2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core-binding factor, ML1-ETO
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2H7BA 2PP4A 2P6VA 2KNHA
chains in the Genus database with same CATH superfamily
4LDRA 3SXYA 2WZLA 1VK5A 5JLIA 2WVNA 5KYXA 4DBRA 3KPHA 2A69F 4C3DA 1K05A 1SYQA 3U2LA 5AC4A 1QPUA 3ABMC 1XZPA 2VASA 1YZCA 3IQTA 1O5HA 2XXAA 3IQCA 1TKNA 1FAPB 1JMWA 2KC3A 3EGXA 2ZXRA 1FFTC 3GEIA 3GM2A 2ETSA 3KMIA 4MVQA 4MW8A 2ZXOA 5KYWA 4CS8C 1E84A 4YT2A 4FESA 5L0JA 3QZCA 5TJ5E 2R25A 4P6IC 2GA0A 3O6XA 1OCOC 3FXHA 4JTCB 1D0ZA 2NPUA 3JCUQ 3LNMB 2IBFA 1QKRA 4NTBA 2HV6A 4AL0A 2CNWD 2XSEA 3VYWA 2CNWA 1ZHZA 3DM5A 4BEMJ 1U89A 3DKAA 2EPLX 4J30B 2IXMA 4YT5A 4GQHA 1TQGA 4U5BE 3S29A 1LS1A 2W45A 2CGEA 1LM3B 1H7IA 1ZW3A 1A0BA 3RVYA 4H54A 2VCAA 4MVRA 5EHHA 4C7OB 3U2MA 2EPOA 5DS4A 5B3IA 1C03A 3GEEA 5EGYA 2FGYA 2A0UA 3CQZA 4JCHA 1M57C 2H7OA 3UNGC 4EBBA 2NUPB 3KL4A 4ULWA 3ABKC 2PBEA 3ECSA 4CDVA 5CIVA 2R7VA 3AQBA 2OCCC 1V54C 3T4RA 3JZ0A 5KYUB 3LEOA 2Y3BA 1FMVA 4GEHA 1V4AA 3EFOB 2MWQA 3C8GB 4U5EE 4CBEA 4N6CA 1KNYA 2L7AA 2YQYA 3S84A 2XS1A 5JUAA 3GM1A 1JR8A 1NFOA 3QW0A 4PJNA 5E3AA 3C7JA 4U5FE 3OWTA 4E0IA 2GFHA 4CJGA 1JRAA 3S27A 1VLSA 2AU5A 3DI5A 3E70C 2CCYA 3HKKA 1G8XA 3W8IA 4X0RA 3O10A 1WTYA 2TMVP 1PD0A 3S0XA 3M4BA 3AG2C 4MVUA 1WOLA 4KC9A 2Q9CA 2NSGA 3IQ5A 5BQGA 4CIHA 5HV9A 1Z63A 1CPRA 4MS2A 2L6GA 3GM3A 1J8YF 1SMYF 2NUTB 2KK1A 4JTDB 1PV3A 1AUEA 1ZZPA 4C3BA 1J8MF 1GM5A 1CGNA 1HY5A 1KU2A 2AWYA 1H6GA 2J46A 4ONSA 2Y3DA 4WGYA 3US6A 1SF8A 3U9JA 1S05A 4PACA 2YKZA 3H65A 2NUPA 2UUIA 3BEHA 4AX2A 1D1BA 1BZ4A 1NSGB 2JPUA 2YHSA 2NG1A 3LNRA 3DAGA 3C8GD 4I1OB 1QSPA 4MVMA 5DS5A 3EHMA 3C8GA 3K66A 3SEOA 5T1DB 1Y4CA 2HSQA 3EGDB 4PJJA 1Z3IX 4XLNF 4DXWA 2ZXPA 1LI7A 2IXPA 5K0IA 1VTMP 4DVZA 1D1CA 4EIYA 2C04A 3GODA 5L3VA 1DOWA 1VLTA 2DYSC 4BJ5C 4YL1A 1JOGA 4MTGA 1OR3A 2D4UA 3KKBA 3EH1A 4CS9A 3U0CA 2XM0A 3UGPA 3ASNC 3N24A 2DI3A 4EWCA 1QQ3A 5JRAA 2MYSA 1OW7A 1M2OA 4NQFA 5KYNA 1M2VB 1LPEA 2R7SA 4JCZA 4PFPA 4XPYA 1YA9A 1FNTc 3EZHA 2V26A 4WABA 3RQFA 2R9RB 1CGME 1WATA 2LFDA 3S28A 4D4XA 4J32B 2Q9AA 1FR0A 2GDCA 3C18A 4Z9HA 3B9QA 4YJWA 5JSLA 5A6BD 1A41A 4XLPF 1LE2A 2L9JA 4CJOA 2M4EA 1HW2A 2XLHA 4CDYA 1EQ1A 4MTOA 2ASRA 1U6HA 3L0IA 2B0JA 2WVOA 4C3EA 4Q5SF 3F47A 3UR3C 4OD5A 4CS8A 4DRIB 2W9YA 3LS0A 1A7EA 3SXMA 4YT4A 5B1BC 1SR2A 2R03A 3L34A 3QTHA 2R7RA 5JP7A 1PCXA 4G78A 3B0VC 4AE4B 3M15A 1NG1A 3RYLA 3NYJA 4P9TA 1YJGA 4U9EA 4E18A 1E83A 2QLAA 3LAYA 3K1HA 4IARA 2EIJC 1XZQA 4JEAA 3E9VA 4KBLA 2J9WA 3QMKA 4AK9A 3NYMA 4K7BA 4IWBA 2A6EF 3TD7A 3HJCA 2YVKA 1IW7F 3M79A 3Q7LA 4R32A 3TJ6A 3AG1C 1E85A 2J8WA 3W2VA 1EA8A 3MX3A 1GS9A 2Y39A 1FTSA 3CSKA 4YL3A 4F4BA 1LKXA 2UUHA 1WGWA 3M4CA 2WZFA 4NCQA 2HV7A 4CSAA 1MMAA 5A69A 3C62A 1S7ZA 1LVKA 2HFIA 2XL6A 4JEBA 2J7PD 2DGJA 1MNEA 1RXQA 2J7PA 2KQ9A 2DB4A 4OINF 3S9OA 1HE9A 2A68F 3OEOA 5D91A 5DVWA 1AEPA 2I15A 3B29A 5BUOA 2OEVA 4OIRF 5DQTA 2HUJA 3GWNA 1Q0GA 4YWQA 3U3FA 4BJ1A 1NLXA 1OKKD 4JKVA 4AE4A 4CS7A 1YYJA 2V3CC 4OIOF 4NC3A 3B0UX 1T01A 1I4YA 2WVQA 2YL0A 3AGTA 3KH2A 4J7TA 3ZVRA 1BDJB 4ZLDA 3LESA 4JC7A 2XL8A 3NDBB 3O55A 3N2ZB 2HJMA 1R4TA 5A6KA 1ZYRF 2AP3A 3NMJA 4MTFA 5A6AA 2PX3A 4I44A 1EKYA 3FAJA 4ER9A 3HNLA 3VRCA 3W4YA 4FX5A 2WZGA 2VC9A 2OJQA 5L0IA 3QW1A 3AG3C 1Q0DA 2EIMC 3K1IA 1E2XA 1QLEC 3SP1A 3EJNA 3Q6MA 2G3VA 1MMDA 3RF3A 1NU9C 1G4US 3LEVA 4U5HA 3U3BA 3OA1A 1RKEB 1OCCC 2MHRA 2OJED 1E86A 4IB4A 1ORSC 3L8IA 5L0GA 1OXKA 4CIPA 4LDKA 1MNDA 1WN0A 3NMKA 4JZAA 1QZXA 1ZW2A 2DYRC 3I5QA 4HFKB 4JW1A 3RW0A 1C02A 4EBJA 4C7OA 256BA 4I1MA 2HKVA 4PJMA 4Q7CA 3RKOF 3AG4C 2XLWA 4HEAJ 4QI0A 3O39A 2J9VA 5L0HA 3JSEO 1Q0KA 2XLMA 1HE1A 3JSZA 3DWWA 2P0NA 5KYUA 4EKWA 1AVOB 1A7DA 2BC5A 1WWPA 1M56C 2KNHA 4IAOA 3EFOA 1GGQA 3A11A 4JJFA 5F28E 3J06A 2YL7A 5JS5A 2RSEB 2IXNA 3V5YA 4QI2A 5D92A 2ZXWC 3RFYA 1UG7A 2YZSA 1JPJA 3X2QC 4G7ZF 4WGZA 3FAPB 1ST6A 2R7WA 3M1CB 2QTVA 2R7QA 4H4KC 2HMZA 4RDAA 4W8PA 5DLJA 1RKEA 1Z5ZA 5AC5A 2EILC 3LS1A 1RCPA 4E17A 1OCRC 4DRJB 2H7VC 2R7OA 3HNKA 5COMA 1OXBA 4O7GA 1TWGA 3L1MA 2EPMX 5FZTA 4J7YA 3UMHA 4B6IA 2ZPAA 4A4AA 5FCLA 2YWAA 3EPVA 3LUTB 3V7OA 2WL8A 2NUTA 1R5ID 4MQ9F 4IAQA 4BJ6C 4BJTA 4E7ZA 4Q4ZF 2CDQA 2Y69C 2YLIA 4DRHB 3VAYA 2Y3GA 2HMQA 3AOUA 2Q3TA 2EPKX 3MYFA 3HTKC 3IEEA 1OW8A 1Z6AA 2A0BA 3DM9B 4JIOA 4MNDA 4XEVA 5E3CA 1D0YA 2R02A 5L3QA 3SXKA 3HNIA 1RKCA 2C03A 3ASOC 3HLZA 1BR2A 2OU6A 2XLVA 5A6BA 2PFDA 5KYYA 1CPQA 3WODF 2PX0A 3C8ZA 3EQLF 5E33A 2PF4E 3LLIA 5GPGB 3WG7C 4NTFA 3CZ6A 1OQCA 4QDLA 2VCCA 4U5CE 3U9MA 3EGDA 4PK4A 2FAPB 4KI2A 3B0PA 4N4WA 4UDVA 2J45A 4LERA 1UFBA 2L6HA 1NBBA 2H8AA 2W4BA 5KYXB 1YDIA 3SNHA 4ULVA 3ZIBA 2G62A 4OIQF 1A7VA 1EI7A 1YZAA 3G4ZA 4CX9A 2P61A 2XXAB 4NTAA 5HSWA 1ZHTA 2XRHA 4DBQA 5KYWB 4EBKA 1M2VA 1C17M 5COGA 3S90A 2NSFA 1KTMA 3T6BA 2H7BA 3BRJA 4YT8A 5EK0A 1FFHA 3H2VA 3HNJA 4CS9C 2IYLD 3TULA 2XS8A 4MVOA 4E7SA 4IGGA 1OW6A 4IRUA 1JAFA 1ZU5A 4MVZA 1T9KA 3L8JA 1HMDA 2BL2A 2J0XA 3AJMA 3FOOA 4DJ9A 1W2WA 3UMIA 1N1CA 2J0WA 4P9FA 2B0HA 2QNLA 3FVYA 4N06A 3ZDLA 3FDQA 2VB6A 3PHF2 2LCHA 2Y3HA 3K7DA 2J9BA 4LDQA 1OR2A 2OKUA 3K33A 5JVEA 2R05A 1FMWA 3C63A 2X0CA 3ZG1A 4PFOA 1ORYA 3RH3A 5BQHA 1YYXA 3UMKA 1BR1A 1OKKA 4K0DA 2VCBA 2HSBA 1GQAA 4MW3A 1YLMA 4BPMA 5L0FA 4LLEA 2GAQA 1I5NA 1YAUO 2A1DD 4KNVA 3EHNA 4LLCA 3R7CA 3RQGA 3ZC4A 2YEVA 5F5FA 1Z23A 3NKEA 3EH2A 4O79A 1L7CA 2KJGA 3NMIA 4O6MA 4RD9A 4XPWA 2AWCA 3ZWIA 3DXJF 4G0HA 2QY9A 2CYDA 1VYKA 1T6IA 3GORA 4EHPA 2G3KA 3IPMO 2R7XA 4DOZA 4XPXA 3T9OA 1TWCA 1NU7D 3DAFA 1HMOA 3SZRA 2ZD9A 1ORJA 2KGOA 2Q9BA 2D5RB 3U8VA 4AL1A 1Q0FA 2A6HF 4YL0A 2KSFA 3MLGA 4D4NA 2KYHA 3EG9B 4M63A 1CGOA 3F46A 4U9DA 3V5XA 3W2WA 5CI9A 4BG0A 4JURI 2PNOA 4E0HA 3I4UA 1ZHYA 4BJ5A 3T6JA 4CSAC 2FFHA 3FHDA 3ZQVA 5B3SC 4XQ1A 2OQMA 4K1OA 3DD7A 3JRTA 1YA7O 3TOLA 1U0BB 4PJLA 3MYIA 5COFA 2L81A 3SXZA 3TOMA 3DE9A 3IQ6A 4Z9IA 1LIHA 2BE5F 1MQVA 3U8PA 1H9GA 3WAQA 2YRFA 2Z15A 3MBGA 2RD9A 1TFOB 4DVYP 3I5PA 3PCVA 2XLOA 2QUPA 4JTAB 2P1AA 4MVSA 2AVKA 2HZ8A 4BJ6A 2WB7A 4ZLCA 2OOCA 4G7HF 3RQEA 3AQCA 4BEJA 1VMAA 2E87A 2LP4A 1YARO 4O6YA 4U5GA 4HE8D 2XLDA 2LQGA 1OCZC 4FAPB 5E2QA 4JJGA 1BR4A 3DJUB 2JX0A 3QVZA 3EZIA 1DOVA 1RMVA 1ZHWA 2IXOA 1SZIA 1T6QA 4IJJA 3JTLO 5T3WA 1B68A 2M64A 3FMSA 1RJ9B 4XEFA 1K04A 3KYJA 4N6HA 4WJ0A 3POVA 1IZMA 2J9UA 3VM6A 2LSEA 1O3UA 1WASA 1TWHA 3AGUA 3JYHA 4GYTA 4O6NA 4W8KA 2GWWA 2LIGA 3EG9A 4I3MA 4RBNA 1T5OA 3JYYA 2LFFA 1F1MA 2PP4A 5L0CA 3KYIA 2OG2A 2P6VA 2L6FA 3K1IC 2HS5A 1L3PA 1VB5A 1VYIA 1XWJA 2YL1A 1I4ZA 2YLDA 3ABLC 3GANA 3TQOA 2F22A 2R7UA 1Y6DA 3DE8A 1V74B 3NYLA 4PR9A 3LJBA 5B1AC 5BQIA 2VH3A 2QE9A 2OEXA 3JRMO 3G50A 4ANJA 3RIPA 2X51A 1Z7Qc 3ITFA 4XTKA 5DS6A 3W8HA 3K6BA 3NKDA 1M6TA 2JD3A 3NG1A 2O9XA 4YK5A 1YVIA 1HW1A 3ATPA 3A9CA 4JVSA 3SYNA 3ZSUA 1LE4A 4OIPF 3G4XA 5KYYB 1MMGA 3DMDA 1LI5A 1K40A 3WHNA 3GEHA 5JT4A 2XM4A 2CW0F 2HJ3A 2Q00A 1TWAA 1JPNA 4EUKB 2LD6A 2EIKC 2KW3C 1TR2A 3R2PA 4JE9A 1G4WR 1RJ9A 5IY5C 2W4MA 4FWVA 4JRZA 3Q7GA 4HFFB 5F5HA 3Q6NA 1O87A 1QVXA 3RVZA 1APCA 2R7TA 4L6RA 1H9TA 3EGXB 2I8BA 3UGOA 3ZTZA 4U5DE 4Z9JA 5CI8A 3ZTMA 1T6UA 2YL3A 5A6JA 3NRHA 2LK4A 3CAXA 1G5ZA 3DJNB 3FOPA 5DQZA 4YN0B 4A2NB 2EPNA 3T6GB 3X1OA 3ZQYA 3PDMP 1BBHA 1MMNA 1NFNA 2Q7RA 4XEKA 1Q0MA 4LACB 1LS4A 2EINC 2IM8A 4G7OF 1NZEA 3V5ZA 4CDAA 3CEXA 4KNWA 2ICWG 3IHUA 5L0DA 3DZAA 3LLKA 2YLGA 2Q4FA 2P7VA 3TJ5A 3PMRA 3B71A 1V55C 1ZU4A 3GWLA 3QVYA 3N0TA 4XWJA 3VF0A 5T3TA 1D0XA 1D1AA 3H2UA 4NY3A 3JT1A 1VOMA 3U5SA 1PD1A 3TK0A 4OD4A 1TFKB 2IOQA 2XL4A 2XLEA 1ZVZA 5AGFA 1ZHXA 3MFNA
chains in the Genus database with same CATH topology
5KYXA 2WZLA 1VK5A 2WVNA 4DBRA 2A69F 2XXAA 3ABMC 2VASA 1O5HA 1TKNA 3EGXA 3KMIA 2ZXRA 1FFTC 5KYWA 2ZXOA 4CS8C 4YT2A 4FESA 3QZCA 4P6IC 3O6XA 1OCOC 1D0ZA 3JCUQ 2HV6A 2CNWD 2XSEA 3VYWA 2CNWA 1ZHZA 3DM5A 4J30B 2IXMA 4YT5A 4U5BE 3S29A 1LS1A 2W45A 2CGEA 4C7OB 5EHHA 5DS4A 5EGYA 2FGYA 3CQZA 4JCHA 1M57C 2H7OA 3UNGC 4EBBA 2NUPB 3KL4A 4ULWA 3ABKC 3ECSA 5F5FA 2R7VA 3AQBA 2OCCC 1V54C 3T4RA 5KYUB 2Y3BA 1FMVA 4GEHA 3EFOB 2MWQA 4U5EE 4CBEA 4PJNA 5E3AA 4U5FE 3OWTA 2GFHA 3S27A 3E70C 1G8XA 4X0RA 1PD0A 3S0XA 3AG2C 4KC9A 2Q9CA 4CIHA 1Z63A 1J8YF 1SMYF 2NUTB 4C3BA 1J8MF 1KU2A 2J46A 2Y3DA 1SF8A 3H65A 2NUPA 4AX2A 1D1BA 5KYYB 2YHSA 2NG1A 3LNRA 3DAGA 4I1OB 5DS5A 3EHMA 3K66A 3SEOA 5T1DB 4XLNF 3EGDB 4PJJA 1Z3IX 2ZXPA 2IXPA 4DVZA 1D1CA 2C04A 3GODA 5L3VA 2DYSC 4BJ5C 3KKBA 3EH1A 4CS9A 3UGPA 3ASNC 3N24A 4EWCA 2MYSA 1M2OA 5KYNA 1M2VB 2R7SA 4PFPA 3EZHA 2V26A 3S28A 4J32B 2Q9AA 3B9QA 4YJWA 4XLPF 2L9JA 2M4EA 3L0IA 4C3EA 2B0JA 2WVOA 4Q5SF 3F47A 3UR3C 4OD5A 4CS8A 2W9YA 3LS0A 4YT4A 5B1BC 3L34A 2R7RA 1PCXA 3B0VC 4AE4B 1NG1A 3RYLA 3NYJA 3LAYA 3K1HA 2EIJC 3E9VA 4KBLA 2J9WA 3QMKA 4AK9A 3NYMA 4K7BA 4IWBA 2A6EF 3TD7A 3HJCA 1IW7F 3Q7LA 3AG1C 3W2VA 3MX3A 2Y39A 1FTSA 3CSKA 4F4BA 1LKXA 1WGWA 2WZFA 2HV7A 4CSAA 1MMAA 1S7ZA 1LVKA 2J7PD 2DGJA 1MNEA 2KQ9A 2J7PA 4OINF 3OEOA 2A68F 5D91A 5DVWA 5BUOA 4OIRF 5DQTA 4YWQA 4BJ1A 1OKKD 4CS7A 4AE4A 2V3CC 4OIOF 3B0UX 3ZVRA 2WVQA 4ZLDA 3KH2A 3LESA 3NDBB 3N2ZB 1ZYRF 2PX3A 4I44A 3FAJA 4FX5A 2WZGA 3AG3C 2EIMC 1QLEC 3SP1A 3EJNA 3Q6MA 2G3VA 1MMDA 1NU9C 3LEVA 4U5HA 3OA1A 1OCCC 1MNDA 4JZAA 1QZXA 2DYRC 3I5QA 4HFKB 4JW1A 4C7OA 4I1MA 4PJMA 4Q7CA 3RKOF 3AG4C 4HEAJ 4QI0A 3O39A 2J9VA 3JSZA 5KYUA 4IAOA 3ZG1A 1M56C 2KNHA 3EFOA 4JJFA 2IXNA 4QI2A 5D92A 2ZXWC 3RFYA 2YZSA 1JPJA 3X2QC 4G7ZF 1ST6A 3M1CB 2QTVA 2R7QA 4H4KC 4RDAA 5DLJA 1Z5ZA 2EILC 3LS1A 1OCRC 2H7VC 2R7OA 5HSWA 4O7GA 1TWGA 3UMHA 4B6IA 2ZPAA 5FCLA 3EPVA 3V7OA 2WL8A 2NUTA 4MQ9F 4BJ6C 4E7ZA 4BJTA 4Q4ZF 2CDQA 2Y69C 3VAYA 2Y3GA 2R7WA 2Q3TA 3HTKC 3IEEA 1Z6AA 3DM9B 4MNDA 5E3CA 4C3DA 5L3QA 1D0YA 2C03A 3ASOC 3HLZA 1BR2A 2PFDA 5KYYA 3WODF 2PX0A 3EQLF 5E33A 3WG7C 2PF4E 3LLIA 3CZ6A 4QDLA 4U5CE 3EGDA 4PK4A 4KI2A 3B0PA 2J45A 4LERA 2W4BA 5KYXB 3SNHA 3ZIBA 2G62A 4OIQF 2XXAB 1ZHTA 2XRHA 4DBQA 5KYWB 1M2VA 3T6BA 2H7BA 4YT8A 1FFHA 4CS9C 2IYLD 4E7SA 4IRUA 1ZU5A 2J0XA 1W2WA 3UMIA 1N1CA 2J0WA 3FVYA 4N06A 3FDQA 2VB6A 3PHF2 2Y3HA 3K7DA 3K33A 1FMWA 4PFOA 3RH3A 3UMKA 1BR1A 1OKKA 4K0DA 4LLEA 2A1DD 4KNVA 4LLCA 3ZC4A 3EHNA 2YEVA 1Z23A 3NKEA 3EH2A 4O79A 2KJGA 4O6MA 4RD9A 3DXJF 4G0HA 2QY9A 1VYKA 2G3KA 2R7XA 4DOZA 1TWCA 1NU7D 3DAFA 3SZRA 2KGOA 2Q9BA 2D5RB 2A6HF 3MLGA 3EG9B 4M63A 3F46A 4BG0A 3W2WA 5CI9A 4JURI 3I4UA 1ZHYA 4BJ5A 3T6JA 4CSAC 2FFHA 3FHDA 5B3SC 3DD7A 3JRTA 4PJLA 2L81A 2BE5F 2Z15A 4DVYP 3I5PA 4G7HF 4BJ6A 2WB7A 4ZLCA 3AQCA 4BEJA 1VMAA 2E87A 4O6YA 4U5GA 4HE8D 1OCZC 5E2QA 4JJGA 1BR4A 3DJUB 3EZIA 1ZHWA 2IXOA 1SZIA 4IJJA 5T3WA 3W8IA 1RJ9B 4WJ0A 3POVA 1IZMA 2J9UA 2LSEA 1TWHA 4GYTA 4W8KA 3JYHA 4O6NA 4RBNA 3EG9A 4I3MA 2PP4A 2OG2A 2P6VA 3K1IC 1VYIA 3GANA 2R7UA 3ABLC 3NYLA 3LJBA 5B1AC 2VH3A 4ANJA 3RIPA 2X51A 3ITFA 4XTKA 5DS6A 3W8HA 3K6BA 3NKDA 2JD3A 3NG1A 2O9XA 4JVSA 3SYNA 3ZSUA 4OIPF 1MMGA 3DMDA 2CW0F 1TWAA 1JPNA 2EIKC 2KW3C 1TR2A 1RJ9A 5IY5C 2W4MA 4FWVA 3Q7GA 4HFFB 5F5HA 3Q6NA 1O87A 2R7TA 3EGXB 2I8BA 3UGOA 4U5DE 5CI8A 3NRHA 3DJNB 5DQZA 4YN0B 4A2NB 3X1OA 1MMNA 4LACB 2EINC 4G7OF 1NZEA 4KNWA 3DZAA 3LLKA 2P7VA 3PMRA 1V55C 1ZU4A 3N0TA 4XWJA 5T3TA 1D0XA 1D1AA 4NY3A 3JT1A 1VOMA 1PD1A 4OD4A 2IOQA 2XL4A 1ZHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7B A;  2PP4 A;  2P6V A;  2KNH A; 
#chains in the Genus database with same CATH topology
 4LDR A;  3SXY A;  2WZL A;  1VK5 A;  5JLI A;  2WVN A;  5KYX A;  4DBR A;  3KPH A;  2A69 F;  4C3D A;  1K05 A;  1SYQ A;  3U2L A;  5AC4 A;  1QPU A;  3ABM C;  1XZP A;  2VAS A;  1YZC A;  3IQT A;  1O5H A;  2XXA A;  3IQC A;  1TKN A;  1FAP B;  1JMW A;  2KC3 A;  3EGX A;  2ZXR A;  1FFT C;  3GEI A;  3GM2 A;  2ETS A;  3KMI A;  4MVQ A;  4MW8 A;  2ZXO A;  5KYW A;  4CS8 C;  1E84 A;  4YT2 A;  4FES A;  5L0J A;  3QZC A;  5TJ5 E;  2R25 A;  4P6I C;  2GA0 A;  3O6X A;  1OCO C;  3FXH A;  4JTC B;  1D0Z A;  2NPU A;  3JCU Q;  3LNM B;  2IBF A;  1QKR A;  4NTB A;  2HV6 A;  4AL0 A;  2CNW D;  2XSE A;  3VYW A;  2CNW A;  1ZHZ A;  3DM5 A;  4BEM J;  1U89 A;  3DKA A;  2EPL X;  4J30 B;  2IXM A;  4YT5 A;  4GQH A;  1TQG A;  4U5B E;  3S29 A;  1LS1 A;  2W45 A;  2CGE A;  1LM3 B;  1H7I A;  1ZW3 A;  1A0B A;  3RVY A;  4H54 A;  2VCA A;  4MVR A;  5EHH A;  4C7O B;  3U2M A;  2EPO A;  5DS4 A;  5B3I A;  1C03 A;  3GEE A;  5EGY A;  2FGY A;  2A0U A;  3CQZ A;  4JCH A;  1M57 C;  2H7O A;  3UNG C;  4EBB A;  2NUP B;  3KL4 A;  4ULW A;  3ABK C;  2PBE A;  3ECS A;  4CDV A;  5CIV A;  2R7V A;  3AQB A;  2OCC C;  1V54 C;  3T4R A;  3JZ0 A;  5KYU B;  3LEO A;  2Y3B A;  1FMV A;  4GEH A;  1V4A A;  3EFO B;  2MWQ A;  3C8G B;  4U5E E;  4CBE A;  4N6C A;  1KNY A;  2L7A A;  2YQY A;  3S84 A;  2XS1 A;  5JUA A;  3GM1 A;  1JR8 A;  1NFO A;  3QW0 A;  4PJN A;  5E3A A;  3C7J A;  4U5F E;  3OWT A;  4E0I A;  2GFH A;  4CJG A;  1JRA A;  3S27 A;  1VLS A;  2AU5 A;  3DI5 A;  3E70 C;  2CCY A;  3HKK A;  1G8X A;  3W8I A;  4X0R A;  3O10 A;  1WTY A;  2TMV P;  1PD0 A;  3S0X A;  3M4B A;  3AG2 C;  4MVU A;  1WOL A;  4KC9 A;  2Q9C A;  2NSG A;  3IQ5 A;  5BQG A;  4CIH A;  5HV9 A;  1Z63 A;  1CPR A;  4MS2 A;  2L6G A;  3GM3 A;  1J8Y F;  1SMY F;  2NUT B;  2KK1 A;  4JTD B;  1PV3 A;  1AUE A;  1ZZP A;  4C3B A;  1J8M F;  1GM5 A;  1CGN A;  1HY5 A;  1KU2 A;  2AWY A;  1H6G A;  2J46 A;  4ONS A;  2Y3D A;  4WGY A;  3US6 A;  1SF8 A;  3U9J A;  1S05 A;  4PAC A;  2YKZ A;  3H65 A;  2NUP A;  2UUI A;  3BEH A;  4AX2 A;  1D1B A;  1BZ4 A;  1NSG B;  2JPU A;  2YHS A;  2NG1 A;  3LNR A;  3DAG A;  3C8G D;  4I1O B;  1QSP A;  4MVM A;  5DS5 A;  3EHM A;  3C8G A;  3K66 A;  3SEO A;  5T1D B;  1Y4C A;  2HSQ A;  3EGD B;  4PJJ A;  1Z3I X;  4XLN F;  4DXW A;  2ZXP A;  1LI7 A;  2IXP A;  5K0I A;  1VTM P;  4DVZ A;  1D1C A;  4EIY A;  2C04 A;  3GOD A;  5L3V A;  1DOW A;  1VLT A;  2DYS C;  4BJ5 C;  4YL1 A;  1JOG A;  4MTG A;  1OR3 A;  2D4U A;  3KKB A;  3EH1 A;  4CS9 A;  3U0C A;  2XM0 A;  3UGP A;  3ASN C;  3N24 A;  2DI3 A;  4EWC A;  1QQ3 A;  5JRA A;  2MYS A;  1OW7 A;  1M2O A;  4NQF A;  5KYN A;  1M2V B;  1LPE A;  2R7S A;  4JCZ A;  4PFP A;  4XPY A;  1YA9 A;  1FNT c;  3EZH A;  2V26 A;  4WAB A;  3RQF A;  2R9R B;  1CGM E;  1WAT A;  2LFD A;  3S28 A;  4D4X A;  4J32 B;  2Q9A A;  1FR0 A;  2GDC A;  3C18 A;  4Z9H A;  3B9Q A;  4YJW A;  5JSL A;  5A6B D;  1A41 A;  4XLP F;  1LE2 A;  2L9J A;  4CJO A;  2M4E A;  1HW2 A;  2XLH A;  4CDY A;  1EQ1 A;  4MTO A;  2ASR A;  1U6H A;  3L0I A;  2B0J A;  2WVO A;  4C3E A;  4Q5S F;  3F47 A;  3UR3 C;  4OD5 A;  4CS8 A;  4DRI B;  2W9Y A;  3LS0 A;  1A7E A;  3SXM A;  4YT4 A;  5B1B C;  1SR2 A;  2R03 A;  3L34 A;  3QTH A;  2R7R A;  5JP7 A;  1PCX A;  4G78 A;  3B0V C;  4AE4 B;  3M15 A;  1NG1 A;  3RYL A;  3NYJ A;  4P9T A;  1YJG A;  4U9E A;  4E18 A;  1E83 A;  2QLA A;  3LAY A;  3K1H A;  4IAR A;  2EIJ C;  1XZQ A;  4JEA A;  3E9V A;  4KBL A;  2J9W A;  3QMK A;  4AK9 A;  3NYM A;  4K7B A;  4IWB A;  2A6E F;  3TD7 A;  3HJC A;  2YVK A;  1IW7 F;  3M79 A;  3Q7L A;  4R32 A;  3TJ6 A;  3AG1 C;  1E85 A;  2J8W A;  3W2V A;  1EA8 A;  3MX3 A;  1GS9 A;  2Y39 A;  1FTS A;  3CSK A;  4YL3 A;  4F4B A;  1LKX A;  2UUH A;  1WGW A;  3M4C A;  2WZF A;  4NCQ A;  2HV7 A;  4CSA A;  1MMA A;  5A69 A;  3C62 A;  1S7Z A;  1LVK A;  2HFI A;  2XL6 A;  4JEB A;  2J7P D;  2DGJ A;  1MNE A;  1RXQ A;  2J7P A;  2KQ9 A;  2DB4 A;  4OIN F;  3S9O A;  1HE9 A;  2A68 F;  3OEO A;  5D91 A;  5DVW A;  1AEP A;  2I15 A;  3B29 A;  5BUO A;  2OEV A;  4OIR F;  5DQT A;  2HUJ A;  3GWN A;  1Q0G A;  4YWQ A;  3U3F A;  4BJ1 A;  1NLX A;  1OKK D;  4JKV A;  4AE4 A;  4CS7 A;  1YYJ A;  2V3C C;  4OIO F;  4NC3 A;  3B0U X;  1T01 A;  1I4Y A;  2WVQ A;  2YL0 A;  3AGT A;  3KH2 A;  4J7T A;  3ZVR A;  1BDJ B;  4ZLD A;  3LES A;  4JC7 A;  2XL8 A;  3NDB B;  3O55 A;  3N2Z B;  2HJM A;  1R4T A;  5A6K A;  1ZYR F;  2AP3 A;  3NMJ A;  4MTF A;  5A6A A;  2PX3 A;  4I44 A;  1EKY A;  3FAJ A;  4ER9 A;  3HNL A;  3VRC A;  3W4Y A;  4FX5 A;  2WZG A;  2VC9 A;  2OJQ A;  5L0I A;  3QW1 A;  3AG3 C;  1Q0D A;  2EIM C;  3K1I A;  1E2X A;  1QLE C;  3SP1 A;  3EJN A;  3Q6M A;  2G3V A;  1MMD A;  3RF3 A;  1NU9 C;  1G4U S;  3LEV A;  4U5H A;  3U3B A;  3OA1 A;  1RKE B;  1OCC C;  2MHR A;  2OJE D;  1E86 A;  4IB4 A;  1ORS C;  3L8I A;  5L0G A;  1OXK A;  4CIP A;  4LDK A;  1MND A;  1WN0 A;  3NMK A;  4JZA A;  1QZX A;  1ZW2 A;  2DYR C;  3I5Q A;  4HFK B;  4JW1 A;  3RW0 A;  1C02 A;  4EBJ A;  4C7O A;  256B A;  4I1M A;  2HKV A;  4PJM A;  4Q7C A;  3RKO F;  3AG4 C;  2XLW A;  4HEA J;  4QI0 A;  3O39 A;  2J9V A;  5L0H A;  3JSE O;  1Q0K A;  2XLM A;  1HE1 A;  3JSZ A;  3DWW A;  2P0N A;  5KYU A;  4EKW A;  1AVO B;  1A7D A;  2BC5 A;  1WWP A;  1M56 C;  2KNH A;  4IAO A;  3EFO A;  1GGQ A;  3A11 A;  4JJF A;  5F28 E;  3J06 A;  2YL7 A;  5JS5 A;  2RSE B;  2IXN A;  3V5Y A;  4QI2 A;  5D92 A;  2ZXW C;  3RFY A;  1UG7 A;  2YZS A;  1JPJ A;  3X2Q C;  4G7Z F;  4WGZ A;  3FAP B;  1ST6 A;  2R7W A;  3M1C B;  2QTV A;  2R7Q A;  4H4K C;  2HMZ A;  4RDA A;  4W8P A;  5DLJ A;  1RKE A;  1Z5Z A;  5AC5 A;  2EIL C;  3LS1 A;  1RCP A;  4E17 A;  1OCR C;  4DRJ B;  2H7V C;  2R7O A;  3HNK A;  5COM A;  1OXB A;  4O7G A;  1TWG A;  3L1M A;  2EPM X;  5FZT A;  4J7Y A;  3UMH A;  4B6I A;  2ZPA A;  4A4A A;  5FCL A;  2YWA A;  3EPV A;  3LUT B;  3V7O A;  2WL8 A;  2NUT A;  1R5I D;  4MQ9 F;  4IAQ A;  4BJ6 C;  4BJT A;  4E7Z A;  4Q4Z F;  2CDQ A;  2Y69 C;  2YLI A;  4DRH B;  3VAY A;  2Y3G A;  2HMQ A;  3AOU A;  2Q3T A;  2EPK X;  3MYF A;  3HTK C;  3IEE A;  1OW8 A;  1Z6A A;  2A0B A;  3DM9 B;  4JIO A;  4MND A;  4XEV A;  5E3C A;  1D0Y A;  2R02 A;  5L3Q A;  3SXK A;  3HNI A;  1RKC A;  2C03 A;  3ASO C;  3HLZ A;  1BR2 A;  2OU6 A;  2XLV A;  5A6B A;  2PFD A;  5KYY A;  1CPQ A;  3WOD F;  2PX0 A;  3C8Z A;  3EQL F;  5E33 A;  2PF4 E;  3LLI A;  5GPG B;  3WG7 C;  4NTF A;  3CZ6 A;  1OQC A;  4QDL A;  2VCC A;  4U5C E;  3U9M A;  3EGD A;  4PK4 A;  2FAP B;  4KI2 A;  3B0P A;  4N4W A;  4UDV A;  2J45 A;  4LER A;  1UFB A;  2L6H A;  1NBB A;  2H8A A;  2W4B A;  5KYX B;  1YDI A;  3SNH A;  4ULV A;  3ZIB A;  2G62 A;  4OIQ F;  1A7V A;  1EI7 A;  1YZA A;  3G4Z A;  4CX9 A;  2P61 A;  2XXA B;  4NTA A;  5HSW A;  1ZHT A;  2XRH A;  4DBQ A;  5KYW B;  4EBK A;  1M2V A;  1C17 M;  5COG A;  3S90 A;  2NSF A;  1KTM A;  3T6B A;  2H7B A;  3BRJ A;  4YT8 A;  5EK0 A;  1FFH A;  3H2V A;  3HNJ A;  4CS9 C;  2IYL D;  3TUL A;  2XS8 A;  4MVO A;  4E7S A;  4IGG A;  1OW6 A;  4IRU A;  1JAF A;  1ZU5 A;  4MVZ A;  1T9K A;  3L8J A;  1HMD A;  2BL2 A;  2J0X A;  3AJM A;  3FOO A;  4DJ9 A;  1W2W A;  3UMI A;  1N1C A;  2J0W A;  4P9F A;  2B0H A;  2QNL A;  3FVY A;  4N06 A;  3ZDL A;  3FDQ A;  2VB6 A;  3PHF 2;  2LCH A;  2Y3H A;  3K7D A;  2J9B A;  4LDQ A;  1OR2 A;  2OKU A;  3K33 A;  5JVE A;  2R05 A;  1FMW A;  3C63 A;  2X0C A;  3ZG1 A;  4PFO A;  1ORY A;  3RH3 A;  5BQH A;  1YYX A;  3UMK A;  1BR1 A;  1OKK A;  4K0D A;  2VCB A;  2HSB A;  1GQA A;  4MW3 A;  1YLM A;  4BPM A;  5L0F A;  4LLE A;  2GAQ A;  1I5N A;  1YAU O;  2A1D D;  4KNV A;  3EHN A;  4LLC A;  3R7C A;  3RQG A;  3ZC4 A;  2YEV A;  5F5F A;  1Z23 A;  3NKE A;  3EH2 A;  4O79 A;  1L7C A;  2KJG A;  3NMI A;  4O6M A;  4RD9 A;  4XPW A;  2AWC A;  3ZWI A;  3DXJ F;  4G0H A;  2QY9 A;  2CYD A;  1VYK A;  1T6I A;  3GOR A;  4EHP A;  2G3K A;  3IPM O;  2R7X A;  4DOZ A;  4XPX A;  3T9O A;  1TWC A;  1NU7 D;  3DAF A;  1HMO A;  3SZR A;  2ZD9 A;  1ORJ A;  2KGO A;  2Q9B A;  2D5R B;  3U8V A;  4AL1 A;  1Q0F A;  2A6H F;  4YL0 A;  2KSF A;  3MLG A;  4D4N A;  2KYH A;  3EG9 B;  4M63 A;  1CGO A;  3F46 A;  4U9D A;  3V5X A;  3W2W A;  5CI9 A;  4BG0 A;  4JUR I;  2PNO A;  4E0H A;  3I4U A;  1ZHY A;  4BJ5 A;  3T6J A;  4CSA C;  2FFH A;  3FHD A;  3ZQV A;  5B3S C;  4XQ1 A;  2OQM A;  4K1O A;  3DD7 A;  3JRT A;  1YA7 O;  3TOL A;  1U0B B;  4PJL A;  3MYI A;  5COF A;  2L81 A;  3SXZ A;  3TOM A;  3DE9 A;  3IQ6 A;  4Z9I A;  1LIH A;  2BE5 F;  1MQV A;  3U8P A;  1H9G A;  3WAQ A;  2YRF A;  2Z15 A;  3MBG A;  2RD9 A;  1TFO B;  4DVY P;  3I5P A;  3PCV A;  2XLO A;  2QUP A;  4JTA B;  2P1A A;  4MVS A;  2AVK A;  2HZ8 A;  4BJ6 A;  2WB7 A;  4ZLC A;  2OOC A;  4G7H F;  3RQE A;  3AQC A;  4BEJ A;  1VMA A;  2E87 A;  2LP4 A;  1YAR O;  4O6Y A;  4U5G A;  4HE8 D;  2XLD A;  2LQG A;  1OCZ C;  4FAP B;  5E2Q A;  4JJG A;  1BR4 A;  3DJU B;  2JX0 A;  3QVZ A;  3EZI A;  1DOV A;  1RMV A;  1ZHW A;  2IXO A;  1SZI A;  1T6Q A;  4IJJ A;  3JTL O;  5T3W A;  1B68 A;  2M64 A;  3FMS A;  1RJ9 B;  4XEF A;  1K04 A;  3KYJ A;  4N6H A;  4WJ0 A;  3POV A;  1IZM A;  2J9U A;  3VM6 A;  2LSE A;  1O3U A;  1WAS A;  1TWH A;  3AGU A;  3JYH A;  4GYT A;  4O6N A;  4W8K A;  2GWW A;  2LIG A;  3EG9 A;  4I3M A;  4RBN A;  1T5O A;  3JYY A;  2LFF A;  1F1M A;  2PP4 A;  5L0C A;  3KYI A;  2OG2 A;  2P6V A;  2L6F A;  3K1I C;  2HS5 A;  1L3P A;  1VB5 A;  1VYI A;  1XWJ A;  2YL1 A;  1I4Z A;  2YLD A;  3ABL C;  3GAN A;  3TQO A;  2F22 A;  2R7U A;  1Y6D A;  3DE8 A;  1V74 B;  3NYL A;  4PR9 A;  3LJB A;  5B1A C;  5BQI A;  2VH3 A;  2QE9 A;  2OEX A;  3JRM O;  3G50 A;  4ANJ A;  3RIP A;  2X51 A;  1Z7Q c;  3ITF A;  4XTK A;  5DS6 A;  3W8H A;  3K6B A;  3NKD A;  1M6T A;  2JD3 A;  3NG1 A;  2O9X A;  4YK5 A;  1YVI A;  1HW1 A;  3ATP A;  3A9C A;  4JVS A;  3SYN A;  3ZSU A;  1LE4 A;  4OIP F;  3G4X A;  5KYY B;  1MMG A;  3DMD A;  1LI5 A;  1K40 A;  3WHN A;  3GEH A;  5JT4 A;  2XM4 A;  2CW0 F;  2HJ3 A;  2Q00 A;  1TWA A;  1JPN A;  4EUK B;  2LD6 A;  2EIK C;  2KW3 C;  1TR2 A;  3R2P A;  4JE9 A;  1G4W R;  1RJ9 A;  5IY5 C;  2W4M A;  4FWV A;  4JRZ A;  3Q7G A;  4HFF B;  5F5H A;  3Q6N A;  1O87 A;  1QVX A;  3RVZ A;  1APC A;  2R7T A;  4L6R A;  1H9T A;  3EGX B;  2I8B A;  3UGO A;  3ZTZ A;  4U5D E;  4Z9J A;  5CI8 A;  3ZTM A;  1T6U A;  2YL3 A;  5A6J A;  3NRH A;  2LK4 A;  3CAX A;  1G5Z A;  3DJN B;  3FOP A;  5DQZ A;  4YN0 B;  4A2N B;  2EPN A;  3T6G B;  3X1O A;  3ZQY A;  3PDM P;  1BBH A;  1MMN A;  1NFN A;  2Q7R A;  4XEK A;  1Q0M A;  4LAC B;  1LS4 A;  2EIN C;  2IM8 A;  4G7O F;  1NZE A;  3V5Z A;  4CDA A;  3CEX A;  4KNW A;  2ICW G;  3IHU A;  5L0D A;  3DZA A;  3LLK A;  2YLG A;  2Q4F A;  2P7V A;  3TJ5 A;  3PMR A;  3B71 A;  1V55 C;  1ZU4 A;  3GWL A;  3QVY A;  3N0T A;  4XWJ A;  3VF0 A;  5T3T A;  1D0X A;  1D1A A;  3H2U A;  4NY3 A;  3JT1 A;  1VOM A;  3U5S A;  1PD1 A;  3TK0 A;  4OD4 A;  1TFK B;  2IOQ A;  2XL4 A;  2XLE A;  1ZVZ A;  5AGF A;  1ZHX A;  3MFN A; 
#chains in the Genus database with same CATH homology
 5KYX A;  2WZL A;  1VK5 A;  2WVN A;  4DBR A;  2A69 F;  2XXA A;  3ABM C;  2VAS A;  1O5H A;  1TKN A;  3EGX A;  3KMI A;  2ZXR A;  1FFT C;  5KYW A;  2ZXO A;  4CS8 C;  4YT2 A;  4FES A;  3QZC A;  4P6I C;  3O6X A;  1OCO C;  1D0Z A;  3JCU Q;  2HV6 A;  2CNW D;  2XSE A;  3VYW A;  2CNW A;  1ZHZ A;  3DM5 A;  4J30 B;  2IXM A;  4YT5 A;  4U5B E;  3S29 A;  1LS1 A;  2W45 A;  2CGE A;  4C7O B;  5EHH A;  5DS4 A;  5EGY A;  2FGY A;  3CQZ A;  4JCH A;  1M57 C;  2H7O A;  3UNG C;  4EBB A;  2NUP B;  3KL4 A;  4ULW A;  3ABK C;  3ECS A;  5F5F A;  2R7V A;  3AQB A;  2OCC C;  1V54 C;  3T4R A;  5KYU B;  2Y3B A;  1FMV A;  4GEH A;  3EFO B;  2MWQ A;  4U5E E;  4CBE A;  4PJN A;  5E3A A;  4U5F E;  3OWT A;  2GFH A;  3S27 A;  3E70 C;  1G8X A;  4X0R A;  1PD0 A;  3S0X A;  3AG2 C;  4KC9 A;  2Q9C A;  4CIH A;  1Z63 A;  1J8Y F;  1SMY F;  2NUT B;  4C3B A;  1J8M F;  1KU2 A;  2J46 A;  2Y3D A;  1SF8 A;  3H65 A;  2NUP A;  4AX2 A;  1D1B A;  5KYY B;  2YHS A;  2NG1 A;  3LNR A;  3DAG A;  4I1O B;  5DS5 A;  3EHM A;  3K66 A;  3SEO A;  5T1D B;  4XLN F;  3EGD B;  4PJJ A;  1Z3I X;  2ZXP A;  2IXP A;  4DVZ A;  1D1C A;  2C04 A;  3GOD A;  5L3V A;  2DYS C;  4BJ5 C;  3KKB A;  3EH1 A;  4CS9 A;  3UGP A;  3ASN C;  3N24 A;  4EWC A;  2MYS A;  1M2O A;  5KYN A;  1M2V B;  2R7S A;  4PFP A;  3EZH A;  2V26 A;  3S28 A;  4J32 B;  2Q9A A;  3B9Q A;  4YJW A;  4XLP F;  2L9J A;  2M4E A;  3L0I A;  4C3E A;  2B0J A;  2WVO A;  4Q5S F;  3F47 A;  3UR3 C;  4OD5 A;  4CS8 A;  2W9Y A;  3LS0 A;  4YT4 A;  5B1B C;  3L34 A;  2R7R A;  1PCX A;  3B0V C;  4AE4 B;  1NG1 A;  3RYL A;  3NYJ A;  3LAY A;  3K1H A;  2EIJ C;  3E9V A;  4KBL A;  2J9W A;  3QMK A;  4AK9 A;  3NYM A;  4K7B A;  4IWB A;  2A6E F;  3TD7 A;  3HJC A;  1IW7 F;  3Q7L A;  3AG1 C;  3W2V A;  3MX3 A;  2Y39 A;  1FTS A;  3CSK A;  4F4B A;  1LKX A;  1WGW A;  2WZF A;  2HV7 A;  4CSA A;  1MMA A;  1S7Z A;  1LVK A;  2J7P D;  2DGJ A;  1MNE A;  2KQ9 A;  2J7P A;  4OIN F;  3OEO A;  2A68 F;  5D91 A;  5DVW A;  5BUO A;  4OIR F;  5DQT A;  4YWQ A;  4BJ1 A;  1OKK D;  4CS7 A;  4AE4 A;  2V3C C;  4OIO F;  3B0U X;  3ZVR A;  2WVQ A;  4ZLD A;  3KH2 A;  3LES A;  3NDB B;  3N2Z B;  1ZYR F;  2PX3 A;  4I44 A;  3FAJ A;  4FX5 A;  2WZG A;  3AG3 C;  2EIM C;  1QLE C;  3SP1 A;  3EJN A;  3Q6M A;  2G3V A;  1MMD A;  1NU9 C;  3LEV A;  4U5H A;  3OA1 A;  1OCC C;  1MND A;  4JZA A;  1QZX A;  2DYR C;  3I5Q A;  4HFK B;  4JW1 A;  4C7O A;  4I1M A;  4PJM A;  4Q7C A;  3RKO F;  3AG4 C;  4HEA J;  4QI0 A;  3O39 A;  2J9V A;  3JSZ A;  5KYU A;  4IAO A;  3ZG1 A;  1M56 C;  2KNH A;  3EFO A;  4JJF A;  2IXN A;  4QI2 A;  5D92 A;  2ZXW C;  3RFY A;  2YZS A;  1JPJ A;  3X2Q C;  4G7Z F;  1ST6 A;  3M1C B;  2QTV A;  2R7Q A;  4H4K C;  4RDA A;  5DLJ A;  1Z5Z A;  2EIL C;  3LS1 A;  1OCR C;  2H7V C;  2R7O A;  5HSW A;  4O7G A;  1TWG A;  3UMH A;  4B6I A;  2ZPA A;  5FCL A;  3EPV A;  3V7O A;  2WL8 A;  2NUT A;  4MQ9 F;  4BJ6 C;  4E7Z A;  4BJT A;  4Q4Z F;  2CDQ A;  2Y69 C;  3VAY A;  2Y3G A;  2R7W A;  2Q3T A;  3HTK C;  3IEE A;  1Z6A A;  3DM9 B;  4MND A;  5E3C A;  4C3D A;  5L3Q A;  1D0Y A;  2C03 A;  3ASO C;  3HLZ A;  1BR2 A;  2PFD A;  5KYY A;  3WOD F;  2PX0 A;  3EQL F;  5E33 A;  3WG7 C;  2PF4 E;  3LLI A;  3CZ6 A;  4QDL A;  4U5C E;  3EGD A;  4PK4 A;  4KI2 A;  3B0P A;  2J45 A;  4LER A;  2W4B A;  5KYX B;  3SNH A;  3ZIB A;  2G62 A;  4OIQ F;  2XXA B;  1ZHT A;  2XRH A;  4DBQ A;  5KYW B;  1M2V A;  3T6B A;  2H7B A;  4YT8 A;  1FFH A;  4CS9 C;  2IYL D;  4E7S A;  4IRU A;  1ZU5 A;  2J0X A;  1W2W A;  3UMI A;  1N1C A;  2J0W A;  3FVY A;  4N06 A;  3FDQ A;  2VB6 A;  3PHF 2;  2Y3H A;  3K7D A;  3K33 A;  1FMW A;  4PFO A;  3RH3 A;  3UMK A;  1BR1 A;  1OKK A;  4K0D A;  4LLE A;  2A1D D;  4KNV A;  4LLC A;  3ZC4 A;  3EHN A;  2YEV A;  1Z23 A;  3NKE A;  3EH2 A;  4O79 A;  2KJG A;  4O6M A;  4RD9 A;  3DXJ F;  4G0H A;  2QY9 A;  1VYK A;  2G3K A;  2R7X A;  4DOZ A;  1TWC A;  1NU7 D;  3DAF A;  3SZR A;  2KGO A;  2Q9B A;  2D5R B;  2A6H F;  3MLG A;  3EG9 B;  4M63 A;  3F46 A;  4BG0 A;  3W2W A;  5CI9 A;  4JUR I;  3I4U A;  1ZHY A;  4BJ5 A;  3T6J A;  4CSA C;  2FFH A;  3FHD A;  5B3S C;  3DD7 A;  3JRT A;  4PJL A;  2L81 A;  2BE5 F;  2Z15 A;  4DVY P;  3I5P A;  4G7H F;  4BJ6 A;  2WB7 A;  4ZLC A;  3AQC A;  4BEJ A;  1VMA A;  2E87 A;  4O6Y A;  4U5G A;  4HE8 D;  1OCZ C;  5E2Q A;  4JJG A;  1BR4 A;  3DJU B;  3EZI A;  1ZHW A;  2IXO A;  1SZI A;  4IJJ A;  5T3W A;  3W8I A;  1RJ9 B;  4WJ0 A;  3POV A;  1IZM A;  2J9U A;  2LSE A;  1TWH A;  4GYT A;  4W8K A;  3JYH A;  4O6N A;  4RBN A;  3EG9 A;  4I3M A;  2PP4 A;  2OG2 A;  2P6V A;  3K1I C;  1VYI A;  3GAN A;  2R7U A;  3ABL C;  3NYL A;  3LJB A;  5B1A C;  2VH3 A;  4ANJ A;  3RIP A;  2X51 A;  3ITF A;  4XTK A;  5DS6 A;  3W8H A;  3K6B A;  3NKD A;  2JD3 A;  3NG1 A;  2O9X A;  4JVS A;  3SYN A;  3ZSU A;  4OIP F;  1MMG A;  3DMD A;  2CW0 F;  1TWA A;  1JPN A;  2EIK C;  2KW3 C;  1TR2 A;  1RJ9 A;  5IY5 C;  2W4M A;  4FWV A;  3Q7G A;  4HFF B;  5F5H A;  3Q6N A;  1O87 A;  2R7T A;  3EGX B;  2I8B A;  3UGO A;  4U5D E;  5CI8 A;  3NRH A;  3DJN B;  5DQZ A;  4YN0 B;  4A2N B;  3X1O A;  1MMN A;  4LAC B;  2EIN C;  4G7O F;  1NZE A;  4KNW A;  3DZA A;  3LLK A;  2P7V A;  3PMR A;  1V55 C;  1ZU4 A;  3N0T A;  4XWJ A;  5T3T A;  1D0X A;  1D1A A;  4NY3 A;  3JT1 A;  1VOM A;  1PD1 A;  4OD4 A;  2IOQ A;  2XL4 A;  1ZHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...