTAA 2HSQA 4MS2A 4JRZA 1V4AA 2D4UA 3V5ZA 3UGPA 2EIMC 5B1AC 1HMDA 1JAFA 2OCCC 1BR1A 4MNDA 1RMVA 5FCLA 4H4KC 4R32A 3L8JA 4U9EA 2LIGA 1BZ4A 1ORSC 2M4EA 3GWNA 4MVZA 4CDAA 1M6TA 3E70C 3MBGA 1TFKB 1O5HA 2GFHA 1H7IA 2P61A 3FVYA 1A7VA 1HW1A 1Q0DA 3HNJA 3LS0A 1QQ3A 1SR2A 2HMQA 3JRMO 4JJGA 2LK4A 3S84A 3TULA 4OIPF 3POVA 2Q00A 3LLIA 2IM8A 4CS8C 1BR2A 2J45A 4PACA 1M2VA 1RCPA 3UGOA 2R7VA 1L3PA 2Q4FA 1QZXA 3W8IA 2VB6A 1K05A 5JP7A 2WZLA 3NKEA 2HFIA 2J9WA 4U5HA 4RBNA 4BEMJ 3J06A 1H9GA 2OEVA 2DGJA 3EJNA 4PFPA 4CDYA 1FR0A 4B6IA 4MVMA 1YLMA 4JCZA 1ZHZA 4YL3A 1Z63A 1WATA 3O6XA 3LESA 3U5SA 3Q7LA 2QLAA 2QTVA 2Y3BA 4CSAC 1LIHA 2NUPA 2CYDA 4ANJA 2Y3GA 1ZZPA 2UUIA 2ZXWC 2XLMA 1G4US 4N4WA 5HV9A 3B71A 3GEEA 3SXMA 4Q4ZF 1NZEA 2YRFA 4ER9A 1J8YF 3ZC4A 2W4BA 4CJGA 1ORYA 4EKWA 4HEAJ 5BUOA 2ZXPA 1H6GA 1YA7O 3GWLA 3LLKA 4DRJB 5KYXA 2NSGA 2J46A 3GM2A 3ZIBA 2RD9A 1OKKA 3U9MA 2VC9A 2J9BA 4G78A 3SXZA 2VASA 1TWCA 3GORA 5COMA 2PX3A 1HY5A 3GM3A 3NYJA 3WAQA 3IQ6A 3I5QA 3HNKA 4NTFA 4CS9A 5E3AA 2P0NA 3C63A 5KYWA 5F5HA 4H54A 2ZD9A 1ZHXA 1Z3IX 4JVSA 1FAPB 1QKRA 4ULWA 1I4YA 1LE2A 2BL2A 3LAYA 2X0CA 3QMKA 1UG7A 1L7CA 1UFBA 1A41A 1PD1A 2JD3A 3M1CB 1AEPA 2B0HA 2R05A 1YARO 2HMZA 3BRJA 4IB4A 3EHNA 1AUEA 1R4TA 2EIJC 2YWAA 1V55C 5KYUB 4NY3A 2Y3HA 2A1DD 1YVIA 4J7YA 1VYKA 2G3VA 2Y39A 1M2VB 1HE9A 2J7PA 2ZXOA 4YJWA 3W2VA 3RH3A 3AG4C 3H65A 3JRTA 1BBHA 3FOPA 3ZTMA 1ST6A 2NUTA 4MVUA 1KNYA 4AL1A 1VOMA 3GODA 3CZ6A 3IHUA 4HFFB 4LDRA 4AK9A 4OIQF 1QLEC 1ZW2A 5FZTA 1E2XA 3O10A 3ZQVA 3ABKC 3ZQYA 1RJ9A 2V3CC 2QUPA 1MMAA 2NUPB 3AOUA 2VH3A 3I4UA 1LE4A 1JRAA 3MYFA 1Z6AA 2DB4A 4DVZA 4KBLA 4OINF 4DXWA 2ICWG 2Q9BA 3FHDA 3VM6A 5A6BA 3N0TA 4QI2A 4ONSA 4Z9HA 4E18A 4NC3A 1C02A 1T6QA 4CDVA 2R7RA 3US6A 3DJNB 4DOZA 3AGTA 3DM5A 4QI0A 4K7BA 4E0HA 1PD0A 3JT1A 1IW7F 2XS8A 4Q7CA 5KYXB 3WODF 4O6YA 2R03A 2I8BA 5JUAA 2WVOA 4XEVA 4DBQA 3DWWA 1TKNA 3U9JA 5DS6A 1K04A 2H7VC 2TMVP 5DQZA 4JEAA 4W8KA 2R7WA 1BR4A 1MNDA 2EPKX 2MYSA 3NYLA 5L0JA 3C62A 3M4CA 5KYWB 3UR3C 4RDAA 2Y69C 3K1IC 2MWQA 2MHRA 2OJQA 3R7CA 5L3VA 1QPUA 2L7AA 2LCHA 3C7JA 2P1AA 1T9KA 4N6CA 3ZDLA 4BPMA 1D1CA 1S7ZA 4JKVA 4EIYA 5HSWA 3JCUQ 3IQCA 4XEKA 2HZ8A 2XSEA 3S29A 3U3FA 5F5FA 4IRUA 1YDIA 3PDMP 2G3KA 1VMAA 4J32B 4JIOA 3DXJF 4PFOA 2GA0A 3Q6MA 4XWJA 1TR2A 1OCRC 5B1BC 3UMKA 2IXPA 1JMWA 3SYNA 1EKYA 3A9CA 4X0RA 2A0BA 4D4NA 1SZIA 2XLEA 2WZFA 4BJ5C 2CW0F 3AQCA 2KK1A 3CAXA 4GQHA 4XLPF 3IQTA 1T5OA 2YL1A 3DZAA 1V54C 3K7DA 4CBEA 1PV3A 4YT8A 2D5RB 3GEIA 3FOOA 1M57C 1ZU5A 2IBFA 2L6FA 1K40A 3EH2A 3GANA 4IARA 4MQ9F 1VK5A 3SXYA 3TOLA 4ZLCA 4WABA 5JSLA 4BJTA 2NG1A 3QZCA 1D1BA 2NSFA 5AGFA 2LD6A 1PCXA 2HJ3A 4JE9A 5E2QA 1NLXA 2PX0A 2KGOA 3RVYA 5E33A 3H2VA 2L6GA 3AG3C 4A4AA 3NG1A 2O9XA 3E9VA 3L34A 1WOLA 3U3BA 4C7OA 3K33A 3LNMB 4IJJA 2E87A 5KYYA 5E3CA 4J30B 3ZTZA 1I5NA 1OCOC 1B68A 2Q9AA 1O3UA 5CIVA 2HV7A 3HTKC 4I1MA 5CI9A 1OKKD 2A6EF 4XPXA 5K0IA 2F22A 3N2ZB 2YL3A 2Q3TA 3SZRA 3U8PA 2DYRC 3RQEA 3BEHA 4DRHB 3A11A 1CPQA 3DKAA 4P6IC 4XPWA 1NFOA 1DOVA 5GPGB 2R7OA
chains in the Genus database with same CATH topology
4Z9JA 1LIHA 1WASA 2LIGA 4H54A 2ASRA 4Z9IA 3ATPA 1VLTA 4Z9HA 3T9OA 1VLSA 1JMWA 1WATA 2D4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9J A;  1LIH A;  1WAS A;  2LIG A;  4H54 A;  2ASR A;  4Z9I A;  3ATP A;  1VLT A;  4Z9H A;  3T9O A;  1VLS A;  1JMW A;  1WAT A;  2D4U A; 
#chains in the Genus database with same CATH topology
 3RQF A;  3U2L A;  1U89 A;  4CS7 A;  4U5E E;  3ZVR A;  5JVE A;  1FNT c;  2W9Y A;  3HJC A;  2X51 A;  3LNR A;  3RFY A;  3V5Y A;  3CEX A;  2J9V A;  3RW0 A;  5L0I A;  1TFO B;  1Y6D A;  3B29 A;  4XEF A;  1NU7 D;  4HE8 D;  3TK0 A;  2J9U A;  3B0V C;  5DS5 A;  1BDJ B;  3S27 A;  1JOG A;  3DMD A;  1E85 A;  3L8I A;  2IXO A;  4PJM A;  1LM3 B;  3ZG1 A;  1WWP A;  4FES A;  3RIP A;  3TQO A;  4GYT A;  4BJ6 C;  4CIP A;  4GEH A;  3MYI A;  1LS4 A;  4WJ0 A;  3TD7 A;  2J7P D;  2AU5 A;  2ASR A;  1QSP A;  2XLD A;  4OD5 A;  4XQ1 A;  3G4Z A;  1GGQ A;  3RYL A;  3HLZ A;  4G0H A;  4DVY P;  3X1O A;  2YVK A;  3JTL O;  2VCA A;  4PJL A;  1VB5 A;  5D91 A;  3RVZ A;  5BQG A;  4DBR A;  2XXA A;  2EPN A;  3LJB A;  4JZA A;  4YL0 A;  1YA9 A;  2EPL X;  4MVQ A;  1LVK A;  4MTF A;  3SNH A;  3WHN A;  5BQH A;  5A6B D;  1A7D A;  4C7O B;  3UMI A;  4N06 A;  4JC7 A;  5KYY B;  3NKD A;  1O87 A;  2A68 F;  2KJG A;  2VCB A;  5L0F A;  1HE1 A;  1HW2 A;  5COG A;  1NU9 C;  2B0J A;  2PFD A;  3EHM A;  5A69 A;  5L3Q A;  1VLT A;  5EGY A;  3H2U A;  1G5Z A;  5EHH A;  4YL1 A;  5T3T A;  2LP4 A;  3EZI A;  4BG0 A;  4PR9 A;  5B3S C;  5DS4 A;  5KYN A;  2XL6 A;  2WL8 A;  1NFN A;  2H7B A;  2KC3 A;  3ITF A;  3QTH A;  1OXK A;  5EK0 A;  3V7O A;  2EIK C;  3T9O A;  3EGD A;  1WGW A;  5JT4 A;  1Z7Q c;  1EI7 A;  3FXH A;  2M64 A;  2H7O A;  3X2Q C;  3W4Y A;  2AVK A;  2H8A A;  1C03 A;  3LS1 A;  3DAF A;  2ZPA A;  4JJF A;  1JR8 A;  1ZW3 A;  4FX5 A;  1CGO A;  1FMW A;  2P6V A;  2YLG A;  4JCH A;  3T6G B;  4AE4 A;  4E17 A;  3HKK A;  3VYW A;  1CGM E;  1XZQ A;  1YYJ A;  1T01 A;  4CS8 A;  1A7E A;  2YL0 A;  4KNW A;  5AC5 A;  2EPO A;  3G4X A;  2R7S A;  3KMI A;  4DJ9 A;  5L0C A;  1NG1 A;  1ZHY A;  1KU2 A;  4I44 A;  4KNV A;  3NMK A;  3JZ0 A;  2R7Q A;  3R2P A;  4O7G A;  1ORJ A;  3HNI A;  4CSA A;  2JX0 A;  2JPU A;  1YJG A;  1E84 A;  2YHS A;  4PJJ A;  2V26 A;  4OIO F;  5A6J A;  1ZYR F;  2QY9 A;  5AC4 A;  1E83 A;  1YZC A;  2HV6 A;  4JUR I;  4OIR F;  2R7U A;  2OKU A;  1VTM P;  4PK4 A;  3C18 A;  3C8Z A;  4YN0 B;  1WTY A;  2P7V A;  2XS1 A;  2C03 A;  3JYY A;  3AQB A;  1GM5 A;  2XLW A;  1G4W R;  2ZXR A;  3WG7 C;  4BJ6 A;  5L0G A;  2EIN C;  2W45 A;  3K1H A;  4G7Z F;  2IXN A;  4Q5S F;  3KPH A;  3T6J A;  4U5D E;  1KTM A;  4YT2 A;  3ASO C;  1TQG A;  3JYH A;  3LUT B;  3QVZ A;  2XLV A;  2AWY A;  3O39 A;  2NUT B;  5T1D B;  3IQ5 A;  2NPU A;  3W2W A;  2J0W A;  3EPV A;  3EFO A;  3FDQ A;  4EBK A;  4WGY A;  1AVO B;  2WVQ A;  2KNH A;  3EGD B;  4ULV A;  1MMD A;  3SEO A;  1D0Z A;  2WZG A;  4AL0 A;  3EGX A;  4YT4 A;  1XZP A;  4CS9 C;  5JLI A;  1RJ9 B;  3GM1 A;  2LFD A;  4EBB A;  2AP3 A;  1W2W A;  4XTK A;  2XL8 A;  4BJ1 A;  4C3E A;  3FAJ A;  1QVX A;  1OW6 A;  3T6B A;  1I4Z A;  2IXM A;  2XM4 A;  3NMJ A;  4D4X A;  4IAQ A;  1A0B A;  1Q0K A;  1C17 M;  2R25 A;  5BQI A;  4AE4 B;  4EBJ A;  3AJM A;  4G7H F;  3TJ5 A;  3Q7G A;  5JS5 A;  2WVN A;  2A0U A;  3L0I A;  1MQV A;  2KQ9 A;  3AGU A;  1VLS A;  1M56 C;  2UUH A;  4MVS A;  4AX2 A;  5JRA A;  2RSE B;  1T6I A;  1WAS A;  3U8V A;  4C3D A;  4A2N B;  3ASN C;  4RD9 A;  4WGZ A;  1DOW A;  4ZLD A;  3RKO F;  1Q0G A;  1Q0F A;  3JSZ A;  2DYS C;  1OR3 A;  2A69 F;  2KW3 C;  3GEH A;  4LLC A;  2FAP B;  1M2O A;  2R9R B;  5L0H A;  5A6K A;  3KYJ A;  2OG2 A;  2OU6 A;  1E86 A;  2CGE A;  4JW1 A;  1TWH A;  4NQF A;  3UMH A;  4K0D A;  3EH1 A;  3TOM A;  4E7Z A;  3QVY A;  1OCZ C;  3EZH A;  3ATP A;  3U0C A;  4O79 A;  3C8G D;  2CCY A;  3CQZ A;  4G7O F;  1Z23 A;  1N1C A;  1ZHT A;  4U5F E;  1D0Y A;  5KYU A;  4W8P A;  1LI5 A;  2PNO A;  3DM9 B;  3S90 A;  1EA8 A;  1GQA A;  3IPM O;  3OA1 A;  4MVR A;  2QE9 A;  3MFN A;  1Z5Z A;  2GDC A;  2XL4 A;  3M4B A;  3OWT A;  1WN0 A;  3Q6N A;  4U5C E;  2R7X A;  1APC A;  2DI3 A;  4YWQ A;  2CNW D;  2YZS A;  3AG2 C;  4E0I A;  1MNE A;  2GAQ A;  2YLI A;  3EFO B;  3EG9 A;  1YYX A;  5DLJ A;  3KH2 A;  2I15 A;  4LER A;  1JPJ A;  3K1I A;  3N24 A;  4Z9I A;  3V5X A;  3VAY A;  3M79 A;  1OCC C;  2Z15 A;  1CGN A;  3DAG A;  3EGX B;  4EHP A;  4MTO A;  1NBB A;  2W4M A;  2HS5 A;  3QW1 A;  4OD4 A;  2BC5 A;  1ZVZ A;  1XWJ A;  4Z9J A;  4F4B A;  1U0B B;  2OJE D;  3DE9 A;  1R5I D;  3VRC A;  3ZSU A;  1GS9 A;  1OQC A;  3C8G A;  4QDL A;  3B0P A;  4LDQ A;  4NTB A;  3OEO A;  3RF3 A;  3MLG A;  1V74 B;  1LKX A;  4BEJ A;  1MMG A;  1ZU4 A;  4K1O A;  4XPY A;  1YZA A;  2IYL D;  3UNG C;  4BJ5 A;  4JEB A;  1RKE A;  5CI8 A;  2CNW A;  4EUK B;  4HFK B;  3DI5 A;  4LDK A;  1D1A A;  3PCV A;  2XM0 A;  3K6B A;  4MVO A;  3M15 A;  3KYI A;  5F28 E;  3IEE A;  1SMY F;  3NRH A;  3NDB B;  2HJM A;  3DD7 A;  4I1O B;  4JTC B;  3SXK A;  3KL4 A;  1RXQ A;  2C04 A;  2HKV A;  1LI7 A;  3DJU B;  2G62 A;  4J7T A;  3LEO A;  3B9Q A;  2OQM A;  4U5B E;  2PBE A;  4KC9 A;  1Q0M A;  3VF0 A;  3ECS A;  1U6H A;  5L0D A;  3NMI A;  4MW3 A;  5T3W A;  2YEV A;  4N6H A;  1FMV A;  3FAP B;  2CDQ A;  1VYI A;  2LSE A;  2KSF A;  4IWB A;  3ZWI A;  2EPM X;  2L6H A;  2KYH A;  2L9J A;  2L81 A;  1RKC A;  2LQG A;  2WB7 A;  2XRH A;  3MX3 A;  4LLE A;  4O6N A;  4P9T A;  3SP1 A;  5B3I A;  1LS1 A;  1OW8 A;  3DE8 A;  2PP4 A;  2PF4 E;  3EQL F;  4IAO A;  2AWC A;  2J0X A;  5D92 A;  1NSG B;  3EG9 B;  4FWV A;  4L6R A;  5A6A A;  4FAP B;  3W8H A;  1OXB A;  2EIL C;  2FGY A;  1OR2 A;  4YK5 A;  2QNL A;  3T4R A;  4I3M A;  2BE5 F;  256B A;  4MTG A;  1T6U A;  4LAC B;  3ABL C;  1CPR A;  3S9O A;  1SYQ A;  1MMN A;  4DRI B;  2Q9C A;  1JPN A;  1IZM A;  2FFH A;  2J8W A;  2YKZ A;  3C8G B;  3O55 A;  5DVW A;  3TJ6 A;  2XXA B;  3F47 A;  4PJN A;  2IOQ A;  2ETS A;  3S0X A;  2XLO A;  4JTA B;  3G50 A;  3KKB A;  1SF8 A;  4CIH A;  3JSE O;  4CJO A;  3AG1 C;  2Q7R A;  2HUJ A;  3L1M A;  3I5P A;  3ABM C;  3PMR A;  3HNL A;  2A6H F;  3RQG A;  3QW0 A;  3LEV A;  1RKE B;  4KI2 A;  1J8M F;  3PHF 2;  3FMS A;  2YL7 A;  4O6M A;  4C3B A;  4CX9 A;  1FTS A;  1G8X A;  4JTD B;  4P9F A;  1HMO A;  4U9D A;  3F46 A;  2R7T A;  4IGG A;  1OW7 A;  3CSK A;  3S28 A;  3NYM A;  1FFH A;  4MW8 A;  1Y4C A;  1H9T A;  1LPE A;  2XLH A;  4M63 A;  1TWA A;  5TJ5 E;  1EQ1 A;  2GWW A;  1D0X A;  1YAU O;  1TWG A;  2OOC A;  1FFT C;  3B0U X;  2Y3D A;  1F1M A;  2HSB A;  5COF A;  3U2M A;  2YLD A;  4E7S A;  2R02 A;  3K66 A;  4U5G A;  1ZHW A;  2LFF A;  1S05 A;  4YT5 A;  5IY5 C;  2YQY A;  5DQT A;  4NCQ A;  2OEX A;  2VCC A;  4XLN F;  4UDV A;  4EWC A;  4NTA A;  2HSQ A;  4MS2 A;  4JRZ A;  1V4A A;  2D4U A;  3V5Z A;  3UGP A;  2EIM C;  5B1A C;  1HMD A;  1JAF A;  2OCC C;  1BR1 A;  4MND A;  1RMV A;  5FCL A;  4H4K C;  4R32 A;  3L8J A;  4U9E A;  2LIG A;  1BZ4 A;  1ORS C;  2M4E A;  3GWN A;  4MVZ A;  4CDA A;  1M6T A;  3E70 C;  3MBG A;  1TFK B;  1O5H A;  2GFH A;  1H7I A;  2P61 A;  3FVY A;  1A7V A;  1HW1 A;  1Q0D A;  3HNJ A;  3LS0 A;  1QQ3 A;  1SR2 A;  2HMQ A;  3JRM O;  4JJG A;  2LK4 A;  3S84 A;  3TUL A;  4OIP F;  3POV A;  2Q00 A;  3LLI A;  2IM8 A;  4CS8 C;  1BR2 A;  2J45 A;  4PAC A;  1M2V A;  1RCP A;  3UGO A;  2R7V A;  1L3P A;  2Q4F A;  1QZX A;  3W8I A;  2VB6 A;  1K05 A;  5JP7 A;  2WZL A;  3NKE A;  2HFI A;  2J9W A;  4U5H A;  4RBN A;  4BEM J;  3J06 A;  1H9G A;  2OEV A;  2DGJ A;  3EJN A;  4PFP A;  4CDY A;  1FR0 A;  4B6I A;  4MVM A;  1YLM A;  4JCZ A;  1ZHZ A;  4YL3 A;  1Z63 A;  1WAT A;  3O6X A;  3LES A;  3U5S A;  3Q7L A;  2QLA A;  2QTV A;  2Y3B A;  4CSA C;  1LIH A;  2NUP A;  2CYD A;  4ANJ A;  2Y3G A;  1ZZP A;  2UUI A;  2ZXW C;  2XLM A;  1G4U S;  4N4W A;  5HV9 A;  3B71 A;  3GEE A;  3SXM A;  4Q4Z F;  1NZE A;  2YRF A;  4ER9 A;  1J8Y F;  3ZC4 A;  2W4B A;  4CJG A;  1ORY A;  4EKW A;  4HEA J;  5BUO A;  2ZXP A;  1H6G A;  1YA7 O;  3GWL A;  3LLK A;  4DRJ B;  5KYX A;  2NSG A;  2J46 A;  3GM2 A;  3ZIB A;  2RD9 A;  1OKK A;  3U9M A;  2VC9 A;  2J9B A;  4G78 A;  3SXZ A;  2VAS A;  1TWC A;  3GOR A;  5COM A;  2PX3 A;  1HY5 A;  3GM3 A;  3NYJ A;  3WAQ A;  3IQ6 A;  3I5Q A;  3HNK A;  4NTF A;  4CS9 A;  5E3A A;  2P0N A;  3C63 A;  5KYW A;  5F5H A;  4H54 A;  2ZD9 A;  1ZHX A;  1Z3I X;  4JVS A;  1FAP B;  1QKR A;  4ULW A;  1I4Y A;  1LE2 A;  2BL2 A;  3LAY A;  2X0C A;  3QMK A;  1UG7 A;  1L7C A;  1UFB A;  1A41 A;  1PD1 A;  2JD3 A;  3M1C B;  1AEP A;  2B0H A;  2R05 A;  1YAR O;  2HMZ A;  3BRJ A;  4IB4 A;  3EHN A;  1AUE A;  1R4T A;  2EIJ C;  2YWA A;  1V55 C;  5KYU B;  4NY3 A;  2Y3H A;  2A1D D;  1YVI A;  4J7Y A;  1VYK A;  2G3V A;  2Y39 A;  1M2V B;  1HE9 A;  2J7P A;  2ZXO A;  4YJW A;  3W2V A;  3RH3 A;  3AG4 C;  3H65 A;  3JRT A;  1BBH A;  3FOP A;  3ZTM A;  1ST6 A;  2NUT A;  4MVU A;  1KNY A;  4AL1 A;  1VOM A;  3GOD A;  3CZ6 A;  3IHU A;  4HFF B;  4LDR A;  4AK9 A;  4OIQ F;  1QLE C;  1ZW2 A;  5FZT A;  1E2X A;  3O10 A;  3ZQV A;  3ABK C;  3ZQY A;  1RJ9 A;  2V3C C;  2QUP A;  1MMA A;  2NUP B;  3AOU A;  2VH3 A;  3I4U A;  1LE4 A;  1JRA A;  3MYF A;  1Z6A A;  2DB4 A;  4DVZ A;  4KBL A;  4OIN F;  4DXW A;  2ICW G;  2Q9B A;  3FHD A;  3VM6 A;  5A6B A;  3N0T A;  4QI2 A;  4ONS A;  4Z9H A;  4E18 A;  4NC3 A;  1C02 A;  1T6Q A;  4CDV A;  2R7R A;  3US6 A;  3DJN B;  4DOZ A;  3AGT A;  3DM5 A;  4QI0 A;  4K7B A;  4E0H A;  1PD0 A;  3JT1 A;  1IW7 F;  2XS8 A;  4Q7C A;  5KYX B;  3WOD F;  4O6Y A;  2R03 A;  2I8B A;  5JUA A;  2WVO A;  4XEV A;  4DBQ A;  3DWW A;  1TKN A;  3U9J A;  5DS6 A;  1K04 A;  2H7V C;  2TMV P;  5DQZ A;  4JEA A;  4W8K A;  2R7W A;  1BR4 A;  1MND A;  2EPK X;  2MYS A;  3NYL A;  5L0J A;  3C62 A;  3M4C A;  5KYW B;  3UR3 C;  4RDA A;  2Y69 C;  3K1I C;  2MWQ A;  2MHR A;  2OJQ A;  3R7C A;  5L3V A;  1QPU A;  2L7A A;  2LCH A;  3C7J A;  2P1A A;  1T9K A;  4N6C A;  3ZDL A;  4BPM A;  1D1C A;  1S7Z A;  4JKV A;  4EIY A;  5HSW A;  3JCU Q;  3IQC A;  4XEK A;  2HZ8 A;  2XSE A;  3S29 A;  3U3F A;  5F5F A;  4IRU A;  1YDI A;  3PDM P;  2G3K A;  1VMA A;  4J32 B;  4JIO A;  3DXJ F;  4PFO A;  2GA0 A;  3Q6M A;  4XWJ A;  1TR2 A;  1OCR C;  5B1B C;  3UMK A;  2IXP A;  1JMW A;  3SYN A;  1EKY A;  3A9C A;  4X0R A;  2A0B A;  4D4N A;  1SZI A;  2XLE A;  2WZF A;  4BJ5 C;  2CW0 F;  3AQC A;  2KK1 A;  3CAX A;  4GQH A;  4XLP F;  3IQT A;  1T5O A;  2YL1 A;  3DZA A;  1V54 C;  3K7D A;  4CBE A;  1PV3 A;  4YT8 A;  2D5R B;  3GEI A;  3FOO A;  1M57 C;  1ZU5 A;  2IBF A;  2L6F A;  1K40 A;  3EH2 A;  3GAN A;  4IAR A;  4MQ9 F;  1VK5 A;  3SXY A;  3TOL A;  4ZLC A;  4WAB A;  5JSL A;  4BJT A;  2NG1 A;  3QZC A;  1D1B A;  2NSF A;  5AGF A;  2LD6 A;  1PCX A;  2HJ3 A;  4JE9 A;  5E2Q A;  1NLX A;  2PX0 A;  2KGO A;  3RVY A;  5E33 A;  3H2V A;  2L6G A;  3AG3 C;  4A4A A;  3NG1 A;  2O9X A;  3E9V A;  3L34 A;  1WOL A;  3U3B A;  4C7O A;  3K33 A;  3LNM B;  4IJJ A;  2E87 A;  5KYY A;  5E3C A;  4J30 B;  3ZTZ A;  1I5N A;  1OCO C;  1B68 A;  2Q9A A;  1O3U A;  5CIV A;  2HV7 A;  3HTK C;  4I1M A;  5CI9 A;  1OKK D;  2A6E F;  4XPX A;  5K0I A;  2F22 A;  3N2Z B;  2YL3 A;  2Q3T A;  3SZR A;  3U8P A;  2DYR C;  3RQE A;  3BEH A;  4DRH B;  3A11 A;  1CPQ A;  3DKA A;  4P6I C;  4XPW A;  1NFO A;  1DOV A;  5GPG B;  2R7O A; 
#chains in the Genus database with same CATH homology
 4Z9J A;  1LIH A;  1WAS A;  2LIG A;  4H54 A;  2ASR A;  4Z9I A;  3ATP A;  1VLT A;  4Z9H A;  3T9O A;  1VLS A;  1JMW A;  1WAT A;  2D4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...