2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Core-binding factor, ML1-ETO
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2P6VA 2KNHA 2PP4A 2H7BA
chains in the Genus database with same CATH superfamily
3U0CA 3SZRA 2EILC 2ZPAA 1A0BA 3AGUA 4CS9A 4NTFA 1VTMP 1E86A 2NUPB 4JJFA 1VMAA 3ABMC 3C7JA 5HSWA 3EG9A 3UMIA 4C7OB 1JPNA 3EPVA 3DJUB 3U2MA 4MQ9F 5AC5A 4UDVA 4MTOA 3Q7GA 1EKYA 5DS5A 4U5CE 3M15A 2G62A 2P61A 3RQEA 3AQBA 3HLZA 3K33A 3E70C 3LLIA 3ZG1A 2EIJC 1Z6AA 1ZYRF 1T6IA 3S90A 2PBEA 2BL2A 2GA0A 1TKNA 2P6VA 4KBLA 4Q7CA 3QMKA 1FFHA 4G7HF 3SNHA 3LESA 1LS4A 3MBGA 1L7CA 2LIGA 3DWWA 2AWYA 2UUIA 2V26A 3EG9B 3I4UA 4L6RA 3H2VA 1ZHWA 3PCVA 3S28A 2Q7RA 1Y4CA 3EH1A 1RJ9B 4OINF 1SZIA 4FESA 3U8VA 1Q0MA 5KYWA 1JR8A 2HJMA 1JPJA 2J9WA 2XS8A 3F46A 2XS1A 3W2WA 2CNWA 1YA7O 2HFIA 3SXZA 3QVZA 2XM0A 2BE5F 1MMGA 1K05A 2XL8A 4YN0B 1MMAA 2BC5A 2CDQA 5A6AA 5L3VA 1YDIA 3C8ZA 3LS0A 1A7VA 4NC3A 1OR3A 2H7BA 4X0RA 3UMKA 4LLEA 3W8IA 4P6IC 1OW7A 5A69A 1V54C 3PMRA 2KNHA 2DB4A 3ABLC 2GDCA 4CSAA 3L8JA 2LFDA 4U9DA 3UGPA 4DXWA 1LPEA 1QQ3A 1TWHA 2HZ8A 2LSEA 2IOQA 3IQ6A 4JVSA 4O7GA 4WGYA 4CS8C 2XL4A 2HV6A 3W4YA 1D0ZA 1J8YF 1SF8A 1TQGA 2HS5A 1TFKB 3NMIA 3C8GD 3EFOA 2L7AA 2B0HA 2IXMA 3HNIA 3MFNA 3IQCA 4FWVA 5EK0A 5B1AC 4DVYP 1T01A 5JRAA 1BDJB 3ZSUA 4YT8A 2Z15A 1RXQA 2LQGA 1FMWA 2OKUA 3KL4A 5E33A 2V3CC 1K04A 1CPRA 1RKCA 3SXYA 1OCOC 3CZ6A 4EBKA 1N1CA 2XSEA 3ITFA 4W8KA 1NZEA 1O87A 2YLIA 4MVOA 3M1CB 4I1OB 4MVZA 1IZMA 1O3UA 2OOCA 1VK5A 4MVMA 4BEJA 1T9KA 5KYXB 1WATA 1PV3A 3RQGA 4CJOA 4YWQA 1WOLA 5K0IA 4JEBA 3IHUA 2YLGA 4OIPF 4DJ9A 3I5PA 5DS6A 5BQGA 2IXNA 3ASNC 4CIHA 3GWLA 1FAPB 1HY5A 2CGEA 1KNYA 4JJGA 3EH2A 1D0YA 3U3FA 5F5FA 4JCZA 4CX9A 1AVOB 3A11A 1FFTC 4U9EA 4ER9A 1F1MA 3HTKC 2I15A 4CSAC 2GAQA 1HW2A 2R02A 2Y3BA 1HMDA 3N0TA 4HFKB 5DS4A 5COFA 2HV7A 1H7IA 2EPMX 4O6MA 4YL3A 4YJWA 4QI2A 2YZSA 3GWNA 3BEHA 3GEEA 2FAPB 1NBBA 1MMNA 1QZXA 2ZXPA 3T6JA 1A41A 4JRZA 1AUEA 3DMDA 3JYHA 2NUTA 1ZHYA 4FX5A 1SMYF 3VM6A 3JYYA 1A7EA 4LACB 3FMSA 5E3AA 4G78A 3GM2A 4XQ1A 5EHHA 4YT5A 3NKDA 3WG7C 5L0HA 4C7OA 3AJMA 2XLDA 3EGDB 3EZIA 2H7OA 4F4BA 2RD9A 2YL7A 2C04A 1YLMA 3N2ZB 2H8AA 3LNMB 3U9MA 3QTHA 2IBFA 3KPHA 1QKRA 5JS5A 2VC9A 1C17M 2QE9A 4ZLDA 1VLSA 3O39A 2Q9BA 2EPKX 4E18A 5L0IA 2QLAA 1L3PA 2HKVA 1PD1A 3B0UX 4BJTA 4A4AA 4W8PA 3LEOA 5E3CA 3KYIA 4PK4A 3DD7A 3CQZA 3NMKA 2HSBA 3S0XA 4EUKB 4OIQF 4OIOF 2OEVA 2Y3HA 3DI5A 4AL0A 4JC7A 2XXAB 3US6A 4H54A 3LJBA 256BA 1VLTA 4PJMA 4XEKA 3W8HA 1RMVA 4DRHB 2G3VA 1E2XA 4OD4A 5A6KA 1C02A 2YRFA 4BEMJ 2WVOA 1OXKA 4Z9IA 2AP3A 3DE8A 1QPUA 2R7WA 2A0BA 3EGDA 1G8XA 2L6HA 3RF3A 4LDKA 2YWAA 4XPWA 3ZDLA 3ZVRA 4D4XA 5KYUB 1OW6A 1VYKA 3MLGA 2J0WA 2J7PA 2Q00A 4K0DA 2A6EF 3N24A 4C3BA 3K1IC 4CS9C 2R05A 4O6YA 4ONSA 2QTVA 4B6IA 1TFOB 4MVSA 1Z7Qc 1E83A 3M4BA 2DGJA 3UMHA 3IEEA 4DRJB 2P0NA 2KYHA 2LP4A 3V5YA 2WZFA 4JURI 4D4NA 4JEAA 1GGQA 1C03A 4IRUA 1KTMA 3FOPA 4NQFA 4Z9JA 1W2WA 1OQCA 1YZAA 4CDVA 2R7SA 2R7VA 3DZAA 1V74B 2IYLD 2OG2A 4IAQA 4OD5A 5DQZA 2YL0A 1HW1A 4U5GA 1HMOA 1Z5ZA 2MHRA 5E2QA 2XM4A 2E87A 1LE4A 4IGGA 4LDQA 3GEIA 3B71A 2L6GA 4MVRA 3C8GB 3T6GB 4EWCA 5KYXA 2R7RA 2Q3TA 3G4XA 2FGYA 4YL1A 2J9BA 2DYSC 4NCQA 1Z63A 3H65A 4AL1A 1E85A 4E7SA 2R7OA 2MYSA 3T6BA 5JVEA 3UNGC 3HKKA 3RKOF 2AU5A 4U5EE 3U9JA 3LUTB 2CW0F 2L81A 1TWCA 3DJNB 3FHDA 4EKWA 1NFNA 2J45A 5JLIA 2Y69C 1JOGA 2LK4A 2ASRA 1QSPA 4BJ1A 4MNDA 3WHNA 2EPLX 3POVA 4XLNF 5DLJA 3M79A 1HE1A 3QVYA 3ZQYA 1NU9C 4YT2A 2OJED 3K66A 1FNTc 1VB5A 2YVKA 4MS2A 2G3KA 4QI0A 3QZCA 3U5SA 3AG4C 4AK9A 2EPNA 5CI8A 3W2VA 3S9OA 3AQCA 3LEVA 3V5ZA 4MTFA 4JZAA 2HSQA 1GQAA 4I44A 4J30B 3O6XA 2WB7A 3TJ5A 1YYJA 3ZTZA 2EPOA 1OKKA 1LI5A 2WVQA 3JT1A 3JSZA 1ORSC 2O9XA 2WVNA 4JCHA 4O6NA 1Q0FA 1UG7A 4ANJA 1R4TA 2CYDA 4XPXA 4AE4B 3B0VC 5KYYA 2VB6A 3C63A 4JKVA 1FMVA 2Y3DA 3NG1A 3RFYA 2QNLA 4U5HA 3FAJA 4JW1A 4I3MA 3UR3C 3GODA 3ZIBA 3MX3A 4GQHA 5T1DB 1HE9A 4AE4A 2ZD9A 3JCUQ 3CSKA 5T3WA 3TOLA 1DOVA 3OWTA 3F47A 4J7YA 1I4YA 1I4ZA 5IY5C 3UGOA 5L0FA 1MQVA 3NYMA 3RQFA 2GWWA 1BR2A 4E0HA 2B0JA 5BQIA 2D4UA 3IPMO 2HMZA 2KSFA 1Q0KA 4CS7A 1ORYA 5AGFA 1M2VA 3OA1A 4E7ZA 3V7OA 2VCAA 1NSGB 2DYRC 4JIOA 1S7ZA 2OQMA 3R7CA 5BUOA 3GEHA 4ULVA 1IW7F 1M57C 1OKKD 2EINC 2KQ9A 3K7DA 1CPQA 3Q6MA 2NSGA 3G4ZA 3RW0A 1MNDA 4C3EA 3NYJA 3G50A 4GYTA 4PJJA 2HJ3A 3FVYA 3RIPA 2X0CA 4BJ5A 1EA8A 1ZW3A 3NKEA 4IARA 4NTAA 5L0GA 1TWGA 2KK1A 1KU2A 1RCPA 1D0XA 5F5HA 1JRAA 5JP7A 2XL6A 4JTDB 3ECSA 3ABKC 4EBBA 2YKZA 2R7XA 1TR2A 4C3DA 4MTGA 5COGA 3LS1A 3JSEO 3V5XA 4KNWA 2M64A 3L34A 1A7DA 1LS1A 3IQ5A 4FAPB 3MYFA 2XLEA 2ZXRA 4PFOA 3ZQVA 2J46A 4MVUA 5L0CA 1YVIA 4KI2A 4HE8D 4Z9HA 1ZZPA 3GM1A 5KYUA 1M2OA 3GANA 1YAUO 2H7VC 5D92A 3HNLA 3TULA 1OW8A 5FCLA 3PDMP 1G4WR 3J06A 2LCHA 3L1MA 2YHSA 3ZTMA 4WABA 1JAFA 2ETSA 1O5HA 4G0HA 3TD7A 5DQTA 5B1BC 4LLCA 4N06A 1QVXA 1Q0GA 5DVWA 1WGWA 2PFDA 1FR0A 1U89A 2OU6A 2J0XA 2KJGA 4O79A 3B9QA 4A2NB 5KYWB 2OJQA 2XRHA 4N6HA 1Z23A 5L0DA 1BBHA 2PP4A 3R2PA 5FZTA 4ZLCA 1OCCC 3VF0A 4DBQA 4RBNA 2M4EA 1BZ4A 2UUHA 3NRHA 3KH2A 2YL1A 4HFFB 3KYJA 2Q4FA 2Y3GA 1OCRC 4H4KC 3VAYA 4G7OF 5T3TA 3TQOA 2R7TA 4CDYA 1I5NA 4HEAJ 1B68A 2I8BA 2PX0A 1H9TA 4YK5A 3EQLF 3QW0A 3AG3C 3DM5A 3RVZA 1D1AA 3KMIA 2AVKA 3O55A 1D1BA 2A68F 1RKEB 3FOOA 1WN0A 4YT4A 2Q9CA 1JMWA 1XWJA 2NG1A 3AOUA 4E0IA 2F22A 1LI7A 2NSFA 1Q0DA 3EFOB 2XLWA 2VASA 3U3BA 2PNOA 3B0PA 3FXHA 4IWBA 5COMA 4DRIB 3S27A 4PJNA 2Q9AA 2W45A 1QLEC 2A1DD 3NMJA 1FTSA 2RSEB 4GEHA 4N6CA 1NG1A 1PCXA 3LNRA 3H2UA 3M4CA 3U2LA 1ORJA 1UFBA 4WJ0A 3EHMA 1YZCA 2D5RB 4P9FA 5L0JA 4KNVA 4U5FE 1G5ZA 4BJ5C 3SEOA 2YEVA 1Z3IX 1MMDA 3DAFA 1NU7D 2R03A 2W4MA 1BR4A 1RKEA 1V4AA 4MW8A 3EJNA 1XZQA 1RJ9A 2Y39A 2NPUA 1GS9A 4EBJA 5JUAA 3FDQA 1CGME 3NDBB 1SR2A 3ATPA 1WWPA 1ZHXA 2J9VA 3DXJF 3ZC4A 1D1CA 2R9RB 3AGTA 1LVKA 4K1OA 2A0UA 4NY3A 3VYWA 2OEXA 4G7ZF 3GORA 2L6FA 2X51A 4P9TA 2HUJA 3TK0A 1E84A 3X2QC 4JTAB 2R7QA 2JX0A 2VCCA 1CGNA 2DI3A 3SXKA 1H9GA 2WL8A 2YLDA 3RVYA 1YJGA 4CJGA 1DOWA 3C62A 3DM9B 3LLKA 5JT4A 1Y6DA 1APCA 3S84A 3TJ6A 4I1MA 2ZXOA 1BR1A 3JZ0A 2MWQA 2J7PD 2ICWG 1WASA 1LIHA 3EZHA 1YA9A 3A9CA 5CIVA 1LKXA 5B3IA 4XWJA 5EGYA 1YARO 3K6BA 4KC9A 2A69F 5A6JA 4NTBA 4XLPF 1J8MF 3CAXA 4MVQA 2C03A 4Q5SF 2VCBA 4PACA 2JPUA 4AX2A 2XXAA 3TOMA 2LD6A 3JTLO 4J32B 3B29A 1ZU4A 3AG2C 3HJCA 3S29A 3JRMO 1T5OA 2QY9A 3LAYA 5A6BA 1WTYA 2AWCA 2OCCC 4DOZA 1EQ1A 2J9UA 2IXOA 1NLXA 4WGZA 1LE2A 3L8IA 2KGOA 3Q6NA 2IM8A 4IJJA 3AG1C 4JE9A 4LDRA 4R32A 3RH3A 4BG0A 4BJ6C 2P1AA 4XEFA 1ZU5A 4LERA 2HMQA 2IXPA 2KC3A 1K40A 4PJLA 3EGXA 2YQYA 4QDLA 4E17A 1TWAA 4OIRF 1R5ID 5D91A 4XEVA 3PHF2 4Q4ZF 2QUPA 3GM3A 2XLOA 3I5QA 1CGOA 3E9VA 3K1IA 4JTCB 4XTKA 2LFFA 4DBRA 2R7UA 2CNWD 4U5BE 2YL3A 2L9JA 4MW3A 5GPGB 3L0IA 1NFOA 4U5DE 4PFPA 3CEXA 3K1HA 3RYLA 3X1OA 3IQTA 5CI9A 3DKAA 5KYYB 4IAOA 1AEPA 5HV9A 3T4RA 1G4US 4CBEA 4N4WA 1M56C 1VOMA 1ZW2A 3FAPB 3HNJA 4EIYA 3SYNA 5AC4A 1S05A 2EIKC 4ULWA 4RD9A 1EI7A 1PD0A 1T6QA 4CIPA 3DAGA 2CCYA 2P7VA 3Q7LA 4RDAA 4EHPA 5A6BD 1GM5A 1T6UA 1U6HA 2A6HF 2XLMA 2NUTB 3QW1A 4BJ6A 5L3QA 2VH3A 2FFHA 1MNEA 1ST6A 2R25A 2WZGA 3WAQA 3BRJA 4XPYA 4CS8A 5B3SC 2WZLA 3HNKA 3T9OA 1H6GA 1M2VB 3EGXB 3JRTA 1ZHZA 2XLHA 2PX3A 5BQHA 1V55C 3U8PA 1M6TA 1OCZC 3C8GA 3EHNA 3DE9A 5F28E 2W9YA 4BPMA 2GFHA 4DVZA 2XLVA 5KYNA 2NUPA 4IB4A 1OR2A 2ZXWC 4YL0A 2J8WA 3NYLA 3SXMA 1XZPA 2EIMC 5JSLA 1SYQA 2W4BA 4J7TA 3ZWIA 1U0BB 1OXBA 2JD3A 3VRCA 2TMVP 3KKBA 1ZVZA 5TJ5E 4M63A 4K7BA 4CDAA 1LM3B 3MYIA 3WODF 3O10A 1ZHTA 4PR9A 3ASOC 3OEOA 2PF4E 2KW3C 3SP1A 3C18A 1VYIA 1YYXA
chains in the Genus database with same CATH topology
3SZRA 2EILC 2ZPAA 4CS9A 2NUPB 4JJFA 1VMAA 3ABMC 5HSWA 3EG9A 3UMIA 4C7OB 1JPNA 3EPVA 3DJUB 4MQ9F 3Q7GA 5DS5A 4U5CE 2G62A 3AQBA 3HLZA 3K33A 3E70C 3LLIA 3ZG1A 2EIJC 1Z6AA 1ZYRF 4KBLA 4Q7CA 1TKNA 2P6VA 3QMKA 1FFHA 4G7HF 3SNHA 3LESA 3I4UA 2V26A 3EG9B 1ZHWA 3S28A 3EH1A 4OINF 1RJ9B 1SZIA 4FESA 5KYWA 1JPJA 2J9WA 3F46A 3W2WA 2CNWA 2BE5F 1MMGA 4YN0B 1MMAA 2CDQA 5L3VA 3LS0A 5B3SC 2H7BA 4X0RA 3UMKA 4LLEA 3W8IA 4P6IC 1V54C 3PMRA 2KNHA 3ABLC 4CSAA 3UGPA 1TWHA 2LSEA 2IOQA 4JVSA 4O7GA 4CS8C 2XL4A 2HV6A 1D0ZA 1J8YF 1SF8A 3EFOA 5B1AC 4DVYP 2IXMA 4FWVA 3ZSUA 4YT8A 2Z15A 3KL4A 1FMWA 5E33A 2V3CC 1OCOC 3CZ6A 1N1CA 2XSEA 3ITFA 4W8KA 1NZEA 1O87A 3M1CB 4I1OB 1IZMA 1VK5A 4BEJA 5KYXB 4YWQA 4OIPF 3I5PA 5DS6A 2IXNA 3ASNC 4CIHA 4JJGA 2CGEA 3EH2A 1D0YA 5F5FA 1FFTC 3HTKC 4CSAC 2Y3BA 3N0TA 4HFKB 5DS4A 2HV7A 4O6MA 4QI2A 4YJWA 2YZSA 1MMNA 1QZXA 2ZXPA 3T6JA 3DMDA 3JYHA 2NUTA 1ZHYA 4FX5A 1SMYF 4LACB 5E3AA 5EHHA 4YT5A 3NKDA 3WG7C 4C7OA 3EGDB 3EZIA 2H7OA 4F4BA 2C04A 3N2ZB 4ZLDA 3O39A 2Q9BA 1PD1A 4BJTA 5E3CA 4PK4A 3DD7A 3CQZA 3S0XA 4OIQF 4OIOF 2Y3HA 2XXAB 3LJBA 4PJMA 3W8HA 2G3VA 4OD4A 2WVOA 2R7WA 3EGDA 1G8XA 3ZVRA 5KYUB 1VYKA 3MLGA 2J0WA 2J7PA 4K0DA 2A6EF 3N24A 4C3BA 3K1IC 4CS9C 4O6YA 2QTVA 4B6IA 2DGJA 3UMHA 3IEEA 2WZFA 4JURI 4IRUA 1W2WA 2R7SA 2R7VA 3DZAA 2IYLD 2OG2A 4OD5A 5DQZA 4U5GA 5E2QA 1Z5ZA 2E87A 4EWCA 5KYXA 2R7RA 2Q3TA 2FGYA 2DYSC 1Z63A 3H65A 4E7SA 2R7OA 2MYSA 3T6BA 3UNGC 3RKOF 4U5EE 2CW0F 2L81A 1TWCA 3DJNB 3FHDA 2J45A 2Y69C 4BJ1A 4MNDA 3POVA 4XLNF 5DLJA 1NU9C 4YT2A 3K66A 2G3KA 4QI0A 3QZCA 3AG4C 4AK9A 5CI8A 3W2VA 3AQCA 3LEVA 4JZAA 4I44A 4J30B 3O6XA 2WB7A 1OKKA 2WVQA 4JCHA 3JT1A 3JSZA 2O9XA 2WVNA 4O6NA 4ANJA 4AE4B 3B0VC 5KYYA 2VB6A 1FMVA 2Y3DA 3NG1A 3RFYA 4U5HA 3FAJA 4JW1A 4I3MA 3UR3C 3GODA 3ZIBA 3MX3A 5T1DB 4AE4A 3JCUQ 5T3WA 3CSKA 3UGOA 3OWTA 3F47A 5IY5C 3NYMA 1BR2A 2B0JA 4CS7A 4E7ZA 1M2VA 3OA1A 3V7OA 2DYRC 1S7ZA 5BUOA 1IW7F 1M57C 1OKKD 2EINC 2KQ9A 3K7DA 3Q6MA 1MNDA 4C3EA 3NYJA 4GYTA 4PJJA 3FVYA 3RIPA 4BJ5A 3NKEA 1TWGA 1KU2A 1D0XA 5F5HA 3ECSA 3ABKC 4EBBA 2R7XA 1TR2A 4C3DA 3LS1A 4KNWA 3L34A 1LS1A 4PFOA 2ZXRA 2J46A 4KI2A 4HE8D 5KYUA 1M2OA 3GANA 2H7VC 5D92A 5FCLA 2YHSA 4G0HA 1O5HA 3TD7A 5DQTA 5B1BC 4LLCA 4N06A 5DVWA 1WGWA 2PFDA 2J0XA 2KJGA 4O79A 3B9QA 4A2NB 5KYWB 2XRHA 1Z23A 2PP4A 4ZLCA 1OCCC 4DBQA 4RBNA 2M4EA 3NRHA 3KH2A 4HFFB 2Y3GA 4G7OF 1OCRC 4H4KC 3VAYA 5T3TA 2R7TA 4HEAJ 2I8BA 2PX0A 3EQLF 3AG3C 3DM5A 1D1AA 3KMIA 1D1BA 2A68F 4YT4A 2Q9CA 2NG1A 3EFOB 3B0UX 2VASA 4IWBA 3B0PA 3S27A 4PJNA 2Q9AA 2W45A 1QLEC 2A1DD 1FTSA 4GEHA 1NG1A 1PCXA 3LNRA 4WJ0A 3EHMA 2D5RB 4KNVA 4U5FE 4BJ5C 3SEOA 2YEVA 1Z3IX 1MMDA 3DAFA 1NU7D 2W4MA 1BR4A 3EJNA 1RJ9A 2Y39A 3FDQA 3NDBB 2J9VA 1ZHXA 3DXJF 3ZC4A 1D1CA 1LVKA 4NY3A 3VYWA 4G7ZF 2X51A 3X2QC 2R7QA 2WL8A 3DM9B 3LLKA 4I1MA 2ZXOA 1BR1A 2MWQA 2J7PD 3EZHA 1LKXA 4XWJA 5EGYA 3K6BA 4KC9A 2A69F 4XLPF 1J8MF 4Q5SF 2C03A 4AX2A 2XXAA 4J32B 1ZU4A 3AG2C 3HJCA 3S29A 2QY9A 3LAYA 2OCCC 4DOZA 2J9UA 2IXOA 3Q6NA 2KGOA 4IJJA 3AG1C 4BG0A 4BJ6C 3RH3A 1ZU5A 4LERA 2IXPA 4PJLA 3EGXA 4QDLA 4Q4ZF 1TWAA 4OIRF 5D91A 3PHF2 3I5QA 4DBRA 3E9VA 4XTKA 2R7UA 2CNWD 4U5BE 2L9JA 3L0IA 4U5DE 4PFPA 3K1HA 3RYLA 3X1OA 5CI9A 5KYYB 4IAOA 3T4RA 4CBEA 1M56C 1VOMA 3SYNA 2EIKC 4ULWA 4RD9A 1PD0A 3DAGA 2P7VA 3Q7LA 4RDAA 2A6HF 2NUTB 4BJ6A 5L3QA 2VH3A 2FFHA 1MNEA 1ST6A 2WZGA 4CS8A 2WZLA 3EGXB 1M2VB 3JRTA 1ZHZA 2PX3A 1V55C 1OCZC 3EHNA 2W9YA 2GFHA 4DVZA 5KYNA 2NUPA 2ZXWC 3NYLA 2EIMC 2W4BA 2JD3A 3KKBA 4M63A 4K7BA 3WODF 1ZHTA 3ASOC 3OEOA 2PF4E 2KW3C 3SP1A 1VYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2KNH A;  2PP4 A;  2H7B A; 
#chains in the Genus database with same CATH topology
 3U0C A;  3SZR A;  2EIL C;  2ZPA A;  1A0B A;  3AGU A;  4CS9 A;  4NTF A;  1VTM P;  1E86 A;  2NUP B;  4JJF A;  1VMA A;  3ABM C;  3C7J A;  5HSW A;  3EG9 A;  3UMI A;  4C7O B;  1JPN A;  3EPV A;  3DJU B;  3U2M A;  4MQ9 F;  5AC5 A;  4UDV A;  4MTO A;  3Q7G A;  1EKY A;  5DS5 A;  4U5C E;  3M15 A;  2G62 A;  2P61 A;  3RQE A;  3AQB A;  3HLZ A;  3K33 A;  3E70 C;  3LLI A;  3ZG1 A;  2EIJ C;  1Z6A A;  1ZYR F;  1T6I A;  3S90 A;  2PBE A;  2BL2 A;  2GA0 A;  1TKN A;  2P6V A;  4KBL A;  4Q7C A;  3QMK A;  1FFH A;  4G7H F;  3SNH A;  3LES A;  1LS4 A;  3MBG A;  1L7C A;  2LIG A;  3DWW A;  2AWY A;  2UUI A;  2V26 A;  3EG9 B;  3I4U A;  4L6R A;  3H2V A;  1ZHW A;  3PCV A;  3S28 A;  2Q7R A;  1Y4C A;  3EH1 A;  1RJ9 B;  4OIN F;  1SZI A;  4FES A;  3U8V A;  1Q0M A;  5KYW A;  1JR8 A;  2HJM A;  1JPJ A;  2J9W A;  2XS8 A;  3F46 A;  2XS1 A;  3W2W A;  2CNW A;  1YA7 O;  2HFI A;  3SXZ A;  3QVZ A;  2XM0 A;  2BE5 F;  1MMG A;  1K05 A;  2XL8 A;  4YN0 B;  1MMA A;  2BC5 A;  2CDQ A;  5A6A A;  5L3V A;  1YDI A;  3C8Z A;  3LS0 A;  1A7V A;  4NC3 A;  1OR3 A;  2H7B A;  4X0R A;  3UMK A;  4LLE A;  3W8I A;  4P6I C;  1OW7 A;  5A69 A;  1V54 C;  3PMR A;  2KNH A;  2DB4 A;  3ABL C;  2GDC A;  4CSA A;  3L8J A;  2LFD A;  4U9D A;  3UGP A;  4DXW A;  1LPE A;  1QQ3 A;  1TWH A;  2HZ8 A;  2LSE A;  2IOQ A;  3IQ6 A;  4JVS A;  4O7G A;  4WGY A;  4CS8 C;  2XL4 A;  2HV6 A;  3W4Y A;  1D0Z A;  1J8Y F;  1SF8 A;  1TQG A;  2HS5 A;  1TFK B;  3NMI A;  3C8G D;  3EFO A;  2L7A A;  2B0H A;  2IXM A;  3HNI A;  3MFN A;  3IQC A;  4FWV A;  5EK0 A;  5B1A C;  4DVY P;  1T01 A;  5JRA A;  1BDJ B;  3ZSU A;  4YT8 A;  2Z15 A;  1RXQ A;  2LQG A;  1FMW A;  2OKU A;  3KL4 A;  5E33 A;  2V3C C;  1K04 A;  1CPR A;  1RKC A;  3SXY A;  1OCO C;  3CZ6 A;  4EBK A;  1N1C A;  2XSE A;  3ITF A;  4W8K A;  1NZE A;  1O87 A;  2YLI A;  4MVO A;  3M1C B;  4I1O B;  4MVZ A;  1IZM A;  1O3U A;  2OOC A;  1VK5 A;  4MVM A;  4BEJ A;  1T9K A;  5KYX B;  1WAT A;  1PV3 A;  3RQG A;  4CJO A;  4YWQ A;  1WOL A;  5K0I A;  4JEB A;  3IHU A;  2YLG A;  4OIP F;  4DJ9 A;  3I5P A;  5DS6 A;  5BQG A;  2IXN A;  3ASN C;  4CIH A;  3GWL A;  1FAP B;  1HY5 A;  2CGE A;  1KNY A;  4JJG A;  3EH2 A;  1D0Y A;  3U3F A;  5F5F A;  4JCZ A;  4CX9 A;  1AVO B;  3A11 A;  1FFT C;  4U9E A;  4ER9 A;  1F1M A;  3HTK C;  2I15 A;  4CSA C;  2GAQ A;  1HW2 A;  2R02 A;  2Y3B A;  1HMD A;  3N0T A;  4HFK B;  5DS4 A;  5COF A;  2HV7 A;  1H7I A;  2EPM X;  4O6M A;  4YL3 A;  4YJW A;  4QI2 A;  2YZS A;  3GWN A;  3BEH A;  3GEE A;  2FAP B;  1NBB A;  1MMN A;  1QZX A;  2ZXP A;  3T6J A;  1A41 A;  4JRZ A;  1AUE A;  3DMD A;  3JYH A;  2NUT A;  1ZHY A;  4FX5 A;  1SMY F;  3VM6 A;  3JYY A;  1A7E A;  4LAC B;  3FMS A;  5E3A A;  4G78 A;  3GM2 A;  4XQ1 A;  5EHH A;  4YT5 A;  3NKD A;  3WG7 C;  5L0H A;  4C7O A;  3AJM A;  2XLD A;  3EGD B;  3EZI A;  2H7O A;  4F4B A;  2RD9 A;  2YL7 A;  2C04 A;  1YLM A;  3N2Z B;  2H8A A;  3LNM B;  3U9M A;  3QTH A;  2IBF A;  3KPH A;  1QKR A;  5JS5 A;  2VC9 A;  1C17 M;  2QE9 A;  4ZLD A;  1VLS A;  3O39 A;  2Q9B A;  2EPK X;  4E18 A;  5L0I A;  2QLA A;  1L3P A;  2HKV A;  1PD1 A;  3B0U X;  4BJT A;  4A4A A;  4W8P A;  3LEO A;  5E3C A;  3KYI A;  4PK4 A;  3DD7 A;  3CQZ A;  3NMK A;  2HSB A;  3S0X A;  4EUK B;  4OIQ F;  4OIO F;  2OEV A;  2Y3H A;  3DI5 A;  4AL0 A;  4JC7 A;  2XXA B;  3US6 A;  4H54 A;  3LJB A;  256B A;  1VLT A;  4PJM A;  4XEK A;  3W8H A;  1RMV A;  4DRH B;  2G3V A;  1E2X A;  4OD4 A;  5A6K A;  1C02 A;  2YRF A;  4BEM J;  2WVO A;  1OXK A;  4Z9I A;  2AP3 A;  3DE8 A;  1QPU A;  2R7W A;  2A0B A;  3EGD A;  1G8X A;  2L6H A;  3RF3 A;  4LDK A;  2YWA A;  4XPW A;  3ZDL A;  3ZVR A;  4D4X A;  5KYU B;  1OW6 A;  1VYK A;  3MLG A;  2J0W A;  2J7P A;  2Q00 A;  4K0D A;  2A6E F;  3N24 A;  4C3B A;  3K1I C;  4CS9 C;  2R05 A;  4O6Y A;  4ONS A;  2QTV A;  4B6I A;  1TFO B;  4MVS A;  1Z7Q c;  1E83 A;  3M4B A;  2DGJ A;  3UMH A;  3IEE A;  4DRJ B;  2P0N A;  2KYH A;  2LP4 A;  3V5Y A;  2WZF A;  4JUR I;  4D4N A;  4JEA A;  1GGQ A;  1C03 A;  4IRU A;  1KTM A;  3FOP A;  4NQF A;  4Z9J A;  1W2W A;  1OQC A;  1YZA A;  4CDV A;  2R7S A;  2R7V A;  3DZA A;  1V74 B;  2IYL D;  2OG2 A;  4IAQ A;  4OD5 A;  5DQZ A;  2YL0 A;  1HW1 A;  4U5G A;  1HMO A;  1Z5Z A;  2MHR A;  5E2Q A;  2XM4 A;  2E87 A;  1LE4 A;  4IGG A;  4LDQ A;  3GEI A;  3B71 A;  2L6G A;  4MVR A;  3C8G B;  3T6G B;  4EWC A;  5KYX A;  2R7R A;  2Q3T A;  3G4X A;  2FGY A;  4YL1 A;  2J9B A;  2DYS C;  4NCQ A;  1Z63 A;  3H65 A;  4AL1 A;  1E85 A;  4E7S A;  2R7O A;  2MYS A;  3T6B A;  5JVE A;  3UNG C;  3HKK A;  3RKO F;  2AU5 A;  4U5E E;  3U9J A;  3LUT B;  2CW0 F;  2L81 A;  1TWC A;  3DJN B;  3FHD A;  4EKW A;  1NFN A;  2J45 A;  5JLI A;  2Y69 C;  1JOG A;  2LK4 A;  2ASR A;  1QSP A;  4BJ1 A;  4MND A;  3WHN A;  2EPL X;  3POV A;  4XLN F;  5DLJ A;  3M79 A;  1HE1 A;  3QVY A;  3ZQY A;  1NU9 C;  4YT2 A;  2OJE D;  3K66 A;  1FNT c;  1VB5 A;  2YVK A;  4MS2 A;  2G3K A;  4QI0 A;  3QZC A;  3U5S A;  3AG4 C;  4AK9 A;  2EPN A;  5CI8 A;  3W2V A;  3S9O A;  3AQC A;  3LEV A;  3V5Z A;  4MTF A;  4JZA A;  2HSQ A;  1GQA A;  4I44 A;  4J30 B;  3O6X A;  2WB7 A;  3TJ5 A;  1YYJ A;  3ZTZ A;  2EPO A;  1OKK A;  1LI5 A;  2WVQ A;  3JT1 A;  3JSZ A;  1ORS C;  2O9X A;  2WVN A;  4JCH A;  4O6N A;  1Q0F A;  1UG7 A;  4ANJ A;  1R4T A;  2CYD A;  4XPX A;  4AE4 B;  3B0V C;  5KYY A;  2VB6 A;  3C63 A;  4JKV A;  1FMV A;  2Y3D A;  3NG1 A;  3RFY A;  2QNL A;  4U5H A;  3FAJ A;  4JW1 A;  4I3M A;  3UR3 C;  3GOD A;  3ZIB A;  3MX3 A;  4GQH A;  5T1D B;  1HE9 A;  4AE4 A;  2ZD9 A;  3JCU Q;  3CSK A;  5T3W A;  3TOL A;  1DOV A;  3OWT A;  3F47 A;  4J7Y A;  1I4Y A;  1I4Z A;  5IY5 C;  3UGO A;  5L0F A;  1MQV A;  3NYM A;  3RQF A;  2GWW A;  1BR2 A;  4E0H A;  2B0J A;  5BQI A;  2D4U A;  3IPM O;  2HMZ A;  2KSF A;  1Q0K A;  4CS7 A;  1ORY A;  5AGF A;  1M2V A;  3OA1 A;  4E7Z A;  3V7O A;  2VCA A;  1NSG B;  2DYR C;  4JIO A;  1S7Z A;  2OQM A;  3R7C A;  5BUO A;  3GEH A;  4ULV A;  1IW7 F;  1M57 C;  1OKK D;  2EIN C;  2KQ9 A;  3K7D A;  1CPQ A;  3Q6M A;  2NSG A;  3G4Z A;  3RW0 A;  1MND A;  4C3E A;  3NYJ A;  3G50 A;  4GYT A;  4PJJ A;  2HJ3 A;  3FVY A;  3RIP A;  2X0C A;  4BJ5 A;  1EA8 A;  1ZW3 A;  3NKE A;  4IAR A;  4NTA A;  5L0G A;  1TWG A;  2KK1 A;  1KU2 A;  1RCP A;  1D0X A;  5F5H A;  1JRA A;  5JP7 A;  2XL6 A;  4JTD B;  3ECS A;  3ABK C;  4EBB A;  2YKZ A;  2R7X A;  1TR2 A;  4C3D A;  4MTG A;  5COG A;  3LS1 A;  3JSE O;  3V5X A;  4KNW A;  2M64 A;  3L34 A;  1A7D A;  1LS1 A;  3IQ5 A;  4FAP B;  3MYF A;  2XLE A;  2ZXR A;  4PFO A;  3ZQV A;  2J46 A;  4MVU A;  5L0C A;  1YVI A;  4KI2 A;  4HE8 D;  4Z9H A;  1ZZP A;  3GM1 A;  5KYU A;  1M2O A;  3GAN A;  1YAU O;  2H7V C;  5D92 A;  3HNL A;  3TUL A;  1OW8 A;  5FCL A;  3PDM P;  1G4W R;  3J06 A;  2LCH A;  3L1M A;  2YHS A;  3ZTM A;  4WAB A;  1JAF A;  2ETS A;  1O5H A;  4G0H A;  3TD7 A;  5DQT A;  5B1B C;  4LLC A;  4N06 A;  1QVX A;  1Q0G A;  5DVW A;  1WGW A;  2PFD A;  1FR0 A;  1U89 A;  2OU6 A;  2J0X A;  2KJG A;  4O79 A;  3B9Q A;  4A2N B;  5KYW B;  2OJQ A;  2XRH A;  4N6H A;  1Z23 A;  5L0D A;  1BBH A;  2PP4 A;  3R2P A;  5FZT A;  4ZLC A;  1OCC C;  3VF0 A;  4DBQ A;  4RBN A;  2M4E A;  1BZ4 A;  2UUH A;  3NRH A;  3KH2 A;  2YL1 A;  4HFF B;  3KYJ A;  2Q4F A;  2Y3G A;  1OCR C;  4H4K C;  3VAY A;  4G7O F;  5T3T A;  3TQO A;  2R7T A;  4CDY A;  1I5N A;  4HEA J;  1B68 A;  2I8B A;  2PX0 A;  1H9T A;  4YK5 A;  3EQL F;  3QW0 A;  3AG3 C;  3DM5 A;  3RVZ A;  1D1A A;  3KMI A;  2AVK A;  3O55 A;  1D1B A;  2A68 F;  1RKE B;  3FOO A;  1WN0 A;  4YT4 A;  2Q9C A;  1JMW A;  1XWJ A;  2NG1 A;  3AOU A;  4E0I A;  2F22 A;  1LI7 A;  2NSF A;  1Q0D A;  3EFO B;  2XLW A;  2VAS A;  3U3B A;  2PNO A;  3B0P A;  3FXH A;  4IWB A;  5COM A;  4DRI B;  3S27 A;  4PJN A;  2Q9A A;  2W45 A;  1QLE C;  2A1D D;  3NMJ A;  1FTS A;  2RSE B;  4GEH A;  4N6C A;  1NG1 A;  1PCX A;  3LNR A;  3H2U A;  3M4C A;  3U2L A;  1ORJ A;  1UFB A;  4WJ0 A;  3EHM A;  1YZC A;  2D5R B;  4P9F A;  5L0J A;  4KNV A;  4U5F E;  1G5Z A;  4BJ5 C;  3SEO A;  2YEV A;  1Z3I X;  1MMD A;  3DAF A;  1NU7 D;  2R03 A;  2W4M A;  1BR4 A;  1RKE A;  1V4A A;  4MW8 A;  3EJN A;  1XZQ A;  1RJ9 A;  2Y39 A;  2NPU A;  1GS9 A;  4EBJ A;  5JUA A;  3FDQ A;  1CGM E;  3NDB B;  1SR2 A;  3ATP A;  1WWP A;  1ZHX A;  2J9V A;  3DXJ F;  3ZC4 A;  1D1C A;  2R9R B;  3AGT A;  1LVK A;  4K1O A;  2A0U A;  4NY3 A;  3VYW A;  2OEX A;  4G7Z F;  3GOR A;  2L6F A;  2X51 A;  4P9T A;  2HUJ A;  3TK0 A;  1E84 A;  3X2Q C;  4JTA B;  2R7Q A;  2JX0 A;  2VCC A;  1CGN A;  2DI3 A;  3SXK A;  1H9G A;  2WL8 A;  2YLD A;  3RVY A;  1YJG A;  4CJG A;  1DOW A;  3C62 A;  3DM9 B;  3LLK A;  5JT4 A;  1Y6D A;  1APC A;  3S84 A;  3TJ6 A;  4I1M A;  2ZXO A;  1BR1 A;  3JZ0 A;  2MWQ A;  2J7P D;  2ICW G;  1WAS A;  1LIH A;  3EZH A;  1YA9 A;  3A9C A;  5CIV A;  1LKX A;  5B3I A;  4XWJ A;  5EGY A;  1YAR O;  3K6B A;  4KC9 A;  2A69 F;  5A6J A;  4NTB A;  4XLP F;  1J8M F;  3CAX A;  4MVQ A;  2C03 A;  4Q5S F;  2VCB A;  4PAC A;  2JPU A;  4AX2 A;  2XXA A;  3TOM A;  2LD6 A;  3JTL O;  4J32 B;  3B29 A;  1ZU4 A;  3AG2 C;  3HJC A;  3S29 A;  3JRM O;  1T5O A;  2QY9 A;  3LAY A;  5A6B A;  1WTY A;  2AWC A;  2OCC C;  4DOZ A;  1EQ1 A;  2J9U A;  2IXO A;  1NLX A;  4WGZ A;  1LE2 A;  3L8I A;  2KGO A;  3Q6N A;  2IM8 A;  4IJJ A;  3AG1 C;  4JE9 A;  4LDR A;  4R32 A;  3RH3 A;  4BG0 A;  4BJ6 C;  2P1A A;  4XEF A;  1ZU5 A;  4LER A;  2HMQ A;  2IXP A;  2KC3 A;  1K40 A;  4PJL A;  3EGX A;  2YQY A;  4QDL A;  4E17 A;  1TWA A;  4OIR F;  1R5I D;  5D91 A;  4XEV A;  3PHF 2;  4Q4Z F;  2QUP A;  3GM3 A;  2XLO A;  3I5Q A;  1CGO A;  3E9V A;  3K1I A;  4JTC B;  4XTK A;  2LFF A;  4DBR A;  2R7U A;  2CNW D;  4U5B E;  2YL3 A;  2L9J A;  4MW3 A;  5GPG B;  3L0I A;  1NFO A;  4U5D E;  4PFP A;  3CEX A;  3K1H A;  3RYL A;  3X1O A;  3IQT A;  5CI9 A;  3DKA A;  5KYY B;  4IAO A;  1AEP A;  5HV9 A;  3T4R A;  1G4U S;  4CBE A;  4N4W A;  1M56 C;  1VOM A;  1ZW2 A;  3FAP B;  3HNJ A;  4EIY A;  3SYN A;  5AC4 A;  1S05 A;  2EIK C;  4ULW A;  4RD9 A;  1EI7 A;  1PD0 A;  1T6Q A;  4CIP A;  3DAG A;  2CCY A;  2P7V A;  3Q7L A;  4RDA A;  4EHP A;  5A6B D;  1GM5 A;  1T6U A;  1U6H A;  2A6H F;  2XLM A;  2NUT B;  3QW1 A;  4BJ6 A;  5L3Q A;  2VH3 A;  2FFH A;  1MNE A;  1ST6 A;  2R25 A;  2WZG A;  3WAQ A;  3BRJ A;  4XPY A;  4CS8 A;  5B3S C;  2WZL A;  3HNK A;  3T9O A;  1H6G A;  1M2V B;  3EGX B;  3JRT A;  1ZHZ A;  2XLH A;  2PX3 A;  5BQH A;  1V55 C;  3U8P A;  1M6T A;  1OCZ C;  3C8G A;  3EHN A;  3DE9 A;  5F28 E;  2W9Y A;  4BPM A;  2GFH A;  4DVZ A;  2XLV A;  5KYN A;  2NUP A;  4IB4 A;  1OR2 A;  2ZXW C;  4YL0 A;  2J8W A;  3NYL A;  3SXM A;  1XZP A;  2EIM C;  5JSL A;  1SYQ A;  2W4B A;  4J7T A;  3ZWI A;  1U0B B;  1OXB A;  2JD3 A;  3VRC A;  2TMV P;  3KKB A;  1ZVZ A;  5TJ5 E;  4M63 A;  4K7B A;  4CDA A;  1LM3 B;  3MYI A;  3WOD F;  3O10 A;  1ZHT A;  4PR9 A;  3ASO C;  3OEO A;  2PF4 E;  2KW3 C;  3SP1 A;  3C18 A;  1VYI A;  1YYX A; 
#chains in the Genus database with same CATH homology
 3SZR A;  2EIL C;  2ZPA A;  4CS9 A;  2NUP B;  4JJF A;  1VMA A;  3ABM C;  5HSW A;  3EG9 A;  3UMI A;  4C7O B;  1JPN A;  3EPV A;  3DJU B;  4MQ9 F;  3Q7G A;  5DS5 A;  4U5C E;  2G62 A;  3AQB A;  3HLZ A;  3K33 A;  3E70 C;  3LLI A;  3ZG1 A;  2EIJ C;  1Z6A A;  1ZYR F;  4KBL A;  4Q7C A;  1TKN A;  2P6V A;  3QMK A;  1FFH A;  4G7H F;  3SNH A;  3LES A;  3I4U A;  2V26 A;  3EG9 B;  1ZHW A;  3S28 A;  3EH1 A;  4OIN F;  1RJ9 B;  1SZI A;  4FES A;  5KYW A;  1JPJ A;  2J9W A;  3F46 A;  3W2W A;  2CNW A;  2BE5 F;  1MMG A;  4YN0 B;  1MMA A;  2CDQ A;  5L3V A;  3LS0 A;  5B3S C;  2H7B A;  4X0R A;  3UMK A;  4LLE A;  3W8I A;  4P6I C;  1V54 C;  3PMR A;  2KNH A;  3ABL C;  4CSA A;  3UGP A;  1TWH A;  2LSE A;  2IOQ A;  4JVS A;  4O7G A;  4CS8 C;  2XL4 A;  2HV6 A;  1D0Z A;  1J8Y F;  1SF8 A;  3EFO A;  5B1A C;  4DVY P;  2IXM A;  4FWV A;  3ZSU A;  4YT8 A;  2Z15 A;  3KL4 A;  1FMW A;  5E33 A;  2V3C C;  1OCO C;  3CZ6 A;  1N1C A;  2XSE A;  3ITF A;  4W8K A;  1NZE A;  1O87 A;  3M1C B;  4I1O B;  1IZM A;  1VK5 A;  4BEJ A;  5KYX B;  4YWQ A;  4OIP F;  3I5P A;  5DS6 A;  2IXN A;  3ASN C;  4CIH A;  4JJG A;  2CGE A;  3EH2 A;  1D0Y A;  5F5F A;  1FFT C;  3HTK C;  4CSA C;  2Y3B A;  3N0T A;  4HFK B;  5DS4 A;  2HV7 A;  4O6M A;  4QI2 A;  4YJW A;  2YZS A;  1MMN A;  1QZX A;  2ZXP A;  3T6J A;  3DMD A;  3JYH A;  2NUT A;  1ZHY A;  4FX5 A;  1SMY F;  4LAC B;  5E3A A;  5EHH A;  4YT5 A;  3NKD A;  3WG7 C;  4C7O A;  3EGD B;  3EZI A;  2H7O A;  4F4B A;  2C04 A;  3N2Z B;  4ZLD A;  3O39 A;  2Q9B A;  1PD1 A;  4BJT A;  5E3C A;  4PK4 A;  3DD7 A;  3CQZ A;  3S0X A;  4OIQ F;  4OIO F;  2Y3H A;  2XXA B;  3LJB A;  4PJM A;  3W8H A;  2G3V A;  4OD4 A;  2WVO A;  2R7W A;  3EGD A;  1G8X A;  3ZVR A;  5KYU B;  1VYK A;  3MLG A;  2J0W A;  2J7P A;  4K0D A;  2A6E F;  3N24 A;  4C3B A;  3K1I C;  4CS9 C;  4O6Y A;  2QTV A;  4B6I A;  2DGJ A;  3UMH A;  3IEE A;  2WZF A;  4JUR I;  4IRU A;  1W2W A;  2R7S A;  2R7V A;  3DZA A;  2IYL D;  2OG2 A;  4OD5 A;  5DQZ A;  4U5G A;  5E2Q A;  1Z5Z A;  2E87 A;  4EWC A;  5KYX A;  2R7R A;  2Q3T A;  2FGY A;  2DYS C;  1Z63 A;  3H65 A;  4E7S A;  2R7O A;  2MYS A;  3T6B A;  3UNG C;  3RKO F;  4U5E E;  2CW0 F;  2L81 A;  1TWC A;  3DJN B;  3FHD A;  2J45 A;  2Y69 C;  4BJ1 A;  4MND A;  3POV A;  4XLN F;  5DLJ A;  1NU9 C;  4YT2 A;  3K66 A;  2G3K A;  4QI0 A;  3QZC A;  3AG4 C;  4AK9 A;  5CI8 A;  3W2V A;  3AQC A;  3LEV A;  4JZA A;  4I44 A;  4J30 B;  3O6X A;  2WB7 A;  1OKK A;  2WVQ A;  4JCH A;  3JT1 A;  3JSZ A;  2O9X A;  2WVN A;  4O6N A;  4ANJ A;  4AE4 B;  3B0V C;  5KYY A;  2VB6 A;  1FMV A;  2Y3D A;  3NG1 A;  3RFY A;  4U5H A;  3FAJ A;  4JW1 A;  4I3M A;  3UR3 C;  3GOD A;  3ZIB A;  3MX3 A;  5T1D B;  4AE4 A;  3JCU Q;  5T3W A;  3CSK A;  3UGO A;  3OWT A;  3F47 A;  5IY5 C;  3NYM A;  1BR2 A;  2B0J A;  4CS7 A;  4E7Z A;  1M2V A;  3OA1 A;  3V7O A;  2DYR C;  1S7Z A;  5BUO A;  1IW7 F;  1M57 C;  1OKK D;  2EIN C;  2KQ9 A;  3K7D A;  3Q6M A;  1MND A;  4C3E A;  3NYJ A;  4GYT A;  4PJJ A;  3FVY A;  3RIP A;  4BJ5 A;  3NKE A;  1TWG A;  1KU2 A;  1D0X A;  5F5H A;  3ECS A;  3ABK C;  4EBB A;  2R7X A;  1TR2 A;  4C3D A;  3LS1 A;  4KNW A;  3L34 A;  1LS1 A;  4PFO A;  2ZXR A;  2J46 A;  4KI2 A;  4HE8 D;  5KYU A;  1M2O A;  3GAN A;  2H7V C;  5D92 A;  5FCL A;  2YHS A;  4G0H A;  1O5H A;  3TD7 A;  5DQT A;  5B1B C;  4LLC A;  4N06 A;  5DVW A;  1WGW A;  2PFD A;  2J0X A;  2KJG A;  4O79 A;  3B9Q A;  4A2N B;  5KYW B;  2XRH A;  1Z23 A;  2PP4 A;  4ZLC A;  1OCC C;  4DBQ A;  4RBN A;  2M4E A;  3NRH A;  3KH2 A;  4HFF B;  2Y3G A;  4G7O F;  1OCR C;  4H4K C;  3VAY A;  5T3T A;  2R7T A;  4HEA J;  2I8B A;  2PX0 A;  3EQL F;  3AG3 C;  3DM5 A;  1D1A A;  3KMI A;  1D1B A;  2A68 F;  4YT4 A;  2Q9C A;  2NG1 A;  3EFO B;  3B0U X;  2VAS A;  4IWB A;  3B0P A;  3S27 A;  4PJN A;  2Q9A A;  2W45 A;  1QLE C;  2A1D D;  1FTS A;  4GEH A;  1NG1 A;  1PCX A;  3LNR A;  4WJ0 A;  3EHM A;  2D5R B;  4KNV A;  4U5F E;  4BJ5 C;  3SEO A;  2YEV A;  1Z3I X;  1MMD A;  3DAF A;  1NU7 D;  2W4M A;  1BR4 A;  3EJN A;  1RJ9 A;  2Y39 A;  3FDQ A;  3NDB B;  2J9V A;  1ZHX A;  3DXJ F;  3ZC4 A;  1D1C A;  1LVK A;  4NY3 A;  3VYW A;  4G7Z F;  2X51 A;  3X2Q C;  2R7Q A;  2WL8 A;  3DM9 B;  3LLK A;  4I1M A;  2ZXO A;  1BR1 A;  2MWQ A;  2J7P D;  3EZH A;  1LKX A;  4XWJ A;  5EGY A;  3K6B A;  4KC9 A;  2A69 F;  4XLP F;  1J8M F;  4Q5S F;  2C03 A;  4AX2 A;  2XXA A;  4J32 B;  1ZU4 A;  3AG2 C;  3HJC A;  3S29 A;  2QY9 A;  3LAY A;  2OCC C;  4DOZ A;  2J9U A;  2IXO A;  3Q6N A;  2KGO A;  4IJJ A;  3AG1 C;  4BG0 A;  4BJ6 C;  3RH3 A;  1ZU5 A;  4LER A;  2IXP A;  4PJL A;  3EGX A;  4QDL A;  4Q4Z F;  1TWA A;  4OIR F;  5D91 A;  3PHF 2;  3I5Q A;  4DBR A;  3E9V A;  4XTK A;  2R7U A;  2CNW D;  4U5B E;  2L9J A;  3L0I A;  4U5D E;  4PFP A;  3K1H A;  3RYL A;  3X1O A;  5CI9 A;  5KYY B;  4IAO A;  3T4R A;  4CBE A;  1M56 C;  1VOM A;  3SYN A;  2EIK C;  4ULW A;  4RD9 A;  1PD0 A;  3DAG A;  2P7V A;  3Q7L A;  4RDA A;  2A6H F;  2NUT B;  4BJ6 A;  5L3Q A;  2VH3 A;  2FFH A;  1MNE A;  1ST6 A;  2WZG A;  4CS8 A;  2WZL A;  3EGX B;  1M2V B;  3JRT A;  1ZHZ A;  2PX3 A;  1V55 C;  1OCZ C;  3EHN A;  2W9Y A;  2GFH A;  4DVZ A;  5KYN A;  2NUP A;  2ZXW C;  3NYL A;  2EIM C;  2W4B A;  2JD3 A;  3KKB A;  4M63 A;  4K7B A;  3WOD F;  1ZHT A;  3ASO C;  3OEO A;  2PF4 E;  2KW3 C;  3SP1 A;  1VYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...