2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Core-binding factor, ML1-ETO
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2H7BA 2KNHA 2P6VA 2PP4A
chains in the Genus database with same CATH superfamily
2B0HA 2XRHA 1ZHWA 4MW8A 3EGXA 4MVZA 2Q9CA 3KYIA 3MYIA 4YT2A 5BQHA 5KYWA 1WWPA 2ZXOA 1SMYF 5CI8A 4IAOA 1M2VA 2GA0A 4U5CE 4XPWA 2FGYA 1D0XA 4BPMA 4ZLDA 2LCHA 3L1MA 4YT5A 2OOCA 3Q6MA 3C8ZA 5B3IA 1LPEA 1DOWA 3GODA 1D1CA 2IBFA 4JTCB 4OIPF 5IY5C 2R7TA 3IQ6A 2YL1A 1G4WR 4RDAA 1SR2A 3POVA 5T1DB 3C8GD 5KYXB 1MNEA 3IQ5A 2FFHA 1G5ZA 3G4ZA 2P0NA 4JJFA 1Z23A 4E0IA 1O87A 3OA1A 4HFKB 1GM5A 4MVRA 3PCVA 1TWGA 2QY9A 1EKYA 4P6IC 1UG7A 1V54C 4U5EE 2M4EA 4MW3A 2KNHA 4YL0A 1NFOA 1RXQA 3ASNC 3IPMO 4U5FE 5L0IA 2J9UA 2CYDA 3IEEA 5KYYB 4HFFB 4DRIB 4IAQA 1TFKB 1TWCA 3DKAA 1T6IA 3NRHA 3PMRA 4FWVA 4EUKB 2L6GA 3DM5A 5BQGA 2BL2A 4UDVA 1VOMA 2PBEA 2Q00A 3O6XA 1ZU4A 1K04A 3CQZA 5JLIA 3K66A 2X0CA 1ORJA 2I8BA 3K1IA 4MVOA 4O6YA 1EI7A 2NUPB 3BRJA 1B68A 3ZWIA 5L0DA 3JT1A 1NU9C 1Q0GA 4MVQA 2LP4A 1BR4A 2YRFA 5COFA 2EIJC 3GM1A 3DJNB 3HNIA 3LS1A 5DQZA 4BEJA 4QI2A 2G3KA 2LSEA 3WODF 3GM2A 1XZQA 2VCBA 4KC9A 1L3PA 1IZMA 2B0JA 1FMWA 2P61A 4JTAB 1M2VB 1ORYA 4I1OB 4MVSA 2CNWA 1ZHZA 2A69F 3DE9A 3KH2A 3ZVRA 2HMQA 2GWWA 2YHSA 4CS7A 3RQEA 3AQCA 3M15A 3QW1A 1TWAA 3K1IC 2HS5A 4Q4ZF 2QE9A 3EGDB 3U0CA 3B71A 1CPQA 1PD0A 3DI5A 3QTHA 1Q0MA 2KW3C 4LDQA 2EPLX 3LNMB 2DYRC 4J30B 4FAPB 3FDQA 2R7XA 4AL0A 3NKDA 2NG1A 3NKEA 1MNDA 3DXJF 4OIQF 3V5YA 4BJ1A 5EK0A 5TJ5E 3AJMA 1TKNA 1W2WA 3KPHA 4F4BA 3IQTA 1E85A 2VASA 3W2VA 2OJED 1LVKA 2HMZA 4LLEA 4AE4B 4CS8A 3U8PA 1HW2A 5L3QA 3EG9B 1QQ3A 2OQMA 3OWTA 3ZDLA 4ULVA 1FNTc 1SZIA 2L7AA 2Y69C 4DVYP 1OCCC 4N6CA 3WHNA 1ZHYA 1YZCA 2NSGA 3N2ZB 4BJTA 2R7SA 4KNVA 2Q7RA 3Q7GA 3B0PA 3L8IA 3JYYA 3I5QA 4YL1A 2ZXPA 1ZW2A 2HFIA 3SXKA 3W8HA 1WTYA 3NMKA 3O55A 4MQ9F 3U9MA 2HV7A 1O3UA 1YZAA 3GEHA 3K6BA 4AL1A 1C02A 4JCHA 3H2VA 1OKKA 5D92A 1S7ZA 1UFBA 2Y3GA 4CS8C 2GDCA 1NG1A 1YYJA 2YL7A 2G62A 3U2MA 2VC9A 1YDIA 1LE4A 2XS1A 3NDBB 2CGEA 2CNWD 1WOLA 2J7PA 2W45A 1BR2A 2FAPB 1SF8A 3QVZA 4JKVA 5F28E 2TMVP 3KYJA 1N1CA 3B0UX 1YA7O 1ST6A 3A11A 3C62A 5KYYA 1YARO 4RBNA 1LI7A 4EBJA 4BJ5A 1ZVZA 1HMDA 4DOZA 2YL0A 3TD7A 4N4WA 1E2XA 5E2QA 3B0VC 3EHNA 3UMKA 1TQGA 3O39A 5B3SC 5E3CA 2NSFA 5COMA 2Y39A 1Z3IX 4ULWA 3T6GB 1WATA 3FXHA 4Z9IA 3VAYA 3AG3C 4CDAA 5A6BA 2NUPA 2IM8A 4MTOA 4JTDB 4YT4A 4C3DA 2XLWA 2XXAB 1KU2A 1CGOA 1TFOB 3ZG1A 3RW0A 2CDQA 1ORSC 5JUAA 4CJOA 4G7HF 1FR0A 2OCCC 3K7DA 2BE5F 4YL3A 1VLTA 2KGOA 2R9RB 2R7OA 1GGQA 1OW8A 3RQFA 3ITFA 4BJ5C 2WZGA 2AU5A 1WN0A 4JC7A 3M1CB 4MNDA 3TOMA 3UMHA 1RKEB 5D91A 5JRAA 5L0JA 4LERA 3RF3A 2J9VA 3I5PA 2DGJA 4I44A 3JSZA 3M4BA 4PK4A 3JSEO 3QVYA 1YAUO 5BQIA 5KYNA 1E86A 3EQLF 4KBLA 2IXNA 3F46A 2J0XA 4GQHA 3AGTA 2ZPAA 1OKKD 3EGDA 1NFNA 4JE9A 4YJWA 1RCPA 4XLPF 4U9DA 1VYKA 5CIVA 1YYXA 4JJGA 2IXMA 3PHF2 3JZ0A 5GPGB 1D1AA 4IARA 2P7VA 3KMIA 4EBKA 3S27A 3NG1A 1K05A 2W9YA 3ABMC 5DS5A 3MBGA 4DRJB 2KYHA 1ZHTA 2XL4A 3LJBA 4EIYA 4IGGA 1C03A 1VYIA 4JIOA 4AE4A 4E7ZA 1AEPA 1VLSA 3C63A 4WGYA 3PDMP 3EG9A 3Q7LA 4PJJA 4CX9A 1A41A 2UUIA 2IXOA 2V26A 4U9EA 4WGZA 4JW1A 2H7BA 1K40A 3W2WA 3FMSA 1HW1A 4G0HA 2Q3TA 3C8GB 1Y4CA 2I15A 1C17M 2IOQA 1Z7Qc 5A6BD 3AG4C 2AWYA 1H7IA 2HJMA 1J8MF 1Z5ZA 5L0HA 1PD1A 4XEFA 3WG7C 4QDLA 2XLOA 3RH3A 4C7OA 3DMDA 3LLKA 4MTFA 3UGOA 5A69A 1TR2A 2R7QA 3HLZA 2Y3HA 3H65A 1D0ZA 3UMIA 1M56C 2KK1A 1FAPB 2OU6A 3LAYA 2PX3A 2IXPA 4J7YA 2EPKX 5HV9A 2MHRA 1Q0FA 4J32B 3E9VA 2R03A 4I3MA 5A6JA 5AC4A 3TK0A 3LS0A 1M57C 2XLVA 4K0DA 1A0BA 1I4ZA 2YWAA 4ONSA 4XEKA 4AX2A 3NMIA 5DLJA 4PACA 2HUJA 5JT4A 1MMAA 2QLAA 5E3AA 1J8YF 1EA8A 1T5OA 2EIMC 5AGFA 4I1MA 4DBQA 5CI9A 3R2PA 2A1DD 2DYSC 4GEHA 3T4RA 4ER9A 5K0IA 1E83A 5JSLA 3G50A 4JEAA 4E17A 4OIOF 4A2NB 1U0BB 2VB6A 4YWQA 4K7BA 2YZSA 4FESA 4CJGA 1LM3B 2RSEB 2DB4A 4XEVA 3ZTMA 3JCUQ 3LESA 2XXAA 2J9WA 2HJ3A 3T9OA 1XWJA 4HEAJ 4CIHA 4JURI 4PFOA 2EINC 3EH2A 3LUTB 1QPUA 3EHMA 3B29A 2WVQA 3GWLA 1OXBA 2KQ9A 1D1BA 3K1HA 4PJNA 1YLMA 4CS9A 4E7SA 2O9XA 4W8KA 3U5SA 3V5XA 3ZIBA 3J06A 1HE9A 3RKOF 4IRUA 1RKEA 4U5HA 2XL6A 1NBBA 1RJ9B 3EFOB 1QSPA 1R5ID 1FFTC 2XLMA 3SXMA 3T6BA 2J0WA 1S05A 1RMVA 2C04A 3JRMO 3NYLA 2YVKA 4C7OB 4R32A 2ZXRA 4OIRF 3X1OA 2PF4E 2A6HF 1MMGA 2WVOA 3U9JA 4NQFA 4E18A 1F1MA 4EWCA 2V3CC 2CW0F 3JRTA 1GS9A 5B1BC 1FMVA 4NCQA 4LACB 1U6HA 3OEOA 3S28A 3N24A 1OW7A 2VCCA 4CS9C 3C7JA 3SP1A 2NUTB 1VB5A 2G3VA 1JMWA 4YN0B 3C18A 4C3BA 5JVEA 1M2OA 2MWQA 3QMKA 2H7OA 1KNYA 3AGUA 4DJ9A 5EGYA 2WL8A 2OEVA 5L0FA 3ZQVA 5T3TA 4ANJA 4WJ0A 2WZFA 3I4UA 4KNWA 5JS5A 4LDRA 1EQ1A 3VF0A 4B6IA 2WZLA 2L6FA 1ZU5A 3DWWA 1JAFA 4BEMJ 3S90A 1A7EA 3AQBA 3X2QC 4EBBA 2R25A 3C8GA 3EZIA 1JRAA 5FCLA 1ZHXA 1Q0KA 4EHPA 3UGPA 3SNHA 5F5FA 1R4TA 1OR3A 4FX5A 3NYJA 4N06A 3US6A 1NZEA 3DZAA 1MMDA 3JTLO 4JRZA 2Q4FA 4XTKA 4A4AA 2R7RA 2P1AA 3QW0A 1E84A 2AVKA 2C03A 3LEVA 4C3EA 5AC5A 1Z6AA 4U5DE 1O5HA 3AG1C 2E87A 1JPNA 3UR3C 3HNLA 1JR8A 2L81A 4G78A 2P6VA 3FVYA 3ZQYA 3LLIA 5T3WA 1I5NA 4CDYA 1APCA 5BUOA 4NTAA 2R05A 4PJLA 2CCYA 4OINF 3TJ6A 2XM4A 4O6MA 4XLNF 3FAJA 4CDVA 2Y3DA 2OKUA 4KI2A 2IYLD 4PR9A 2KJGA 3K33A 4DBRA 1MQVA 3HNKA 3HTKC 2HZ8A 1YVIA 4U5GA 4XPYA 2Z15A 4P9FA 2EPMX 4OD5A 2J7PD 5B1AC 1OR2A 1A7VA 1MMNA 3N0TA 2W4MA 4G7ZF 2PFDA 3TULA 4Q5SF 1T6QA 1LKXA 1PCXA 1RKCA 3CEXA 2VH3A 3UNGC 4O79A 4DVZA 2H8AA 2Q9BA 3R7CA 1H9GA 2ETSA 2W4BA 4XPXA 3RIPA 3RYLA 1JOGA 1V74B 2HKVA 3FAPB 4L6RA 3U3BA 3ZC4A 3FHDA 4Z9HA 2Y3BA 2HV6A 3FOOA 2XLDA 4JCZA 5A6AA 3ASOC 4YK5A 1QLEC 2A6EF 3GORA 1OXKA 1T6UA 3V5ZA 3SXZA 3ABLC 1LI5A 1V55C 4BJ6A 2XLEA 3ECSA 5DVWA 4XWJA 1RJ9A 2KSFA 2M64A 2L6HA 3EFOA 3G4XA 1LIHA 4W8PA 1BR1A 3S29A 2YEVA 3W8IA 3ATPA 2LFDA 5KYUB 2J9BA 3SEOA 2KC3A 2OEXA 3VM6A 1IW7F 4CBEA 2JPUA 4PJMA 3M4CA 1Y6DA 4N6HA 4CIPA 3EJNA 1QKRA 4OD4A 1HE1A 3AOUA 2GFHA 3CSKA 1NU7D 4JZAA 3L0IA 3S9OA 2YKZA 2LQGA 4Z9JA 3LNRA 3T6JA 3KL4A 4ZLCA 5EHHA 1AUEA 4X0RA 3U2LA 2XM0A 2NUTA 3B9QA 1AVOB 1XZPA 2QNLA 3FOPA 2OG2A 3Q6NA 2HSBA 3TOLA 2LK4A 5JP7A 4BJ6C 3MFNA 1D0YA 4DRHB 4AK9A 5L3VA 4DXWA 2HSQA 3MYFA 2L9JA 3JYHA 3GM3A 3SZRA 5HSWA 4U5BE 3DAFA 3U3FA 2QUPA 5DQTA 1JPJA 256BA 2UUHA 3L8JA 1ZW3A 4H4KC 3NMJA 3EGXB 1DOVA 3EPVA 4MVUA 2GAQA 3L34A 3LEOA 5KYWB 4D4NA 3ABKC 5FZTA 4PFPA 3VRCA 2WVNA 1ZYRF 3H2UA 2R7UA 2BC5A 1ZZPA 3CAXA 4Q7CA 3RVYA 2DI3A 1NLXA 3GWNA 4IJJA 4H54A 4RD9A 4NTBA 1SYQA 2VCAA 2YL3A 2WB7A 4M63A 2J45A 4E0HA 1L7CA 4YT8A 4EKWA 2A68F 1OW6A 1YJGA 3KKBA 4GYTA 4JEBA 4XQ1A 3WAQA 5DS6A 4CSAA 2YLIA 3DAGA 4LDKA 5COGA 1U89A 2MYSA 4NC3A 2LD6A 3TQOA 4K1OA 5E33A 1QZXA 5F5HA 3V7OA 3AG2C 3DE8A 2PP4A 2XS8A 3ZSUA 2JD3A 4MVMA 2PNOA 2AP3A 3RFYA 2EILC 1G4US 2YLGA 3GANA 3TJ5A 3S0XA 1V4AA 2YLDA 1HY5A 1T01A 4WABA 3DM9B 2A0UA 3GEEA 2D4UA 3HJCA 4NY3A 2RD9A 3QZCA 4HE8D 1OQCA 4O6NA 1NSGB 4BG0A 1CGNA 4P9TA 1H9TA 1LS4A 1WASA 4CSAC 1OCRC 2LFFA 3E70C 2R7WA 4MTGA 3SXYA 3M79A 3DD7A 2XL8A 3HKKA 4IWBA 2A0BA 3S84A 1CGME 3W4YA 2ZD9A 1I4YA 2EPNA 4O7GA 3U8VA 3O10A 3F47A 1KTMA 2H7VC 2R02A 2EPOA 3MLGA 2J8WA 3ZTZA 1Q0DA 3NYMA 1QVXA 5DS4A 2QTVA 1HMOA 4J7TA 3IHUA 2JX0A 5KYXA 5A6KA 2ICWG 2ZXWC 1OCOC 1BZ4A 1BDJB 2X51A 1VK5A 1TWHA 5KYUA 1OCZC 5L0CA 1LS1A 1GQAA 3A9CA 3VYWA 1FTSA 2D5RB 2YQYA 1T9KA 3DJUB 2NPUA 3GEIA 2ASRA 2XLHA 4MS2A 4NTFA 3SYNA 2R7VA 2EIKC 2LIGA 4G7OF 3EH1A 1PV3A 1Z63A 5L0GA 1VMAA 4QI0A 2XSEA 3RVZA 1VTMP 4JVSA 2AWCA 2F22A 3RQGA 1CPRA 1A7DA 1H6GA 4D4XA 3EZHA 2J46A 1BBHA 1LE2A 2OJQA 4IB4A 3CZ6A 1FFHA 2PX0A 4LLCA 3HNJA 2Q9AA 1G8XA 3MX3A 1M6TA 1YA9A 3IQCA 3BEHA 1WGWA
chains in the Genus database with same CATH topology
2XRHA 1ZHWA 3EGXA 2Q9CA 5KYWA 4YT2A 2ZXOA 1SMYF 5CI8A 4IAOA 1M2VA 4U5CE 2FGYA 1D0XA 4ZLDA 4YT5A 3Q6MA 3GODA 1D1CA 4OIPF 5IY5C 2R7TA 4RDAA 3POVA 5T1DB 5KYXB 1MNEA 2FFHA 4JJFA 1Z23A 1O87A 3OA1A 4HFKB 1TWGA 2QY9A 4P6IC 1V54C 4U5EE 2M4EA 2KNHA 4U5FE 3ASNC 5KYYB 2J9UA 3IEEA 4HFFB 1TWCA 4FWVA 3NRHA 3PMRA 3DM5A 1VOMA 3O6XA 1ZU4A 3CQZA 3K66A 2I8BA 4O6YA 2NUPB 3JT1A 1NU9C 1BR4A 2EIJC 3DJNB 3LS1A 5DQZA 4BEJA 4QI2A 2G3KA 2LSEA 3WODF 4KC9A 1IZMA 2B0JA 1FMWA 1M2VB 4I1OB 2CNWA 1ZHZA 2A69F 3ZVRA 3KH2A 2YHSA 4CS7A 3AQCA 1TWAA 3K1IC 4Q4ZF 3EGDB 1PD0A 2KW3C 2R7XA 4J30B 2DYRC 3FDQA 3NKDA 2NG1A 3NKEA 1MNDA 3DXJF 4OIQF 4BJ1A 1TKNA 1W2WA 4F4BA 2VASA 3W2VA 1LVKA 4LLEA 4AE4B 4CS8A 5L3QA 3EG9B 3OWTA 1SZIA 2Y69C 4DVYP 1OCCC 1ZHYA 3N2ZB 4BJTA 2R7SA 4KNVA 3Q7GA 3B0PA 3I5QA 2ZXPA 3W8HA 4MQ9F 2HV7A 3K6BA 4JCHA 5D92A 1OKKA 1S7ZA 2Y3GA 4CS8C 1NG1A 2G62A 3NDBB 2CGEA 2CNWD 2J7PA 2W45A 1BR2A 1SF8A 1N1CA 3B0UX 5KYYA 1ST6A 4RBNA 4BJ5A 4DOZA 3TD7A 5E2QA 3B0VC 3EHNA 3UMKA 3O39A 5B3SC 5E3CA 2Y39A 1Z3IX 4ULWA 3VAYA 3AG3C 2NUPA 4YT4A 4C3DA 2XXAB 1KU2A 3ZG1A 2CDQA 4G7HF 2OCCC 3K7DA 2BE5F 2KGOA 2R7OA 3ITFA 4BJ5C 2WZGA 4MNDA 3UMHA 3M1CB 5D91A 4LERA 2J9VA 3I5PA 2DGJA 4I44A 3JSZA 4PK4A 5KYNA 3EQLF 4KBLA 2IXNA 3F46A 2J0XA 5DS4A 3EGDA 2ZPAA 1OKKD 4YJWA 1VYKA 4JJGA 2IXMA 3PHF2 1D1AA 2P7VA 3KMIA 3S27A 3NG1A 2W9YA 3ABMC 5DS5A 1ZHTA 2XL4A 3LJBA 1VYIA 4AE4A 4E7ZA 3EG9A 3Q7LA 4PJJA 2IXOA 2V26A 4JW1A 2H7BA 3W2WA 4G0HA 2Q3TA 2IOQA 3AG4C 1J8MF 1Z5ZA 1PD1A 3WG7C 4QDLA 3RH3A 4C7OA 3DMDA 3LLKA 3UGOA 1TR2A 2R7QA 3HLZA 2Y3HA 3H65A 1D0ZA 3UMIA 1M56C 3LAYA 2PX3A 2IXPA 4J32B 3E9VA 4I3MA 3LS0A 1M57C 4K0DA 4AX2A 5DLJA 1MMAA 5E3AA 1J8YF 2EIMC 4I1MA 4DBQA 5CI9A 3T4RA 2A1DD 2DYSC 4GEHA 4OIOF 4A2NB 2VB6A 4YWQA 4K7BA 2YZSA 4FESA 3JCUQ 3LESA 2XXAA 2J9WA 4HEAJ 4CIHA 4JURI 4PFOA 2EINC 3EH2A 3EHMA 2WVQA 2KQ9A 3K1HA 1D1BA 4PJNA 4CS9A 4E7SA 2O9XA 4W8KA 3ZIBA 3RKOF 4IRUA 4U5HA 1RJ9B 3EFOB 1FFTC 3T6BA 2J0WA 2C04A 3NYLA 4C7OB 2ZXRA 4OIRF 3X1OA 2PF4E 2A6HF 1MMGA 2WVOA 4EWCA 2V3CC 2CW0F 3JRTA 5B1BC 1FMVA 4LACB 3OEOA 3S28A 3N24A 4XLPF 4CS9C 3SP1A 2NUTB 2G3VA 4YN0B 4C3BA 1M2OA 2MWQA 3QMKA 2H7OA 5EGYA 2WL8A 5T3TA 4ANJA 4WJ0A 2WZFA 3I4UA 4KNWA 4B6IA 2WZLA 1ZU5A 3AQBA 3X2QC 4EBBA 3EZIA 5FCLA 1ZHXA 3UGPA 3SNHA 5F5FA 4FX5A 3NYJA 4N06A 2R7RA 1NZEA 3DZAA 1MMDA 4XTKA 2C03A 3LEVA 4C3EA 1Z6AA 4U5DE 1O5HA 3AG1C 2E87A 1JPNA 3UR3C 2L81A 2P6VA 3FVYA 3LLIA 5T3WA 5BUOA 4PJLA 4OINF 4O6MA 4XLNF 3FAJA 4KI2A 2Y3DA 2IYLD 2KJGA 3K33A 4DBRA 3HTKC 4U5GA 2Z15A 4OD5A 2J7PD 5B1AC 3N0TA 1MMNA 2W4MA 4G7ZF 2PFDA 4Q5SF 1LKXA 1PCXA 2VH3A 3UNGC 4O79A 4DVZA 2Q9BA 2W4BA 3RIPA 3RYLA 3ZC4A 3FHDA 2Y3BA 2HV6A 3ASOC 1QLEC 2A6EF 3ABLC 1V55C 4BJ6A 3ECSA 5DVWA 4XWJA 1RJ9A 3EFOA 3W8IA 1BR1A 3S29A 2YEVA 5KYUB 3SEOA 1IW7F 4CBEA 4PJMA 3EJNA 4OD4A 2GFHA 3CSKA 1NU7D 4JZAA 3L0IA 3LNRA 3T6JA 3KL4A 4ZLCA 5EHHA 4X0RA 2NUTA 3B9QA 2OG2A 3Q6NA 4BJ6C 1D0YA 5L3VA 4AK9A 3SZRA 2L9JA 3JYHA 5HSWA 4U5BE 3DAFA 5DQTA 1JPJA 4H4KC 3EGXB 3EPVA 5KYWB 3L34A 3ABKC 4PFPA 2WVNA 1ZYRF 2R7UA 4Q7CA 4RD9A 4IJJA 4M63A 2WB7A 2J45A 4YT8A 2A68F 3KKBA 4GYTA 5DS6A 4CSAA 3DAGA 2MYSA 5E33A 1QZXA 5F5HA 3V7OA 3AG2C 3ZSUA 2PP4A 2JD3A 3RFYA 2EILC 3GANA 3S0XA 3DM9B 4NY3A 3HJCA 3QZCA 4HE8D 4O6NA 4BG0A 4CSAC 1OCRC 3E70C 2R7WA 4IWBA 3DD7A 4O7GA 3F47A 2H7VC 3MLGA 3NYMA 2QTVA 5KYXA 2ZXWC 1OCOC 2X51A 1VK5A 1TWHA 5KYUA 1OCZC 1LS1A 3VYWA 1FTSA 2D5RB 3DJUB 3SYNA 2R7VA 2EIKC 4G7OF 3EH1A 1Z63A 1VMAA 4QI0A 2XSEA 4JVSA 3EZHA 2J46A 3CZ6A 1FFHA 2PX0A 4LLCA 2Q9AA 1G8XA 3MX3A 1WGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7B A;  2KNH A;  2P6V A;  2PP4 A; 
#chains in the Genus database with same CATH topology
 2B0H A;  2XRH A;  1ZHW A;  4MW8 A;  3EGX A;  4MVZ A;  2Q9C A;  3KYI A;  3MYI A;  4YT2 A;  5BQH A;  5KYW A;  1WWP A;  2ZXO A;  1SMY F;  5CI8 A;  4IAO A;  1M2V A;  2GA0 A;  4U5C E;  4XPW A;  2FGY A;  1D0X A;  4BPM A;  4ZLD A;  2LCH A;  3L1M A;  4YT5 A;  2OOC A;  3Q6M A;  3C8Z A;  5B3I A;  1LPE A;  1DOW A;  3GOD A;  1D1C A;  2IBF A;  4JTC B;  4OIP F;  5IY5 C;  2R7T A;  3IQ6 A;  2YL1 A;  1G4W R;  4RDA A;  1SR2 A;  3POV A;  5T1D B;  3C8G D;  5KYX B;  1MNE A;  3IQ5 A;  2FFH A;  1G5Z A;  3G4Z A;  2P0N A;  4JJF A;  1Z23 A;  4E0I A;  1O87 A;  3OA1 A;  4HFK B;  1GM5 A;  4MVR A;  3PCV A;  1TWG A;  2QY9 A;  1EKY A;  4P6I C;  1UG7 A;  1V54 C;  4U5E E;  2M4E A;  4MW3 A;  2KNH A;  4YL0 A;  1NFO A;  1RXQ A;  3ASN C;  3IPM O;  4U5F E;  5L0I A;  2J9U A;  2CYD A;  3IEE A;  5KYY B;  4HFF B;  4DRI B;  4IAQ A;  1TFK B;  1TWC A;  3DKA A;  1T6I A;  3NRH A;  3PMR A;  4FWV A;  4EUK B;  2L6G A;  3DM5 A;  5BQG A;  2BL2 A;  4UDV A;  1VOM A;  2PBE A;  2Q00 A;  3O6X A;  1ZU4 A;  1K04 A;  3CQZ A;  5JLI A;  3K66 A;  2X0C A;  1ORJ A;  2I8B A;  3K1I A;  4MVO A;  4O6Y A;  1EI7 A;  2NUP B;  3BRJ A;  1B68 A;  3ZWI A;  5L0D A;  3JT1 A;  1NU9 C;  1Q0G A;  4MVQ A;  2LP4 A;  1BR4 A;  2YRF A;  5COF A;  2EIJ C;  3GM1 A;  3DJN B;  3HNI A;  3LS1 A;  5DQZ A;  4BEJ A;  4QI2 A;  2G3K A;  2LSE A;  3WOD F;  3GM2 A;  1XZQ A;  2VCB A;  4KC9 A;  1L3P A;  1IZM A;  2B0J A;  1FMW A;  2P61 A;  4JTA B;  1M2V B;  1ORY A;  4I1O B;  4MVS A;  2CNW A;  1ZHZ A;  2A69 F;  3DE9 A;  3KH2 A;  3ZVR A;  2HMQ A;  2GWW A;  2YHS A;  4CS7 A;  3RQE A;  3AQC A;  3M15 A;  3QW1 A;  1TWA A;  3K1I C;  2HS5 A;  4Q4Z F;  2QE9 A;  3EGD B;  3U0C A;  3B71 A;  1CPQ A;  1PD0 A;  3DI5 A;  3QTH A;  1Q0M A;  2KW3 C;  4LDQ A;  2EPL X;  3LNM B;  2DYR C;  4J30 B;  4FAP B;  3FDQ A;  2R7X A;  4AL0 A;  3NKD A;  2NG1 A;  3NKE A;  1MND A;  3DXJ F;  4OIQ F;  3V5Y A;  4BJ1 A;  5EK0 A;  5TJ5 E;  3AJM A;  1TKN A;  1W2W A;  3KPH A;  4F4B A;  3IQT A;  1E85 A;  2VAS A;  3W2V A;  2OJE D;  1LVK A;  2HMZ A;  4LLE A;  4AE4 B;  4CS8 A;  3U8P A;  1HW2 A;  5L3Q A;  3EG9 B;  1QQ3 A;  2OQM A;  3OWT A;  3ZDL A;  4ULV A;  1FNT c;  1SZI A;  2L7A A;  2Y69 C;  4DVY P;  1OCC C;  4N6C A;  3WHN A;  1ZHY A;  1YZC A;  2NSG A;  3N2Z B;  4BJT A;  2R7S A;  4KNV A;  2Q7R A;  3Q7G A;  3B0P A;  3L8I A;  3JYY A;  3I5Q A;  4YL1 A;  2ZXP A;  1ZW2 A;  2HFI A;  3SXK A;  3W8H A;  1WTY A;  3NMK A;  3O55 A;  4MQ9 F;  3U9M A;  2HV7 A;  1O3U A;  1YZA A;  3GEH A;  3K6B A;  4AL1 A;  1C02 A;  4JCH A;  3H2V A;  1OKK A;  5D92 A;  1S7Z A;  1UFB A;  2Y3G A;  4CS8 C;  2GDC A;  1NG1 A;  1YYJ A;  2YL7 A;  2G62 A;  3U2M A;  2VC9 A;  1YDI A;  1LE4 A;  2XS1 A;  3NDB B;  2CGE A;  2CNW D;  1WOL A;  2J7P A;  2W45 A;  1BR2 A;  2FAP B;  1SF8 A;  3QVZ A;  4JKV A;  5F28 E;  2TMV P;  3KYJ A;  1N1C A;  3B0U X;  1YA7 O;  1ST6 A;  3A11 A;  3C62 A;  5KYY A;  1YAR O;  4RBN A;  1LI7 A;  4EBJ A;  4BJ5 A;  1ZVZ A;  1HMD A;  4DOZ A;  2YL0 A;  3TD7 A;  4N4W A;  1E2X A;  5E2Q A;  3B0V C;  3EHN A;  3UMK A;  1TQG A;  3O39 A;  5B3S C;  5E3C A;  2NSF A;  5COM A;  2Y39 A;  1Z3I X;  4ULW A;  3T6G B;  1WAT A;  3FXH A;  4Z9I A;  3VAY A;  3AG3 C;  4CDA A;  5A6B A;  2NUP A;  2IM8 A;  4MTO A;  4JTD B;  4YT4 A;  4C3D A;  2XLW A;  2XXA B;  1KU2 A;  1CGO A;  1TFO B;  3ZG1 A;  3RW0 A;  2CDQ A;  1ORS C;  5JUA A;  4CJO A;  4G7H F;  1FR0 A;  2OCC C;  3K7D A;  2BE5 F;  4YL3 A;  1VLT A;  2KGO A;  2R9R B;  2R7O A;  1GGQ A;  1OW8 A;  3RQF A;  3ITF A;  4BJ5 C;  2WZG A;  2AU5 A;  1WN0 A;  4JC7 A;  3M1C B;  4MND A;  3TOM A;  3UMH A;  1RKE B;  5D91 A;  5JRA A;  5L0J A;  4LER A;  3RF3 A;  2J9V A;  3I5P A;  2DGJ A;  4I44 A;  3JSZ A;  3M4B A;  4PK4 A;  3JSE O;  3QVY A;  1YAU O;  5BQI A;  5KYN A;  1E86 A;  3EQL F;  4KBL A;  2IXN A;  3F46 A;  2J0X A;  4GQH A;  3AGT A;  2ZPA A;  1OKK D;  3EGD A;  1NFN A;  4JE9 A;  4YJW A;  1RCP A;  4XLP F;  4U9D A;  1VYK A;  5CIV A;  1YYX A;  4JJG A;  2IXM A;  3PHF 2;  3JZ0 A;  5GPG B;  1D1A A;  4IAR A;  2P7V A;  3KMI A;  4EBK A;  3S27 A;  3NG1 A;  1K05 A;  2W9Y A;  3ABM C;  5DS5 A;  3MBG A;  4DRJ B;  2KYH A;  1ZHT A;  2XL4 A;  3LJB A;  4EIY A;  4IGG A;  1C03 A;  1VYI A;  4JIO A;  4AE4 A;  4E7Z A;  1AEP A;  1VLS A;  3C63 A;  4WGY A;  3PDM P;  3EG9 A;  3Q7L A;  4PJJ A;  4CX9 A;  1A41 A;  2UUI A;  2IXO A;  2V26 A;  4U9E A;  4WGZ A;  4JW1 A;  2H7B A;  1K40 A;  3W2W A;  3FMS A;  1HW1 A;  4G0H A;  2Q3T A;  3C8G B;  1Y4C A;  2I15 A;  1C17 M;  2IOQ A;  1Z7Q c;  5A6B D;  3AG4 C;  2AWY A;  1H7I A;  2HJM A;  1J8M F;  1Z5Z A;  5L0H A;  1PD1 A;  4XEF A;  3WG7 C;  4QDL A;  2XLO A;  3RH3 A;  4C7O A;  3DMD A;  3LLK A;  4MTF A;  3UGO A;  5A69 A;  1TR2 A;  2R7Q A;  3HLZ A;  2Y3H A;  3H65 A;  1D0Z A;  3UMI A;  1M56 C;  2KK1 A;  1FAP B;  2OU6 A;  3LAY A;  2PX3 A;  2IXP A;  4J7Y A;  2EPK X;  5HV9 A;  2MHR A;  1Q0F A;  4J32 B;  3E9V A;  2R03 A;  4I3M A;  5A6J A;  5AC4 A;  3TK0 A;  3LS0 A;  1M57 C;  2XLV A;  4K0D A;  1A0B A;  1I4Z A;  2YWA A;  4ONS A;  4XEK A;  4AX2 A;  3NMI A;  5DLJ A;  4PAC A;  2HUJ A;  5JT4 A;  1MMA A;  2QLA A;  5E3A A;  1J8Y F;  1EA8 A;  1T5O A;  2EIM C;  5AGF A;  4I1M A;  4DBQ A;  5CI9 A;  3R2P A;  2A1D D;  2DYS C;  4GEH A;  3T4R A;  4ER9 A;  5K0I A;  1E83 A;  5JSL A;  3G50 A;  4JEA A;  4E17 A;  4OIO F;  4A2N B;  1U0B B;  2VB6 A;  4YWQ A;  4K7B A;  2YZS A;  4FES A;  4CJG A;  1LM3 B;  2RSE B;  2DB4 A;  4XEV A;  3ZTM A;  3JCU Q;  3LES A;  2XXA A;  2J9W A;  2HJ3 A;  3T9O A;  1XWJ A;  4HEA J;  4CIH A;  4JUR I;  4PFO A;  2EIN C;  3EH2 A;  3LUT B;  1QPU A;  3EHM A;  3B29 A;  2WVQ A;  3GWL A;  1OXB A;  2KQ9 A;  1D1B A;  3K1H A;  4PJN A;  1YLM A;  4CS9 A;  4E7S A;  2O9X A;  4W8K A;  3U5S A;  3V5X A;  3ZIB A;  3J06 A;  1HE9 A;  3RKO F;  4IRU A;  1RKE A;  4U5H A;  2XL6 A;  1NBB A;  1RJ9 B;  3EFO B;  1QSP A;  1R5I D;  1FFT C;  2XLM A;  3SXM A;  3T6B A;  2J0W A;  1S05 A;  1RMV A;  2C04 A;  3JRM O;  3NYL A;  2YVK A;  4C7O B;  4R32 A;  2ZXR A;  4OIR F;  3X1O A;  2PF4 E;  2A6H F;  1MMG A;  2WVO A;  3U9J A;  4NQF A;  4E18 A;  1F1M A;  4EWC A;  2V3C C;  2CW0 F;  3JRT A;  1GS9 A;  5B1B C;  1FMV A;  4NCQ A;  4LAC B;  1U6H A;  3OEO A;  3S28 A;  3N24 A;  1OW7 A;  2VCC A;  4CS9 C;  3C7J A;  3SP1 A;  2NUT B;  1VB5 A;  2G3V A;  1JMW A;  4YN0 B;  3C18 A;  4C3B A;  5JVE A;  1M2O A;  2MWQ A;  3QMK A;  2H7O A;  1KNY A;  3AGU A;  4DJ9 A;  5EGY A;  2WL8 A;  2OEV A;  5L0F A;  3ZQV A;  5T3T A;  4ANJ A;  4WJ0 A;  2WZF A;  3I4U A;  4KNW A;  5JS5 A;  4LDR A;  1EQ1 A;  3VF0 A;  4B6I A;  2WZL A;  2L6F A;  1ZU5 A;  3DWW A;  1JAF A;  4BEM J;  3S90 A;  1A7E A;  3AQB A;  3X2Q C;  4EBB A;  2R25 A;  3C8G A;  3EZI A;  1JRA A;  5FCL A;  1ZHX A;  1Q0K A;  4EHP A;  3UGP A;  3SNH A;  5F5F A;  1R4T A;  1OR3 A;  4FX5 A;  3NYJ A;  4N06 A;  3US6 A;  1NZE A;  3DZA A;  1MMD A;  3JTL O;  4JRZ A;  2Q4F A;  4XTK A;  4A4A A;  2R7R A;  2P1A A;  3QW0 A;  1E84 A;  2AVK A;  2C03 A;  3LEV A;  4C3E A;  5AC5 A;  1Z6A A;  4U5D E;  1O5H A;  3AG1 C;  2E87 A;  1JPN A;  3UR3 C;  3HNL A;  1JR8 A;  2L81 A;  4G78 A;  2P6V A;  3FVY A;  3ZQY A;  3LLI A;  5T3W A;  1I5N A;  4CDY A;  1APC A;  5BUO A;  4NTA A;  2R05 A;  4PJL A;  2CCY A;  4OIN F;  3TJ6 A;  2XM4 A;  4O6M A;  4XLN F;  3FAJ A;  4CDV A;  2Y3D A;  2OKU A;  4KI2 A;  2IYL D;  4PR9 A;  2KJG A;  3K33 A;  4DBR A;  1MQV A;  3HNK A;  3HTK C;  2HZ8 A;  1YVI A;  4U5G A;  4XPY A;  2Z15 A;  4P9F A;  2EPM X;  4OD5 A;  2J7P D;  5B1A C;  1OR2 A;  1A7V A;  1MMN A;  3N0T A;  2W4M A;  4G7Z F;  2PFD A;  3TUL A;  4Q5S F;  1T6Q A;  1LKX A;  1PCX A;  1RKC A;  3CEX A;  2VH3 A;  3UNG C;  4O79 A;  4DVZ A;  2H8A A;  2Q9B A;  3R7C A;  1H9G A;  2ETS A;  2W4B A;  4XPX A;  3RIP A;  3RYL A;  1JOG A;  1V74 B;  2HKV A;  3FAP B;  4L6R A;  3U3B A;  3ZC4 A;  3FHD A;  4Z9H A;  2Y3B A;  2HV6 A;  3FOO A;  2XLD A;  4JCZ A;  5A6A A;  3ASO C;  4YK5 A;  1QLE C;  2A6E F;  3GOR A;  1OXK A;  1T6U A;  3V5Z A;  3SXZ A;  3ABL C;  1LI5 A;  1V55 C;  4BJ6 A;  2XLE A;  3ECS A;  5DVW A;  4XWJ A;  1RJ9 A;  2KSF A;  2M64 A;  2L6H A;  3EFO A;  3G4X A;  1LIH A;  4W8P A;  1BR1 A;  3S29 A;  2YEV A;  3W8I A;  3ATP A;  2LFD A;  5KYU B;  2J9B A;  3SEO A;  2KC3 A;  2OEX A;  3VM6 A;  1IW7 F;  4CBE A;  2JPU A;  4PJM A;  3M4C A;  1Y6D A;  4N6H A;  4CIP A;  3EJN A;  1QKR A;  4OD4 A;  1HE1 A;  3AOU A;  2GFH A;  3CSK A;  1NU7 D;  4JZA A;  3L0I A;  3S9O A;  2YKZ A;  2LQG A;  4Z9J A;  3LNR A;  3T6J A;  3KL4 A;  4ZLC A;  5EHH A;  1AUE A;  4X0R A;  3U2L A;  2XM0 A;  2NUT A;  3B9Q A;  1AVO B;  1XZP A;  2QNL A;  3FOP A;  2OG2 A;  3Q6N A;  2HSB A;  3TOL A;  2LK4 A;  5JP7 A;  4BJ6 C;  3MFN A;  1D0Y A;  4DRH B;  4AK9 A;  5L3V A;  4DXW A;  2HSQ A;  3MYF A;  2L9J A;  3JYH A;  3GM3 A;  3SZR A;  5HSW A;  4U5B E;  3DAF A;  3U3F A;  2QUP A;  5DQT A;  1JPJ A;  256B A;  2UUH A;  3L8J A;  1ZW3 A;  4H4K C;  3NMJ A;  3EGX B;  1DOV A;  3EPV A;  4MVU A;  2GAQ A;  3L34 A;  3LEO A;  5KYW B;  4D4N A;  3ABK C;  5FZT A;  4PFP A;  3VRC A;  2WVN A;  1ZYR F;  3H2U A;  2R7U A;  2BC5 A;  1ZZP A;  3CAX A;  4Q7C A;  3RVY A;  2DI3 A;  1NLX A;  3GWN A;  4IJJ A;  4H54 A;  4RD9 A;  4NTB A;  1SYQ A;  2VCA A;  2YL3 A;  2WB7 A;  4M63 A;  2J45 A;  4E0H A;  1L7C A;  4YT8 A;  4EKW A;  2A68 F;  1OW6 A;  1YJG A;  3KKB A;  4GYT A;  4JEB A;  4XQ1 A;  3WAQ A;  5DS6 A;  4CSA A;  2YLI A;  3DAG A;  4LDK A;  5COG A;  1U89 A;  2MYS A;  4NC3 A;  2LD6 A;  3TQO A;  4K1O A;  5E33 A;  1QZX A;  5F5H A;  3V7O A;  3AG2 C;  3DE8 A;  2PP4 A;  2XS8 A;  3ZSU A;  2JD3 A;  4MVM A;  2PNO A;  2AP3 A;  3RFY A;  2EIL C;  1G4U S;  2YLG A;  3GAN A;  3TJ5 A;  3S0X A;  1V4A A;  2YLD A;  1HY5 A;  1T01 A;  4WAB A;  3DM9 B;  2A0U A;  3GEE A;  2D4U A;  3HJC A;  4NY3 A;  2RD9 A;  3QZC A;  4HE8 D;  1OQC A;  4O6N A;  1NSG B;  4BG0 A;  1CGN A;  4P9T A;  1H9T A;  1LS4 A;  1WAS A;  4CSA C;  1OCR C;  2LFF A;  3E70 C;  2R7W A;  4MTG A;  3SXY A;  3M79 A;  3DD7 A;  2XL8 A;  3HKK A;  4IWB A;  2A0B A;  3S84 A;  1CGM E;  3W4Y A;  2ZD9 A;  1I4Y A;  2EPN A;  4O7G A;  3U8V A;  3O10 A;  3F47 A;  1KTM A;  2H7V C;  2R02 A;  2EPO A;  3MLG A;  2J8W A;  3ZTZ A;  1Q0D A;  3NYM A;  1QVX A;  5DS4 A;  2QTV A;  1HMO A;  4J7T A;  3IHU A;  2JX0 A;  5KYX A;  5A6K A;  2ICW G;  2ZXW C;  1OCO C;  1BZ4 A;  1BDJ B;  2X51 A;  1VK5 A;  1TWH A;  5KYU A;  1OCZ C;  5L0C A;  1LS1 A;  1GQA A;  3A9C A;  3VYW A;  1FTS A;  2D5R B;  2YQY A;  1T9K A;  3DJU B;  2NPU A;  3GEI A;  2ASR A;  2XLH A;  4MS2 A;  4NTF A;  3SYN A;  2R7V A;  2EIK C;  2LIG A;  4G7O F;  3EH1 A;  1PV3 A;  1Z63 A;  5L0G A;  1VMA A;  4QI0 A;  2XSE A;  3RVZ A;  1VTM P;  4JVS A;  2AWC A;  2F22 A;  3RQG A;  1CPR A;  1A7D A;  1H6G A;  4D4X A;  3EZH A;  2J46 A;  1BBH A;  1LE2 A;  2OJQ A;  4IB4 A;  3CZ6 A;  1FFH A;  2PX0 A;  4LLC A;  3HNJ A;  2Q9A A;  1G8X A;  3MX3 A;  1M6T A;  1YA9 A;  3IQC A;  3BEH A;  1WGW A; 
#chains in the Genus database with same CATH homology
 2XRH A;  1ZHW A;  3EGX A;  2Q9C A;  5KYW A;  4YT2 A;  2ZXO A;  1SMY F;  5CI8 A;  4IAO A;  1M2V A;  4U5C E;  2FGY A;  1D0X A;  4ZLD A;  4YT5 A;  3Q6M A;  3GOD A;  1D1C A;  4OIP F;  5IY5 C;  2R7T A;  4RDA A;  3POV A;  5T1D B;  5KYX B;  1MNE A;  2FFH A;  4JJF A;  1Z23 A;  1O87 A;  3OA1 A;  4HFK B;  1TWG A;  2QY9 A;  4P6I C;  1V54 C;  4U5E E;  2M4E A;  2KNH A;  4U5F E;  3ASN C;  5KYY B;  2J9U A;  3IEE A;  4HFF B;  1TWC A;  4FWV A;  3NRH A;  3PMR A;  3DM5 A;  1VOM A;  3O6X A;  1ZU4 A;  3CQZ A;  3K66 A;  2I8B A;  4O6Y A;  2NUP B;  3JT1 A;  1NU9 C;  1BR4 A;  2EIJ C;  3DJN B;  3LS1 A;  5DQZ A;  4BEJ A;  4QI2 A;  2G3K A;  2LSE A;  3WOD F;  4KC9 A;  1IZM A;  2B0J A;  1FMW A;  1M2V B;  4I1O B;  2CNW A;  1ZHZ A;  2A69 F;  3ZVR A;  3KH2 A;  2YHS A;  4CS7 A;  3AQC A;  1TWA A;  3K1I C;  4Q4Z F;  3EGD B;  1PD0 A;  2KW3 C;  2R7X A;  4J30 B;  2DYR C;  3FDQ A;  3NKD A;  2NG1 A;  3NKE A;  1MND A;  3DXJ F;  4OIQ F;  4BJ1 A;  1TKN A;  1W2W A;  4F4B A;  2VAS A;  3W2V A;  1LVK A;  4LLE A;  4AE4 B;  4CS8 A;  5L3Q A;  3EG9 B;  3OWT A;  1SZI A;  2Y69 C;  4DVY P;  1OCC C;  1ZHY A;  3N2Z B;  4BJT A;  2R7S A;  4KNV A;  3Q7G A;  3B0P A;  3I5Q A;  2ZXP A;  3W8H A;  4MQ9 F;  2HV7 A;  3K6B A;  4JCH A;  5D92 A;  1OKK A;  1S7Z A;  2Y3G A;  4CS8 C;  1NG1 A;  2G62 A;  3NDB B;  2CGE A;  2CNW D;  2J7P A;  2W45 A;  1BR2 A;  1SF8 A;  1N1C A;  3B0U X;  5KYY A;  1ST6 A;  4RBN A;  4BJ5 A;  4DOZ A;  3TD7 A;  5E2Q A;  3B0V C;  3EHN A;  3UMK A;  3O39 A;  5B3S C;  5E3C A;  2Y39 A;  1Z3I X;  4ULW A;  3VAY A;  3AG3 C;  2NUP A;  4YT4 A;  4C3D A;  2XXA B;  1KU2 A;  3ZG1 A;  2CDQ A;  4G7H F;  2OCC C;  3K7D A;  2BE5 F;  2KGO A;  2R7O A;  3ITF A;  4BJ5 C;  2WZG A;  4MND A;  3UMH A;  3M1C B;  5D91 A;  4LER A;  2J9V A;  3I5P A;  2DGJ A;  4I44 A;  3JSZ A;  4PK4 A;  5KYN A;  3EQL F;  4KBL A;  2IXN A;  3F46 A;  2J0X A;  5DS4 A;  3EGD A;  2ZPA A;  1OKK D;  4YJW A;  1VYK A;  4JJG A;  2IXM A;  3PHF 2;  1D1A A;  2P7V A;  3KMI A;  3S27 A;  3NG1 A;  2W9Y A;  3ABM C;  5DS5 A;  1ZHT A;  2XL4 A;  3LJB A;  1VYI A;  4AE4 A;  4E7Z A;  3EG9 A;  3Q7L A;  4PJJ A;  2IXO A;  2V26 A;  4JW1 A;  2H7B A;  3W2W A;  4G0H A;  2Q3T A;  2IOQ A;  3AG4 C;  1J8M F;  1Z5Z A;  1PD1 A;  3WG7 C;  4QDL A;  3RH3 A;  4C7O A;  3DMD A;  3LLK A;  3UGO A;  1TR2 A;  2R7Q A;  3HLZ A;  2Y3H A;  3H65 A;  1D0Z A;  3UMI A;  1M56 C;  3LAY A;  2PX3 A;  2IXP A;  4J32 B;  3E9V A;  4I3M A;  3LS0 A;  1M57 C;  4K0D A;  4AX2 A;  5DLJ A;  1MMA A;  5E3A A;  1J8Y F;  2EIM C;  4I1M A;  4DBQ A;  5CI9 A;  3T4R A;  2A1D D;  2DYS C;  4GEH A;  4OIO F;  4A2N B;  2VB6 A;  4YWQ A;  4K7B A;  2YZS A;  4FES A;  3JCU Q;  3LES A;  2XXA A;  2J9W A;  4HEA J;  4CIH A;  4JUR I;  4PFO A;  2EIN C;  3EH2 A;  3EHM A;  2WVQ A;  2KQ9 A;  3K1H A;  1D1B A;  4PJN A;  4CS9 A;  4E7S A;  2O9X A;  4W8K A;  3ZIB A;  3RKO F;  4IRU A;  4U5H A;  1RJ9 B;  3EFO B;  1FFT C;  3T6B A;  2J0W A;  2C04 A;  3NYL A;  4C7O B;  2ZXR A;  4OIR F;  3X1O A;  2PF4 E;  2A6H F;  1MMG A;  2WVO A;  4EWC A;  2V3C C;  2CW0 F;  3JRT A;  5B1B C;  1FMV A;  4LAC B;  3OEO A;  3S28 A;  3N24 A;  4XLP F;  4CS9 C;  3SP1 A;  2NUT B;  2G3V A;  4YN0 B;  4C3B A;  1M2O A;  2MWQ A;  3QMK A;  2H7O A;  5EGY A;  2WL8 A;  5T3T A;  4ANJ A;  4WJ0 A;  2WZF A;  3I4U A;  4KNW A;  4B6I A;  2WZL A;  1ZU5 A;  3AQB A;  3X2Q C;  4EBB A;  3EZI A;  5FCL A;  1ZHX A;  3UGP A;  3SNH A;  5F5F A;  4FX5 A;  3NYJ A;  4N06 A;  2R7R A;  1NZE A;  3DZA A;  1MMD A;  4XTK A;  2C03 A;  3LEV A;  4C3E A;  1Z6A A;  4U5D E;  1O5H A;  3AG1 C;  2E87 A;  1JPN A;  3UR3 C;  2L81 A;  2P6V A;  3FVY A;  3LLI A;  5T3W A;  5BUO A;  4PJL A;  4OIN F;  4O6M A;  4XLN F;  3FAJ A;  4KI2 A;  2Y3D A;  2IYL D;  2KJG A;  3K33 A;  4DBR A;  3HTK C;  4U5G A;  2Z15 A;  4OD5 A;  2J7P D;  5B1A C;  3N0T A;  1MMN A;  2W4M A;  4G7Z F;  2PFD A;  4Q5S F;  1LKX A;  1PCX A;  2VH3 A;  3UNG C;  4O79 A;  4DVZ A;  2Q9B A;  2W4B A;  3RIP A;  3RYL A;  3ZC4 A;  3FHD A;  2Y3B A;  2HV6 A;  3ASO C;  1QLE C;  2A6E F;  3ABL C;  1V55 C;  4BJ6 A;  3ECS A;  5DVW A;  4XWJ A;  1RJ9 A;  3EFO A;  3W8I A;  1BR1 A;  3S29 A;  2YEV A;  5KYU B;  3SEO A;  1IW7 F;  4CBE A;  4PJM A;  3EJN A;  4OD4 A;  2GFH A;  3CSK A;  1NU7 D;  4JZA A;  3L0I A;  3LNR A;  3T6J A;  3KL4 A;  4ZLC A;  5EHH A;  4X0R A;  2NUT A;  3B9Q A;  2OG2 A;  3Q6N A;  4BJ6 C;  1D0Y A;  5L3V A;  4AK9 A;  3SZR A;  2L9J A;  3JYH A;  5HSW A;  4U5B E;  3DAF A;  5DQT A;  1JPJ A;  4H4K C;  3EGX B;  3EPV A;  5KYW B;  3L34 A;  3ABK C;  4PFP A;  2WVN A;  1ZYR F;  2R7U A;  4Q7C A;  4RD9 A;  4IJJ A;  4M63 A;  2WB7 A;  2J45 A;  4YT8 A;  2A68 F;  3KKB A;  4GYT A;  5DS6 A;  4CSA A;  3DAG A;  2MYS A;  5E33 A;  1QZX A;  5F5H A;  3V7O A;  3AG2 C;  3ZSU A;  2PP4 A;  2JD3 A;  3RFY A;  2EIL C;  3GAN A;  3S0X A;  3DM9 B;  4NY3 A;  3HJC A;  3QZC A;  4HE8 D;  4O6N A;  4BG0 A;  4CSA C;  1OCR C;  3E70 C;  2R7W A;  4IWB A;  3DD7 A;  4O7G A;  3F47 A;  2H7V C;  3MLG A;  3NYM A;  2QTV A;  5KYX A;  2ZXW C;  1OCO C;  2X51 A;  1VK5 A;  1TWH A;  5KYU A;  1OCZ C;  1LS1 A;  3VYW A;  1FTS A;  2D5R B;  3DJU B;  3SYN A;  2R7V A;  2EIK C;  4G7O F;  3EH1 A;  1Z63 A;  1VMA A;  4QI0 A;  2XSE A;  4JVS A;  3EZH A;  2J46 A;  3CZ6 A;  1FFH A;  2PX0 A;  4LLC A;  2Q9A A;  1G8X A;  3MX3 A;  1WGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...