2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
b'GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core-binding factor, ML1-ETO
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2PP4A 2H7BA 2KNHA 2P6VA
chains in the Genus database with same CATH superfamily
2A6EF 3EQLF 3NYLA 3H2VA 1JPNA 5KYWB 3UNGC 4CS8A 4QI2A 4I1OB 2XS8A 2KJGA 1YA9A 4MNDA 1WWPA 2XXAA 3EG9A 4JE9A 3M15A 1LKXA 4NCQA 4AX2A 1OKKD 4J7YA 1YJGA 3RH3A 1G5ZA 4Q4ZF 3EJNA 3QW1A 4U9DA 1I5NA 3EGXA 1VOMA 4PJJA 2IBFA 4YJWA 3C7JA 4JEBA 1OW8A 1U89A 1XZPA 2EPLX 2XLVA 3C8ZA 4MQ9F 1QPUA 3B0PA 2EILC 3GWNA 3MFNA 4DBRA 3NDBB 4ZLCA 2IXPA 4E7SA 2R03A 4WJ0A 3LS0A 3EGDA 3L8IA 2BE5F 4JC7A 2M64A 3B0UX 2QTVA 3EG9B 4CIHA 2XXAB 2GWWA 4BJ6C 1Z5ZA 2HV6A 2XL6A 3DKAA 1FMVA 3NKDA 3AOUA 2OJED 2KSFA 3IQ6A 3TK0A 4MS2A 4C7OA 4JVSA 3EGXB 3FDQA 1JRAA 2V26A 2L6FA 3DAFA 4I3MA 2I15A 5HV9A 2CGEA 3QW0A 4OIRF 1WGWA 2A68F 3RYLA 2XLEA 2HSQA 2LCHA 4MW8A 2CNWA 1V54C 2ZXOA 2L81A 5FCLA 1C02A 1Q0GA 5A69A 3M4CA 4C3EA 1Z7Qc 5K0IA 2R7VA 2YRFA 3C18A 2DYRC 2YEVA 1A7VA 4K7BA 2YL3A 3RVYA 1SMYF 2R25A 2ZPAA 4O6MA 1HMDA 3C8GA 3KPHA 4XPYA 3RIPA 4DRHB 2TMVP 4C7OB 3KH2A 2CCYA 3HNLA 4M63A 2H7OA 3BRJA 3DD7A 1G4US 3I5PA 3U8PA 1DOVA 1L7CA 4MTGA 2FGYA 5EK0A 1QZXA 3EFOA 1LE4A 4PJMA 2NPUA 1K05A 1Q0MA 3EZHA 4JRZA 4JTDB 2QY9A 1RKCA 3RW0A 4CS8C 1R4TA 4DRIB 4WGZA 4XPWA 3ZSUA 2PFDA 2R02A 2Q4FA 1KU2A 2W9YA 2Q9AA 4H54A 4EBJA 256BA 2DYSC 3DAGA 4CSAC 3KL4A 3N2ZB 3CZ6A 2UUIA 1A41A 3C8GB 4ZLDA 2QUPA 1PD1A 3FAJA 3F47A 3HTKC 3FOOA 4X0RA 3ZVRA 4P6IC 5A6JA 2IXOA 2A69F 2KW3C 2YWAA 3TOLA 3S28A 4IAQA 3EFOB 4YT8A 4LDRA 5COMA 1FAPB 3BEHA 2KC3A 4HE8D 4IAOA 3GM3A 4MVOA 3U3FA 3GEHA 2L9JA 3Q7GA 4D4NA 5B3SC 1Z63A 1J8YF 3W4YA 2WZFA 2KGOA 5A6KA 3B71A 3GODA 2BL2A 3US6A 1NFOA 3AQCA 3GEEA 1CPRA 2QE9A 3W8HA 4PACA 2A1DD 1TWHA 3SP1A 4CIPA 1QKRA 1BBHA 1Z23A 2W4BA 3TJ6A 2H7BA 1ORYA 4PFPA 5B3IA 1E85A 3S29A 3VF0A 1VTMP 4JTAB 2YQYA 4HEAJ 2YL0A 3LEVA 4ANJA 3NRHA 2L6GA 2R05A 4NTAA 1JMWA 5L0JA 2EPMX 3VAYA 4JKVA 4BPMA 2NUPA 4CBEA 4JW1A 1ZW3A 3ASOC 1TWCA 1VLTA 5BUOA 4BJ5C 1OXKA 1EI7A 1YLMA 2NG1A 3B29A 4NC3A 1FR0A 4C3DA 4Z9JA 3AJMA 5L0IA 2D4UA 1EKYA 4IARA 2LSEA 2WVNA 3LNRA 1ZHTA 4OIOF 3L1MA 2YL1A 4O6YA 3A9CA 1N1CA 2J9WA 2RSEB 2R7WA 4CS9A 3NKEA 3K1IC 5AC5A 2EPKX 3ASNC 2NUPB 3ZQYA 3IEEA 1YZAA 1AVOB 3RQGA 3S9OA 3M4BA 2LK4A 2CDQA 1CGNA 3JYYA 3MX3A 3Q6NA 4MVZA 4AE4B 2JX0A 3JYHA 1RXQA 1M56C 2HMZA 4UDVA 2IOQA 3KMIA 2IXNA 4GYTA 5EHHA 2J45A 2J46A 1QLEC 1SF8A 3EH1A 4Z9IA 3DE9A 3H2UA 1D1CA 2OU6A 1TR2A 4O79A 2OJQA 4EBKA 2OG2A 2ZD9A 3GM2A 1TWAA 3GM1A 3VM6A 2HS5A 2WZLA 3U9JA 3WODF 1W2WA 4I1MA 2Q9CA 3K66A 3NMKA 1T01A 2HSBA 2W45A 3L8JA 2C04A 4H4KC 4DRJB 1D0XA 5E3AA 2W4MA 4CDVA 5E33A 4OD4A 1NBBA 2OEVA 4CDAA 2NSFA 4G7ZF 2Y69C 3MYIA 3OWTA 4P9FA 4HFKB 2VH3A 2J0XA 1K40A 3K6BA 2CNWD 1LM3B 1LI5A 3K1HA 4MVMA 1NLXA 1D1AA 1OXBA 3DM5A 1KNYA 2Q00A 3SXYA 5HSWA 5EGYA 5DS5A 3ZTZA 1EQ1A 4JURI 3ZIBA 2J0WA 1M2VB 4CX9A 1SYQA 4XPXA 4WABA 1BR4A 3CEXA 4ONSA 1JPJA 3C8GD 4JTCB 4J30B 3U2MA 1ZYRF 2G3VA 1YDIA 3NMIA 4K1OA 2C03A 2PBEA 1OW6A 2YLIA 1CGME 1VMAA 1ZZPA 3SNHA 1B68A 1I4ZA 1U6HA 2YL7A 4GQHA 4ER9A 3ABKC 3G4ZA 2G62A 5L0FA 1C03A 5BQGA 3W2VA 1S7ZA 3DJNB 3M1CB 5DVWA 1G4WR 2BC5A 1NU7D 2YLGA 3GWLA 3EPVA 3ZWIA 3DI5A 1K04A 2XLMA 5T1DB 2VASA 4JJGA 3U3BA 3U8VA 2YHSA 4JIOA 2ZXPA 4G7OF 2F22A 3LUTB 4QDLA 1WTYA 4CS9C 4BJTA 3O39A 4IJJA 1Q0DA 1YAUO 2AU5A 3RQFA 1LS4A 2Q3TA 1H9TA 3KYJA 3SZRA 2PX0A 3LLIA 4ULVA 4BJ1A 3K7DA 3LLKA 5A6BA 4CDYA 1M2OA 2DI3A 3GANA 3HJCA 4EHPA 4A2NB 2A0BA 4FAPB 2KYHA 2YVKA 3FXHA 3IQ5A 4MW3A 5BQIA 1CGOA 4G0HA 4P9TA 2ZXWC 4N6HA 5COFA 5IY5C 3NG1A 3ABLC 1M6TA 1M57C 3B0VC 2R7XA 2MWQA 4K0DA 3QTHA 2J7PA 1T6IA 1PV3A 5L0DA 4U5FE 2R7RA 2OKUA 2M4EA 2EIJC 1R5ID 2B0JA 1VK5A 1ST6A 1YZCA 4E18A 3S0XA 4MVSA 2Q7RA 1NSGB 3S90A 4LERA 2O9XA 2L6HA 2AWYA 4OD5A 4DJ9A 1WASA 5AGFA 4D4XA 4EKWA 4YL0A 1NU9C 1OR2A 3KYIA 4RBNA 4AK9A 1OW7A 3AG2C 1WN0A 4KNWA 1E2XA 3IHUA 3E9VA 1XZQA 1YYJA 4DXWA 3WG7C 1O87A 3JCUQ 4Q5SF 1V55C 1GS9A 2EIMC 5BQHA 3C62A 1LPEA 1PCXA 3HNIA 2E87A 4U5HA 3WAQA 5CIVA 4U9EA 2LIGA 2X51A 3UMHA 2OOCA 4FESA 3KKBA 4IB4A 3IQCA 2VB6A 2EPOA 2LP4A 5CI8A 1IW7F 2LFDA 2Y3DA 1ZHYA 2GDCA 2RD9A 1E84A 3T9OA 2NUTA 4EWCA 1S05A 2HFIA 3Q7LA 4NTBA 2R7QA 4YT5A 4MVQA 3WHNA 1UG7A 2Y3GA 3ECSA 4I44A 3ZC4A 3AGTA 5DQTA 1UFBA 1HMOA 3OEOA 4EIYA 3F46A 4DBQA 2EIKC 4KC9A 4W8KA 4CS7A 1ORSC 1BR1A 2WVQA 1ZHZA 1GQAA 5TJ5E 2P7VA 3MBGA 4YK5A 4KI2A 1U0BB 4XTKA 1YARO 2Z15A 4L6RA 4MVRA 3AQBA 4Q7CA 2CYDA 2R9RB 3DE8A 3LJBA 4AE4A 2ZXRA 1HW2A 1TFKB 3GEIA 1XWJA 3X1OA 4YN0B 3C63A 5JP7A 4HFFB 1ZW2A 1A7DA 2NUTB 2HKVA 5FZTA 1TWGA 1LE2A 1APCA 4U5EE 3AG3C 3JTLO 1SR2A 5KYUA 1JR8A 2YKZA 1RJ9A 3HNJA 5DQZA 3J06A 1D1BA 2XL4A 3E70C 4W8PA 1T6UA 4YWQA 3TULA 3SXKA 2AVKA 2KNHA 1Y4CA 5DLJA 1TQGA 4B6IA 2GAQA 4XWJA 5D92A 2P61A 4MTFA 4RD9A 1VYKA 1Z3IX 2HZ8A 3PDMP 5GPGB 2XLDA 3HLZA 3I4UA 3M79A 1V74B 5L3VA 3T6JA 3POVA 1OCCC 2HJ3A 3PCVA 1M2VA 3SYNA 4NTFA 4DOZA 1J8MF 3TJ5A 2GFHA 1Q0KA 4QI0A 2L7AA 5F5HA 1LS1A 4NY3A 4E0IA 5KYUB 2NSGA 3W2WA 2R7UA 1RJ9B 2FAPB 3AG1C 3VRCA 2VCCA 4GEHA 1MMGA 1CPQA 4LDKA 5L3QA 3DM9B 4WGYA 3S27A 3JT1A 3OA1A 3HNKA 3LS1A 3DWWA 1H7IA 3QMKA 3ZDLA 4FX5A 4XEVA 1T6QA 1C17M 3LESA 2OEXA 3I5QA 3AGUA 2ASRA 2WB7A 2IM8A 4MTOA 5JT4A 2HMQA 1QQ3A 1OCZC 1DOWA 2J9BA 3JSEO 5A6BD 2XLWA 3NMJA 4PR9A 2XL8A 4FWVA 4JCZA 2P0NA 1ZU5A 3N0TA 4OIPF 2YZSA 4XEFA 1VB5A 4AL0A 4CSAA 3HKKA 2Y3BA 4JJFA 2VC9A 3EH2A 3LAYA 5L0GA 1MQVA 4DVZA 2D5RB 2XM4A 3FHDA 3FAPB 4LDQA 2J7PD 4RDAA 5T3TA 3CAXA 2GA0A 1A7EA 2JPUA 3DJUB 3DXJF 3R2PA 4IWBA 3ZG1A 1AEPA 4BEJA 2WVOA 1NFNA 1I4YA 2HV7A 3UMIA 3AG4C 2P6VA 2EPNA 2VCAA 1JAFA 2QNLA 1T5OA 3CSKA 4N06A 1BR2A 5JLIA 3LNMB 3UGOA 5F5FA 5B1BC 1OR3A 4CJGA 5CI9A 2R7SA 1H6GA 4LACB 1SZIA 3CQZA 1OCOC 2HUJA 2XS1A 2YLDA 3EHNA 3JSZA 4O6NA 5T3WA 1OKKA 5JUAA 5JSLA 2KK1A 5D91A 1MNEA 3JZ0A 4Z9HA 3V5YA 4IGGA 3MYFA 2WZGA 3R7CA 1ZHWA 4F4BA 3EGDB 4PJLA 2J8WA 1A0BA 2XRHA 3UGPA 1LI7A 5KYYA 1MMAA 2A0UA 1ZU4A 4PFOA 1YYXA 3N24A 3DMDA 5COGA 4KNVA 3V5ZA 4N4WA 1FFTC 3O10A 3DZAA 5JRAA 1AUEA 2AP3A 2WL8A 3IQTA 4PJNA 3SEOA 2ICWG 1MMNA 1O3UA 1WATA 2LQGA 2IYLD 3G4XA 3QVZA 4YL1A 3T6GB 4BJ5A 1GM5A 2P1AA 3ABMC 1GGQA 3LEOA 3GORA 2Y39A 1FFHA 1T9KA 3W8IA 1BDJB 4E0HA 2PX3A 2J9VA 4JEAA 1HW1A 1LIHA 1VYIA 1FTSA 2G3KA 2XSEA 4J7TA 1O5HA 2CW0F 1OQCA 4PK4A 4ULWA 3RQEA 2A6HF 5F28E 1BZ4A 2H7VC 5KYYB 2OCCC 3K1IA 2XLHA 3V7OA 1WOLA 1OCRC 2Y3HA 1IZMA 4JZAA 1MMDA 2AWCA 3RVZA 2XM0A 4O7GA 1NZEA 2PF4E 3ATPA 2VCBA 4G78A 1D0ZA 3U5SA 2ETSA 3V5XA 2V3CC 3QZCA 4U5GA 1YA7O 1EA8A 2R7TA 2QLAA 2KQ9A 4N6CA 3RF3A 4XLPF 1QVXA 3SXMA 1D0YA 1FNTc 1HY5A 1MNDA 3O55A 1Y6DA 1E86A 3RFYA 3FVYA 1G8XA 1HE9A 3JRMO 3X2QC 3UR3C 3G50A 4YT4A 5L0CA 1RKEA 4YT2A 1L3PA 2LFFA 1PD0A 1E83A 1JOGA 4J32B 3B9QA 5E3CA 2DB4A 2R7OA 3UMKA 1TKNA 1H9GA 2FFHA 4C3BA 1V4AA 2XLOA 1TFOB 3U2LA 2HJMA 5JS5A 4XQ1A 3QVYA 2Q9BA 2PP4A 3FMSA 1VLSA 2X0CA 3JRTA 3T4RA 3T6BA 4AL1A 3A11A 4DVYP 4E7ZA 1RKEB 2EINC 4E17A 1NG1A 4LLEA 4U5DE 2I8BA 2IXMA 4BJ6A 1QSPA 3RKOF 3ITFA 4JCHA 4OINF 2OQMA 4A4AA 1RCPA 4U5CE 3Q6MA 3PMRA 3U9MA 4MVUA 4NQFA 3IPMO 4XLNF 5A6AA 5KYXA 1ZHXA 3ZQVA 4EUKB 3U0CA 3PHF2 3O6XA 3TOMA 1KTMA 1F1MA 1ORJA 3VYWA 1FMWA 4CJOA 3K33A 4G7HF 1ZVZA 3L34A 1Z6AA 3MLGA 5KYNA 3NYJA 5DS4A 4BG0A 5KYWA 3L0IA 1YVIA 2MHRA 4YL3A 3TD7A 4KBLA 4BEMJ 4EBBA 3TQOA 5JVEA 3FOPA 2DGJA 3ZTMA 2H8AA 2UUHA 4U5BE 4R32A 2J9UA 2PNOA 3EHMA 2MYSA 3NYMA 3EZIA 5DS6A 2JD3A 5KYXB 5E2QA 4XEKA 1Q0FA 3S84A 4OIQF 4LLCA 5B1AC 1HE1A 1LVKA 2LD6A 5L0HA 3SXZA 1RMVA 2B0HA 5AC4A 4IRUA 3H65A
chains in the Genus database with same CATH topology
2A6EF 3EQLF 3NYLA 1JPNA 5KYWB 3UNGC 4CS8A 4QI2A 4I1OB 2KJGA 4MNDA 2XXAA 3EG9A 1LKXA 4AX2A 1OKKD 3RH3A 4Q4ZF 3EJNA 3EGXA 4PJJA 1VOMA 3T6BA 4YJWA 3X1OA 3W2WA 4DBRA 4MQ9F 3B0PA 2EILC 3NDBB 4ZLCA 2IXPA 4E7SA 4WJ0A 3LS0A 3EGDA 2BE5F 2QTVA 3EG9B 4CIHA 2XXAB 4BJ6C 1Z5ZA 2HV6A 1FMVA 3NKDA 4C7OA 4JVSA 3EGXB 3FDQA 2V26A 3DAFA 4I3MA 2CGEA 4OIRF 1WGWA 2A68F 3RYLA 2CNWA 1V54C 2ZXOA 2L81A 5FCLA 4C3EA 2R7VA 2DYRC 2YEVA 4K7BA 1SMYF 2ZPAA 4O6MA 3RIPA 4C7OB 3KH2A 4M63A 2H7OA 3DD7A 3I5PA 2FGYA 1QZXA 3EFOA 4PJMA 4CS8C 3EZHA 2QY9A 3ZSUA 2PFDA 2W9YA 1KU2A 2Q9AA 4CSAC 2DYSC 3DAGA 3KL4A 3N2ZB 3CZ6A 4ZLDA 1PD1A 3FAJA 3F47A 3HTKC 4X0RA 3ZVRA 4P6IC 2IXOA 2A69F 2KW3C 3S28A 3EFOB 4YT8A 4HE8D 4IAOA 5B3SC 2L9JA 3Q7GA 1Z63A 1J8YF 2WZFA 2KGOA 3GODA 3AQCA 3W8HA 2A1DD 1TWHA 3SP1A 2W4BA 1Z23A 2H7BA 4PFPA 3S29A 4HEAJ 3LEVA 4ANJA 3NRHA 3VAYA 4CBEA 2NUPA 4JW1A 3ASOC 1TWCA 5BUOA 4BJ5C 2NG1A 4C3DA 2LSEA 2WVNA 3LNRA 1ZHTA 4OIOF 4O6YA 1N1CA 2J9WA 2R7WA 4CS9A 3NKEA 3K1IC 3ASNC 2NUPB 3IEEA 2CDQA 3MX3A 3Q6NA 4AE4B 3JYHA 1M56C 2IOQA 3KMIA 2IXNA 4GYTA 5EHHA 2J45A 2J46A 1SF8A 1QLEC 3EH1A 1D1CA 4O79A 1TR2A 2OG2A 1TWAA 2WZLA 3WODF 1W2WA 4I1MA 2Q9CA 3K66A 2W45A 4H4KC 2C04A 1D0XA 5E3AA 2W4MA 5E33A 4OD4A 4G7ZF 2Y69C 3OWTA 4HFKB 2VH3A 2J0XA 3K6BA 2CNWD 3S27A 3K1HA 3DM5A 1D1AA 5HSWA 5EGYA 5DS5A 4JURI 3ZIBA 2J0WA 1M2VB 1BR4A 1JPJA 4J30B 1ZYRF 2G3VA 2C03A 1VMAA 3SNHA 3ABKC 2G62A 3W2VA 1S7ZA 3DJNB 3M1CB 5DVWA 1NU7D 3EPVA 5T1DB 2VASA 4JJGA 2YHSA 2ZXPA 4G7OF 4QDLA 4CS9C 4BJTA 3O39A 4IJJA 2Q3TA 3SZRA 4BJ1A 2PX0A 3LLIA 3K7DA 3LLKA 1M2OA 3GANA 3HJCA 4A2NB 4G0HA 2ZXWC 5IY5C 3NG1A 3ABLC 3B0VC 1M57C 2R7XA 2MWQA 4K0DA 2J7PA 4U5FE 2R7RA 2M4EA 2EIJC 2B0JA 1VK5A 1ST6A 3S0XA 4LERA 2O9XA 4OD5A 1NU9C 4RBNA 4AK9A 3AG2C 4KNWA 3E9VA 3WG7C 1O87A 3JCUQ 4Q5SF 1V55C 2EIMC 1PCXA 4U5HA 2E87A 2X51A 3UMHA 4FESA 3KKBA 2VB6A 5CI8A 1IW7F 2Y3DA 1ZHYA 2NUTA 4EWCA 3Q7LA 4YT5A 2R7QA 3ECSA 2Y3GA 4I44A 3ZC4A 5DQTA 3OEOA 4DBQA 3F46A 2EIKC 4KC9A 4W8KA 4CS7A 2WVQA 1BR1A 1ZHZA 2P7VA 4KI2A 4XTKA 2Z15A 3AQBA 4Q7CA 3LJBA 4AE4A 2ZXRA 4YN0B 4HFFB 2NUTB 1TWGA 4U5EE 3AG3C 5KYUA 5DQZA 1RJ9A 1D1BA 2XL4A 3E70C 4YWQA 2KNHA 5DLJA 4B6IA 4XWJA 5D92A 4RD9A 1VYKA 1Z3IX 3HLZA 3POVA 3I4UA 5L3VA 3T6JA 1OCCC 1M2VA 3SYNA 4DOZA 1J8MF 2GFHA 4QI0A 5F5HA 1LS1A 4NY3A 5KYUB 2R7UA 1RJ9B 3AG1C 4GEHA 1MMGA 5L3QA 3DM9B 3JT1A 3OA1A 3LS1A 3QMKA 4FX5A 3LESA 3I5QA 2WB7A 1OCZC 4FWVA 1ZU5A 3N0TA 4OIPF 2YZSA 4CSAA 2Y3BA 4JJFA 3EH2A 3LAYA 4DVZA 2D5RB 3FHDA 2J7PD 4RDAA 5T3TA 3DJUB 3DXJF 3ZG1A 4IWBA 4BEJA 2WVOA 2HV7A 3UMIA 3AG4C 2P6VA 3CSKA 4N06A 1BR2A 5F5FA 3UGOA 5B1BC 5CI9A 2R7SA 4LACB 1SZIA 3CQZA 1OCOC 3JSZA 4O6NA 3EHNA 5T3WA 1OKKA 5D91A 1MNEA 2WZGA 1ZHWA 4F4BA 3EGDB 4PJLA 2XRHA 3UGPA 5KYYA 1MMAA 1ZU4A 4PFOA 3N24A 3DMDA 4KNVA 1FFTC 3DZAA 2WL8A 3SEOA 4PJNA 1MMNA 4BJ5A 2IYLD 3ABMC 2Y39A 1FFHA 3W8IA 2PX3A 2J9VA 1VYIA 2G3KA 1FTSA 2XSEA 3B0UX 1O5HA 2CW0F 4PK4A 4ULWA 5KYYB 2A6HF 2H7VC 2OCCC 3V7OA 1OCRC 2Y3HA 1IZMA 4JZAA 1MMDA 4O7GA 1NZEA 2PF4E 1D0ZA 2V3CC 3QZCA 4U5GA 2R7TA 2KQ9A 4XLPF 1D0YA 1MNDA 3RFYA 3FVYA 1G8XA 3X2QC 4YT4A 3UR3C 4YT2A 1PD0A 4J32B 3B9QA 5E3CA 2R7OA 3UMKA 1TKNA 2FFHA 4C3BA 2Q9BA 2PP4A 3T4RA 4DVYP 3JRTA 4E7ZA 2EINC 1NG1A 4LLEA 4U5DE 2I8BA 2IXMA 4BJ6A 3RKOF 3ITFA 4JCHA 4OINF 4U5CE 3Q6MA 3PMRA 5KYXA 4XLNF 1ZHXA 3PHF2 3O6XA 3VYWA 1FMWA 4G7HF 3K33A 3L34A 1Z6AA 3MLGA 5KYNA 3NYJA 5DS4A 4BG0A 5KYWA 3L0IA 4EBBA 3TD7A 4KBLA 2DGJA 4U5BE 2J9UA 3EHMA 2MYSA 3NYMA 3EZIA 5DS6A 2JD3A 5KYXB 5E2QA 4OIQF 4LLCA 5B1AC 1LVKA 4IRUA 3H65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PP4 A;  2H7B A;  2KNH A;  2P6V A; 
#chains in the Genus database with same CATH topology
 2A6E F;  3EQL F;  3NYL A;  3H2V A;  1JPN A;  5KYW B;  3UNG C;  4CS8 A;  4QI2 A;  4I1O B;  2XS8 A;  2KJG A;  1YA9 A;  4MND A;  1WWP A;  2XXA A;  3EG9 A;  4JE9 A;  3M15 A;  1LKX A;  4NCQ A;  4AX2 A;  1OKK D;  4J7Y A;  1YJG A;  3RH3 A;  1G5Z A;  4Q4Z F;  3EJN A;  3QW1 A;  4U9D A;  1I5N A;  3EGX A;  1VOM A;  4PJJ A;  2IBF A;  4YJW A;  3C7J A;  4JEB A;  1OW8 A;  1U89 A;  1XZP A;  2EPL X;  2XLV A;  3C8Z A;  4MQ9 F;  1QPU A;  3B0P A;  2EIL C;  3GWN A;  3MFN A;  4DBR A;  3NDB B;  4ZLC A;  2IXP A;  4E7S A;  2R03 A;  4WJ0 A;  3LS0 A;  3EGD A;  3L8I A;  2BE5 F;  4JC7 A;  2M64 A;  3B0U X;  2QTV A;  3EG9 B;  4CIH A;  2XXA B;  2GWW A;  4BJ6 C;  1Z5Z A;  2HV6 A;  2XL6 A;  3DKA A;  1FMV A;  3NKD A;  3AOU A;  2OJE D;  2KSF A;  3IQ6 A;  3TK0 A;  4MS2 A;  4C7O A;  4JVS A;  3EGX B;  3FDQ A;  1JRA A;  2V26 A;  2L6F A;  3DAF A;  4I3M A;  2I15 A;  5HV9 A;  2CGE A;  3QW0 A;  4OIR F;  1WGW A;  2A68 F;  3RYL A;  2XLE A;  2HSQ A;  2LCH A;  4MW8 A;  2CNW A;  1V54 C;  2ZXO A;  2L81 A;  5FCL A;  1C02 A;  1Q0G A;  5A69 A;  3M4C A;  4C3E A;  1Z7Q c;  5K0I A;  2R7V A;  2YRF A;  3C18 A;  2DYR C;  2YEV A;  1A7V A;  4K7B A;  2YL3 A;  3RVY A;  1SMY F;  2R25 A;  2ZPA A;  4O6M A;  1HMD A;  3C8G A;  3KPH A;  4XPY A;  3RIP A;  4DRH B;  2TMV P;  4C7O B;  3KH2 A;  2CCY A;  3HNL A;  4M63 A;  2H7O A;  3BRJ A;  3DD7 A;  1G4U S;  3I5P A;  3U8P A;  1DOV A;  1L7C A;  4MTG A;  2FGY A;  5EK0 A;  1QZX A;  3EFO A;  1LE4 A;  4PJM A;  2NPU A;  1K05 A;  1Q0M A;  3EZH A;  4JRZ A;  4JTD B;  2QY9 A;  1RKC A;  3RW0 A;  4CS8 C;  1R4T A;  4DRI B;  4WGZ A;  4XPW A;  3ZSU A;  2PFD A;  2R02 A;  2Q4F A;  1KU2 A;  2W9Y A;  2Q9A A;  4H54 A;  4EBJ A;  256B A;  2DYS C;  3DAG A;  4CSA C;  3KL4 A;  3N2Z B;  3CZ6 A;  2UUI A;  1A41 A;  3C8G B;  4ZLD A;  2QUP A;  1PD1 A;  3FAJ A;  3F47 A;  3HTK C;  3FOO A;  4X0R A;  3ZVR A;  4P6I C;  5A6J A;  2IXO A;  2A69 F;  2KW3 C;  2YWA A;  3TOL A;  3S28 A;  4IAQ A;  3EFO B;  4YT8 A;  4LDR A;  5COM A;  1FAP B;  3BEH A;  2KC3 A;  4HE8 D;  4IAO A;  3GM3 A;  4MVO A;  3U3F A;  3GEH A;  2L9J A;  3Q7G A;  4D4N A;  5B3S C;  1Z63 A;  1J8Y F;  3W4Y A;  2WZF A;  2KGO A;  5A6K A;  3B71 A;  3GOD A;  2BL2 A;  3US6 A;  1NFO A;  3AQC A;  3GEE A;  1CPR A;  2QE9 A;  3W8H A;  4PAC A;  2A1D D;  1TWH A;  3SP1 A;  4CIP A;  1QKR A;  1BBH A;  1Z23 A;  2W4B A;  3TJ6 A;  2H7B A;  1ORY A;  4PFP A;  5B3I A;  1E85 A;  3S29 A;  3VF0 A;  1VTM P;  4JTA B;  2YQY A;  4HEA J;  2YL0 A;  3LEV A;  4ANJ A;  3NRH A;  2L6G A;  2R05 A;  4NTA A;  1JMW A;  5L0J A;  2EPM X;  3VAY A;  4JKV A;  4BPM A;  2NUP A;  4CBE A;  4JW1 A;  1ZW3 A;  3ASO C;  1TWC A;  1VLT A;  5BUO A;  4BJ5 C;  1OXK A;  1EI7 A;  1YLM A;  2NG1 A;  3B29 A;  4NC3 A;  1FR0 A;  4C3D A;  4Z9J A;  3AJM A;  5L0I A;  2D4U A;  1EKY A;  4IAR A;  2LSE A;  2WVN A;  3LNR A;  1ZHT A;  4OIO F;  3L1M A;  2YL1 A;  4O6Y A;  3A9C A;  1N1C A;  2J9W A;  2RSE B;  2R7W A;  4CS9 A;  3NKE A;  3K1I C;  5AC5 A;  2EPK X;  3ASN C;  2NUP B;  3ZQY A;  3IEE A;  1YZA A;  1AVO B;  3RQG A;  3S9O A;  3M4B A;  2LK4 A;  2CDQ A;  1CGN A;  3JYY A;  3MX3 A;  3Q6N A;  4MVZ A;  4AE4 B;  2JX0 A;  3JYH A;  1RXQ A;  1M56 C;  2HMZ A;  4UDV A;  2IOQ A;  3KMI A;  2IXN A;  4GYT A;  5EHH A;  2J45 A;  2J46 A;  1QLE C;  1SF8 A;  3EH1 A;  4Z9I A;  3DE9 A;  3H2U A;  1D1C A;  2OU6 A;  1TR2 A;  4O79 A;  2OJQ A;  4EBK A;  2OG2 A;  2ZD9 A;  3GM2 A;  1TWA A;  3GM1 A;  3VM6 A;  2HS5 A;  2WZL A;  3U9J A;  3WOD F;  1W2W A;  4I1M A;  2Q9C A;  3K66 A;  3NMK A;  1T01 A;  2HSB A;  2W45 A;  3L8J A;  2C04 A;  4H4K C;  4DRJ B;  1D0X A;  5E3A A;  2W4M A;  4CDV A;  5E33 A;  4OD4 A;  1NBB A;  2OEV A;  4CDA A;  2NSF A;  4G7Z F;  2Y69 C;  3MYI A;  3OWT A;  4P9F A;  4HFK B;  2VH3 A;  2J0X A;  1K40 A;  3K6B A;  2CNW D;  1LM3 B;  1LI5 A;  3K1H A;  4MVM A;  1NLX A;  1D1A A;  1OXB A;  3DM5 A;  1KNY A;  2Q00 A;  3SXY A;  5HSW A;  5EGY A;  5DS5 A;  3ZTZ A;  1EQ1 A;  4JUR I;  3ZIB A;  2J0W A;  1M2V B;  4CX9 A;  1SYQ A;  4XPX A;  4WAB A;  1BR4 A;  3CEX A;  4ONS A;  1JPJ A;  3C8G D;  4JTC B;  4J30 B;  3U2M A;  1ZYR F;  2G3V A;  1YDI A;  3NMI A;  4K1O A;  2C03 A;  2PBE A;  1OW6 A;  2YLI A;  1CGM E;  1VMA A;  1ZZP A;  3SNH A;  1B68 A;  1I4Z A;  1U6H A;  2YL7 A;  4GQH A;  4ER9 A;  3ABK C;  3G4Z A;  2G62 A;  5L0F A;  1C03 A;  5BQG A;  3W2V A;  1S7Z A;  3DJN B;  3M1C B;  5DVW A;  1G4W R;  2BC5 A;  1NU7 D;  2YLG A;  3GWL A;  3EPV A;  3ZWI A;  3DI5 A;  1K04 A;  2XLM A;  5T1D B;  2VAS A;  4JJG A;  3U3B A;  3U8V A;  2YHS A;  4JIO A;  2ZXP A;  4G7O F;  2F22 A;  3LUT B;  4QDL A;  1WTY A;  4CS9 C;  4BJT A;  3O39 A;  4IJJ A;  1Q0D A;  1YAU O;  2AU5 A;  3RQF A;  1LS4 A;  2Q3T A;  1H9T A;  3KYJ A;  3SZR A;  2PX0 A;  3LLI A;  4ULV A;  4BJ1 A;  3K7D A;  3LLK A;  5A6B A;  4CDY A;  1M2O A;  2DI3 A;  3GAN A;  3HJC A;  4EHP A;  4A2N B;  2A0B A;  4FAP B;  2KYH A;  2YVK A;  3FXH A;  3IQ5 A;  4MW3 A;  5BQI A;  1CGO A;  4G0H A;  4P9T A;  2ZXW C;  4N6H A;  5COF A;  5IY5 C;  3NG1 A;  3ABL C;  1M6T A;  1M57 C;  3B0V C;  2R7X A;  2MWQ A;  4K0D A;  3QTH A;  2J7P A;  1T6I A;  1PV3 A;  5L0D A;  4U5F E;  2R7R A;  2OKU A;  2M4E A;  2EIJ C;  1R5I D;  2B0J A;  1VK5 A;  1ST6 A;  1YZC A;  4E18 A;  3S0X A;  4MVS A;  2Q7R A;  1NSG B;  3S90 A;  4LER A;  2O9X A;  2L6H A;  2AWY A;  4OD5 A;  4DJ9 A;  1WAS A;  5AGF A;  4D4X A;  4EKW A;  4YL0 A;  1NU9 C;  1OR2 A;  3KYI A;  4RBN A;  4AK9 A;  1OW7 A;  3AG2 C;  1WN0 A;  4KNW A;  1E2X A;  3IHU A;  3E9V A;  1XZQ A;  1YYJ A;  4DXW A;  3WG7 C;  1O87 A;  3JCU Q;  4Q5S F;  1V55 C;  1GS9 A;  2EIM C;  5BQH A;  3C62 A;  1LPE A;  1PCX A;  3HNI A;  2E87 A;  4U5H A;  3WAQ A;  5CIV A;  4U9E A;  2LIG A;  2X51 A;  3UMH A;  2OOC A;  4FES A;  3KKB A;  4IB4 A;  3IQC A;  2VB6 A;  2EPO A;  2LP4 A;  5CI8 A;  1IW7 F;  2LFD A;  2Y3D A;  1ZHY A;  2GDC A;  2RD9 A;  1E84 A;  3T9O A;  2NUT A;  4EWC A;  1S05 A;  2HFI A;  3Q7L A;  4NTB A;  2R7Q A;  4YT5 A;  4MVQ A;  3WHN A;  1UG7 A;  2Y3G A;  3ECS A;  4I44 A;  3ZC4 A;  3AGT A;  5DQT A;  1UFB A;  1HMO A;  3OEO A;  4EIY A;  3F46 A;  4DBQ A;  2EIK C;  4KC9 A;  4W8K A;  4CS7 A;  1ORS C;  1BR1 A;  2WVQ A;  1ZHZ A;  1GQA A;  5TJ5 E;  2P7V A;  3MBG A;  4YK5 A;  4KI2 A;  1U0B B;  4XTK A;  1YAR O;  2Z15 A;  4L6R A;  4MVR A;  3AQB A;  4Q7C A;  2CYD A;  2R9R B;  3DE8 A;  3LJB A;  4AE4 A;  2ZXR A;  1HW2 A;  1TFK B;  3GEI A;  1XWJ A;  3X1O A;  4YN0 B;  3C63 A;  5JP7 A;  4HFF B;  1ZW2 A;  1A7D A;  2NUT B;  2HKV A;  5FZT A;  1TWG A;  1LE2 A;  1APC A;  4U5E E;  3AG3 C;  3JTL O;  1SR2 A;  5KYU A;  1JR8 A;  2YKZ A;  1RJ9 A;  3HNJ A;  5DQZ A;  3J06 A;  1D1B A;  2XL4 A;  3E70 C;  4W8P A;  1T6U A;  4YWQ A;  3TUL A;  3SXK A;  2AVK A;  2KNH A;  1Y4C A;  5DLJ A;  1TQG A;  4B6I A;  2GAQ A;  4XWJ A;  5D92 A;  2P61 A;  4MTF A;  4RD9 A;  1VYK A;  1Z3I X;  2HZ8 A;  3PDM P;  5GPG B;  2XLD A;  3HLZ A;  3I4U A;  3M79 A;  1V74 B;  5L3V A;  3T6J A;  3POV A;  1OCC C;  2HJ3 A;  3PCV A;  1M2V A;  3SYN A;  4NTF A;  4DOZ A;  1J8M F;  3TJ5 A;  2GFH A;  1Q0K A;  4QI0 A;  2L7A A;  5F5H A;  1LS1 A;  4NY3 A;  4E0I A;  5KYU B;  2NSG A;  3W2W A;  2R7U A;  1RJ9 B;  2FAP B;  3AG1 C;  3VRC A;  2VCC A;  4GEH A;  1MMG A;  1CPQ A;  4LDK A;  5L3Q A;  3DM9 B;  4WGY A;  3S27 A;  3JT1 A;  3OA1 A;  3HNK A;  3LS1 A;  3DWW A;  1H7I A;  3QMK A;  3ZDL A;  4FX5 A;  4XEV A;  1T6Q A;  1C17 M;  3LES A;  2OEX A;  3I5Q A;  3AGU A;  2ASR A;  2WB7 A;  2IM8 A;  4MTO A;  5JT4 A;  2HMQ A;  1QQ3 A;  1OCZ C;  1DOW A;  2J9B A;  3JSE O;  5A6B D;  2XLW A;  3NMJ A;  4PR9 A;  2XL8 A;  4FWV A;  4JCZ A;  2P0N A;  1ZU5 A;  3N0T A;  4OIP F;  2YZS A;  4XEF A;  1VB5 A;  4AL0 A;  4CSA A;  3HKK A;  2Y3B A;  4JJF A;  2VC9 A;  3EH2 A;  3LAY A;  5L0G A;  1MQV A;  4DVZ A;  2D5R B;  2XM4 A;  3FHD A;  3FAP B;  4LDQ A;  2J7P D;  4RDA A;  5T3T A;  3CAX A;  2GA0 A;  1A7E A;  2JPU A;  3DJU B;  3DXJ F;  3R2P A;  4IWB A;  3ZG1 A;  1AEP A;  4BEJ A;  2WVO A;  1NFN A;  1I4Y A;  2HV7 A;  3UMI A;  3AG4 C;  2P6V A;  2EPN A;  2VCA A;  1JAF A;  2QNL A;  1T5O A;  3CSK A;  4N06 A;  1BR2 A;  5JLI A;  3LNM B;  3UGO A;  5F5F A;  5B1B C;  1OR3 A;  4CJG A;  5CI9 A;  2R7S A;  1H6G A;  4LAC B;  1SZI A;  3CQZ A;  1OCO C;  2HUJ A;  2XS1 A;  2YLD A;  3EHN A;  3JSZ A;  4O6N A;  5T3W A;  1OKK A;  5JUA A;  5JSL A;  2KK1 A;  5D91 A;  1MNE A;  3JZ0 A;  4Z9H A;  3V5Y A;  4IGG A;  3MYF A;  2WZG A;  3R7C A;  1ZHW A;  4F4B A;  3EGD B;  4PJL A;  2J8W A;  1A0B A;  2XRH A;  3UGP A;  1LI7 A;  5KYY A;  1MMA A;  2A0U A;  1ZU4 A;  4PFO A;  1YYX A;  3N24 A;  3DMD A;  5COG A;  4KNV A;  3V5Z A;  4N4W A;  1FFT C;  3O10 A;  3DZA A;  5JRA A;  1AUE A;  2AP3 A;  2WL8 A;  3IQT A;  4PJN A;  3SEO A;  2ICW G;  1MMN A;  1O3U A;  1WAT A;  2LQG A;  2IYL D;  3G4X A;  3QVZ A;  4YL1 A;  3T6G B;  4BJ5 A;  1GM5 A;  2P1A A;  3ABM C;  1GGQ A;  3LEO A;  3GOR A;  2Y39 A;  1FFH A;  1T9K A;  3W8I A;  1BDJ B;  4E0H A;  2PX3 A;  2J9V A;  4JEA A;  1HW1 A;  1LIH A;  1VYI A;  1FTS A;  2G3K A;  2XSE A;  4J7T A;  1O5H A;  2CW0 F;  1OQC A;  4PK4 A;  4ULW A;  3RQE A;  2A6H F;  5F28 E;  1BZ4 A;  2H7V C;  5KYY B;  2OCC C;  3K1I A;  2XLH A;  3V7O A;  1WOL A;  1OCR C;  2Y3H A;  1IZM A;  4JZA A;  1MMD A;  2AWC A;  3RVZ A;  2XM0 A;  4O7G A;  1NZE A;  2PF4 E;  3ATP A;  2VCB A;  4G78 A;  1D0Z A;  3U5S A;  2ETS A;  3V5X A;  2V3C C;  3QZC A;  4U5G A;  1YA7 O;  1EA8 A;  2R7T A;  2QLA A;  2KQ9 A;  4N6C A;  3RF3 A;  4XLP F;  1QVX A;  3SXM A;  1D0Y A;  1FNT c;  1HY5 A;  1MND A;  3O55 A;  1Y6D A;  1E86 A;  3RFY A;  3FVY A;  1G8X A;  1HE9 A;  3JRM O;  3X2Q C;  3UR3 C;  3G50 A;  4YT4 A;  5L0C A;  1RKE A;  4YT2 A;  1L3P A;  2LFF A;  1PD0 A;  1E83 A;  1JOG A;  4J32 B;  3B9Q A;  5E3C A;  2DB4 A;  2R7O A;  3UMK A;  1TKN A;  1H9G A;  2FFH A;  4C3B A;  1V4A A;  2XLO A;  1TFO B;  3U2L A;  2HJM A;  5JS5 A;  4XQ1 A;  3QVY A;  2Q9B A;  2PP4 A;  3FMS A;  1VLS A;  2X0C A;  3JRT A;  3T4R A;  3T6B A;  4AL1 A;  3A11 A;  4DVY P;  4E7Z A;  1RKE B;  2EIN C;  4E17 A;  1NG1 A;  4LLE A;  4U5D E;  2I8B A;  2IXM A;  4BJ6 A;  1QSP A;  3RKO F;  3ITF A;  4JCH A;  4OIN F;  2OQM A;  4A4A A;  1RCP A;  4U5C E;  3Q6M A;  3PMR A;  3U9M A;  4MVU A;  4NQF A;  3IPM O;  4XLN F;  5A6A A;  5KYX A;  1ZHX A;  3ZQV A;  4EUK B;  3U0C A;  3PHF 2;  3O6X A;  3TOM A;  1KTM A;  1F1M A;  1ORJ A;  3VYW A;  1FMW A;  4CJO A;  3K33 A;  4G7H F;  1ZVZ A;  3L34 A;  1Z6A A;  3MLG A;  5KYN A;  3NYJ A;  5DS4 A;  4BG0 A;  5KYW A;  3L0I A;  1YVI A;  2MHR A;  4YL3 A;  3TD7 A;  4KBL A;  4BEM J;  4EBB A;  3TQO A;  5JVE A;  3FOP A;  2DGJ A;  3ZTM A;  2H8A A;  2UUH A;  4U5B E;  4R32 A;  2J9U A;  2PNO A;  3EHM A;  2MYS A;  3NYM A;  3EZI A;  5DS6 A;  2JD3 A;  5KYX B;  5E2Q A;  4XEK A;  1Q0F A;  3S84 A;  4OIQ F;  4LLC A;  5B1A C;  1HE1 A;  1LVK A;  2LD6 A;  5L0H A;  3SXZ A;  1RMV A;  2B0H A;  5AC4 A;  4IRU A;  3H65 A; 
#chains in the Genus database with same CATH homology
 2A6E F;  3EQL F;  3NYL A;  1JPN A;  5KYW B;  3UNG C;  4CS8 A;  4QI2 A;  4I1O B;  2KJG A;  4MND A;  2XXA A;  3EG9 A;  1LKX A;  4AX2 A;  1OKK D;  3RH3 A;  4Q4Z F;  3EJN A;  3EGX A;  4PJJ A;  1VOM A;  3T6B A;  4YJW A;  3X1O A;  3W2W A;  4DBR A;  4MQ9 F;  3B0P A;  2EIL C;  3NDB B;  4ZLC A;  2IXP A;  4E7S A;  4WJ0 A;  3LS0 A;  3EGD A;  2BE5 F;  2QTV A;  3EG9 B;  4CIH A;  2XXA B;  4BJ6 C;  1Z5Z A;  2HV6 A;  1FMV A;  3NKD A;  4C7O A;  4JVS A;  3EGX B;  3FDQ A;  2V26 A;  3DAF A;  4I3M A;  2CGE A;  4OIR F;  1WGW A;  2A68 F;  3RYL A;  2CNW A;  1V54 C;  2ZXO A;  2L81 A;  5FCL A;  4C3E A;  2R7V A;  2DYR C;  2YEV A;  4K7B A;  1SMY F;  2ZPA A;  4O6M A;  3RIP A;  4C7O B;  3KH2 A;  4M63 A;  2H7O A;  3DD7 A;  3I5P A;  2FGY A;  1QZX A;  3EFO A;  4PJM A;  4CS8 C;  3EZH A;  2QY9 A;  3ZSU A;  2PFD A;  2W9Y A;  1KU2 A;  2Q9A A;  4CSA C;  2DYS C;  3DAG A;  3KL4 A;  3N2Z B;  3CZ6 A;  4ZLD A;  1PD1 A;  3FAJ A;  3F47 A;  3HTK C;  4X0R A;  3ZVR A;  4P6I C;  2IXO A;  2A69 F;  2KW3 C;  3S28 A;  3EFO B;  4YT8 A;  4HE8 D;  4IAO A;  5B3S C;  2L9J A;  3Q7G A;  1Z63 A;  1J8Y F;  2WZF A;  2KGO A;  3GOD A;  3AQC A;  3W8H A;  2A1D D;  1TWH A;  3SP1 A;  2W4B A;  1Z23 A;  2H7B A;  4PFP A;  3S29 A;  4HEA J;  3LEV A;  4ANJ A;  3NRH A;  3VAY A;  4CBE A;  2NUP A;  4JW1 A;  3ASO C;  1TWC A;  5BUO A;  4BJ5 C;  2NG1 A;  4C3D A;  2LSE A;  2WVN A;  3LNR A;  1ZHT A;  4OIO F;  4O6Y A;  1N1C A;  2J9W A;  2R7W A;  4CS9 A;  3NKE A;  3K1I C;  3ASN C;  2NUP B;  3IEE A;  2CDQ A;  3MX3 A;  3Q6N A;  4AE4 B;  3JYH A;  1M56 C;  2IOQ A;  3KMI A;  2IXN A;  4GYT A;  5EHH A;  2J45 A;  2J46 A;  1SF8 A;  1QLE C;  3EH1 A;  1D1C A;  4O79 A;  1TR2 A;  2OG2 A;  1TWA A;  2WZL A;  3WOD F;  1W2W A;  4I1M A;  2Q9C A;  3K66 A;  2W45 A;  4H4K C;  2C04 A;  1D0X A;  5E3A A;  2W4M A;  5E33 A;  4OD4 A;  4G7Z F;  2Y69 C;  3OWT A;  4HFK B;  2VH3 A;  2J0X A;  3K6B A;  2CNW D;  3S27 A;  3K1H A;  3DM5 A;  1D1A A;  5HSW A;  5EGY A;  5DS5 A;  4JUR I;  3ZIB A;  2J0W A;  1M2V B;  1BR4 A;  1JPJ A;  4J30 B;  1ZYR F;  2G3V A;  2C03 A;  1VMA A;  3SNH A;  3ABK C;  2G62 A;  3W2V A;  1S7Z A;  3DJN B;  3M1C B;  5DVW A;  1NU7 D;  3EPV A;  5T1D B;  2VAS A;  4JJG A;  2YHS A;  2ZXP A;  4G7O F;  4QDL A;  4CS9 C;  4BJT A;  3O39 A;  4IJJ A;  2Q3T A;  3SZR A;  4BJ1 A;  2PX0 A;  3LLI A;  3K7D A;  3LLK A;  1M2O A;  3GAN A;  3HJC A;  4A2N B;  4G0H A;  2ZXW C;  5IY5 C;  3NG1 A;  3ABL C;  3B0V C;  1M57 C;  2R7X A;  2MWQ A;  4K0D A;  2J7P A;  4U5F E;  2R7R A;  2M4E A;  2EIJ C;  2B0J A;  1VK5 A;  1ST6 A;  3S0X A;  4LER A;  2O9X A;  4OD5 A;  1NU9 C;  4RBN A;  4AK9 A;  3AG2 C;  4KNW A;  3E9V A;  3WG7 C;  1O87 A;  3JCU Q;  4Q5S F;  1V55 C;  2EIM C;  1PCX A;  4U5H A;  2E87 A;  2X51 A;  3UMH A;  4FES A;  3KKB A;  2VB6 A;  5CI8 A;  1IW7 F;  2Y3D A;  1ZHY A;  2NUT A;  4EWC A;  3Q7L A;  4YT5 A;  2R7Q A;  3ECS A;  2Y3G A;  4I44 A;  3ZC4 A;  5DQT A;  3OEO A;  4DBQ A;  3F46 A;  2EIK C;  4KC9 A;  4W8K A;  4CS7 A;  2WVQ A;  1BR1 A;  1ZHZ A;  2P7V A;  4KI2 A;  4XTK A;  2Z15 A;  3AQB A;  4Q7C A;  3LJB A;  4AE4 A;  2ZXR A;  4YN0 B;  4HFF B;  2NUT B;  1TWG A;  4U5E E;  3AG3 C;  5KYU A;  5DQZ A;  1RJ9 A;  1D1B A;  2XL4 A;  3E70 C;  4YWQ A;  2KNH A;  5DLJ A;  4B6I A;  4XWJ A;  5D92 A;  4RD9 A;  1VYK A;  1Z3I X;  3HLZ A;  3POV A;  3I4U A;  5L3V A;  3T6J A;  1OCC C;  1M2V A;  3SYN A;  4DOZ A;  1J8M F;  2GFH A;  4QI0 A;  5F5H A;  1LS1 A;  4NY3 A;  5KYU B;  2R7U A;  1RJ9 B;  3AG1 C;  4GEH A;  1MMG A;  5L3Q A;  3DM9 B;  3JT1 A;  3OA1 A;  3LS1 A;  3QMK A;  4FX5 A;  3LES A;  3I5Q A;  2WB7 A;  1OCZ C;  4FWV A;  1ZU5 A;  3N0T A;  4OIP F;  2YZS A;  4CSA A;  2Y3B A;  4JJF A;  3EH2 A;  3LAY A;  4DVZ A;  2D5R B;  3FHD A;  2J7P D;  4RDA A;  5T3T A;  3DJU B;  3DXJ F;  3ZG1 A;  4IWB A;  4BEJ A;  2WVO A;  2HV7 A;  3UMI A;  3AG4 C;  2P6V A;  3CSK A;  4N06 A;  1BR2 A;  5F5F A;  3UGO A;  5B1B C;  5CI9 A;  2R7S A;  4LAC B;  1SZI A;  3CQZ A;  1OCO C;  3JSZ A;  4O6N A;  3EHN A;  5T3W A;  1OKK A;  5D91 A;  1MNE A;  2WZG A;  1ZHW A;  4F4B A;  3EGD B;  4PJL A;  2XRH A;  3UGP A;  5KYY A;  1MMA A;  1ZU4 A;  4PFO A;  3N24 A;  3DMD A;  4KNV A;  1FFT C;  3DZA A;  2WL8 A;  3SEO A;  4PJN A;  1MMN A;  4BJ5 A;  2IYL D;  3ABM C;  2Y39 A;  1FFH A;  3W8I A;  2PX3 A;  2J9V A;  1VYI A;  2G3K A;  1FTS A;  2XSE A;  3B0U X;  1O5H A;  2CW0 F;  4PK4 A;  4ULW A;  5KYY B;  2A6H F;  2H7V C;  2OCC C;  3V7O A;  1OCR C;  2Y3H A;  1IZM A;  4JZA A;  1MMD A;  4O7G A;  1NZE A;  2PF4 E;  1D0Z A;  2V3C C;  3QZC A;  4U5G A;  2R7T A;  2KQ9 A;  4XLP F;  1D0Y A;  1MND A;  3RFY A;  3FVY A;  1G8X A;  3X2Q C;  4YT4 A;  3UR3 C;  4YT2 A;  1PD0 A;  4J32 B;  3B9Q A;  5E3C A;  2R7O A;  3UMK A;  1TKN A;  2FFH A;  4C3B A;  2Q9B A;  2PP4 A;  3T4R A;  4DVY P;  3JRT A;  4E7Z A;  2EIN C;  1NG1 A;  4LLE A;  4U5D E;  2I8B A;  2IXM A;  4BJ6 A;  3RKO F;  3ITF A;  4JCH A;  4OIN F;  4U5C E;  3Q6M A;  3PMR A;  5KYX A;  4XLN F;  1ZHX A;  3PHF 2;  3O6X A;  3VYW A;  1FMW A;  4G7H F;  3K33 A;  3L34 A;  1Z6A A;  3MLG A;  5KYN A;  3NYJ A;  5DS4 A;  4BG0 A;  5KYW A;  3L0I A;  4EBB A;  3TD7 A;  4KBL A;  2DGJ A;  4U5B E;  2J9U A;  3EHM A;  2MYS A;  3NYM A;  3EZI A;  5DS6 A;  2JD3 A;  5KYX B;  5E2Q A;  4OIQ F;  4LLC A;  5B1A C;  1LVK A;  4IRU A;  3H65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...