2H7BA

Solution structure of the etafh domain from the human leukemia-associated fusion protein aml1-eto
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHAARLAKQNPAQYLAQHEQLLLDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Core-binding factor, ML1-ETO
total genus 19
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2h7bA01
2PP4A 2H7BA 2KNHA 2P6VA
chains in the Genus database with same CATH superfamily
1QKRA 2CW0F 4B6IA 2XL4A 3CQZA 1LVKA 1JOGA 2GA0A 2XS1A 2ZXRA 4K0DA 2QY9A 3R7CA 4LDRA 2WB7A 3PMRA 1Q0MA 1ZHTA 3BEHA 4ZLCA 3DJNB 2ZPAA 1BZ4A 1ZVZA 2OEXA 2YWAA 4CSAC 4JKVA 2DYSC 1H9GA 1RMVA 5A6BA 3ZVRA 3AQCA 4XWJA 2A6HF 3DAFA 2KSFA 2CNWD 2NUPB 1YDIA 3NYJA 3Q7GA 3V5YA 2CGEA 3M1CB 3FAPB 3K33A 1M6TA 4JE9A 2UUHA 1T01A 2Q9AA 2XRHA 2G3KA 4PJLA 4EUKB 1U6HA 1ZHWA 5BQIA 1TR2A 1ST6A 2AU5A 3EGDB 1VYIA 2XLVA 3ASOC 3EGXA 2LP4A 2R7VA 5L0GA 3K6BA 4MVUA 2BC5A 1WATA 1AVOB 1ZYRF 3U3BA 4BPMA 1GM5A 5B3SC 2DYRC 2DB4A 2Y69C 3DAGA 3US6A 1M2VB 4NQFA 2C03A 4BJ6A 1RJ9A 3JRMO 3AG1C 4I1OB 1GS9A 2Q7RA 5JVEA 2O9XA 1BR4A 1N1CA 4KBLA 1T5OA 4CJOA 3TJ5A 2XM4A 1E83A 3S0XA 3SXMA 5KYXA 3JCUQ 1LS4A 2PX0A 2XS8A 2OG2A 5D92A 1K40A 3IPMO 4OD5A 1OW8A 3RKOF 3TD7A 4YT2A 1OKKD 1T9KA 2AP3A 1TQGA 3S29A 5K0IA 3KH2A 4CIPA 2E87A 4C7OA 3EH2A 1SZIA 5JSLA 3QW1A 4WABA 4CDYA 4XPYA 1VLSA 3PDMP 2XXAB 2YL7A 2Q4FA 1S7ZA 3NKDA 3O6XA 4G0HA 4IARA 4YL3A 2H7VC 4DRIB 1Z3IX 1V55C 2IYLD 1E86A 3V5ZA 3EH1A 4PJJA 2AWCA 2MHRA 1PD0A 3FHDA 4JEBA 1RJ9B 2H7OA 2R7OA 5COGA 4CDAA 2CDQA 2NUTB 3B9QA 3DI5A 3FDQA 3GEEA 4JJGA 3SEOA 4FAPB 1QVXA 2LFFA 3DMDA 1CPRA 3GODA 4G7OF 3ABLC 3ZDLA 4BJ5C 4FX5A 3GM1A 1Z6AA 5AC4A 2VCBA 1JRAA 2ASRA 2HUJA 4Z9IA 3UMIA 5L3QA 4CSAA 2HJ3A 3TULA 1Q0KA 3L8IA 1HMDA 4IAQA 3U5SA 2FFHA 2R03A 3JTLO 4N06A 2L6HA 5KYYB 5DS5A 1NSGB 3KPHA 4U5CE 4A2NB 1NFNA 1ORJA 1VMAA 4LDQA 4MVSA 1OW6A 1QSPA 1WN0A 4YT8A 5JUAA 5HV9A 1YYXA 1VTMP 2YRFA 3W8IA 4E7ZA 2QNLA 3CAXA 1C03A 1NFOA 1U0BB 2NUPA 4W8KA 4H4KC 4MQ9F 3FAJA 3JYYA 1G8XA 4JRZA 4EHPA 1OW7A 5AC5A 1FAPB 1WTYA 4JEAA 1RCPA 2F22A 4Z9JA 3ZG1A 1XZPA 2Z15A 2Y3HA 4JW1A 4NC3A 4YT4A 3FXHA 3S84A 3ZSUA 2J8WA 2IXMA 3B71A 4U5DE 4C3EA 1TWHA 3AJMA 1NZEA 3UGOA 1NLXA 3EHNA 4J7TA 1FMVA 2EIMC 1ZW3A 5E33A 1FTSA 1D0ZA 4CS9A 2A0BA 2KC3A 3FOOA 3U8VA 4BJTA 2GAQA 5A6JA 2HV7A 3LNMB 4KNVA 4Q4ZF 1YYJA 2J7PD 2R05A 4KNWA 5JT4A 2L6FA 2Q9BA 3ABMC 3ZC4A 3N2ZB 4Q5SF 3ZWIA 1U89A 5BQGA 1BBHA 4U5EE 3N0TA 4O6YA 3IQ5A 1MMNA 3FVYA 5BUOA 3DJUB 1I4YA 2YZSA 1OCOC 1OKKA 3I5PA 3OWTA 4IB4A 2HJMA 3DM9B 1M57C 4WGYA 2BL2A 2M4EA 2RSEB 3G4XA 2ICWG 3GEHA 5JLIA 2OJED 1DOVA 2G62A 4XLPF 1QPUA 1UFBA 3HJCA 3QW0A 2PFDA 4BJ5A 1J8YF 4CX9A 5CIVA 1FMWA 1OQCA 4X0RA 1YAUO 1L3PA 2EILC 2EINC 2NSFA 3W8HA 4CS8A 1XZQA 5L3VA 4ULVA 1AUEA 2W4BA 4U5FE 5COMA 1H9TA 3LLIA 4LACB 1JR8A 3DE9A 1H7IA 2R7TA 2NUTA 1CGNA 5JS5A 2R7WA 3M4CA 2IM8A 2YLDA 4IGGA 3HNLA 1VYKA 4JJFA 4ONSA 3NDBB 1HE9A 1I4ZA 4YL0A 4MW8A 3W2WA 1KNYA 3EGXB 3ZQVA 2PBEA 1EKYA 1EI7A 2YL1A 4HEAJ 4OIRF 3ZQYA 2R7QA 3VAYA 2W4MA 3AG2C 3SZRA 3TOLA 3ZTMA 1SYQA 3TQOA 3UNGC 2B0HA 2P0NA 2WL8A 4NTBA 1LE4A 4H54A 4IJJA 3SXKA 2YEVA 5L0DA 2PF4E 2MWQA 1BR1A 3L1MA 4E0HA 4JVSA 1PCXA 4D4NA 3IQTA 4MNDA 1FR0A 3PCVA 1YZCA 4RBNA 2J45A 1CGOA 2P7VA 5KYXB 3B0VC 1Z63A 3MYFA 3W4YA 3K1IA 4MVZA 3S28A 1EA8A 3C63A 3M15A 4JIOA 4HFFB 2R25A 5CI9A 2RD9A 3B0PA 2AVKA 2YVKA 5CI8A 3U2LA 4PJMA 1MMAA 5KYNA 4E18A 4NY3A 2EPLX 4ER9A 5B1AC 1A0BA 2PX3A 5L0HA 4HE8D 2R02A 1MMGA 1APCA 2EPNA 3EFOB 3Q6NA 3KL4A 1A7VA 3KMIA 2XLEA 3OEOA 1LKXA 2WVOA 3RF3A 1SMYF 3RQGA 4LDKA 4KI2A 3M79A 3IEEA 3IHUA 2FGYA 3EZHA 1VOMA 2HSBA 3AG3C 3DXJF 4XEVA 1OR2A 2P1AA 4BJ6C 4DVZA 4GYTA 2Y39A 4Z9HA 4DBRA 2R7UA 2XLWA 5L0JA 3TJ6A 3H2UA 5KYUB 2L6GA 2A6EF 2OJQA 3I5QA 4JCZA 4MW3A 2YQYA 2J9UA 4DVYP 2KGOA 1WOLA 4I44A 2GDCA 1E2XA 1B68A 2J7PA 4J30B 4PK4A 4G7HF 1NG1A 1QLEC 3V5XA 5TJ5E 3EJNA 1L7CA 1XWJA 1RKCA 2UUIA 2VCCA 2A69F 2R9RB 3TK0A 4CS7A 1JPJA 5E3AA 3UMKA 1M2VA 1NBBA 1WGWA 4U5GA 2ZD9A 2CCYA 2H8AA 3ABKC 1D1AA 1LI7A 1SF8A 3LUTB 4PFOA 4UDVA 3LLKA 4L6RA 4N6CA 2C04A 4R32A 2VH3A 3F46A 3U9MA 4ULWA 4DBQA 2YHSA 4XQ1A 3UMHA 4CJGA 3HTKC 3U3FA 4QDLA 4XPWA 4MVMA 3HLZA 3MLGA 3SP1A 5GPGB 1BR2A 2WZLA 3R2PA 1H6GA 4KC9A 4CIHA 3C8ZA 1ZHXA 2XL8A 2WVQA 5EHHA 4AX2A 3O55A 1KU2A 2HMQA 3C8GB 4U5BE 4PR9A 5HSWA 2J9WA 2PP4A 4NTAA 5KYUA 3VM6A 3EPVA 5KYWB 3ASNC 1BDJB 4OIQF 4OINF 3NMKA 1K04A 2X0CA 2A68F 2OU6A 3ECSA 3QMKA 4E0IA 2LQGA 4JCHA 2LK4A 2P61A 2OEVA 3DD7A 4G78A 4EBBA 1V4AA 1YJGA 1LS1A 3POVA 3NYMA 2NPUA 3EG9A 2YLGA 1FFTC 5EK0A 5L0CA 3UGPA 1YZAA 1FNTc 2JD3A 2XLHA 5F5FA 1C17M 1VK5A 4IAOA 4XPXA 4N6HA 1NU9C 1YVIA 2BE5F 3LESA 1ORSC 4NCQA 3BRJA 2D5RB 2J0XA 1LE2A 3KKBA 3RIPA 1FFHA 4WGZA 3FOPA 4MTFA 3SXZA 4Q7CA 1Z5ZA 3K1HA 3WAQA 4G7ZF 1W2WA 3LJBA 3EGDA 5JP7A 1O87A 1TFKB 3VF0A 4XEKA 5KYWA 3G4ZA 2IOQA 2XM0A 5T3TA 2EIJC 3IQ6A 5F28E 1DOWA 2HS5A 5F5HA 4A4AA 5JRAA 5FZTA 3T9OA 1RKEA 1Q0DA 3TOMA 2ETSA 2FAPB 2I15A 5KYYA 4E7SA 2IXOA 2XL6A 1V54C 2EIKC 2HSQA 5A6BD 3KYJA 3RW0A 4MVQA 4E17A 5FCLA 3LEVA 2Y3BA 1A41A 1CGME 4AL1A 3LAYA 2YL0A 3EG9B 4XEFA 5DQTA 2XLOA 2AWYA 4ANJA 4ZLDA 2OKUA 3EHMA 4QI0A 4CS8C 3RVYA 4J32B 1PD1A 2QE9A 3C18A 4JZAA 3GM3A 4LLEA 2W9YA 4CS9C 3JSZA 4BEMJ 4WJ0A 2XSEA 4FWVA 2EPMX 1D1BA 2XLMA 4LLCA 3RVZA 4I1MA 4PACA 1HY5A 4JTDB 4NTFA 5DVWA 1G4WR 5T3WA 1PV3A 2VASA 2HMZA 5EGYA 2P6VA 4DRJB 2Q9CA 3RH3A 2R7SA 2YLIA 2IBFA 2DI3A 2PNOA 3C8GA 3EFOA 1HMOA 1QQ3A 3N24A 2J9BA 3AGUA 1YLMA 2CYDA 2YKZA 3KYIA 3Q7LA 1T6IA 2IXNA 1TWCA 2OQMA 2WZGA 3GEIA 5A6KA 2KJGA 1LM3B 4F4BA 4DOZA 4JC7A 4XTKA 3DWWA 4DRHB 2D4UA 3O10A 1HW1A 4FESA 5A69A 3MYIA 1I5NA 2A0UA 3NKEA 1OXKA 2HKVA 3NYLA 3AG4C 3X1OA 4YWQA 3NG1A 4MTGA 1OCZC 1EQ1A 1MNEA 1T6QA 2V3CC 3ITFA 2L7AA 3SXYA 1Y4CA 2GWWA 3QTHA 2LCHA 1IZMA 4YT5A 1LPEA 3WHNA 1KTMA 4DXWA 1MMDA 4O79A 3HNKA 1MNDA 3MBGA 3CZ6A 2W45A 3EZIA 3GORA 4HFKB 4EKWA 3FMSA 4AL0A 4C7OB 2HV6A 1WWPA 4MS2A 3ZIBA 2JX0A 4P9TA 4YN0B 1WASA 3B0UX 1T6UA 5COFA 4CDVA 5DS4A 1R5ID 3F47A 1YA7O 1M56C 3JSEO 4D4XA 4GEHA 3U8PA 3DZAA 3B29A 2J0WA 4BJ1A 3X2QC 1SR2A 4N4WA 4BEJA 1E85A 1OR3A 1ZHZA 3NMIA 2R7RA 4O6NA 3J06A 2NG1A 4MVOA 3G50A 3MX3A 2M64A 1LI5A 2KQ9A 3JRTA 4JTAB 3L0IA 2DGJA 4AK9A 3E9VA 5D91A 3MFNA 1RXQA 2J9VA 4RD9A 3VYWA 4C3DA 1UG7A 1F1MA 1GQAA 2A1DD 2QUPA 2HZ8A 2LIGA 1JPNA 3Q6MA 2JPUA 2VB6A 2Y3DA 3GANA 1Y6DA 3CSKA 3K7DA 3RQFA 3H2VA 3E70C 1TFOB 3S27A 2J46A 3O39A 1HW2A 5E3CA 1TKNA 3DKAA 4MTOA 2Q3TA 2ZXPA 3JT1A 2KNHA 3DE8A 2MYSA 4JTCB 4P9FA 4MVRA 2IXPA 3LEOA 4LERA 1VB5A 2LSEA 4C3BA 3WODF 3PHF2 1AEPA 2OCCC 4GQHA 1ZU5A 1ORYA 3SYNA 3JYHA 1ZHYA 3W2VA 4K7BA 1E84A 3OA1A 2R7XA 1G4US 4XLNF 3T6JA 3LNRA 2KYHA 2EPOA 3I4UA 2ZXWC 1J8MF 1S05A 2I8BA 3K66A 1JMWA 1OXBA 1ZW2A 2KK1A 4PJNA 3RYLA 1C02A 3NMJA 3T6BA 5DS6A 1D1CA 3QZCA 1M2OA 1ZZPA 2G3VA 3CEXA 4JURI 3C7JA 2Y3GA 3SNHA 1VLTA 3HNJA 3JZ0A 5IY5C 3L34A 4W8PA 1NU7D 1V74B 2L81A 3GWNA 5B1BC 3LS1A 5T1DB 3AQBA 3EQLF 4O7GA 2X51A 4P6IC 3U0CA 1A7EA 4YK5A 1K05A 4U5HA 3AOUA 3AGTA 5L0FA 4IRUA 4CBEA 3L8JA 1YARO 1OCRC 2VC9A 3NRHA 2GFHA 3ZTZA 4AE4A 4BG0A 3QVYA 4OIPF 3DM5A 3K1IC 1G5ZA 1Z7Qc 3U2MA 1IW7F 1Q0FA 3WG7C 4OIOF 2Q00A 2HFIA 3GM2A 4J7YA 2QLAA 4YJWA 2CNWA 2YL3A 5L0IA 3S9OA 1QZXA 4RDAA 1O5HA 2XLDA 3GWLA 2B0JA 1TWAA 1O3UA 3IQCA 1D0YA 2KW3C 4QI2A 1Z23A 3VRCA 2LD6A 3HNIA 5E2QA 3H65A 4EBJA 1CPQA 4IWBA 3S90A 2TMVP 3A9CA 2OOCA 2XXAA 2WVNA 5AGFA 1MQVA 4EBKA 3T4RA 1D0XA 1JAFA 3HKKA 4O6MA 4OD4A 3U9JA 3V7OA 2ZXOA 4DJ9A 3QVZA 1YA9A 2NSGA 2WZFA 3A11A 3RFYA 5BQHA 1GGQA 1LIHA 1R4TA 4I3MA 4AE4B 2H7BA 3C8GD 1RKEB 4PFPA 5DQZA 2LFDA 1ZU4A 1A7DA 2EPKX 1HE1A 2QTVA 4U9EA 256BA 4EIYA 3C62A 5B3IA 5A6AA 1Q0GA 2VCAA 3M4BA 1OCCC 2L9JA 1TWGA 2V26A 3ATPA 3LS0A 4K1OA 4M63A 3T6GB 3UR3C 5DLJA 4EWCA 3RQEA 4YL1A 4U9DA
chains in the Genus database with same CATH topology
2CW0F 4B6IA 2XL4A 3CQZA 1LVKA 2ZXRA 4K0DA 2QY9A 2WB7A 3PMRA 4ZLCA 1ZHTA 3DJNB 2ZPAA 4CSAC 2DYSC 3ZVRA 3AQCA 4XWJA 2A6HF 3DAFA 2CNWD 2NUPB 3NYJA 3Q7GA 2CGEA 3M1CB 3K33A 2Q9AA 2XRHA 2G3KA 4PJLA 1ZHWA 1TR2A 1ST6A 3EGDB 1VYIA 3ASOC 3EGXA 2R7VA 3K6BA 1ZYRF 5B3SC 2DYRC 2Y69C 3DAGA 1M2VB 2C03A 4BJ6A 1RJ9A 3AG1C 4I1OB 2O9XA 1BR4A 1N1CA 4KBLA 3S0XA 5KYXA 3JCUQ 2PX0A 3TD7A 2OG2A 5D92A 4YT2A 3RKOF 4OD5A 1OKKD 3S29A 3KH2A 2E87A 4C7OA 3EH2A 1SZIA 2XXAB 3O6XA 1S7ZA 3NKDA 4G0HA 2H7VC 1Z3IX 1V55C 2IYLD 3EH1A 4PJJA 1PD0A 3FHDA 1RJ9B 2H7OA 2R7OA 2CDQA 2NUTB 3B9QA 3FDQA 4JJGA 3SEOA 3DMDA 3GODA 4G7OF 3ABLC 4BJ5C 4FX5A 1Z6AA 3UMIA 4CSAA 5L3QA 2FFHA 4N06A 5KYYB 5DS5A 4A2NB 4U5CE 1VMAA 4YT8A 4E7ZA 3W8IA 2NUPA 4W8KA 4H4KC 4MQ9F 3FAJA 1G8XA 3ZG1A 2Z15A 2Y3HA 4JW1A 4YT4A 3ZSUA 2IXMA 4U5DE 4C3EA 1TWHA 1NZEA 3UGOA 3EHNA 1FMVA 2EIMC 5E33A 1FTSA 1D0ZA 4CS9A 4BJTA 4Q4ZF 2HV7A 4KNVA 2J7PD 4KNWA 2Q9BA 3ABMC 3ZC4A 3N2ZB 4Q5SF 4U5EE 3N0TA 4O6YA 1MMNA 3FVYA 5BUOA 3DJUB 2YZSA 3I5PA 1OCOC 1OKKA 3OWTA 3DM9B 1M57C 2M4EA 2G62A 4XLPF 3HJCA 2PFDA 4BJ5A 1J8YF 1FMWA 4X0RA 2EILC 2EINC 4CS8A 3W8HA 5L3VA 2W4BA 4U5FE 3LLIA 4LACB 2R7TA 2NUTA 2R7WA 4JJFA 1VYKA 3NDBB 3W2WA 3EGXB 4HEAJ 4OIRF 2R7QA 3VAYA 2W4MA 3AG2C 3SZRA 3UNGC 2WL8A 4IJJA 2YEVA 2PF4E 2MWQA 1BR1A 4JVSA 1PCXA 4MNDA 4RBNA 2J45A 2P7VA 5KYXB 3B0VC 1Z63A 3S28A 5CI9A 4HFFB 3B0PA 5CI8A 4PJMA 1MMAA 5KYNA 4NY3A 5B1AC 2PX3A 4HE8D 1MMGA 3EFOB 3Q6NA 3KL4A 3KMIA 3OEOA 1LKXA 2WVOA 1SMYF 4KI2A 3IEEA 2FGYA 3EZHA 1VOMA 3AG3C 3DXJF 4OIQF 4BJ6C 4DBRA 4DVZA 4GYTA 2Y39A 2R7UA 5KYUB 2A6EF 3I5QA 2J9UA 4DVYP 2KGOA 4I44A 2J7PA 4J30B 4PK4A 4G7HF 1NG1A 1QLEC 3EJNA 2A69F 4CS7A 1JPJA 5E3AA 3UMKA 1M2VA 1WGWA 4U5GA 3ABKC 1D1AA 1SF8A 4PFOA 3LLKA 2C04A 2VH3A 3F46A 4ULWA 4DBQA 2YHSA 3UMHA 3HTKC 4QDLA 3HLZA 3MLGA 3SP1A 1BR2A 2WZLA 4KC9A 4CIHA 1ZHXA 2WVQA 5EHHA 4AX2A 1KU2A 4U5BE 2J9WA 2PP4A 5KYUA 3EPVA 5KYWB 3ASNC 4OINF 2A68F 3QMKA 3ECSA 4JCHA 3DD7A 4EBBA 1LS1A 3POVA 3NYMA 3EG9A 3UGPA 1FFTC 5F5FA 2JD3A 4IAOA 1VK5A 1NU9C 2BE5F 3LESA 2D5RB 2J0XA 3KKBA 3RIPA 1FFHA 4Q7CA 1Z5ZA 3K1HA 4G7ZF 1W2WA 3LJBA 3EGDA 1O87A 5KYWA 2IOQA 5T3TA 2EIJC 5F5HA 5KYYA 4E7SA 2IXOA 1V54C 2EIKC 5FCLA 3LEVA 2Y3BA 3LAYA 3EG9B 5DQTA 4ANJA 4ZLDA 3EHMA 4QI0A 4CS8C 4J32B 1PD1A 4JZAA 4LLEA 2W9YA 4CS9C 3JSZA 4WJ0A 2XSEA 4FWVA 1D1BA 4LLCA 4I1MA 5DVWA 5T3WA 2VASA 5EGYA 2P6VA 2Q9CA 3RH3A 2R7SA 3EFOA 3N24A 3Q7LA 2IXNA 1TWCA 2WZGA 2KJGA 4F4BA 4DOZA 4XTKA 4FESA 3NKEA 3X1OA 3NYLA 4YWQA 3AG4C 3NG1A 1OCZC 1MNEA 2V3CC 3ITFA 1IZMA 4YT5A 1MMDA 4O79A 1MNDA 4HFKB 3CZ6A 2W45A 3EZIA 4C7OB 2HV6A 3ZIBA 4YN0B 3B0UX 5DS4A 3F47A 1M56C 4GEHA 3DZAA 2J0WA 4BJ1A 3X2QC 4BEJA 1ZHZA 2R7RA 4O6NA 2NG1A 3MX3A 2KQ9A 3JRTA 3L0IA 2DGJA 4AK9A 3E9VA 5D91A 3VYWA 2J9VA 4C3DA 4RD9A 2A1DD 1JPNA 3Q6MA 2Y3DA 2VB6A 3GANA 3CSKA 3K7DA 3E70C 3S27A 2J46A 3O39A 5E3CA 1TKNA 2Q3TA 2ZXPA 3JT1A 2KNHA 2MYSA 2IXPA 4LERA 2LSEA 4C3BA 3WODF 3PHF2 2OCCC 1ZU5A 3SYNA 3JYHA 1ZHYA 3W2VA 4K7BA 3OA1A 2R7XA 4XLNF 3T6JA 3LNRA 3K66A 3I4UA 2ZXWC 1J8MF 4PJNA 2I8BA 3RYLA 3T6BA 5DS6A 1D1CA 3QZCA 1M2OA 2G3VA 4JURI 2Y3GA 3SNHA 5IY5C 3L34A 1NU7D 2L81A 5T1DB 5B1BC 3LS1A 3AQBA 3EQLF 4O7GA 2X51A 4P6IC 4U5HA 4IRUA 4CBEA 1OCRC 4BG0A 3NRHA 2GFHA 4AE4A 4OIPF 3DM5A 3K1IC 1IW7F 3WG7C 4OIOF 4YJWA 2CNWA 1QZXA 4RDAA 1O5HA 2B0JA 1TWAA 1D0YA 2KW3C 4QI2A 1Z23A 5E2QA 3H65A 4IWBA 2XXAA 2WVNA 3T4RA 1D0XA 4O6MA 4OD4A 3V7OA 5HSWA 2ZXOA 2WZFA 3RFYA 4I3MA 4AE4B 2H7BA 4PFPA 5DQZA 1ZU4A 2QTVA 1OCCC 2L9JA 1TWGA 2V26A 3LS0A 4M63A 4EWCA 5DLJA 3UR3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PP4 A;  2H7B A;  2KNH A;  2P6V A; 
#chains in the Genus database with same CATH topology
 1QKR A;  2CW0 F;  4B6I A;  2XL4 A;  3CQZ A;  1LVK A;  1JOG A;  2GA0 A;  2XS1 A;  2ZXR A;  4K0D A;  2QY9 A;  3R7C A;  4LDR A;  2WB7 A;  3PMR A;  1Q0M A;  1ZHT A;  3BEH A;  4ZLC A;  3DJN B;  2ZPA A;  1BZ4 A;  1ZVZ A;  2OEX A;  2YWA A;  4CSA C;  4JKV A;  2DYS C;  1H9G A;  1RMV A;  5A6B A;  3ZVR A;  3AQC A;  4XWJ A;  2A6H F;  3DAF A;  2KSF A;  2CNW D;  2NUP B;  1YDI A;  3NYJ A;  3Q7G A;  3V5Y A;  2CGE A;  3M1C B;  3FAP B;  3K33 A;  1M6T A;  4JE9 A;  2UUH A;  1T01 A;  2Q9A A;  2XRH A;  2G3K A;  4PJL A;  4EUK B;  1U6H A;  1ZHW A;  5BQI A;  1TR2 A;  1ST6 A;  2AU5 A;  3EGD B;  1VYI A;  2XLV A;  3ASO C;  3EGX A;  2LP4 A;  2R7V A;  5L0G A;  3K6B A;  4MVU A;  2BC5 A;  1WAT A;  1AVO B;  1ZYR F;  3U3B A;  4BPM A;  1GM5 A;  5B3S C;  2DYR C;  2DB4 A;  2Y69 C;  3DAG A;  3US6 A;  1M2V B;  4NQF A;  2C03 A;  4BJ6 A;  1RJ9 A;  3JRM O;  3AG1 C;  4I1O B;  1GS9 A;  2Q7R A;  5JVE A;  2O9X A;  1BR4 A;  1N1C A;  4KBL A;  1T5O A;  4CJO A;  3TJ5 A;  2XM4 A;  1E83 A;  3S0X A;  3SXM A;  5KYX A;  3JCU Q;  1LS4 A;  2PX0 A;  2XS8 A;  2OG2 A;  5D92 A;  1K40 A;  3IPM O;  4OD5 A;  1OW8 A;  3RKO F;  3TD7 A;  4YT2 A;  1OKK D;  1T9K A;  2AP3 A;  1TQG A;  3S29 A;  5K0I A;  3KH2 A;  4CIP A;  2E87 A;  4C7O A;  3EH2 A;  1SZI A;  5JSL A;  3QW1 A;  4WAB A;  4CDY A;  4XPY A;  1VLS A;  3PDM P;  2XXA B;  2YL7 A;  2Q4F A;  1S7Z A;  3NKD A;  3O6X A;  4G0H A;  4IAR A;  4YL3 A;  2H7V C;  4DRI B;  1Z3I X;  1V55 C;  2IYL D;  1E86 A;  3V5Z A;  3EH1 A;  4PJJ A;  2AWC A;  2MHR A;  1PD0 A;  3FHD A;  4JEB A;  1RJ9 B;  2H7O A;  2R7O A;  5COG A;  4CDA A;  2CDQ A;  2NUT B;  3B9Q A;  3DI5 A;  3FDQ A;  3GEE A;  4JJG A;  3SEO A;  4FAP B;  1QVX A;  2LFF A;  3DMD A;  1CPR A;  3GOD A;  4G7O F;  3ABL C;  3ZDL A;  4BJ5 C;  4FX5 A;  3GM1 A;  1Z6A A;  5AC4 A;  2VCB A;  1JRA A;  2ASR A;  2HUJ A;  4Z9I A;  3UMI A;  5L3Q A;  4CSA A;  2HJ3 A;  3TUL A;  1Q0K A;  3L8I A;  1HMD A;  4IAQ A;  3U5S A;  2FFH A;  2R03 A;  3JTL O;  4N06 A;  2L6H A;  5KYY B;  5DS5 A;  1NSG B;  3KPH A;  4U5C E;  4A2N B;  1NFN A;  1ORJ A;  1VMA A;  4LDQ A;  4MVS A;  1OW6 A;  1QSP A;  1WN0 A;  4YT8 A;  5JUA A;  5HV9 A;  1YYX A;  1VTM P;  2YRF A;  3W8I A;  4E7Z A;  2QNL A;  3CAX A;  1C03 A;  1NFO A;  1U0B B;  2NUP A;  4W8K A;  4H4K C;  4MQ9 F;  3FAJ A;  3JYY A;  1G8X A;  4JRZ A;  4EHP A;  1OW7 A;  5AC5 A;  1FAP B;  1WTY A;  4JEA A;  1RCP A;  2F22 A;  4Z9J A;  3ZG1 A;  1XZP A;  2Z15 A;  2Y3H A;  4JW1 A;  4NC3 A;  4YT4 A;  3FXH A;  3S84 A;  3ZSU A;  2J8W A;  2IXM A;  3B71 A;  4U5D E;  4C3E A;  1TWH A;  3AJM A;  1NZE A;  3UGO A;  1NLX A;  3EHN A;  4J7T A;  1FMV A;  2EIM C;  1ZW3 A;  5E33 A;  1FTS A;  1D0Z A;  4CS9 A;  2A0B A;  2KC3 A;  3FOO A;  3U8V A;  4BJT A;  2GAQ A;  5A6J A;  2HV7 A;  3LNM B;  4KNV A;  4Q4Z F;  1YYJ A;  2J7P D;  2R05 A;  4KNW A;  5JT4 A;  2L6F A;  2Q9B A;  3ABM C;  3ZC4 A;  3N2Z B;  4Q5S F;  3ZWI A;  1U89 A;  5BQG A;  1BBH A;  4U5E E;  3N0T A;  4O6Y A;  3IQ5 A;  1MMN A;  3FVY A;  5BUO A;  3DJU B;  1I4Y A;  2YZS A;  1OCO C;  1OKK A;  3I5P A;  3OWT A;  4IB4 A;  2HJM A;  3DM9 B;  1M57 C;  4WGY A;  2BL2 A;  2M4E A;  2RSE B;  3G4X A;  2ICW G;  3GEH A;  5JLI A;  2OJE D;  1DOV A;  2G62 A;  4XLP F;  1QPU A;  1UFB A;  3HJC A;  3QW0 A;  2PFD A;  4BJ5 A;  1J8Y F;  4CX9 A;  5CIV A;  1FMW A;  1OQC A;  4X0R A;  1YAU O;  1L3P A;  2EIL C;  2EIN C;  2NSF A;  3W8H A;  4CS8 A;  1XZQ A;  5L3V A;  4ULV A;  1AUE A;  2W4B A;  4U5F E;  5COM A;  1H9T A;  3LLI A;  4LAC B;  1JR8 A;  3DE9 A;  1H7I A;  2R7T A;  2NUT A;  1CGN A;  5JS5 A;  2R7W A;  3M4C A;  2IM8 A;  2YLD A;  4IGG A;  3HNL A;  1VYK A;  4JJF A;  4ONS A;  3NDB B;  1HE9 A;  1I4Z A;  4YL0 A;  4MW8 A;  3W2W A;  1KNY A;  3EGX B;  3ZQV A;  2PBE A;  1EKY A;  1EI7 A;  2YL1 A;  4HEA J;  4OIR F;  3ZQY A;  2R7Q A;  3VAY A;  2W4M A;  3AG2 C;  3SZR A;  3TOL A;  3ZTM A;  1SYQ A;  3TQO A;  3UNG C;  2B0H A;  2P0N A;  2WL8 A;  4NTB A;  1LE4 A;  4H54 A;  4IJJ A;  3SXK A;  2YEV A;  5L0D A;  2PF4 E;  2MWQ A;  1BR1 A;  3L1M A;  4E0H A;  4JVS A;  1PCX A;  4D4N A;  3IQT A;  4MND A;  1FR0 A;  3PCV A;  1YZC A;  4RBN A;  2J45 A;  1CGO A;  2P7V A;  5KYX B;  3B0V C;  1Z63 A;  3MYF A;  3W4Y A;  3K1I A;  4MVZ A;  3S28 A;  1EA8 A;  3C63 A;  3M15 A;  4JIO A;  4HFF B;  2R25 A;  5CI9 A;  2RD9 A;  3B0P A;  2AVK A;  2YVK A;  5CI8 A;  3U2L A;  4PJM A;  1MMA A;  5KYN A;  4E18 A;  4NY3 A;  2EPL X;  4ER9 A;  5B1A C;  1A0B A;  2PX3 A;  5L0H A;  4HE8 D;  2R02 A;  1MMG A;  1APC A;  2EPN A;  3EFO B;  3Q6N A;  3KL4 A;  1A7V A;  3KMI A;  2XLE A;  3OEO A;  1LKX A;  2WVO A;  3RF3 A;  1SMY F;  3RQG A;  4LDK A;  4KI2 A;  3M79 A;  3IEE A;  3IHU A;  2FGY A;  3EZH A;  1VOM A;  2HSB A;  3AG3 C;  3DXJ F;  4XEV A;  1OR2 A;  2P1A A;  4BJ6 C;  4DVZ A;  4GYT A;  2Y39 A;  4Z9H A;  4DBR A;  2R7U A;  2XLW A;  5L0J A;  3TJ6 A;  3H2U A;  5KYU B;  2L6G A;  2A6E F;  2OJQ A;  3I5Q A;  4JCZ A;  4MW3 A;  2YQY A;  2J9U A;  4DVY P;  2KGO A;  1WOL A;  4I44 A;  2GDC A;  1E2X A;  1B68 A;  2J7P A;  4J30 B;  4PK4 A;  4G7H F;  1NG1 A;  1QLE C;  3V5X A;  5TJ5 E;  3EJN A;  1L7C A;  1XWJ A;  1RKC A;  2UUI A;  2VCC A;  2A69 F;  2R9R B;  3TK0 A;  4CS7 A;  1JPJ A;  5E3A A;  3UMK A;  1M2V A;  1NBB A;  1WGW A;  4U5G A;  2ZD9 A;  2CCY A;  2H8A A;  3ABK C;  1D1A A;  1LI7 A;  1SF8 A;  3LUT B;  4PFO A;  4UDV A;  3LLK A;  4L6R A;  4N6C A;  2C04 A;  4R32 A;  2VH3 A;  3F46 A;  3U9M A;  4ULW A;  4DBQ A;  2YHS A;  4XQ1 A;  3UMH A;  4CJG A;  3HTK C;  3U3F A;  4QDL A;  4XPW A;  4MVM A;  3HLZ A;  3MLG A;  3SP1 A;  5GPG B;  1BR2 A;  2WZL A;  3R2P A;  1H6G A;  4KC9 A;  4CIH A;  3C8Z A;  1ZHX A;  2XL8 A;  2WVQ A;  5EHH A;  4AX2 A;  3O55 A;  1KU2 A;  2HMQ A;  3C8G B;  4U5B E;  4PR9 A;  5HSW A;  2J9W A;  2PP4 A;  4NTA A;  5KYU A;  3VM6 A;  3EPV A;  5KYW B;  3ASN C;  1BDJ B;  4OIQ F;  4OIN F;  3NMK A;  1K04 A;  2X0C A;  2A68 F;  2OU6 A;  3ECS A;  3QMK A;  4E0I A;  2LQG A;  4JCH A;  2LK4 A;  2P61 A;  2OEV A;  3DD7 A;  4G78 A;  4EBB A;  1V4A A;  1YJG A;  1LS1 A;  3POV A;  3NYM A;  2NPU A;  3EG9 A;  2YLG A;  1FFT C;  5EK0 A;  5L0C A;  3UGP A;  1YZA A;  1FNT c;  2JD3 A;  2XLH A;  5F5F A;  1C17 M;  1VK5 A;  4IAO A;  4XPX A;  4N6H A;  1NU9 C;  1YVI A;  2BE5 F;  3LES A;  1ORS C;  4NCQ A;  3BRJ A;  2D5R B;  2J0X A;  1LE2 A;  3KKB A;  3RIP A;  1FFH A;  4WGZ A;  3FOP A;  4MTF A;  3SXZ A;  4Q7C A;  1Z5Z A;  3K1H A;  3WAQ A;  4G7Z F;  1W2W A;  3LJB A;  3EGD A;  5JP7 A;  1O87 A;  1TFK B;  3VF0 A;  4XEK A;  5KYW A;  3G4Z A;  2IOQ A;  2XM0 A;  5T3T A;  2EIJ C;  3IQ6 A;  5F28 E;  1DOW A;  2HS5 A;  5F5H A;  4A4A A;  5JRA A;  5FZT A;  3T9O A;  1RKE A;  1Q0D A;  3TOM A;  2ETS A;  2FAP B;  2I15 A;  5KYY A;  4E7S A;  2IXO A;  2XL6 A;  1V54 C;  2EIK C;  2HSQ A;  5A6B D;  3KYJ A;  3RW0 A;  4MVQ A;  4E17 A;  5FCL A;  3LEV A;  2Y3B A;  1A41 A;  1CGM E;  4AL1 A;  3LAY A;  2YL0 A;  3EG9 B;  4XEF A;  5DQT A;  2XLO A;  2AWY A;  4ANJ A;  4ZLD A;  2OKU A;  3EHM A;  4QI0 A;  4CS8 C;  3RVY A;  4J32 B;  1PD1 A;  2QE9 A;  3C18 A;  4JZA A;  3GM3 A;  4LLE A;  2W9Y A;  4CS9 C;  3JSZ A;  4BEM J;  4WJ0 A;  2XSE A;  4FWV A;  2EPM X;  1D1B A;  2XLM A;  4LLC A;  3RVZ A;  4I1M A;  4PAC A;  1HY5 A;  4JTD B;  4NTF A;  5DVW A;  1G4W R;  5T3W A;  1PV3 A;  2VAS A;  2HMZ A;  5EGY A;  2P6V A;  4DRJ B;  2Q9C A;  3RH3 A;  2R7S A;  2YLI A;  2IBF A;  2DI3 A;  2PNO A;  3C8G A;  3EFO A;  1HMO A;  1QQ3 A;  3N24 A;  2J9B A;  3AGU A;  1YLM A;  2CYD A;  2YKZ A;  3KYI A;  3Q7L A;  1T6I A;  2IXN A;  1TWC A;  2OQM A;  2WZG A;  3GEI A;  5A6K A;  2KJG A;  1LM3 B;  4F4B A;  4DOZ A;  4JC7 A;  4XTK A;  3DWW A;  4DRH B;  2D4U A;  3O10 A;  1HW1 A;  4FES A;  5A69 A;  3MYI A;  1I5N A;  2A0U A;  3NKE A;  1OXK A;  2HKV A;  3NYL A;  3AG4 C;  3X1O A;  4YWQ A;  3NG1 A;  4MTG A;  1OCZ C;  1EQ1 A;  1MNE A;  1T6Q A;  2V3C C;  3ITF A;  2L7A A;  3SXY A;  1Y4C A;  2GWW A;  3QTH A;  2LCH A;  1IZM A;  4YT5 A;  1LPE A;  3WHN A;  1KTM A;  4DXW A;  1MMD A;  4O79 A;  3HNK A;  1MND A;  3MBG A;  3CZ6 A;  2W45 A;  3EZI A;  3GOR A;  4HFK B;  4EKW A;  3FMS A;  4AL0 A;  4C7O B;  2HV6 A;  1WWP A;  4MS2 A;  3ZIB A;  2JX0 A;  4P9T A;  4YN0 B;  1WAS A;  3B0U X;  1T6U A;  5COF A;  4CDV A;  5DS4 A;  1R5I D;  3F47 A;  1YA7 O;  1M56 C;  3JSE O;  4D4X A;  4GEH A;  3U8P A;  3DZA A;  3B29 A;  2J0W A;  4BJ1 A;  3X2Q C;  1SR2 A;  4N4W A;  4BEJ A;  1E85 A;  1OR3 A;  1ZHZ A;  3NMI A;  2R7R A;  4O6N A;  3J06 A;  2NG1 A;  4MVO A;  3G50 A;  3MX3 A;  2M64 A;  1LI5 A;  2KQ9 A;  3JRT A;  4JTA B;  3L0I A;  2DGJ A;  4AK9 A;  3E9V A;  5D91 A;  3MFN A;  1RXQ A;  2J9V A;  4RD9 A;  3VYW A;  4C3D A;  1UG7 A;  1F1M A;  1GQA A;  2A1D D;  2QUP A;  2HZ8 A;  2LIG A;  1JPN A;  3Q6M A;  2JPU A;  2VB6 A;  2Y3D A;  3GAN A;  1Y6D A;  3CSK A;  3K7D A;  3RQF A;  3H2V A;  3E70 C;  1TFO B;  3S27 A;  2J46 A;  3O39 A;  1HW2 A;  5E3C A;  1TKN A;  3DKA A;  4MTO A;  2Q3T A;  2ZXP A;  3JT1 A;  2KNH A;  3DE8 A;  2MYS A;  4JTC B;  4P9F A;  4MVR A;  2IXP A;  3LEO A;  4LER A;  1VB5 A;  2LSE A;  4C3B A;  3WOD F;  3PHF 2;  1AEP A;  2OCC C;  4GQH A;  1ZU5 A;  1ORY A;  3SYN A;  3JYH A;  1ZHY A;  3W2V A;  4K7B A;  1E84 A;  3OA1 A;  2R7X A;  1G4U S;  4XLN F;  3T6J A;  3LNR A;  2KYH A;  2EPO A;  3I4U A;  2ZXW C;  1J8M F;  1S05 A;  2I8B A;  3K66 A;  1JMW A;  1OXB A;  1ZW2 A;  2KK1 A;  4PJN A;  3RYL A;  1C02 A;  3NMJ A;  3T6B A;  5DS6 A;  1D1C A;  3QZC A;  1M2O A;  1ZZP A;  2G3V A;  3CEX A;  4JUR I;  3C7J A;  2Y3G A;  3SNH A;  1VLT A;  3HNJ A;  3JZ0 A;  5IY5 C;  3L34 A;  4W8P A;  1NU7 D;  1V74 B;  2L81 A;  3GWN A;  5B1B C;  3LS1 A;  5T1D B;  3AQB A;  3EQL F;  4O7G A;  2X51 A;  4P6I C;  3U0C A;  1A7E A;  4YK5 A;  1K05 A;  4U5H A;  3AOU A;  3AGT A;  5L0F A;  4IRU A;  4CBE A;  3L8J A;  1YAR O;  1OCR C;  2VC9 A;  3NRH A;  2GFH A;  3ZTZ A;  4AE4 A;  4BG0 A;  3QVY A;  4OIP F;  3DM5 A;  3K1I C;  1G5Z A;  1Z7Q c;  3U2M A;  1IW7 F;  1Q0F A;  3WG7 C;  4OIO F;  2Q00 A;  2HFI A;  3GM2 A;  4J7Y A;  2QLA A;  4YJW A;  2CNW A;  2YL3 A;  5L0I A;  3S9O A;  1QZX A;  4RDA A;  1O5H A;  2XLD A;  3GWL A;  2B0J A;  1TWA A;  1O3U A;  3IQC A;  1D0Y A;  2KW3 C;  4QI2 A;  1Z23 A;  3VRC A;  2LD6 A;  3HNI A;  5E2Q A;  3H65 A;  4EBJ A;  1CPQ A;  4IWB A;  3S90 A;  2TMV P;  3A9C A;  2OOC A;  2XXA A;  2WVN A;  5AGF A;  1MQV A;  4EBK A;  3T4R A;  1D0X A;  1JAF A;  3HKK A;  4O6M A;  4OD4 A;  3U9J A;  3V7O A;  2ZXO A;  4DJ9 A;  3QVZ A;  1YA9 A;  2NSG A;  2WZF A;  3A11 A;  3RFY A;  5BQH A;  1GGQ A;  1LIH A;  1R4T A;  4I3M A;  4AE4 B;  2H7B A;  3C8G D;  1RKE B;  4PFP A;  5DQZ A;  2LFD A;  1ZU4 A;  1A7D A;  2EPK X;  1HE1 A;  2QTV A;  4U9E A;  256B A;  4EIY A;  3C62 A;  5B3I A;  5A6A A;  1Q0G A;  2VCA A;  3M4B A;  1OCC C;  2L9J A;  1TWG A;  2V26 A;  3ATP A;  3LS0 A;  4K1O A;  4M63 A;  3T6G B;  3UR3 C;  5DLJ A;  4EWC A;  3RQE A;  4YL1 A;  4U9D A; 
#chains in the Genus database with same CATH homology
 2CW0 F;  4B6I A;  2XL4 A;  3CQZ A;  1LVK A;  2ZXR A;  4K0D A;  2QY9 A;  2WB7 A;  3PMR A;  4ZLC A;  1ZHT A;  3DJN B;  2ZPA A;  4CSA C;  2DYS C;  3ZVR A;  3AQC A;  4XWJ A;  2A6H F;  3DAF A;  2CNW D;  2NUP B;  3NYJ A;  3Q7G A;  2CGE A;  3M1C B;  3K33 A;  2Q9A A;  2XRH A;  2G3K A;  4PJL A;  1ZHW A;  1TR2 A;  1ST6 A;  3EGD B;  1VYI A;  3ASO C;  3EGX A;  2R7V A;  3K6B A;  1ZYR F;  5B3S C;  2DYR C;  2Y69 C;  3DAG A;  1M2V B;  2C03 A;  4BJ6 A;  1RJ9 A;  3AG1 C;  4I1O B;  2O9X A;  1BR4 A;  1N1C A;  4KBL A;  3S0X A;  5KYX A;  3JCU Q;  2PX0 A;  3TD7 A;  2OG2 A;  5D92 A;  4YT2 A;  3RKO F;  4OD5 A;  1OKK D;  3S29 A;  3KH2 A;  2E87 A;  4C7O A;  3EH2 A;  1SZI A;  2XXA B;  3O6X A;  1S7Z A;  3NKD A;  4G0H A;  2H7V C;  1Z3I X;  1V55 C;  2IYL D;  3EH1 A;  4PJJ A;  1PD0 A;  3FHD A;  1RJ9 B;  2H7O A;  2R7O A;  2CDQ A;  2NUT B;  3B9Q A;  3FDQ A;  4JJG A;  3SEO A;  3DMD A;  3GOD A;  4G7O F;  3ABL C;  4BJ5 C;  4FX5 A;  1Z6A A;  3UMI A;  4CSA A;  5L3Q A;  2FFH A;  4N06 A;  5KYY B;  5DS5 A;  4A2N B;  4U5C E;  1VMA A;  4YT8 A;  4E7Z A;  3W8I A;  2NUP A;  4W8K A;  4H4K C;  4MQ9 F;  3FAJ A;  1G8X A;  3ZG1 A;  2Z15 A;  2Y3H A;  4JW1 A;  4YT4 A;  3ZSU A;  2IXM A;  4U5D E;  4C3E A;  1TWH A;  1NZE A;  3UGO A;  3EHN A;  1FMV A;  2EIM C;  5E33 A;  1FTS A;  1D0Z A;  4CS9 A;  4BJT A;  4Q4Z F;  2HV7 A;  4KNV A;  2J7P D;  4KNW A;  2Q9B A;  3ABM C;  3ZC4 A;  3N2Z B;  4Q5S F;  4U5E E;  3N0T A;  4O6Y A;  1MMN A;  3FVY A;  5BUO A;  3DJU B;  2YZS A;  3I5P A;  1OCO C;  1OKK A;  3OWT A;  3DM9 B;  1M57 C;  2M4E A;  2G62 A;  4XLP F;  3HJC A;  2PFD A;  4BJ5 A;  1J8Y F;  1FMW A;  4X0R A;  2EIL C;  2EIN C;  4CS8 A;  3W8H A;  5L3V A;  2W4B A;  4U5F E;  3LLI A;  4LAC B;  2R7T A;  2NUT A;  2R7W A;  4JJF A;  1VYK A;  3NDB B;  3W2W A;  3EGX B;  4HEA J;  4OIR F;  2R7Q A;  3VAY A;  2W4M A;  3AG2 C;  3SZR A;  3UNG C;  2WL8 A;  4IJJ A;  2YEV A;  2PF4 E;  2MWQ A;  1BR1 A;  4JVS A;  1PCX A;  4MND A;  4RBN A;  2J45 A;  2P7V A;  5KYX B;  3B0V C;  1Z63 A;  3S28 A;  5CI9 A;  4HFF B;  3B0P A;  5CI8 A;  4PJM A;  1MMA A;  5KYN A;  4NY3 A;  5B1A C;  2PX3 A;  4HE8 D;  1MMG A;  3EFO B;  3Q6N A;  3KL4 A;  3KMI A;  3OEO A;  1LKX A;  2WVO A;  1SMY F;  4KI2 A;  3IEE A;  2FGY A;  3EZH A;  1VOM A;  3AG3 C;  3DXJ F;  4OIQ F;  4BJ6 C;  4DBR A;  4DVZ A;  4GYT A;  2Y39 A;  2R7U A;  5KYU B;  2A6E F;  3I5Q A;  2J9U A;  4DVY P;  2KGO A;  4I44 A;  2J7P A;  4J30 B;  4PK4 A;  4G7H F;  1NG1 A;  1QLE C;  3EJN A;  2A69 F;  4CS7 A;  1JPJ A;  5E3A A;  3UMK A;  1M2V A;  1WGW A;  4U5G A;  3ABK C;  1D1A A;  1SF8 A;  4PFO A;  3LLK A;  2C04 A;  2VH3 A;  3F46 A;  4ULW A;  4DBQ A;  2YHS A;  3UMH A;  3HTK C;  4QDL A;  3HLZ A;  3MLG A;  3SP1 A;  1BR2 A;  2WZL A;  4KC9 A;  4CIH A;  1ZHX A;  2WVQ A;  5EHH A;  4AX2 A;  1KU2 A;  4U5B E;  2J9W A;  2PP4 A;  5KYU A;  3EPV A;  5KYW B;  3ASN C;  4OIN F;  2A68 F;  3QMK A;  3ECS A;  4JCH A;  3DD7 A;  4EBB A;  1LS1 A;  3POV A;  3NYM A;  3EG9 A;  3UGP A;  1FFT C;  5F5F A;  2JD3 A;  4IAO A;  1VK5 A;  1NU9 C;  2BE5 F;  3LES A;  2D5R B;  2J0X A;  3KKB A;  3RIP A;  1FFH A;  4Q7C A;  1Z5Z A;  3K1H A;  4G7Z F;  1W2W A;  3LJB A;  3EGD A;  1O87 A;  5KYW A;  2IOQ A;  5T3T A;  2EIJ C;  5F5H A;  5KYY A;  4E7S A;  2IXO A;  1V54 C;  2EIK C;  5FCL A;  3LEV A;  2Y3B A;  3LAY A;  3EG9 B;  5DQT A;  4ANJ A;  4ZLD A;  3EHM A;  4QI0 A;  4CS8 C;  4J32 B;  1PD1 A;  4JZA A;  4LLE A;  2W9Y A;  4CS9 C;  3JSZ A;  4WJ0 A;  2XSE A;  4FWV A;  1D1B A;  4LLC A;  4I1M A;  5DVW A;  5T3W A;  2VAS A;  5EGY A;  2P6V A;  2Q9C A;  3RH3 A;  2R7S A;  3EFO A;  3N24 A;  3Q7L A;  2IXN A;  1TWC A;  2WZG A;  2KJG A;  4F4B A;  4DOZ A;  4XTK A;  4FES A;  3NKE A;  3X1O A;  3NYL A;  4YWQ A;  3AG4 C;  3NG1 A;  1OCZ C;  1MNE A;  2V3C C;  3ITF A;  1IZM A;  4YT5 A;  1MMD A;  4O79 A;  1MND A;  4HFK B;  3CZ6 A;  2W45 A;  3EZI A;  4C7O B;  2HV6 A;  3ZIB A;  4YN0 B;  3B0U X;  5DS4 A;  3F47 A;  1M56 C;  4GEH A;  3DZA A;  2J0W A;  4BJ1 A;  3X2Q C;  4BEJ A;  1ZHZ A;  2R7R A;  4O6N A;  2NG1 A;  3MX3 A;  2KQ9 A;  3JRT A;  3L0I A;  2DGJ A;  4AK9 A;  3E9V A;  5D91 A;  3VYW A;  2J9V A;  4C3D A;  4RD9 A;  2A1D D;  1JPN A;  3Q6M A;  2Y3D A;  2VB6 A;  3GAN A;  3CSK A;  3K7D A;  3E70 C;  3S27 A;  2J46 A;  3O39 A;  5E3C A;  1TKN A;  2Q3T A;  2ZXP A;  3JT1 A;  2KNH A;  2MYS A;  2IXP A;  4LER A;  2LSE A;  4C3B A;  3WOD F;  3PHF 2;  2OCC C;  1ZU5 A;  3SYN A;  3JYH A;  1ZHY A;  3W2V A;  4K7B A;  3OA1 A;  2R7X A;  4XLN F;  3T6J A;  3LNR A;  3K66 A;  3I4U A;  2ZXW C;  1J8M F;  4PJN A;  2I8B A;  3RYL A;  3T6B A;  5DS6 A;  1D1C A;  3QZC A;  1M2O A;  2G3V A;  4JUR I;  2Y3G A;  3SNH A;  5IY5 C;  3L34 A;  1NU7 D;  2L81 A;  5T1D B;  5B1B C;  3LS1 A;  3AQB A;  3EQL F;  4O7G A;  2X51 A;  4P6I C;  4U5H A;  4IRU A;  4CBE A;  1OCR C;  4BG0 A;  3NRH A;  2GFH A;  4AE4 A;  4OIP F;  3DM5 A;  3K1I C;  1IW7 F;  3WG7 C;  4OIO F;  4YJW A;  2CNW A;  1QZX A;  4RDA A;  1O5H A;  2B0J A;  1TWA A;  1D0Y A;  2KW3 C;  4QI2 A;  1Z23 A;  5E2Q A;  3H65 A;  4IWB A;  2XXA A;  2WVN A;  3T4R A;  1D0X A;  4O6M A;  4OD4 A;  3V7O A;  5HSW A;  2ZXO A;  2WZF A;  3RFY A;  4I3M A;  4AE4 B;  2H7B A;  4PFP A;  5DQZ A;  1ZU4 A;  2QTV A;  1OCC C;  2L9J A;  1TWG A;  2V26 A;  3LS0 A;  4M63 A;  4EWC A;  5DLJ A;  3UR3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...