2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core-binding factor, ML1-ETO
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2H7BA 2P6VA 2PP4A 2KNHA
chains in the Genus database with same CATH superfamily
1H9GA 2Q00A 4IB4A 5EK0A 1D1BA 1UFBA 1VLTA 1O3UA 2EPMX 3WAQA 1Z23A 3ZVRA 1A0BA 2A6EF 3NMKA 2D4UA 4D4XA 1G4US 3L1MA 1T01A 2XLEA 2G62A 1PCXA 3C8ZA 4E18A 4G7ZF 2J0WA 2P1AA 1ZU5A 2KJGA 3U9MA 2R7XA 4OIQF 3QVZA 1EA8A 1CGNA 2DGJA 3EGDB 3LNMB 5KYUA 4JEBA 2J7PA 2L6HA 1HMOA 2NPUA 3FDQA 1QPUA 3OWTA 1ZHXA 4Q5SF 5B3SC 1H9TA 1HW2A 1ZU4A 1YDIA 1W2WA 2LP4A 3KPHA 2AU5A 2IXMA 4JTCB 2BL2A 4RBNA 4YWQA 3QW0A 2J0XA 3E9VA 4F4BA 1Z3IX 2EIJC 1RKEA 4W8KA 2KYHA 1APCA 4AE4B 1U89A 1WOLA 2VC9A 5CI8A 3JT1A 3FOPA 4PFOA 4BJ5C 4D4NA 1OR2A 1V4AA 3GEEA 5KYWA 1ORSC 1C03A 3L8IA 1JPJA 1Y6DA 3CZ6A 2AWCA 4JVSA 4X0RA 3SXYA 1ZHWA 4IAQA 4AK9A 3NYJA 3AG1C 2R05A 4G78A 1MNEA 1NG1A 1FR0A 2UUIA 1FFTC 5T1DB 4BJTA 5A6JA 1K04A 1YA9A 4P6IC 2F22A 2R7WA 1FTSA 1OCCC 2H7VC 2XL8A 4MVOA 4L6RA 4MNDA 3LNRA 4CSAC 2EIKC 2YL3A 1GS9A 1G5ZA 2ASRA 3NKDA 1F1MA 3VF0A 1TWHA 4XEKA 4G7HF 3BRJA 2J9BA 3FVYA 4DRJB 4HEAJ 3W2VA 3U8VA 3PHF2 2FGYA 2NUTB 4CS7A 2Q9AA 1QKRA 1YZAA 1Q0KA 2HFIA 2OG2A 3NYLA 4H54A 1YVIA 2YLDA 4WGZA 4MTFA 1ST6A 1DOVA 2XRHA 3RQEA 1TWCA 2ZD9A 1FNTc 2VH3A 4IARA 3O6XA 3ITFA 4P9FA 2AWYA 3G50A 5DS6A 5DQZA 2GFHA 1D0YA 3K66A 1OCZC 3PCVA 5JS5A 2HMZA 3RF3A 1T6IA 1YA7O 2PFDA 3U2MA 2QUPA 4MQ9F 2OQMA 2OEXA 5D92A 1LE2A 2KSFA 4KBLA 2KC3A 2QY9A 3I5QA 3ASOC 3F47A 5A69A 5BQGA 1S05A 5JSLA 4GQHA 5JP7A 4CS9A 5F5FA 2A1DD 4JTDB 2QE9A 4OD5A 3LLKA 2J9WA 4AE4A 3C63A 2HUJA 4CDAA 2G3KA 3NKEA 2OCCC 4DVZA 4NTAA 3QVYA 4CX9A 5BQHA 5L0HA 3F46A 1CGME 1D0XA 1N1CA 2OEVA 2HJ3A 4KNVA 2H7OA 3BEHA 3T6BA 4CDYA 4I3MA 2GDCA 2J9UA 3ECSA 3EGXB 5A6AA 1JAFA 1YLMA 4Q7CA 3UGPA 4NY3A 1BR2A 3N2ZB 4H4KC 1H6GA 1L3PA 4NC3A 4PJMA 1ZZPA 4EIYA 4BEJA 1QVXA 2ZXOA 4AL0A 1VOMA 2KGOA 4YL3A 2R7QA 3U3BA 3TJ5A 1G4WR 4EBJA 2Q7RA 2XLHA 4KI2A 2E87A 4AL1A 1NSGB 4U5FE 2M64A 3C8GD 4HFKB 2W4BA 3B71A 4BJ6C 2NUTA 4MTGA 2KK1A 2PP4A 4OINF 2KW3C 2O9XA 3DZAA 4U5DE 1M2VB 5E2QA 1OXKA 2HV7A 2LQGA 4LDRA 4WGYA 5L3VA 1Z7Qc 1KU2A 3IEEA 1Q0DA 1FMWA 3DM9B 2MYSA 5COFA 4J7YA 1LE4A 4B6IA 3CQZA 3OEOA 2HMQA 2HSQA 3M1CB 5AGFA 1TKNA 4XEVA 4XPWA 1VK5A 2Y3HA 1SZIA 3X2QC 4OIPF 4JJGA 5T3WA 1O87A 4E0IA 1E2XA 4PR9A 3W8HA 3ABKC 3EFOB 2D5RB 4FWVA 1RJ9B 4XWJA 4U5CE 5FZTA 3EZHA 2R7VA 4I1MA 2QLAA 2YWAA 4ZLDA 4DBQA 5HV9A 3KL4A 1OQCA 4Z9JA 1OR3A 3EH1A 3NG1A 3RQGA 4DJ9A 5JVEA 3GODA 2HJMA 2YLIA 3R2PA 3WODF 3RVYA 4NTBA 3DJUB 4CSAA 1OXBA 1HE9A 2P0NA 2FFHA 1LIHA 4YT2A 3EGXA 3AJMA 3HNIA 1LI7A 1BR4A 1OKKD 1RKCA 1Z6AA 3DI5A 3NMIA 2I8BA 4N6CA 1M2OA 4EWCA 2ZXPA 1NZEA 3AOUA 5A6BA 2XL4A 3K33A 2R7SA 4JC7A 4CS8C 4UDVA 4BJ1A 2CNWA 1J8YF 2L6GA 2R9RB 3E70C 2PBEA 1VYKA 2IXNA 3PMRA 4O6NA 1L7CA 1OCOC 1V54C 4FAPB 1J8MF 1Y4CA 1Z63A 4W8PA 2CYDA 1MMGA 3JTLO 3NRHA 2R7TA 2WVQA 1UG7A 3UR3C 1CPRA 5B1AC 3WHNA 3TQOA 5JRAA 3SXMA 4BEMJ 2YKZA 3MX3A 3AQBA 2WZFA 1ORYA 4ULWA 3TULA 3U0CA 2CCYA 2R02A 2C03A 1M2VA 4J32B 2OKUA 4MS2A 2XLDA 2LIGA 2LK4A 3IQ6A 4PJNA 4QDLA 4RDAA 3ZG1A 3ZTZA 3HLZA 2IM8A 3B9QA 5BUOA 3DJNB 3K1HA 3SXZA 3MLGA 1RCPA 2CDQA 2P61A 1AVOB 1ORJA 4N6HA 4FESA 4DXWA 4EBKA 2BE5F 2I15A 4PACA 2IBFA 1NLXA 2J7PD 3ZTMA 2HV6A 1WATA 1ZHYA 2WVNA 3U2LA 2YVKA 1VYIA 3MBGA 3NYMA 3G4ZA 4OD4A 3EZIA 3V5XA 3KYIA 2YQYA 3EFOA 5AC4A 4DBRA 3M79A 1RJ9A 1SYQA 3DMDA 1G8XA 4ULVA 1PD0A 3S9OA 3W4YA 2Y3GA 4ANJA 5KYYB 2B0JA 1E84A 2VB6A 2IOQA 2LD6A 1WTYA 1ZYRF 3Q7LA 3RVZA 1JMWA 3VM6A 3I4UA 1GQAA 1FAPB 2L9JA 4JZAA 4MVZA 3VAYA 5F28E 3W2WA 2CW0F 2V26A 5DQTA 3LEVA 5T3TA 4C3EA 3RQFA 2EIMC 2A0BA 3IQTA 3L0IA 3MYFA 4JURI 5E33A 1U0BB 4A4AA 4IWBA 3DD7A 4ONSA 4EUKB 3POVA 2XS1A 3EGDA 1TR2A 2EPKX 2MHRA 4CBEA 2EPLX 2P6VA 4GYTA 4JEAA 4BJ6A 5L0JA 4QI0A 4LLEA 2FAPB 3DE8A 4YN0B 5DLJA 4JTAB 1DOWA 4PJJA 4N06A 1LM3B 3LJBA 5L3QA 1QLEC 1E83A 3S0XA 1ZW2A 5BQIA 4EHPA 4YT5A 4J7TA 2ZPAA 1A7EA 1V74B 3MYIA 3O55A 3V5YA 3UMIA 5FCLA 1T5OA 1T9KA 3HNKA 1MQVA 2Q4FA 2A0UA 5L0FA 3T9OA 3Q6MA 2NSFA 3DAGA 1QSPA 2ICWG 4MVUA 4RD9A 3UNGC 1EKYA 2HSBA 3U5SA 5L0GA 4CJGA 2HKVA 1LS4A 5F5HA 1R5ID 2XXAB 1GM5A 2VASA 4BG0A 2AVKA 3AG4C 3EJNA 4C3DA 1AUEA 4JCZA 5JT4A 4DRIB 3DAFA 4C7OB 4G7OF 2WZLA 4U5BE 1ZVZA 3ABMC 2B0HA 1IW7F 3JRTA 3JYHA 4MVQA 3T6JA 3S27A 5JUAA 4I1OB 2H7BA 4HE8D 1O5HA 1KNYA 2RD9A 1IZMA 4JJFA 3O39A 3HNLA 1CGOA 5JLIA 3NMJA 4LDKA 2NSGA 3AQCA 4PJLA 5B1BC 2XSEA 3SNHA 5KYYA 2CGEA 3CAXA 3DWWA 4JIOA 3JRMO 2EINC 4IJJA 2NUPB 4XPXA 4XEFA 3W8IA 4Q4ZF 2DYRC 4O7GA 1E85A 1MNDA 2DI3A 1Q0FA 2EPNA 2WVOA 1WASA 4JCHA 4AX2A 1MMNA 2VCAA 3RH3A 4MVSA 1YAUO 3I5PA 3T4RA 1A41A 3FAJA 2XM4A 4N4WA 3DM5A 2PX3A 3JYYA 1SR2A 4XLNF 5DS4A 3CEXA 2R03A 4DVYP 3ZIBA 2M4EA 3ABLC 1YYXA 3GWLA 4O6MA 3ZDLA 3TD7A 3MFNA 2XL6A 3ZQYA 3RKOF 2LFFA 2OOCA 1JR8A 2XM0A 4BJ5A 4OIRF 4YL1A 1U6HA 2QNLA 5E3CA 2W45A 3EG9B 1HW1A 4XPYA 4LLCA 2ZXWC 2HS5A 2KQ9A 3C18A 3TOMA 1NBBA 3EHNA 4MVRA 1HE1A 1A7VA 1RXQA 4HFFB 2P7VA 1OW6A 2JD3A 4XTKA 3IQCA 3GM1A 3KYJA 3RW0A 3ATPA 4WJ0A 2XXAA 1BBHA 1QQ3A 3UMHA 1WN0A 3TJ6A 3ZSUA 3B0UX 1B68A 4C7OA 4J30B 2L81A 4CS9C 4DRHB 4CIHA 2J9VA 3JSEO 3M4BA 5CI9A 1EI7A 1HY5A 1H7IA 4IAOA 3H2VA 3EH2A 4EKWA 2R7RA 1LPEA 4YT8A 1YARO 2YLGA 3PDMP 2JPUA 2YEVA 3EPVA 3V7OA 3ZQVA 3H65A 256BA 1ZHZA 1OW7A 2Y3DA 1PV3A 3AGUA 2NUPA 2Q3TA 1BZ4A 3L8JA 1JPNA 1VMAA 1NU9C 1TQGA 2Z15A 4KNWA 1D1CA 4MTOA 1T6QA 3EHMA 4E0HA 1SF8A 4K0DA 3Q6NA 2PX0A 2J45A 2PNOA 3O10A 5EHHA 2YL1A 1M57C 1T6UA 5DVWA 2A6HF 4E7ZA 3GWNA 4PFPA 3T6GB 5KYNA 2W4MA 2VCBA 4MVMA 2GWWA 3GM2A 2MWQA 3IQ5A 2R7OA 4O6YA 5TJ5E 3R7CA 4EBBA 5A6BD 2R25A 4XQ1A 4JE9A 2QTVA 1I5NA 1VTMP 1MMDA 4K1OA 2CNWD 3VRCA 4PK4A 3AGTA 3GEIA 2G3VA 2J8WA 3B0PA 3HKKA 2XLWA 4JKVA 5HSWA 3CSKA 1A7DA 1WWPA 1LS1A 3EG9A 3QTHA 4LACB 5D91A 3J06A 5AC5A 3K1IC 1M56C 1JOGA 3C8GB 4U5GA 5B3IA 3GANA 3RYLA 1Z5ZA 2Y39A 3JCUQ 3SP1A 1NFNA 2XLOA 2EPOA 1LVKA 4QI2A 3A11A 3M4CA 1R4TA 1ZHTA 2WL8A 4O79A 1OW8A 2Y3BA 2RSEB 3KH2A 4KC9A 3U8PA 1EQ1A 1XZQA 3AG3C 1XWJA 1TFOB 2LCHA 3QW1A 4YK5A 3SYNA 3UGOA 2AP3A 3LS1A 2Q9CA 3B29A 1I4YA 1S7ZA 2YHSA 3N0TA 4LERA 4R32A 3AG2C 2OU6A 4Z9HA 3FMSA 5A6KA 4NTFA 4U9DA 4WABA 5KYXB 5GPGB 3TOLA 3EQLF 2JX0A 2X51A 2TMVP 1CPQA 3LEOA 1BDJB 3OA1A 1KTMA 1Q0GA 2GA0A 3QMKA 3FHDA 1YZCA 3LS0A 1D0ZA 2DB4A 4MW8A 4G0HA 2KNHA 3US6A 5COMA 3X1OA 2OJQA 4GEHA 5CIVA 3LUTB 3LLIA 3VYWA 1C17M 2ETSA 2IYLD 2IXOA 2Y69C 3K6BA 4U9EA 3RIPA 1K40A 1MMAA 2GAQA 3V5ZA 1Q0MA 2VCCA 4NQFA 5IY5C 3HJCA 3NDBB 2LFDA 4CDVA 2XS8A 4DOZA 3B0VC 3G4XA 4CJOA 2YRFA 4ER9A 3FXHA 4P9TA 2A68F 5L0IA 3LESA 2ZXRA 3A9CA 4BPMA 2WB7A 3C62A 3LAYA 3M15A 5DS5A 3L34A 5L0CA 3JSZA 1SMYF 3C8GA 1WGWA 3DE9A 3Q7GA 4IGGA 4A2NB 5EGYA 2XLMA 5L0DA 3C7JA 4JRZA 1HMDA 2LSEA 1AEPA 4K7BA 4CS8A 3N24A 2C04A 3TK0A 3WG7C 3QZCA 1QZXA 1NU7D 2W9YA 3IPMO 4U5EE 3SXKA 2R7UA 1BR1A 1NFOA 4YT4A 4MW3A 3KKBA 4CIPA 1I4ZA 3GEHA 3S29A 1RMVA 2UUHA 5KYUB 5COGA 3KMIA 2BC5A 1FMVA 1OCRC 1PD1A 3GM3A 1JRAA 1TFKB 4M63A 2EILC 5KYXA 1LKXA 2HZ8A 4NCQA 3H2UA 4JW1A 2IXPA 3HTKC 3S90A 4FX5A 4LDQA 4I44A 3ZWIA 2WZGA 3K7DA 4E17A 1TWGA 3GORA 3JZ0A 1E86A 1V55C 2DYSC 3IHUA 4YJWA 1RKEB 2YL0A 4Z9IA 4ZLCA 3HNJA 3DKAA 5K0IA 3U9JA 4OIOF 2L6FA 2A69F 3UMKA 5KYWB 1K05A 2J46A 2X0CA 1OKKA 2PF4E 2H8AA 3SZRA 4XLPF 3K1IA 1YJGA 3ASNC 2XLVA 2V3CC 4U5HA 1XZPA 3FAPB 3S84A 1C02A 2L7AA 1VLSA 4IRUA 1TWAA 3RFYA 4E7SA 2YL7A 3SEOA 3DXJF 1LI5A 1D1AA 1VB5A 3FOOA 1M6TA 1ZW3A 4YL0A 5E3AA 3ZC4A 4C3BA 1GGQA 2OJED 2Q9BA 2NG1A 2YZSA 3U3FA 3S28A 1YYJA 1FFHA
chains in the Genus database with same CATH topology
1D1BA 1Z23A 3ZVRA 2A6EF 4G7ZF 2G62A 1PCXA 2J0WA 1ZU5A 2KJGA 2R7XA 4OIQF 2DGJA 3EGDB 5KYUA 2J7PA 3FDQA 3OWTA 1ZHXA 4Q5SF 5B3SC 1ZU4A 1W2WA 2IXMA 4RBNA 4YWQA 2J0XA 3E9VA 4F4BA 1Z3IX 2EIJC 4W8KA 4AE4B 5CI8A 3JT1A 4BJ5C 4PFOA 5KYWA 1JPJA 3CZ6A 4JVSA 4X0RA 1ZHWA 4AK9A 3NYJA 3AG1C 1MNEA 1NG1A 1FFTC 5T1DB 4BJTA 4P6IC 2R7WA 1FTSA 1OCCC 2H7VC 4MNDA 3LNRA 4CSAC 2EIKC 3NKDA 1TWHA 4G7HF 3FVYA 4HEAJ 3W2VA 3PHF2 2FGYA 2NUTB 4CS7A 2Q9AA 2OG2A 3NYLA 1ST6A 2XRHA 1TWCA 2VH3A 3O6XA 3ITFA 5DS6A 5DQZA 2GFHA 1D0YA 3K66A 1OCZC 2PFDA 4MQ9F 5D92A 4KBLA 2QY9A 3I5QA 3ASOC 3F47A 4CS9A 5F5FA 2A1DD 4OD5A 3LLKA 2J9WA 4AE4A 2G3KA 3NKEA 2OCCC 4DVZA 3F46A 1D0XA 1N1CA 4KNVA 2H7OA 3T6BA 2R7SA 4I3MA 2J9UA 3ECSA 3EGXB 3UGPA 4Q7CA 4NY3A 1BR2A 3N2ZB 4H4KC 4PJMA 4BEJA 2ZXOA 1VOMA 2KGOA 2R7QA 4KI2A 2E87A 4U5FE 4HFKB 4BJ6C 2W4BA 2NUTA 2PP4A 4OINF 2KW3C 2O9XA 3DZAA 4U5DE 1M2VB 5E2QA 2HV7A 4EBBA 5L3VA 1KU2A 3IEEA 3DM9B 1FMWA 2MYSA 4B6IA 3CQZA 3OEOA 3M1CB 1TKNA 1VK5A 2Y3HA 1SZIA 3X2QC 4OIPF 4JJGA 5T3WA 1O87A 3W8HA 3ABKC 3EFOB 2D5RB 4FWVA 1RJ9B 4XWJA 4U5CE 3EZHA 2R7VA 4I1MA 4ZLDA 4DBQA 3KL4A 3EH1A 3NG1A 3GODA 3WODF 3DJUB 4CSAA 2FFHA 4YT2A 3EGXA 4OIRF 1BR4A 1OKKD 1Z6AA 4EWCA 2I8BA 5EGYA 1M2OA 2ZXPA 1NZEA 2XL4A 3K33A 4CS8C 4BJ1A 2CNWA 1J8YF 3E70C 3POVA 1VYKA 2IXNA 3PMRA 4O6NA 1OCOC 1V54C 1J8MF 1Z63A 1MMGA 3NRHA 2R7TA 2WVQA 3UR3C 5B1AC 3MX3A 3AQBA 2WZFA 4ULWA 2C03A 1M2VA 4J32B 4PJNA 4RDAA 3ZG1A 4QDLA 3HLZA 3B9QA 5BUOA 3DJNB 3K1HA 3MLGA 2CDQA 4FESA 2BE5F 2J7PD 2HV6A 1ZHYA 2WVNA 1VYIA 3NYMA 4OD4A 3EZIA 3EFOA 4DBRA 1RJ9A 3DMDA 1G8XA 1PD0A 2Y3GA 4ANJA 5KYYB 2B0JA 2VB6A 2IOQA 1ZYRF 3Q7LA 3I4UA 2L9JA 4JZAA 3W2WA 3VAYA 4C3EA 2CW0F 2V26A 5DQTA 3LEVA 5T3TA 2EIMC 3L0IA 4JURI 5E33A 4IWBA 3DD7A 3EGDA 1TR2A 4CBEA 2P6VA 4GYTA 4BJ6A 4QI0A 4LLEA 4YN0B 5DLJA 4PJJA 5L3QA 4N06A 3S0XA 3LJBA 1QLEC 4YT5A 2ZPAA 3UMIA 5FCLA 3Q6MA 3DAGA 4RD9A 3UNGC 5F5HA 2XXAB 2VASA 4BG0A 3AG4C 3EJNA 4C3DA 4G7OF 4C7OB 3DAFA 2WZLA 4U5BE 3ABMC 3JYHA 3T6JA 1IW7F 3JRTA 3S27A 4I1OB 2H7BA 4HE8D 1O5HA 4JJFA 1IZMA 3O39A 3AQCA 4PJLA 5B1BC 2XSEA 3SNHA 5KYYA 2CGEA 2EINC 4IJJA 2NUPB 3W8IA 4Q4ZF 2DYRC 4O7GA 1MNDA 4AX2A 2WVOA 4JCHA 1MMNA 3RH3A 3I5PA 3T4RA 3FAJA 5DS4A 3DM5A 2PX3A 4XLNF 4DVYP 3ZIBA 2M4EA 3ABLC 4O6MA 3TD7A 3RKOF 4BJ5A 5E3CA 2W45A 3EG9B 4LLCA 2ZXWC 2KQ9A 3EHNA 4HFFB 2P7VA 2JD3A 4XTKA 4WJ0A 2XXAA 3UMHA 3ZSUA 3B0UX 4C7OA 4J30B 2L81A 4CS9C 4CIHA 2J9VA 5CI9A 4IAOA 2R7RA 3EH2A 4YT8A 2YEVA 3EPVA 3V7OA 3H65A 1ZHZA 2Y3DA 2NUPA 2Q3TA 1JPNA 1VMAA 1NU9C 2Z15A 4KNWA 1D1CA 3EHMA 1SF8A 4K0DA 3Q6NA 2PX0A 2J45A 5EHHA 1M57C 5DVWA 2A6HF 4E7ZA 4PFPA 5KYNA 2W4MA 4O6YA 2MWQA 2R7OA 2QTVA 1MMDA 2CNWD 4PK4A 2G3VA 3B0PA 5HSWA 3CSKA 1LS1A 3EG9A 5D91A 4LACB 3K1IC 1M56C 4U5GA 3GANA 3RYLA 1Z5ZA 2Y39A 3JCUQ 3SP1A 1LVKA 4QI2A 1ZHTA 2WL8A 4O79A 2Y3BA 3KH2A 4KC9A 3AG3C 3SYNA 3UGOA 3LS1A 2Q9CA 3N0TA 2YHSA 1S7ZA 4LERA 3AG2C 5KYXB 3EQLF 2X51A 3OA1A 3QMKA 3FHDA 3LS0A 1D0ZA 4G0HA 2KNHA 3X1OA 4GEHA 3LLIA 3VYWA 2IYLD 2IXOA 2Y69C 3K6BA 3RIPA 1MMAA 5IY5C 3HJCA 3NDBB 4DOZA 3B0VC 2A68F 3LESA 2ZXRA 2WB7A 3LAYA 5DS5A 3L34A 3JSZA 1SMYF 1WGWA 3Q7GA 4A2NB 2LSEA 4K7BA 4CS8A 3N24A 2C04A 3WG7C 3QZCA 1QZXA 1NU7D 2W9YA 2R7UA 4U5EE 1BR1A 4YT4A 3KKBA 3S29A 5KYUB 3KMIA 1OCRC 1FMVA 1PD1A 4M63A 5KYXA 2EILC 1LKXA 4JW1A 2IXPA 3HTKC 4FX5A 4I44A 2WZGA 3K7DA 1TWGA 1V55C 2DYSC 4ZLCA 4YJWA 4OIOF 2A69F 3UMKA 5KYWB 2J46A 1OKKA 2PF4E 3SZRA 4XLPF 3ASNC 2V3CC 4U5HA 4IRUA 1TWAA 3RFYA 4E7SA 3SEOA 3DXJF 1D1AA 5E3AA 3ZC4A 4C3BA 2Q9BA 2NG1A 2YZSA 3S28A 1FFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7B A;  2P6V A;  2PP4 A;  2KNH A; 
#chains in the Genus database with same CATH topology
 1H9G A;  2Q00 A;  4IB4 A;  5EK0 A;  1D1B A;  1UFB A;  1VLT A;  1O3U A;  2EPM X;  3WAQ A;  1Z23 A;  3ZVR A;  1A0B A;  2A6E F;  3NMK A;  2D4U A;  4D4X A;  1G4U S;  3L1M A;  1T01 A;  2XLE A;  2G62 A;  1PCX A;  3C8Z A;  4E18 A;  4G7Z F;  2J0W A;  2P1A A;  1ZU5 A;  2KJG A;  3U9M A;  2R7X A;  4OIQ F;  3QVZ A;  1EA8 A;  1CGN A;  2DGJ A;  3EGD B;  3LNM B;  5KYU A;  4JEB A;  2J7P A;  2L6H A;  1HMO A;  2NPU A;  3FDQ A;  1QPU A;  3OWT A;  1ZHX A;  4Q5S F;  5B3S C;  1H9T A;  1HW2 A;  1ZU4 A;  1YDI A;  1W2W A;  2LP4 A;  3KPH A;  2AU5 A;  2IXM A;  4JTC B;  2BL2 A;  4RBN A;  4YWQ A;  3QW0 A;  2J0X A;  3E9V A;  4F4B A;  1Z3I X;  2EIJ C;  1RKE A;  4W8K A;  2KYH A;  1APC A;  4AE4 B;  1U89 A;  1WOL A;  2VC9 A;  5CI8 A;  3JT1 A;  3FOP A;  4PFO A;  4BJ5 C;  4D4N A;  1OR2 A;  1V4A A;  3GEE A;  5KYW A;  1ORS C;  1C03 A;  3L8I A;  1JPJ A;  1Y6D A;  3CZ6 A;  2AWC A;  4JVS A;  4X0R A;  3SXY A;  1ZHW A;  4IAQ A;  4AK9 A;  3NYJ A;  3AG1 C;  2R05 A;  4G78 A;  1MNE A;  1NG1 A;  1FR0 A;  2UUI A;  1FFT C;  5T1D B;  4BJT A;  5A6J A;  1K04 A;  1YA9 A;  4P6I C;  2F22 A;  2R7W A;  1FTS A;  1OCC C;  2H7V C;  2XL8 A;  4MVO A;  4L6R A;  4MND A;  3LNR A;  4CSA C;  2EIK C;  2YL3 A;  1GS9 A;  1G5Z A;  2ASR A;  3NKD A;  1F1M A;  3VF0 A;  1TWH A;  4XEK A;  4G7H F;  3BRJ A;  2J9B A;  3FVY A;  4DRJ B;  4HEA J;  3W2V A;  3U8V A;  3PHF 2;  2FGY A;  2NUT B;  4CS7 A;  2Q9A A;  1QKR A;  1YZA A;  1Q0K A;  2HFI A;  2OG2 A;  3NYL A;  4H54 A;  1YVI A;  2YLD A;  4WGZ A;  4MTF A;  1ST6 A;  1DOV A;  2XRH A;  3RQE A;  1TWC A;  2ZD9 A;  1FNT c;  2VH3 A;  4IAR A;  3O6X A;  3ITF A;  4P9F A;  2AWY A;  3G50 A;  5DS6 A;  5DQZ A;  2GFH A;  1D0Y A;  3K66 A;  1OCZ C;  3PCV A;  5JS5 A;  2HMZ A;  3RF3 A;  1T6I A;  1YA7 O;  2PFD A;  3U2M A;  2QUP A;  4MQ9 F;  2OQM A;  2OEX A;  5D92 A;  1LE2 A;  2KSF A;  4KBL A;  2KC3 A;  2QY9 A;  3I5Q A;  3ASO C;  3F47 A;  5A69 A;  5BQG A;  1S05 A;  5JSL A;  4GQH A;  5JP7 A;  4CS9 A;  5F5F A;  2A1D D;  4JTD B;  2QE9 A;  4OD5 A;  3LLK A;  2J9W A;  4AE4 A;  3C63 A;  2HUJ A;  4CDA A;  2G3K A;  3NKE A;  2OCC C;  4DVZ A;  4NTA A;  3QVY A;  4CX9 A;  5BQH A;  5L0H A;  3F46 A;  1CGM E;  1D0X A;  1N1C A;  2OEV A;  2HJ3 A;  4KNV A;  2H7O A;  3BEH A;  3T6B A;  4CDY A;  4I3M A;  2GDC A;  2J9U A;  3ECS A;  3EGX B;  5A6A A;  1JAF A;  1YLM A;  4Q7C A;  3UGP A;  4NY3 A;  1BR2 A;  3N2Z B;  4H4K C;  1H6G A;  1L3P A;  4NC3 A;  4PJM A;  1ZZP A;  4EIY A;  4BEJ A;  1QVX A;  2ZXO A;  4AL0 A;  1VOM A;  2KGO A;  4YL3 A;  2R7Q A;  3U3B A;  3TJ5 A;  1G4W R;  4EBJ A;  2Q7R A;  2XLH A;  4KI2 A;  2E87 A;  4AL1 A;  1NSG B;  4U5F E;  2M64 A;  3C8G D;  4HFK B;  2W4B A;  3B71 A;  4BJ6 C;  2NUT A;  4MTG A;  2KK1 A;  2PP4 A;  4OIN F;  2KW3 C;  2O9X A;  3DZA A;  4U5D E;  1M2V B;  5E2Q A;  1OXK A;  2HV7 A;  2LQG A;  4LDR A;  4WGY A;  5L3V A;  1Z7Q c;  1KU2 A;  3IEE A;  1Q0D A;  1FMW A;  3DM9 B;  2MYS A;  5COF A;  4J7Y A;  1LE4 A;  4B6I A;  3CQZ A;  3OEO A;  2HMQ A;  2HSQ A;  3M1C B;  5AGF A;  1TKN A;  4XEV A;  4XPW A;  1VK5 A;  2Y3H A;  1SZI A;  3X2Q C;  4OIP F;  4JJG A;  5T3W A;  1O87 A;  4E0I A;  1E2X A;  4PR9 A;  3W8H A;  3ABK C;  3EFO B;  2D5R B;  4FWV A;  1RJ9 B;  4XWJ A;  4U5C E;  5FZT A;  3EZH A;  2R7V A;  4I1M A;  2QLA A;  2YWA A;  4ZLD A;  4DBQ A;  5HV9 A;  3KL4 A;  1OQC A;  4Z9J A;  1OR3 A;  3EH1 A;  3NG1 A;  3RQG A;  4DJ9 A;  5JVE A;  3GOD A;  2HJM A;  2YLI A;  3R2P A;  3WOD F;  3RVY A;  4NTB A;  3DJU B;  4CSA A;  1OXB A;  1HE9 A;  2P0N A;  2FFH A;  1LIH A;  4YT2 A;  3EGX A;  3AJM A;  3HNI A;  1LI7 A;  1BR4 A;  1OKK D;  1RKC A;  1Z6A A;  3DI5 A;  3NMI A;  2I8B A;  4N6C A;  1M2O A;  4EWC A;  2ZXP A;  1NZE A;  3AOU A;  5A6B A;  2XL4 A;  3K33 A;  2R7S A;  4JC7 A;  4CS8 C;  4UDV A;  4BJ1 A;  2CNW A;  1J8Y F;  2L6G A;  2R9R B;  3E70 C;  2PBE A;  1VYK A;  2IXN A;  3PMR A;  4O6N A;  1L7C A;  1OCO C;  1V54 C;  4FAP B;  1J8M F;  1Y4C A;  1Z63 A;  4W8P A;  2CYD A;  1MMG A;  3JTL O;  3NRH A;  2R7T A;  2WVQ A;  1UG7 A;  3UR3 C;  1CPR A;  5B1A C;  3WHN A;  3TQO A;  5JRA A;  3SXM A;  4BEM J;  2YKZ A;  3MX3 A;  3AQB A;  2WZF A;  1ORY A;  4ULW A;  3TUL A;  3U0C A;  2CCY A;  2R02 A;  2C03 A;  1M2V A;  4J32 B;  2OKU A;  4MS2 A;  2XLD A;  2LIG A;  2LK4 A;  3IQ6 A;  4PJN A;  4QDL A;  4RDA A;  3ZG1 A;  3ZTZ A;  3HLZ A;  2IM8 A;  3B9Q A;  5BUO A;  3DJN B;  3K1H A;  3SXZ A;  3MLG A;  1RCP A;  2CDQ A;  2P61 A;  1AVO B;  1ORJ A;  4N6H A;  4FES A;  4DXW A;  4EBK A;  2BE5 F;  2I15 A;  4PAC A;  2IBF A;  1NLX A;  2J7P D;  3ZTM A;  2HV6 A;  1WAT A;  1ZHY A;  2WVN A;  3U2L A;  2YVK A;  1VYI A;  3MBG A;  3NYM A;  3G4Z A;  4OD4 A;  3EZI A;  3V5X A;  3KYI A;  2YQY A;  3EFO A;  5AC4 A;  4DBR A;  3M79 A;  1RJ9 A;  1SYQ A;  3DMD A;  1G8X A;  4ULV A;  1PD0 A;  3S9O A;  3W4Y A;  2Y3G A;  4ANJ A;  5KYY B;  2B0J A;  1E84 A;  2VB6 A;  2IOQ A;  2LD6 A;  1WTY A;  1ZYR F;  3Q7L A;  3RVZ A;  1JMW A;  3VM6 A;  3I4U A;  1GQA A;  1FAP B;  2L9J A;  4JZA A;  4MVZ A;  3VAY A;  5F28 E;  3W2W A;  2CW0 F;  2V26 A;  5DQT A;  3LEV A;  5T3T A;  4C3E A;  3RQF A;  2EIM C;  2A0B A;  3IQT A;  3L0I A;  3MYF A;  4JUR I;  5E33 A;  1U0B B;  4A4A A;  4IWB A;  3DD7 A;  4ONS A;  4EUK B;  3POV A;  2XS1 A;  3EGD A;  1TR2 A;  2EPK X;  2MHR A;  4CBE A;  2EPL X;  2P6V A;  4GYT A;  4JEA A;  4BJ6 A;  5L0J A;  4QI0 A;  4LLE A;  2FAP B;  3DE8 A;  4YN0 B;  5DLJ A;  4JTA B;  1DOW A;  4PJJ A;  4N06 A;  1LM3 B;  3LJB A;  5L3Q A;  1QLE C;  1E83 A;  3S0X A;  1ZW2 A;  5BQI A;  4EHP A;  4YT5 A;  4J7T A;  2ZPA A;  1A7E A;  1V74 B;  3MYI A;  3O55 A;  3V5Y A;  3UMI A;  5FCL A;  1T5O A;  1T9K A;  3HNK A;  1MQV A;  2Q4F A;  2A0U A;  5L0F A;  3T9O A;  3Q6M A;  2NSF A;  3DAG A;  1QSP A;  2ICW G;  4MVU A;  4RD9 A;  3UNG C;  1EKY A;  2HSB A;  3U5S A;  5L0G A;  4CJG A;  2HKV A;  1LS4 A;  5F5H A;  1R5I D;  2XXA B;  1GM5 A;  2VAS A;  4BG0 A;  2AVK A;  3AG4 C;  3EJN A;  4C3D A;  1AUE A;  4JCZ A;  5JT4 A;  4DRI B;  3DAF A;  4C7O B;  4G7O F;  2WZL A;  4U5B E;  1ZVZ A;  3ABM C;  2B0H A;  1IW7 F;  3JRT A;  3JYH A;  4MVQ A;  3T6J A;  3S27 A;  5JUA A;  4I1O B;  2H7B A;  4HE8 D;  1O5H A;  1KNY A;  2RD9 A;  1IZM A;  4JJF A;  3O39 A;  3HNL A;  1CGO A;  5JLI A;  3NMJ A;  4LDK A;  2NSG A;  3AQC A;  4PJL A;  5B1B C;  2XSE A;  3SNH A;  5KYY A;  2CGE A;  3CAX A;  3DWW A;  4JIO A;  3JRM O;  2EIN C;  4IJJ A;  2NUP B;  4XPX A;  4XEF A;  3W8I A;  4Q4Z F;  2DYR C;  4O7G A;  1E85 A;  1MND A;  2DI3 A;  1Q0F A;  2EPN A;  2WVO A;  1WAS A;  4JCH A;  4AX2 A;  1MMN A;  2VCA A;  3RH3 A;  4MVS A;  1YAU O;  3I5P A;  3T4R A;  1A41 A;  3FAJ A;  2XM4 A;  4N4W A;  3DM5 A;  2PX3 A;  3JYY A;  1SR2 A;  4XLN F;  5DS4 A;  3CEX A;  2R03 A;  4DVY P;  3ZIB A;  2M4E A;  3ABL C;  1YYX A;  3GWL A;  4O6M A;  3ZDL A;  3TD7 A;  3MFN A;  2XL6 A;  3ZQY A;  3RKO F;  2LFF A;  2OOC A;  1JR8 A;  2XM0 A;  4BJ5 A;  4OIR F;  4YL1 A;  1U6H A;  2QNL A;  5E3C A;  2W45 A;  3EG9 B;  1HW1 A;  4XPY A;  4LLC A;  2ZXW C;  2HS5 A;  2KQ9 A;  3C18 A;  3TOM A;  1NBB A;  3EHN A;  4MVR A;  1HE1 A;  1A7V A;  1RXQ A;  4HFF B;  2P7V A;  1OW6 A;  2JD3 A;  4XTK A;  3IQC A;  3GM1 A;  3KYJ A;  3RW0 A;  3ATP A;  4WJ0 A;  2XXA A;  1BBH A;  1QQ3 A;  3UMH A;  1WN0 A;  3TJ6 A;  3ZSU A;  3B0U X;  1B68 A;  4C7O A;  4J30 B;  2L81 A;  4CS9 C;  4DRH B;  4CIH A;  2J9V A;  3JSE O;  3M4B A;  5CI9 A;  1EI7 A;  1HY5 A;  1H7I A;  4IAO A;  3H2V A;  3EH2 A;  4EKW A;  2R7R A;  1LPE A;  4YT8 A;  1YAR O;  2YLG A;  3PDM P;  2JPU A;  2YEV A;  3EPV A;  3V7O A;  3ZQV A;  3H65 A;  256B A;  1ZHZ A;  1OW7 A;  2Y3D A;  1PV3 A;  3AGU A;  2NUP A;  2Q3T A;  1BZ4 A;  3L8J A;  1JPN A;  1VMA A;  1NU9 C;  1TQG A;  2Z15 A;  4KNW A;  1D1C A;  4MTO A;  1T6Q A;  3EHM A;  4E0H A;  1SF8 A;  4K0D A;  3Q6N A;  2PX0 A;  2J45 A;  2PNO A;  3O10 A;  5EHH A;  2YL1 A;  1M57 C;  1T6U A;  5DVW A;  2A6H F;  4E7Z A;  3GWN A;  4PFP A;  3T6G B;  5KYN A;  2W4M A;  2VCB A;  4MVM A;  2GWW A;  3GM2 A;  2MWQ A;  3IQ5 A;  2R7O A;  4O6Y A;  5TJ5 E;  3R7C A;  4EBB A;  5A6B D;  2R25 A;  4XQ1 A;  4JE9 A;  2QTV A;  1I5N A;  1VTM P;  1MMD A;  4K1O A;  2CNW D;  3VRC A;  4PK4 A;  3AGT A;  3GEI A;  2G3V A;  2J8W A;  3B0P A;  3HKK A;  2XLW A;  4JKV A;  5HSW A;  3CSK A;  1A7D A;  1WWP A;  1LS1 A;  3EG9 A;  3QTH A;  4LAC B;  5D91 A;  3J06 A;  5AC5 A;  3K1I C;  1M56 C;  1JOG A;  3C8G B;  4U5G A;  5B3I A;  3GAN A;  3RYL A;  1Z5Z A;  2Y39 A;  3JCU Q;  3SP1 A;  1NFN A;  2XLO A;  2EPO A;  1LVK A;  4QI2 A;  3A11 A;  3M4C A;  1R4T A;  1ZHT A;  2WL8 A;  4O79 A;  1OW8 A;  2Y3B A;  2RSE B;  3KH2 A;  4KC9 A;  3U8P A;  1EQ1 A;  1XZQ A;  3AG3 C;  1XWJ A;  1TFO B;  2LCH A;  3QW1 A;  4YK5 A;  3SYN A;  3UGO A;  2AP3 A;  3LS1 A;  2Q9C A;  3B29 A;  1I4Y A;  1S7Z A;  2YHS A;  3N0T A;  4LER A;  4R32 A;  3AG2 C;  2OU6 A;  4Z9H A;  3FMS A;  5A6K A;  4NTF A;  4U9D A;  4WAB A;  5KYX B;  5GPG B;  3TOL A;  3EQL F;  2JX0 A;  2X51 A;  2TMV P;  1CPQ A;  3LEO A;  1BDJ B;  3OA1 A;  1KTM A;  1Q0G A;  2GA0 A;  3QMK A;  3FHD A;  1YZC A;  3LS0 A;  1D0Z A;  2DB4 A;  4MW8 A;  4G0H A;  2KNH A;  3US6 A;  5COM A;  3X1O A;  2OJQ A;  4GEH A;  5CIV A;  3LUT B;  3LLI A;  3VYW A;  1C17 M;  2ETS A;  2IYL D;  2IXO A;  2Y69 C;  3K6B A;  4U9E A;  3RIP A;  1K40 A;  1MMA A;  2GAQ A;  3V5Z A;  1Q0M A;  2VCC A;  4NQF A;  5IY5 C;  3HJC A;  3NDB B;  2LFD A;  4CDV A;  2XS8 A;  4DOZ A;  3B0V C;  3G4X A;  4CJO A;  2YRF A;  4ER9 A;  3FXH A;  4P9T A;  2A68 F;  5L0I A;  3LES A;  2ZXR A;  3A9C A;  4BPM A;  2WB7 A;  3C62 A;  3LAY A;  3M15 A;  5DS5 A;  3L34 A;  5L0C A;  3JSZ A;  1SMY F;  3C8G A;  1WGW A;  3DE9 A;  3Q7G A;  4IGG A;  4A2N B;  5EGY A;  2XLM A;  5L0D A;  3C7J A;  4JRZ A;  1HMD A;  2LSE A;  1AEP A;  4K7B A;  4CS8 A;  3N24 A;  2C04 A;  3TK0 A;  3WG7 C;  3QZC A;  1QZX A;  1NU7 D;  2W9Y A;  3IPM O;  4U5E E;  3SXK A;  2R7U A;  1BR1 A;  1NFO A;  4YT4 A;  4MW3 A;  3KKB A;  4CIP A;  1I4Z A;  3GEH A;  3S29 A;  1RMV A;  2UUH A;  5KYU B;  5COG A;  3KMI A;  2BC5 A;  1FMV A;  1OCR C;  1PD1 A;  3GM3 A;  1JRA A;  1TFK B;  4M63 A;  2EIL C;  5KYX A;  1LKX A;  2HZ8 A;  4NCQ A;  3H2U A;  4JW1 A;  2IXP A;  3HTK C;  3S90 A;  4FX5 A;  4LDQ A;  4I44 A;  3ZWI A;  2WZG A;  3K7D A;  4E17 A;  1TWG A;  3GOR A;  3JZ0 A;  1E86 A;  1V55 C;  2DYS C;  3IHU A;  4YJW A;  1RKE B;  2YL0 A;  4Z9I A;  4ZLC A;  3HNJ A;  3DKA A;  5K0I A;  3U9J A;  4OIO F;  2L6F A;  2A69 F;  3UMK A;  5KYW B;  1K05 A;  2J46 A;  2X0C A;  1OKK A;  2PF4 E;  2H8A A;  3SZR A;  4XLP F;  3K1I A;  1YJG A;  3ASN C;  2XLV A;  2V3C C;  4U5H A;  1XZP A;  3FAP B;  3S84 A;  1C02 A;  2L7A A;  1VLS A;  4IRU A;  1TWA A;  3RFY A;  4E7S A;  2YL7 A;  3SEO A;  3DXJ F;  1LI5 A;  1D1A A;  1VB5 A;  3FOO A;  1M6T A;  1ZW3 A;  4YL0 A;  5E3A A;  3ZC4 A;  4C3B A;  1GGQ A;  2OJE D;  2Q9B A;  2NG1 A;  2YZS A;  3U3F A;  3S28 A;  1YYJ A;  1FFH A; 
#chains in the Genus database with same CATH homology
 1D1B A;  1Z23 A;  3ZVR A;  2A6E F;  4G7Z F;  2G62 A;  1PCX A;  2J0W A;  1ZU5 A;  2KJG A;  2R7X A;  4OIQ F;  2DGJ A;  3EGD B;  5KYU A;  2J7P A;  3FDQ A;  3OWT A;  1ZHX A;  4Q5S F;  5B3S C;  1ZU4 A;  1W2W A;  2IXM A;  4RBN A;  4YWQ A;  2J0X A;  3E9V A;  4F4B A;  1Z3I X;  2EIJ C;  4W8K A;  4AE4 B;  5CI8 A;  3JT1 A;  4BJ5 C;  4PFO A;  5KYW A;  1JPJ A;  3CZ6 A;  4JVS A;  4X0R A;  1ZHW A;  4AK9 A;  3NYJ A;  3AG1 C;  1MNE A;  1NG1 A;  1FFT C;  5T1D B;  4BJT A;  4P6I C;  2R7W A;  1FTS A;  1OCC C;  2H7V C;  4MND A;  3LNR A;  4CSA C;  2EIK C;  3NKD A;  1TWH A;  4G7H F;  3FVY A;  4HEA J;  3W2V A;  3PHF 2;  2FGY A;  2NUT B;  4CS7 A;  2Q9A A;  2OG2 A;  3NYL A;  1ST6 A;  2XRH A;  1TWC A;  2VH3 A;  3O6X A;  3ITF A;  5DS6 A;  5DQZ A;  2GFH A;  1D0Y A;  3K66 A;  1OCZ C;  2PFD A;  4MQ9 F;  5D92 A;  4KBL A;  2QY9 A;  3I5Q A;  3ASO C;  3F47 A;  4CS9 A;  5F5F A;  2A1D D;  4OD5 A;  3LLK A;  2J9W A;  4AE4 A;  2G3K A;  3NKE A;  2OCC C;  4DVZ A;  3F46 A;  1D0X A;  1N1C A;  4KNV A;  2H7O A;  3T6B A;  2R7S A;  4I3M A;  2J9U A;  3ECS A;  3EGX B;  3UGP A;  4Q7C A;  4NY3 A;  1BR2 A;  3N2Z B;  4H4K C;  4PJM A;  4BEJ A;  2ZXO A;  1VOM A;  2KGO A;  2R7Q A;  4KI2 A;  2E87 A;  4U5F E;  4HFK B;  4BJ6 C;  2W4B A;  2NUT A;  2PP4 A;  4OIN F;  2KW3 C;  2O9X A;  3DZA A;  4U5D E;  1M2V B;  5E2Q A;  2HV7 A;  4EBB A;  5L3V A;  1KU2 A;  3IEE A;  3DM9 B;  1FMW A;  2MYS A;  4B6I A;  3CQZ A;  3OEO A;  3M1C B;  1TKN A;  1VK5 A;  2Y3H A;  1SZI A;  3X2Q C;  4OIP F;  4JJG A;  5T3W A;  1O87 A;  3W8H A;  3ABK C;  3EFO B;  2D5R B;  4FWV A;  1RJ9 B;  4XWJ A;  4U5C E;  3EZH A;  2R7V A;  4I1M A;  4ZLD A;  4DBQ A;  3KL4 A;  3EH1 A;  3NG1 A;  3GOD A;  3WOD F;  3DJU B;  4CSA A;  2FFH A;  4YT2 A;  3EGX A;  4OIR F;  1BR4 A;  1OKK D;  1Z6A A;  4EWC A;  2I8B A;  5EGY A;  1M2O A;  2ZXP A;  1NZE A;  2XL4 A;  3K33 A;  4CS8 C;  4BJ1 A;  2CNW A;  1J8Y F;  3E70 C;  3POV A;  1VYK A;  2IXN A;  3PMR A;  4O6N A;  1OCO C;  1V54 C;  1J8M F;  1Z63 A;  1MMG A;  3NRH A;  2R7T A;  2WVQ A;  3UR3 C;  5B1A C;  3MX3 A;  3AQB A;  2WZF A;  4ULW A;  2C03 A;  1M2V A;  4J32 B;  4PJN A;  4RDA A;  3ZG1 A;  4QDL A;  3HLZ A;  3B9Q A;  5BUO A;  3DJN B;  3K1H A;  3MLG A;  2CDQ A;  4FES A;  2BE5 F;  2J7P D;  2HV6 A;  1ZHY A;  2WVN A;  1VYI A;  3NYM A;  4OD4 A;  3EZI A;  3EFO A;  4DBR A;  1RJ9 A;  3DMD A;  1G8X A;  1PD0 A;  2Y3G A;  4ANJ A;  5KYY B;  2B0J A;  2VB6 A;  2IOQ A;  1ZYR F;  3Q7L A;  3I4U A;  2L9J A;  4JZA A;  3W2W A;  3VAY A;  4C3E A;  2CW0 F;  2V26 A;  5DQT A;  3LEV A;  5T3T A;  2EIM C;  3L0I A;  4JUR I;  5E33 A;  4IWB A;  3DD7 A;  3EGD A;  1TR2 A;  4CBE A;  2P6V A;  4GYT A;  4BJ6 A;  4QI0 A;  4LLE A;  4YN0 B;  5DLJ A;  4PJJ A;  5L3Q A;  4N06 A;  3S0X A;  3LJB A;  1QLE C;  4YT5 A;  2ZPA A;  3UMI A;  5FCL A;  3Q6M A;  3DAG A;  4RD9 A;  3UNG C;  5F5H A;  2XXA B;  2VAS A;  4BG0 A;  3AG4 C;  3EJN A;  4C3D A;  4G7O F;  4C7O B;  3DAF A;  2WZL A;  4U5B E;  3ABM C;  3JYH A;  3T6J A;  1IW7 F;  3JRT A;  3S27 A;  4I1O B;  2H7B A;  4HE8 D;  1O5H A;  4JJF A;  1IZM A;  3O39 A;  3AQC A;  4PJL A;  5B1B C;  2XSE A;  3SNH A;  5KYY A;  2CGE A;  2EIN C;  4IJJ A;  2NUP B;  3W8I A;  4Q4Z F;  2DYR C;  4O7G A;  1MND A;  4AX2 A;  2WVO A;  4JCH A;  1MMN A;  3RH3 A;  3I5P A;  3T4R A;  3FAJ A;  5DS4 A;  3DM5 A;  2PX3 A;  4XLN F;  4DVY P;  3ZIB A;  2M4E A;  3ABL C;  4O6M A;  3TD7 A;  3RKO F;  4BJ5 A;  5E3C A;  2W45 A;  3EG9 B;  4LLC A;  2ZXW C;  2KQ9 A;  3EHN A;  4HFF B;  2P7V A;  2JD3 A;  4XTK A;  4WJ0 A;  2XXA A;  3UMH A;  3ZSU A;  3B0U X;  4C7O A;  4J30 B;  2L81 A;  4CS9 C;  4CIH A;  2J9V A;  5CI9 A;  4IAO A;  2R7R A;  3EH2 A;  4YT8 A;  2YEV A;  3EPV A;  3V7O A;  3H65 A;  1ZHZ A;  2Y3D A;  2NUP A;  2Q3T A;  1JPN A;  1VMA A;  1NU9 C;  2Z15 A;  4KNW A;  1D1C A;  3EHM A;  1SF8 A;  4K0D A;  3Q6N A;  2PX0 A;  2J45 A;  5EHH A;  1M57 C;  5DVW A;  2A6H F;  4E7Z A;  4PFP A;  5KYN A;  2W4M A;  4O6Y A;  2MWQ A;  2R7O A;  2QTV A;  1MMD A;  2CNW D;  4PK4 A;  2G3V A;  3B0P A;  5HSW A;  3CSK A;  1LS1 A;  3EG9 A;  5D91 A;  4LAC B;  3K1I C;  1M56 C;  4U5G A;  3GAN A;  3RYL A;  1Z5Z A;  2Y39 A;  3JCU Q;  3SP1 A;  1LVK A;  4QI2 A;  1ZHT A;  2WL8 A;  4O79 A;  2Y3B A;  3KH2 A;  4KC9 A;  3AG3 C;  3SYN A;  3UGO A;  3LS1 A;  2Q9C A;  3N0T A;  2YHS A;  1S7Z A;  4LER A;  3AG2 C;  5KYX B;  3EQL F;  2X51 A;  3OA1 A;  3QMK A;  3FHD A;  3LS0 A;  1D0Z A;  4G0H A;  2KNH A;  3X1O A;  4GEH A;  3LLI A;  3VYW A;  2IYL D;  2IXO A;  2Y69 C;  3K6B A;  3RIP A;  1MMA A;  5IY5 C;  3HJC A;  3NDB B;  4DOZ A;  3B0V C;  2A68 F;  3LES A;  2ZXR A;  2WB7 A;  3LAY A;  5DS5 A;  3L34 A;  3JSZ A;  1SMY F;  1WGW A;  3Q7G A;  4A2N B;  2LSE A;  4K7B A;  4CS8 A;  3N24 A;  2C04 A;  3WG7 C;  3QZC A;  1QZX A;  1NU7 D;  2W9Y A;  2R7U A;  4U5E E;  1BR1 A;  4YT4 A;  3KKB A;  3S29 A;  5KYU B;  3KMI A;  1OCR C;  1FMV A;  1PD1 A;  4M63 A;  5KYX A;  2EIL C;  1LKX A;  4JW1 A;  2IXP A;  3HTK C;  4FX5 A;  4I44 A;  2WZG A;  3K7D A;  1TWG A;  1V55 C;  2DYS C;  4ZLC A;  4YJW A;  4OIO F;  2A69 F;  3UMK A;  5KYW B;  2J46 A;  1OKK A;  2PF4 E;  3SZR A;  4XLP F;  3ASN C;  2V3C C;  4U5H A;  4IRU A;  1TWA A;  3RFY A;  4E7S A;  3SEO A;  3DXJ F;  1D1A A;  5E3A A;  3ZC4 A;  4C3B A;  2Q9B A;  2NG1 A;  2YZS A;  3S28 A;  1FFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...