4YT5A

Hmdii from methanocaldococcus jannaschii with bound methylene-tetrahydromethanopterin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
344
Chain Sequence
b'DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 111
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt5A01
2H1SA 4NDNE 1LDNA 2FMUA 3CMMA 3H6KA 5DBFA 4RO0A 3JQ8A 1BRMA 5BQFA 3KYCA 1KEUA 3PHGA 4LRTB 2Y68A 3GGOA 3U4DA 4NU6A 3COSA 1CIVA 5F5NA 3GRKA 1DAOA 2Y1DA 4CV1A 4Z0PA 1FF9A 2WE7A 1V6AA 2WDZA 3N7UA 4EJ6A 5A4DA 1NNUA 4J2OA 4JBHA 2YZ7A 4CLRB 4IMRA 3IAHA 2X5OA 2VHYA 4UUNA 4CM7A 4U0JA 5A9SA 1ZCJA 2AEFA 5KWEA 1U28A 4UVEA 1KERA 1EDZA 1Q7GA 3EZYA 4YJFB 2A94A 4XJSA 2W2KA 5JDCC 3DHNA 3ASVA 4CL3A 1C0PA 3RUEA 2VT2A 2VWPA 3AUSA 2JCXA 3OEWA 5T6BA 4YB8A 5L7TA 5H81A 2CF5A 2AMFA 4IS2A 1IYZA 3QHAA 3UUWA 4H16A 4CMJA 4YAIA 2V6FA 1NFQA 1IZ9A 4XGIA 4QSMA 2ZATA 1NAIA 2EERA 2JKVA 3NAQA 4HNHA 1RJWA 2EKQA 4HNGA 3WWYA 4BNNA 3CE6A 3AFMA 3GEGA 3ETGA 3DOJA 4CM5A 5JW6A 5U4QA 5CEJA 3DOOA 3RKUA 4LW8A 1FDSA 1PSDA 5CEFA 4MKXA 4NJOA 4JJFA 1DC6A 3QSGA 1XEAA 4HP8A 2AQIA 1GCOA 1E6UA 3INRA 4ALJA 3PFFA 5GY7A 4BNVA 1A7AA 4LISA 2O3SA 4R9SA 4GLOA 3PJFA 2RH4A 4RORA 5JO0A 2P4HX 3QVWA 3CPSA 5K6AC 4F6CA 4YT4A 1GYPA 3L4BA 3VZQA 4IJWA 5ADHA 4IDAA 3HFSA 1N2SA 5TJHA 4CMIB 4XR9A 6LDHA 2B5VA 2JAHA 3PZRA 5H82A 3RVDA 4E32A 2YDYA 3UH1A 4EYEA 3W4IA 2YDXA 1QLHA 3ZN2A 3E8XA 5JMWA 4WGGA 1NFRA 2VRCA 2CDCA 4Q3BA 5JAMA 1DJNA 1NFFA 1B8PA 3NT2A 5EN4A 5TJ9A 4MOWA 2YFHA 2QZ9A 4BNYA 2VRCD 3PVZA 3X2FA 2BFMA 5KTKA 2O48X 1NBOA 1UP4A 1GU7A 3AI3A 3GPDG 3JSAA 1K5HA 5DBIA 3KOUA 2XOXA 3WGTA 1FDUA 1UXKA 1A4UA 1ULSA 2PD6A 1K6IA 1JVBA 4O6VA 4N5NA 1C0LA 2VHZA 4UEKA 2CMDA 1E7SA 4B4UA 4DMMA 5JCXA 1XSEA 3H7AA 4G5HA 1I3KA 3MJ4A 4PG7A 2W4QA 4J7XA 5DOZA 1NAHA 4MVJI 1Z75A 5JAIA 3C1AA 3MTJA 3H9UA 3JYNA 5AVOA 3DC2A 2A92A 4E21A 1GADO 2R6JA 3NDIA 1ZSVA 3GVPA 4P4NA 3UVEA 4NIMA 3TOXA 4W99A 1QYXA 2H6EA 3DBLB 5GZ1A 4YJDA 1HSZA 4PZDA 2PWZA 4GQAA 3QVSA 4BIIA 4M86A 3ZWVA 4RPHA 5L3ZA 1R0SA 5THQA 3AUAA 3UCEA 4TRNA 2IZZA 1PGPA 4OOFA 1ULUA 4YR9A 1XKQA 4YTEA 1AHIA 1RKXA 4S1VA 3BIOA 1WDKA 2NM0A 2NU8A 2B37A 4K9DA 3GVHA 3WTCA 4EDFA 1H9BA 3GEDA 3RASA 1DIBA 1E7WA 2O7QA 4NBWA 1H6CA 3O38A 2FPGA 8ADHA 1IY8A 3AOEC 5TQVA 3FR8A 3RU9A 4R3NA 2Q1WA 4JX8A 1NQ5A 2QG4A 1VM6A 2XXJA 5BNTA 3AY6A 2QYTA 3G79A 5EINA 4XDYA 1LRJA 4NHEA 2VYVA 5IZCA 1AN9A 4OAQA 4IGEA 1JVSA 3RROA 4K1LA 5C37A 4O1MA 1B8VA 4AVYA 1K3TA 2VYVD 3HDHA 3K31A 5KJCA 1P1IA 2DBZA 3H8VA 3JQDA 4R01A 1OOEA 2HKIA 3JQ9A 3RUFA 1ZK3A 4MVJG 4L4XA 1HRDA 1OI7A 3QE3A 2GDZA 4Q9NA 4P8RA 4BHTA 5T64A 4GMFA 1ZK2A 3WG9A 3WGYA 3C1TA 3DXFA 3FF4A 1TT5B 4GSKA 2NVBA 3BTSA 3K5PA 4K28A 4XYBA 2NTJA 1ISIA 2D5AA 3C8MA 2ZYDA 1Z82A 3HUDA 2OXIA 1YOVA 4KWIA 2YV3A 2A9FA 3DMTC 5G2OA 4FN4A 1E1NA 2PD3A 1HEUA 2EGHA 4Y8VA 5JDIA 2I67A 3BTUA 3AW9A 3R3SA 4UREA 3VH1A 5T5QA 2FY8A 1QLJA 1YQDA 2NWQA 3Q2KA 4H7PA 1MG0A 5KJ1A 4JK3A 1Y81A 4YEDA 3VH4A 3WGHA 5I7EA 4XQEA 3QWBA 1SEVA 1HDOA 1X14A 5IAAA 2EW8A 1I32A 3JQ7A 2CSUA 3PFWO 2CD9A 4I5EA 1VLLA 3G1UA 4OHUA 1N9GA 4BO8A 3VZPA 1T4BA 5EESA 3W6ZA 1KYQA 3MJEA 1B2LA 1HWYA 1M6HA 2D0IA 4OQYA 3GN2A 2DU8A 2C2YA 4TQGA 2Q46A 4A5OA 1UAYA 1R6DA 2G82A 2OHXA 5L9AA 2J3KA 3HNPA 1U2DA 2PKQP 3ONDA 3I9MA 1D3AA 2X4GA 3HQ4O 5IG2A 4TROA 4IZIA 1GEEA 5TIIA 1JAXA 2JL1A 4CQLA 2ZCUA 2NQ8A 2Q4BA 4CV2A 3EAGA 5JBIA 4CODB 3CZRA 4CR6A 3F5QA 3PJEA 1DIRA 3FWZA 2C7GA 4ESOA 4HWKA 2ZIZA 3ZNOA 3GDGA 3BMQA 1NR1A 2P5YA 3MEQA 5BSFA 3I9NA 5G0TA 4XYMA 3F4BA 2YV1A 2O4UX 3OJLA 2DFVA 2RIRA 2HMTA 3KYBA 3SXPA 1UZNA 2BHLA 3NYWA 2I76A 3FNGA 3WTBA 1N1GA 1CJCA 1XYGA 2HCTA 1H93A 3B1KA 3QP9A 3U4HA 5B4UA 2OFPA 4AJ2A 2GZ1A 3AWDA 5C3MA 1U8FO 2OBNA 2VWQA 3PK0A 3WX0A 4GGOA 2E4AA 1VKNA 3ONFA 3WYEA 3TJRA 2Y0DA 3GC6A 3TN7A 4D43A 2Y93A 4D3DA 3G49A 4LRSB 1P1FA 4BNXA 1MGOA 2BGMA 3GVCA 1XLTA 4NFHA 5COBA 5I9MA 5L7WA 1D8AA 5U9CA 4K6FA 1X13A 3IP3A 2EG9A 4E0BA 3DZBA 2CVOA 3I9OA 1KOLA 3GA0A 5A3JA 1R15A 3HJAA 1RWBA 2Q1UA 2AE1A 4NBVA 4RZIA 3LLSA 2AHRA 3JQFA 3U3XA 3ITDA 2O3RA 1LSOA 3EHEA 4RZHA 1VJ0A 1QYCA 3NEPX 1Q0LA 1SOVA 2GPTA 4FGSA 2HMVA 5BNIA 1HL3A 3L77A 5ILGA 4F46A 4OJNA 4DIBA 3GFBA 2FWMX 3LYLA 4W7HA 1GTMA 1P9LA 4CM8B 2Z1NA 3A9WA 1DC3A 2VYNA 4GBJA 4RDIA 3GDFA 3RBVA 3K9QO 5TGDA 1F06A 4WNCA 2J6IA 3OEYA 5ICSA 2G1UA 2VYND 2YFQA 3ONEA 1WPQA 1CEQA 4EUEA 2WEKA 1RM5A 2XF8A 4XQGA 4YJGA 2PH3A 4BOYA 1U1IA 4FFPA 3D4NA 5IN4A 3I83A 3ZV5A 2EJWA 3LVFO 4EJMA 3GVIA 3Q0EA 4R16A 3CSDA 4DRYA 4KWHA 1OFGA 4PLVA 4AJOA 3JD3A 4NMHA 4WLUA 3UAGA 1A7KA 4OQZA 5DN9A 3I9LA 3JQAB 4BNUA 4J49A 4KZPA 1YJQA 3WJ7A 3JQBC 1S7CA 4JN6B 3NUGA 3LT4A 4DMLA 3VAZA 4XWYA 5DF1A 2Q99A 4XIYA 5BSEA 1Y9EA 4RV9A 5A5EA 4RQTA 3QQPA 1YL7A 3UF0A 4CLOA 8LDHA 1LC3A 4XDZA 1ID1A 2H9IA 4UULA 1JKJA 1I3NA 4PLFA 5JFOA 1CRWG 2B69A 3ZWXA 4RL6A 1P74A 3DFUA 4BO0A 1WAMA 4DREA 2X9NA 4A03A 4RJTA 4UAGA 4P38A 4E5KA 2NU6A 3CEAA 4N54A 1KC1A 5DNAA 5A06A 3E03A 3ETDA 2XAAA 4FJ2A 2V7PA 4RPJA 2UUPA 4BQRA 3E5MA 2PZJA 2C7VA 2IRWA 1CYDA 5A1TA 5B12A 2D59A 4ILKA 2GLXA 2OMEA 1HE2A 3OMLA 3NV9A 1E1KA 1HE3A 1E77A 5ITVA 4CMGA 4N18A 3FNFA 1EVIA 4BNMA 2R00C 3OSUA 2D2IA 2X0IA 4WPGA 3I6QA 2NTVA 5B37A 3OECA 3GG2A 2GYYA 3AU8A 3ITKA 1DDOA 3NKLA 1Z45A 4MVJE 3L9XA 1LRKA 2EV9A 1R0LA 4DLLA 1D4FA 5KOIA 4QO8A 2NVUB 3RD5A 1DLJA 2JAPA 1YQGA 3ZNNA 5L7YA 2W2LA 2P9EA 3MJCA 4Z9FA 4R68A 2HJRA 3AU9A 4DIOA 1Y1PA 1YL6A 3QWIA 2W2LD 4IGFA 5BSGA 4RF3A 2B36A 3HHPA 3Q3CA 3EK2A 1YVEI 3PJGA 3CKYA 4JP2A 2BGLA 3QV1A 3HFGA 1A27A 4PRLA 5GMOA 1PR3A 2BF7A 1PJQA 4R3WA 3FCOA 3ROQA 3RFXA 4R1NA 1CERA 2I3AA 3GK3A 1VC2A 1ZZEA 2ZTVA 3QWFA 4KTVE 1NP3A 4ALMA 4CMEC 2X22A 1PS8A 1R4MA 4M1QA 1LU9A 2PTGA 4CLXA 4J0FA 2E6UX 4NJMA 4J7UA 4Q3NA 4CM4A 4B4VA 3R1IA 3HDQA 4HXYA 4HX5A 3EGOA 2VHVA 1HDZA 2X8LA 2PZMA 3I9JA 4FBGA 4QEDA 1YJ8A 4E33A 1M6WA 4CL8A 5G0SA 1YXMA 3RKRA 4DQXA 5IDXA 2VTDA 4DA9A 3H3FA 4IDGA 3IKTA 1SC6A 1EK5A 3WSVA 1HXHA 1TVEA 1UXGA 4BMNA 4Q3AA 2JFGA 3DTYA 5TSDA 4DPLA 1DFIA 2J5RA 2UVDA 1N5DA 1EEHA 5DZSA 1I3MA 4ND4A 3W6UA 1DPGA 3KBOA 3RBZA 2E37A 2CZCA 3UKOA 3PXXA 2NU9A 3FN4A 1QR6A 3AM3A 4EBFA 4GVXA 3ZV3A 4E6PA 1AE1A 2YW9A 1C0IA 1K89A 2FR0A 1R37A 4GGPA 3G3EA 1X7DA 1KY5A 2D1YA 4NPCA 4CLRA 4MVJF 1LTHR 4BKRA 1KVRA 1MV8A 4IJVA 1GUFA 3DL2A 4JGBA 2YJZA 1DLIA 2I5PO 5IDYA 2DPGA 1M67A 1UXIA 4YJFA 1XGKA 3BTOA 5A05A 4FFLA 4E5YA 3K96A 2JFFA 5G4LA 3VC7A 2Y66A 5F1PA 5CDYA 3AM4A 2VUTA 4FR5A 3UGKA 4PG5A 4ZVVA 3DZKA 1LLQA 4CM3A 1F8FA 3BHMA 4GKBA 1LQTA 2I99A 2C82A 2VOEA 3BMOB 1ZSNA 2EKPA 4PLZA 4ZJUA 1QV6A 3H5NA 1H2HA 1KC3A 3E5RA 1FMCA 2P2SA 5I7SA 3RC1A 3N74A 5DOVA 4A27A 3RFVA 4B7CA 1XELA 1Y5MA 2HMWA 2GERA 2Z95A 1NVMB 3HADA 5IXYA 1NWCA 2C0CA 5J23A 1U7HA 2PNFA 3TRIA 1V3VA 1T1RA 1OMOA 4IBOA 2BRUA 3NGXA 1NHWA 4OSOA 4TKMA 3H9GA 3QY9A 1JKIA 5DDIP 4Z9YA 3DBRB 4AJNA 2I9PA 1YL5A 3ZH2A 1EQUA 1SZJG 5I7FA 2Q4EA 3MZ0A 3D3EA 1XQ6A 2PR2A 4GKVA 4UVGA 4CLHA 1NXQA 4F3YA 3GAZA 3UICA 1C1XB 4QXMA 1LSSA 1HDXA 1HYGA 2VCYA 3VH3A 1LEHA 5IN5A 4BKOA 1L7EA 4IDFA 4CMKA 5F3RA 4QECA 4CMIA 3L4BC 2X7HA 5AXCA 2FP4A 3QA9A 1DXYA 1C3VA 4PG6A 4IQ8A 2HQ1A 1GAEO 3FNHA 4MVJA 4XB1A 3TZQA 3L4SO 3O9ZA 2VUSA 4LCJA 1UDBA 3KTDA 1MX3A 2B35A 1O6ZA 1EBFA 3ROKA 3FI9A 4YYZA 4MVJD 2P9CA 3ZV4A 3PLRA 1H2BA 2IODA 3LU1A 4J1QA 3WQQA 3SC6A 4YRDA 2FSVA 1TEHA 4IZHA 1PZFA 1ZJZA 1HZJA 1MLDA 3NDJA 3PPIA 5EL0A 4QQRA 4HFMA 3ZI0A 4YAJA 2AXQA 4LCEA 1ZK1A 2V6MA 4AG3A 1ZSYA 4KQWA 4FC7A 4W9NA 1P3DA 5DBGA 4ND3A 2FSSA 2FHSA 2PK3A 5AYVA 1YB5A 2Q1SA 2X6TA 4CV3A 4IDDA 1IB6A 3OJOA 1OAAA 4ALKA 4GL4A 3KLMX 4I08A 5DULA 4IDBA 4KTTE 1Q0HA 2DUUA 1DAPA 1B3BA 1PL6A 5JLAA 3A14A 1T1SA 3WB9A 5CPBA 5GZ6A 4DPKA 4JJGA 1WXDA 3GVXA 2IEBA 3H2ZA 3DBLA 2D8AA 1M66A 1UJMA 3WFIA 3TFQA 2IYOA 2NACA 3TOZA 1JQBA 3RU7A 2Y1GA 3DAPA 3GNTA 1I2ZA 2AEMA 1HDCA 4DQUA 1YQXA 4YA6A 1N8KA 2AG5A 1LJ8A 4TRMA 1YB1A 4IMPA 4HADA 4XD2A 1IPEA 2NV6A 1IZ0A 1HKUA 3PP8A 2GN6A 1WWKA 3TSCA 5TLSA 1W73A 4DYVA 2VRBA 3JQGB 3DBVO 1S6YA 4NU5A 4XRGA 1EUCA 3VPSA 3V2HA 2AQKA 4PG8A 2HMUA 3WFJA 4WEQA 3KEQA 4EITA 4M49A 4CQMB 3HN7A 4EI2A 4E13A 1Q7BA 4BO9A 4Y67A 2RHRA 3DTTA 1UR5A 4C7KA 1HZZA 2BFOA 4F6LA 5C7IO 4CMHA 3RBXA 1T2FA 1JAYA 3GOHA 1YONA 2DBVO 3GNSA 5JY6A 4J1TA 2HUNA 3TZ6A 4Z6KA 3KXDA 1ONPA 5IZCC 2X58A 1QP8A 2I66A 5A02A 4DL9A 1W4ZA 3PYLA 3S2FA 2ZYAA 3G17A 2GASA 3DMYA 1OBFO 1XDWA 2ZTLA 2OL4A 3FD8A 1HDGO 2O2SA 4Y98A 5FYDA 4GX2A 4MIYA 1TT5A 3GMSA 1QMGA 3W4JA 4QUKA 5ITWA 1GUYA 5EPOA 3HN2A 4P4GA 1RM3A 3DBHB 1YO6A 2PA3A 3UXYA 3AI2A 1SNYA 1E5QA 3BMNB 1H5QA 5CG1A 4A2CA 4E5PA 2B0JA 4DXHA 1X0VA 4UUOA 4BB6A 1HLPA 3C7DB 3Q11A 1XQ1A 4EGFA 1LBEA 3ZHBA 3GZNB 5JDIC 1YS4A 4G2NA 1NPDA 2HRBA 2WJPA 5JYEA 5BT9A 2I6TA 1KVSA 1E7MA 2DAPA 3PGJA 4WEOA 3WGZA 4WCFB 4A26A 4AFNA 3TF5A 2SCUA 1UDAA 5I8ZA 4IM7A 4NH4A 3I6IA 3D1LA 2ZCVA 1CDOA 1MP0A 5BR7A 1O94A 3F3SA 2CUKA 4P4LA 3TPCA 5COAA 2LDBA 1FJHA 2Y0EA 3D5QA 1EVZA 4ID9A 3KSUA 1KEPA 1ZMOA 1UZMA 4WKGA 3VPXA 1LC0A 2ZB4A 4ZRNA 1H6AA 4RPGA 4CMCA 2EGGA 5TT0A 4L4SA 3WQRA 1RM0A 5JPIA 1SO8A 1VJ1A 3KB6A 3QJ5A 3TL3A 4UUMA 2TMGA 4CV0A 4INAA 3AY7A 3K73O 3ZZNA 3AI1A 1HSOA 2E48A 4PZEA 4CLDA 3BTVA 4UVDA 1R4NB 2UDPA 5K6AA 1AXGA 3NX4A 3OA2A 2GZ3A 2RHCA 4R5MA 1LXCA 1PZHA 5IFLA 4DUPA 1SEPA 4OIMA 4YCAA 4YT8A 1G6KA 4L74A 2FRDA 1I33A 3ZWWA 4BGUA 1GQ2A 2I65A 4BQPA 5HRUA 3RUHA 1F8GA 5L45A 4D46A 3B70A 2HDHA 4TVOA 2IEDA 4BMSA 3H65A 1X1EA 2O4CA 5TS3A 2G17A 1ZEMA 1XA0A 4XCVA 2DM6A 3MTGA 4OL9A 4JNKA 1YBVA 2DLDA 3EVNA 3W1VA 5JYDA 2PV7A 5T57A 3EZLA 1T2CA 3WLEA 4J9VA 4XYLA 2VT3A 4FFNA 5KKAA 4A73A 2O23A 4KMSA 3F9IA 3KETA 4LN1A 5B4VA 1Z74A 4GVLA 3AY3A 4RDHA 1U5CA 5CAEA 1M2WA 3OQ6A 2X23A 1I10A 4R1UA 4YJHB 3RWBA 4AJEA 2Y1FA 4BO2A 1GZ6A 3FTPA 4AJHA 1YBMA 2OUIA 5U1PA 2X0JA 3GFGA 5KVQA 3ZGYA 3VVCA 3L9WA 3WYCA 1JDJA 1E7YA 4QO7A 3GHYA 4WECA 1CQJA 1N7GA 4YXFA 5I8WA 4R1TA 3GG9A 3PWSA 4J43A 4QFDA 1PJLA 5L95A 1ZEJA 3JYPA 3N58A 4QT0A 1HE4A 1VSVA 4DLAA 1ZJYA 3ETEA 3E6AA 3PI7A 4OKIA 1ENOA 1JN0A 1I2CA 3B6ZA 3JQFC 3BZUA 1GZ4A 2NU7A 5EIOA 3RCBA 3PQDA 3WMXA 5KVCA 1U4OA 3KM0A 2OP1A 4B7UA 1I24A 1Y7TA 2D3TA 5L4SA 3MJSA 4JQCA 4C7JA 3DWFA 3NTOA 1ZVMA 4RF4A 4CM8A 5HM8A 4PLYA 1WZIA 2NTNA 3HG7A 3GPIA 1H6BA 1WVGA 4DBVO 4E31A 1QSGA 2DBRA 4OH1A 2G76A 4F45A 3V2GA 2PY6A 3E1KA 1U3UA 1E6EA 2QIOA 4NBTA 1J0XO 4OXYA 4ZN6A 3E18A 4II3A 3S2GA 3PJDA 5B1YA 3IP1A 5L40A 2CDBA 3ANNA 3M2TA 4BNLA 1XHLA 3U09A 3GRPA 7MDHA 2PD4A 3MWEB 1ADFA 4YRAA 4OGWA 1IHXA 3WYBA 1ENPA 2CVZA 1B7GO 3D64A 1TT7A 4WUVA 4CJXA 3BYZA 4PLCA 3GN1A 4YQYA 5A03A 2IDZA 4QX6A 4TSKA 1PEDA 3JQAA 4EEZA 5CDUA 2QZZA 3E9MA 2JJYA 1ZKMA 4LGVA 3VOSA 3JQAD 5C5IA 3GAFA 4HFJA 5LDGA 4ALIA 2WYWA 3KRTA 3PDUA 4BNZA 1O9BA 3K2BA 5KIAA 4YWJA 4J1SA 1PJBA 1PL7A 3KYDB 2IE0A 1M75A 3I5MA 2OBYA 3ICPA 1BXZA 1ARZA 3JYLA 4EW6A 4OKNA 4M54A 2AA3A 1U3WA 2VOJA 2HLPA 3K92A 1LLDA 2PGLA 2BH9A 4N5MA 5CDTA 5CEEA 2VZ8A 4O63O 4JROA 1JKFA 4BNHA 5C7OO 2E49A 3KUXA 3EYWA 1W8DA 4XKJA 1I2BA 1XR3A 1CQIA 1N1EA 3RUDA 3ZWBA 2W8ZA 5HBRA 2P9GA 3RC9A 3ZNPA 2EW2A 4YAGA 3HZZA 4YT2A 3ROPA 5AXBA 4NQZA 3VVBA 2VHWA 3ON5A 4BVAA 1LX6A 2JFHA 4YBZA 4ZQHA 4DC1A 2O2YA 2PGDA 5FEUA 2JCVA 4GI2A 2O3QA 4E2YA 3L6OO 1ONOA 4E2WA 3ASUA 4ZU3A 1DBVO 1LSUA 1Z7EA 3PLNA 4IDEA 1EZ4A 3O8QB 3U62A 1EUZA 3AUTA 4FFMA 3ZDFA 1E7QA 3F1KA 3HB5X 4ROSA 2C20A 2NVUA 1C1DB 3WIDA 5JMPA 4B7XA 4URFA 1Y8QB 4XJTA 3OHSX 3NDRA 2VZ9A 1LUAA 2WM3A 3W8EA 2VQ3A 3LC1O 3LSYA 4G81A 3M1LA 4BO5A 4LSMA 1PJCA 3AFNA 3ZHYA 1QG6A 3FPLA 4BKPA 2WSBA 3PEFA 4MIEA 4E12A 1SOWA 4EJ0A 4L4RA 1PWZA 2J5KA 4WK6A 2IZ0A 3DZFA 1XWFA 2YQ4A 1E7RA 2B4TO 4IY1A 2RBEA 2QQ5A 2GNAA 3NTRA 2GO1A 1EQ2A 1HF3A 1JWBB 2Y99A 4LVUA 3V2UA 4BNGA 3LC7O 1YRLA 2X1HA 3D4PA 4XYGA 3WOHA 3X2EA 3ZNQA 5ICMA 1LA2A 4AJJA 4CM1A 2BI7A 2FOIA 4U0KA 1ZBQA 2ZYGA 5T8KA 4ZRMA 3T4EA 1O89A 1D1TA 2PKQO 5AXDA 1IUKA 1P44A 2D4AA 1SMKA 1YB4A 1PQPA 2CF6A 4L9RA 1GZ3A 4BNIA 4D45A 1ZIDA 2WMDA 5TRTA 5I9NA 4R4JA 1ZMTA 3TZKA 1H6DA 1NQTA 4WE3A 2Y1OA 1E1MA 4BB5A 2EJVA 1B0AA 3H2SA 3LDHA 4OSPA 4IS3A 2DBQA 4OYRA 5HWSA 3W8FA 3F5SA 3CUKA 4D44A 4XQ9A 1WNTA 1YWGO 1DO8A 1N7HA 3PYMA 5A9RA 1PX0A 3H3JA 1Y5RA 4WLNA 1E5LA 4MP8A 2DPHA 4CLEA 4RQUA 5ILOA 4OMUA 3OETA 5TX7A 3GF4A 4XGKA 1L1FA 4S3MA 1GY8A 1K6JA 1HYHA 1AXEA 2EIHA 4PVDA 2EP5A 1RYDA 1SAYA 1DRVA 4XEHA 1GQYA 3VTZA 3QWAA 1YBAA 3GMDA 3IJRA 3ZW9A 1W0CA 5IF3A 1MXFA 2B4RO 4JP3A 2JHGA 1FXSA 1JU9A 4WLFA 3QWHA 4M8SA 1EVYA 4PG4A 5ENDA 1R66A 1W6UA 4L75A 1CF2O 4TRRA 1EDOA 4NBUA 2HO5A 1ZUD1 1N92A 2WD7B 3B1FA 3ROMA 4AICA 3E82A 5CP8A 1I01A 2NQTA 2FN7A 3LT1A 2GCGA 3WQSB 2NLOA 4OXNA 2PGJA 3L6DA 4ALLA 4BNFA 4ALNA 5IJZA 4H3VA 1Z6ZA 5T67A 5LDHA 3JD1A 4M55A 3JV7A 4LSWA 2YUTA 4D7AA 4E5MA 1B15A 3MJVA 4Z3KA 1XU7A 2IYPA 1FDWA 4FOSA 5KJEA 4ZQEA 3WR5A 4CUJA 1YKFA 1ZXLA 3BMOA 1XCBA 3OJEA 4FIZA 1ZH8A 4R51A 4ZQGA 2QW8A 3I9KA 3ZWCA 4CR7A 1PJTA 2HK9A 5KKCA 3CIFA 2A35A 5F5LA 2Y67A 3H9QA 4MO2A 1U8XX 1UZLA 4D42A 3C3XA 4DTIA 3QRWA 4CR8A 4MINA 1X7GA 3VPFA 1DRWA 1A72A 1GDHA 4CMBA 1PZGA 4R9RA 4KDFA 3PQFA 3DBRA 2DC1A 4BS9A 1NHGA 4HFRA 3L6EA 2BD0A 1PGNA 4CUKA 5CPFA 1NASA 3DZHA 2FPPA 4ZA2A 4KUHA 4IIVA 1C1XA 5HA5A 1GQQA 3BHJA 3PZBA 4BO1A 3C7AA 3IIEA 4IJKA 5L4LA 4QFCA 4J4TA 3O03A 2X9GA 4L8VA 3JQEA 1G0NA 2ZK7A 1U7TA 5JAZA 3HB4X 2EHDA 1BXGB 3TWOA 5KJ6A 2EKLA 4Y6SA 4EZBA 2YY7A 4ND2A 1IOLA 4KP7A 3ULKA 1X1TA 1A5ZA 3WNVA 1ISHA 3NT5A 1ENZA 3OBBA 2CDAA 1PGOA 4J4BA 3RJ9A 1PIWA 4FB5A 1ISGA 1HDRA 1KBZA 1ONNA 3U4CA 2WD8A 3ZHXA 5BSHA 3JD0A 3GNQA 3DAGA 1EE2A 1EVJA 4ND1A 3IJPA 1A71A 2ET6A 3T7CA 3R3JA 2B83A 3VH2A 2X0RA 4IIUA 4UUPA 1TXGA 3CTMA 3LLVA 3HWRA 1P45A 1G1AA 4EUHA 3OF2A 5ES3A 4FS3A 2V6BA 1HE5A 3E9QA 2POQX 4GH5A 4W9NC 5EMHA 2RAFA 2OO5A 5DP2A 2Y1CA 3GZ4A 4U6QA 1I36A 1B26A 1VI2A 1R12A 2HU2A 4IDCA 4ZGWA 1MC5A 1MFPA 1YH3A 5JE8A 3OA0A 1ISFA 3KHUA 4XA8A 1P1HA 2H5LA 2Q1TA 1WDMA 1OC2A 3HDJA 1EUDA 1ZNQO 3R0IA 1O8CA 1V9LA 2YHIB 2AQ8A 2CFCA 2Y1EA 3AOGA 5F1KA 1B8UA 4TZTA 3SX2A 3ENKA 1WDLA 4BGVA 3LQFA 2O3TA 3F46A 1EK6A 4J0EA 1SBYA 3ANLA 3PQEA 4U5QA 3BXXA 5FI5A 1ORRA 2FR8A 3GT0A 3AJRA 3I52A 4RVDA 1E3JA 4CM6A 3OIDA 3OH8A 5TC4A 4E2XA 2RCYA 2PZLA 4DPMA 1PU2A 3RSHA 3T4XA 4TKLA 4GAEA 3TQHA 1MA0A 3ORFA 2X86A 1ISMA 4MVJH 5FF9A 5G0VA 3ZWAA 1BW9B 2J8ZA 3JQGA 4MPDA 1BVRA 1I5RA 3FWNA 4J4HA 2DTXA 5GZ3A 4II2A 4RVSA 3ZW8A 2J5QA 1M76A 1E3WB 3T7EA 4XRRA 4CQMA 2AW5A 4PLTA 4M87A 1JWAB 4U6SA 3EW7A 1GPJA 1PGQA 4CQMD 1E3IA 2DTEA 3HSKA 1D7OA 1T26A 3FSRA 1EBUA 4DYDA 2QX7A 3ENNA 3D3WB 3WDSA 3EMKA 4NK4A 1PGJA 1JA9A 2NNLD 4CPDA 3P7MA 1O95A 4PFJA 1IL0A 4B3IA 3PIIA 3I3OA 4L0QA 5CHEA 4MKZA 3NGLA 3S8MA 3M1AA 1WLYA 2DTDA 5KJFA 2AE2A 1NPTO 3WGIA 3Q2IA 3ZV6A 4DGSA 4YVFA 3ZU2A 4Y6PA 4FPXA 2C54A 3DBHA 4Q3CA 4WLVA 1GV0A 2BELA 1ENYA 2OP0A 3BMNA 2ZKLA 3UCFA 2G0TA 2P68A 1PJ3A 3BMCB 2J3JA 1GFSA 3ANMA 4JLWA 2ILTA 2GSDA 1QV7A 4WOKA 3BA1A 2OOSA 3ZU4A 4MVJP 5JS6A 4E5NA 4LMRA 1JLLA 3M2PA 3GZNA 2JD2A 4RCVA 7ADHA 1FDVA 3JCZA 1B16A 2PH5A 4NI5A 3VPGA 2X5KO 4R1SA 1U2GA 1FK8A 1YGYA 4RPKA 3U5TA 2ZB7A 2QYSA 4WCFA 3LF2A 4GX5A 1T2AA 4B3HA 4NFYA 3FPCA 5KCZA 1MFZA 3AM5A 4E2ZA 1Y8RB 2HRZA 4GWKA 4Z0TA 3QVTA 3V1YA 4Y9DA 1QYVA 5BNFA 2B4QA 5DP1A 1DJQA 4DWVA 4R5HA 1QKIA 1LDEA 3S2EA 1HETA 1JTVA 4BGEA 4FC6A 1C0KA 5TT1A 1WW8A 4I5GA 3JYQA 3SJUA 3JTMA 1DHTA 3QIVA 4BNWA 4D3SA 4HV4A 3FHLA 1PJ4A 3IDSA 1DIHA 3NT4A 4R54A 1C14A 1QRRA 1R4NA 1E92A 2Z5LA 5JC8A 1J6UA 4K26A 3TNLA 2IXBA 5G4KB 1NQAO 1Y6JA 4FQ8A 3AUUA 4DLBA 3JD2A 2Q2VA 4FD3A 4RPLA 3UN1A 5JCJA 1V35A 4AJ4A 3JQ9C 3JQ8B 4GX0A 4I5DA 1ZO8A 3DHYA 3KYCB 3DHEA 4BO6A 5I9LA 4Y6RA 3IUPA 4CM9A 5JCJD 1P31A 1YDEA 2VUUA 3VHRA 1NPYA 3QVOA 4M89A 2BGKA 3PHLA 5THKA 4CM9D 3IS3A 3O26A 4HFNA 4BUCA 4WCDA 4BL5A 1X15A 4XZ3A 2AG8A 2O7SA 5DCWA 3FBGA 3OICA 2GN9A 2JD1A 3PYXA 4CMAA 4FFOA 5A9SB 4AJ1A 3EDMA 1UDCA 4DQVA 1NTOA 3VDQA 4N5LA 5JDCA 3RJ5A 2PZKA 2EXXA 4TWRA 2W98A 4YJHA 2VNSA 3PDJA 1DFGA 4YAKA 1T25A 4UVHA 1BVUA 2W2KB 5G0WA 2FPIA 3PRJA 1ZW1A 1LDGA 4FSHA 3RI3A 3E48A 2LDXA 4YRBA 3RQSA 1TLTA 2P4QA 1HT0A 2WE8A 4I8XA 1Z73A 3ZU5A 1VE9A 3A1NA 4C4OA 1CWUA 3OQBA 5L4NA 4B4WA 4LMPA 2ZJ0A 1UXHA 2DFDA 2Q2QA 2V65A 1E1LA 1P77A 2IXAA 3TZHA 3H9EO 4KOAA 5KNLA 2WYVA 1ML3A 4I5FA 5AXAA 2JHFA 3TL2A 4HY3A 4JIGA 4JJIA 2J3IA 2BLLA 3KO8A 2XXBA 3STHA 4ZD6A 4BO3A 3ZWNA 2HJSA 4AL4A 5LCXA 3SJ7A 4D79A 1DEHA 1E0DA 2PKRA 3PGXA 4J1NA 2JD0A 5JO9A 1PZEA 5HS6A 4MIOA 2VZ0A 5HS4A 2YV2A 4PLGA 3WGOA 2UV8A 3IUSA 4MKRA 2PLAA 2X9VA 2Y05A 3DZGA 3QW2A 4BNJA 3U4IA 4FCCA 2F1KA 3BHIA 4JBGA 2NSDA 4Q3EA 3SVTA 2JCYA 1GEGA 1G0OA 2Y0CA 1VSUA 2OZPA 4W7IA 1DC5A 4H15A 1U9JA 4E3ZA 2ZTUA 1GYRA 2VTEA 3BAZA 1BTOA 5KVVA 4LK3A 3P2OA 3L0DA 4PLPA 1PS0A 2TMDA 3WGGA 2YYYA 1U4SA 3LK7A 3ZWPA 1ZXBA 4AJPA 2CY0A 1KEWA 3NJ8A 1VKOA 3S55A 1T2DA 1O5IA 3GUYA 3KYDA 3MWDB 4XGNA 5DT9A 4MJLA 2G5CA 1GD1O 5JY1A 3FTNA 2H63A 3GGGA 4EEXA 5IDQA 1Q7CA 2CNBA 1YE3A 5FI3A 3UOGA 1AUPA 1PTJA 1PQUA 4MP3A 5ER9A 3RC7A 1KVUA 4IINA 3TZCA 1R16A 2VNAA 3ZHZA 1Q0QA 4ZHSA 3LZ6A 4Z0HO 4PZCA 3CZMA 4NZ9A 1RPNA 5EQFA 1ZK0A 1KVTA 2NADA 4XR4A 4IUYA 3ZWYA 4TMFA 3VZSA 2Q3EA 3DONA 4K6CA 4YACA 4RLHA 4XIJA 4YQZA 5CFZA 1P0CA 2C5AA 1AGNA 1VL0A 4IXTA 2OORA 1MB4A 3ADPA 4RF2A 1BXKA 4IQ0A 1JW9B 4FOOA 3CXRA 1CETA 1HTBA 4IJUA 3DOCA 1T2EA 3DAFA 5EQDA 3SC4A 3FNEA 1TI7A 3DDNA 1XIVA 3PHHA 3O8QA 3Q1LA 4I1IA 1DOHA 4OXKA 3V1TC 3PHJA 4WJZA 4KUEA 4XB2A 2EEZA 5EERA 3DO5A 5KVSA 5JC1A 4GLLA 4ND5A 1C1DA 3TDKA 4UVIA 4PLWA 5A3VA 4UEOA 1Y8QA 1B14A 1EE9A 2C5EA 1J5PA 4J6FA 1X0XA 1OC4A 2YQ5A 3SLGA 1GV1A 4RVGA 1LDYA 4R41A 3QVXA 1Y9AA 2FZWA 4AJIA 3W8DA 1F14A 3QLJA 1RYEA 1KVQA 4BNTA 4PN3A 5AQ1A 4IPTA 4TZKA 1T4DA 4NNJA 1NM5A 1GYQA 4D3FA 1LDBA 3AOEA 3A06A 4FFRA 1EFKA 3KEOA 3EVTA 3R6DA 4NK5A 2B5WA 1UAGA 1HYEA 4BNKA 3UFXA 2VWGA 2UYYA 2GN4A 3EUWA 1YDWA 1SPXA 2QHXA 2V6GA 5L53A 3SBOA 4AJLA 4HBGA 2X0NA 2ZJ1A 4BGIA 3W4KA 4J90A 1UUFA 4O59O 3OP4A 3UHAA 2VWHA 4DBZA 1J4AA 4B8WA 5T8KC 3JQ6A 1BHSA 2GN8A 2P91A 4JCOA 1NVGA 1SB9A 3DEYX 3RUCA 1P1JA 1E3SA 4ONEA 1P0FA 4L73A 3GGPA 4B8ZA 1LQUA 4E30A 1QXSA 3HE3A 3K30A 4X54A 2QRJA 3NTQA 5F1OA 3IL2A 3OIGA 4W6ZA 2WTBA 4CUZA 1E3EA 2QRKA 4PIVA 3KZVA 1Q1NA 1NYTA 3INTA 3DMTA 1BMDA 3GUCA 3SLKA 1DIGA 3V1UA 4L76A 5IDWA 2GR9A 1YOVB 2IZ1A 1BG6A 4GX1A 5TF4A 1FDTA 1TB4A 3GR6A 2ZQYA 3PIDA 3IC5A 3LC2O 2BKAA 3WLFA 1A9YA 4WLOA 4XX0A 3JYOA 1KETA 1P33A 4GWGA 1WMAA 5COQA 4J16A 3WS7A 1GCUA 2XPCA 1VL6A 1QYDA 4RVFA 2EP7A 3O4RA 2DT5A 1BSVA 4ZQFA 5F21A 1R0KA 1V8BA 4WNIA 1I30A 1LDMA 1L7DA 1UP6A 2AQHA 3DQPA 4NR0A 5K9ZA 1I0ZA 3JQ7B 2GZ2A 2WD7A 3AK4A 3OJFA 1MXHA 3ZWMA 1U5AA 3F4LA 1K0UA 1N9GB 1NQOA 3NJ4A 1P1KA 2BFPA 1BDMA 2NUAA 2ZB8A 2FZEA 1LRLA 3DB2A 3LF1A 1H94A 2ZTMA 4D0RA 4BO7A 5EJ2A 5A04A 2FR1A 4RLSA 5ENVA 1DFHA 3U49A 3ZCXA 5IXSA 1IPFA 4J91A 1BGVA 3C7CB 1V0JA 3IKVA 3L07A 1VJTA 4P22A 1DHRA 4J2HA 3ZU3A 4CQLB 4ZICA 2CVQA 2O3UA 3C1OA 4B3JA 1ADCA 1NR7A 2Q2WA 3GLQA 5JXWA 1F0YA 3KSDO 2EF1A 3H4VA 4YAEA 3ST7A 5JNLA 2E82A 1BWSA 5TNXA 1HDYA 4KQXA 4PVCA 3BMQB 5IZ4A 4A0SA 1XG5A 3OJ0A 2AEJA 1NWHA 2UUOA 9LDTA 2I3GA 3P19A 4G65A 3G0OA 1EMDA 9LDBA 3PWKA 3WNQA 4BV9A 3KLPX 2HAEA 2BFAA 4WOJA 4IQGA 4YDRA 3A4VA 2GD1O 2VN8A 2P5UA 3DZJA 3P2YA 4PCVA 1V3TA 1F12A 1MUUA 1KEVA 3IQDB 5I7VA 3WMWA 1BXGA 1A9ZA 1DRUA 3RUIA 3I23A 1KY4A 3S2IA 1WMBA 1ISJA 4FDAA 4PRKA 1D1SA 3K2EA 1F17A 3D5TA 1WZEA 3H9JA 2HSDA 3F1LA 1TA4A 2Q45A 2F00A 3RIHA 3WSWA 5MDHA 5CDGA 2C2XA 1GL3A 2GRAA 3OM9A 4RF5A 4WLEA 1KIFA 4NFSA 1XU9A 1Z7BA 5JSFA 1U3TA 3OQ1A 1X7HA 4I9NA 1UXJA 3D4OA 3GH3A 3MOGA 3Q9NA 3WJAA 3UW3A 1UP7A 2D5CA 4PGFA 2QRLA 4NBRA 4BO4A 2X5JO 3LT2A 1RM4A 1PJ2A 4A7PA 1IULA 4MVJM 2C07A 3FBTA 4XYEA 3ABIA 1PQWA 1WP4A 3WBFA 4W82A 3U0BA 1LLCA 1H9AA 4LVCA 2GUGA 1UH5A 1KS9A 2Q50A 1SB8A 5DCYA 3PTZA 3B1JA 4HUJA 2DQ4A 4Q39A 4OM8A 4YJGB 3GDOA 4OOEA 3VKUA 2YHIA 1OZAA 4YT5A 1I8TA 3VKVA 2RH8A 6ADHA 5A9TA 3SEFA 5B4TA 1HLDA 3FRJA 3V5NA 3I1JA 5CG2A 3IMFA 2BMAA 3I4CA 3M6IA 3B20A 4KUGA 3TFOA 3JQBA 3ZWOA 5H83A 4FGWA 1AHHA 1A4IA 1K2WA 3S1LA 4GSLA 2W90A 1LLUA 1IE3A 2UAGA 3UCXA 3E9NA 3EY4A 3ICCA 4ITUA 4Z3DA 3CH6A 3RFTA 1MC4A 1ZK4A 1PJSA 2DVMA 3FR7A 3GQVA 1BW9A 4CLOB 5FWNA 3H5AA 3WGQA 1GUZA 5A5FA 4DC0A 3U9LA 1DB3A 2J3HA 5JAQA 3JD4A 1T24A 2HK8A 4U7WA 3KSZO 1H0KA 4JBIA 4N7RA 1O0SA 1E3WA 1BDBA 3MCVA 1MG5A 1VRWA 4FJ0A 2C59A 3EC7A 4JXKA 1NX6A 3GHHA 4I9HA 4DIFA 3INGA 3WWZA 3KV3O 2ZQZA 3OIFA 3VTFA 5C7LO 5L51A 3IOYA 2PFGA 4U8GA 1P1RA 4MP6A 2ZB3A 3ADOA 3VZRA 5K0ZA 3D3WA 2R00A 3F47A 4GPD1 3V8BA 2EWMA 2A4KA 5MGBA 1PR9A 4DVJA 3F6YA 3GEMA 1LSJA 4BMVA 3RC2A 4EUFA 4J9UE 3WXBA 3G1TA 3DZIA 2C29D 3RUAA 3PHIA 4WASA 4TVBA 4XQCA 3C85A 3MOIA 4I9UA 3LT0A 4YPOA 1U3VA 2DKNA 4FJ1A 1VL8A 2WWRA 3MJTA 1GR0A 1LI4A 3DR3A 1PWXA 3D0OA 4B79A 3C24A 4W4TA 2Q49A 5FFFA 3CINA 3Q6IA 3BMCA 4E4YA 3WIEA 3OFSA 1LNQA 3GY0A 2GF2A 1VPDA 2R2GA 4RVUA 3PWZA 2BI8A 1Q2XA 3Q9UA 3DFZA 4J7CA 3A28A 5AOVA 1E3LA 5G0UA 1DC4A 2O50A 2OGUA 4R69A 3NRCA 2WYUA 2NVWA 1PL8A 1ADGA 4QTZA 1E6WA 2HK7A 1QORA 2O3JA 3H5RA 4NG5A 4O5OA 3JQCA 1DSSG 1DIAA 4WCFC 4CMEA 4Q3DA 4ZQBA 1EFLA 4MDHA 4GMGA 1Y8RA 2HMSA 3I4FA 4KDEA 4AJKA 4PLHA 3D7LA 1R4MB 3CMCO 5CDSA 4A10A 4UEJA 1ZFNA 3P5SA 4FW8A 4NJMB 3WICA 1IHYA 4CM4B 4BKUA 1PS9A 4D41A 1V3UA 2VHXA 3HDYA 4TRJA 2Z1MA 4O0LA 2YHUA 1QYWA 1B3RA 4HKTA 1I3LA 4IXWA 4RGBA 1NVTA 2DUWA 1SCUA 5DCUA 3K8ZA 1ADBA 4J3FA 5LC1A 4BKQA 3K6JA 5HTOA 2GGSA 1J49A 5G4KA 4B4OA 4D0SA 3VPHA 3WBBA 1K6XA 4OO3A 3KVOA 4Z9XA 3VDRA 5ER6A 3RAJA 1GPDG 4BV8A 4RVHA
chains in the Genus database with same CATH superfamily
5DBFA 5KOJA 4LRTB 5TJ5E 1KJQA 3JSXA 4CV1A 4Z0PA 3IE1A 3HB7A 3CVWA 2NMVA 5A9SA 3ET4A 1P2VA 4AUEA 3ZDRA 4N41A 2A94A 4C87A 3DLCA 4CL3A 3CNBA 3NORA 5JLJA 1JR3D 3VV2A 2ZSIA 4DLZA 4C88A 5L7TA 5E3CA 1MABB 1QJCA 4E4RA 4Q03A 4A8PA 3G7SA 3CE6A 3DOJA 1NVKA 3WG7C 1E6MA 3A1EA 2Z2YA 4NJOA 3H5VA 3M0EA 2C2MA 1J0DA 1LM3B 4HP8A 1E6UA 2G25A 3O75A 3PFFA 1X92A 4Q1AA 5GY7A 1N75A 2YMQA 5JO0A 2P4HX 2Y6VA 1RE1A 1DAHA 4CMIB 4ZMSA 3QNWA 4P0QB 4HTAA 1J2EA 2A1TS 4D5GA 5AI8A 4WGGA 1RMQA 5LWHA 4PYRA 3HNOA 1YJBA 1YYXA 4GOOD 4A1FA 2O48X 1L4NA 3GPDG 1LF5A 2VH2A 2XHZA 1FDUA 4DHWA 2PD6A 4N8EA 4UEKA 2CMDA 3LJKA 1THGA 3GL9A 4DUGD 3MJ4A 1OV6A 5T41A 3CH7A 3BGWA 2OORC 1GADO 2YNMC 5AT1A 1K6EA 4F3NA 4KFUA 4ZARA 1ZPDA 3VC2A 3WAKA 2AOTB 1SUAA 4GQAA 3AKZA 4XUDA 4U2GA 2WWIA 2DJIA 3AUAA 4DC9A 2C9OA 2WWVD 5LMCA 4BUJA 1XXHE 1UT8A 5AUNB 4P2GA 1DIBA 1NM5C 1DBWA 2WJ6A 1ECGA 2QP4A 4KG7A 4MXDA 3AY0A 4XDYA 5BSMA 3MYIA 1VG0B 4UUQA 3CYFA 3H87A 3VYWA 2DBZA 4R01A 4P5PA 4L4XA 3RK0A 1O54A 4FP9A 4DNXA 2RAVA 2ZIGA 5EMJA 5DNEA 3QLEA 3WGYA 3C1TA 4EUKA 2NTJA 4DDHA 4MX8A 5KTSA 1A8QA 5J2UB 3DMDA 1N2GA 2AG0A 4AX4A 3KSRA 2RJ3A 3Q2KA 4WKNA 5C4GB 2H8GA 4Q18A 4YCSA 4ZV9A 3JQ7A 1ZA2A 1LVKA 4GDMA 3RNLA 5I51A 3MJHA 5AVUA 5HQ3A 4OQYA 4Q9LA 4Q05A 5JPDA 2RGNA 2OHXA 4K6KA 4PYIA 1U2DA 3WMRA 2I2FA 3AR2A 4OI1A 1A9PA 5ECWA 5D87A 5F9HA 4CODB 1A04A 4LTDA 1NF9A 3HWSA 2OU6A 5AOBA 3MEQA 4DMHA 4JKOA 3K8OE 3K1IC 2YWFA 2O52A 1N1GA 4R6WA 2HWKA 4ATNA 4F85A 2OO7A 2Q8QA 1SBZA 4G8JA 1KI9A 4LRSB 3M4JA 4C07A 1YZVA 1XN1A 1MRZA 1X13A 2GKSA 2CVOA 4YQEA 3I9OA 4PPYA 1AGPA 2A84A 1Y34E 5FV7A 4B0OA 3KUCA 1Q0LA 2JLQA 3ZD6A 5JSKA 4PS1A 4RIHA 3WLLA 2I55A 1NG9A 3RBVA 2J59A 4GPTA 1ZUNB 2VYND 4WZBB 4YJGA 2XUHA 1WOYA 5DW0A 2LKCA 4NNPA 4NL4H 5JJIA 1MD9A 4OYHA 1VLHA 3I9LA 4BNUA 4EGQA 2GK6A 2RHTA 1OGJA 5CIYA 4XWYA 5DF1A 1JEJA 3ZIAD 5CB8A 2H4YA 3QQPA 4XDZA 3G9UA 4PLFA 1UKBA 5CLQA 5JFOA 4RL6A 2X9NA 2DFPA 1UK7A 2N0SA 2XF2A 1YB7A 4KR0A 2AFHA 3VRCA 5A1TA 2XCIA 2XUQA 3WKCA 4RD0A 3K1YA 1OXKB 3U26A 2D2IA 3IVXA 2IA5A 3PE3A 2QPTA 1MR3F 4H0CA 1D4FA 5LKRA 4L9SA 4K86A 1E79D 1M74A 4R68A 3N6XA 4TTRA 3AU9A 3CSKA 3KLOA 1WCWA 4MI9A 5F5XA 1A27A 1OT5A 3U56A 3KVYA 1AUEA 5CH5A 4M1ZA 1NN0A 1VC2A 3NBFA 1TO2E 4NYJQ 2N1BA 5EIHA 4G41A 4QTXA 4H4DA 1FIUA 3LVBA 1FE8A 4FDMA 4KPFC 2XL6A 3G8CA 3H3FA 1HXHA 1QE3A 5EHNA 3DA8A 1NVBA 5JNRA 1Z56C 1VCOA 3KBOA 2P75A 2CZCA 1YD7A 1AE1A 5JNSA 1C0IA 4MA4A 2RGBA 1X19A 3TGLA 1RKQA 5E9JA 1SA0B 1PT9A 3A6KA 2BGRA 3D7SA 1W5FA 1R9GA 4LG1A 2ASEA 3PB3A 3I62A 1CUDA 4QQNA 1H2XA 1UMKA 4A27A 1ST6A 4B7CA 1Y5MA 3PG5A 3KFLA 2FFHA 3T06B 4OSOA 3RSCA 3GFFA 1S1CA 4IV0A 1YL5A 4E0HA 4UAJA 2X42A 4GKVA 3LG2A 4FOPA 4QL3A 1TFUA 3JW8A 2ZR7A 2FAXA 4F60A 1I4EB 5LXTA 4BTVA 4M3NA 3EGXB 4OJYA 3X43A 3PPYA 2ZU0C 4YRDA 1SY7A 2A9VA 4G7HF 3L6BA 2LUOA 3QU2A 3FUWA 4W9NA 4EYQA 1P17A 2EIJC 1EDDA 1R6AA 4RIFA 4O1IA 4OJMX 4ZT2A 4M0MA 1HG1A 1CUHA 2YIDA 4J0DA 1MB2A 4JQZA 4HS4A 3WFIA 3G2LA 2IUUA 1HDCA 3IEVA 2AG5A 4I55A 2Y1LA 5DNCA 4DR4B 3LO5A 2O1XA 3ZY2A 1JEDA 3IUNA 3H0EA 3LPNA 4UU0A 1DL5A 4YJ3A 4HYEA 3O82A 2RHRA 2W6MA 3AR5A 5GGXA 1IBRA 3U7RA 1QP8A 4EQZA 4C5CA 3V1MA 3L02A 3CZPA 3A9UA 5IH3A 2JLVA 1E2KA 5DRYA 2VNIA 3O84A 1YO6A 2XXAB 3SAJA 4AC9A 3EVZA 1BAPA 3AI2A 2WWHA 1D6MA 1YK1A 4GR4A 4BEJA 3LLMA 1M72A 1IW7F 3UBMA 1A76A 1L5ZA 5H80A 1UDAA 4A8JA 2BEVA 5JZVA 2QG9A 3K3PA 2ERCA 3EJWA 1W0KD 1RD4A 1JR8A 4GPZA 3A32A 1MB0A 4CMCA 2VK8A 2J48A 3WQRA 2JBAA 4E22A 1JNYA 3OE5A 2CK3A 4Q1EA 5FOUA 3AR6A 4PZEA 3LFHA 4ESHA 4NENA 1OX4A 3QSYA 4YCAA 4BQPA 3LZCA 3X1OA 4EUNA 3RUHA 4P5DA 2H0QA 4QRDA 2BPOA 2O4CA 4XCVA 4QUGA 4KSCA 4A8TA 5F4ZA 1KHHA 1Y4DE 1FMLA 5T57A 3HM2A 4J9VA 2WMOB 1T8WA 3ZGYA 3S3TA 4WXHA 3WYCA 1DJOA 3EH2A 1CQJA 2JEYA 2FEPA 4ANFA 1U0FA 1U4OA 2XUFA 3ESXA 1H8HD 2B3TA 1QJ4A 3NYLA 2FH5B 3E1KA 4FNOA 4WX2B 2HWUA 4R8RA 1KWKA 2I6FA 4C7MA 3DSRA 3M6UA 4YFVA 3CLTC 2A68F 4Q9HA 3ZDAA 5CFOA 1PDVA 5EHHA 1GNVA 4ALIA 3X2QC 1H3NA 4B73A 4S2EA 4E18A 1M75A 1K05A 2XGMA 3SBEA 5C34B 2HLPA 5L0IA 2Z8XA 2AYZA 3GCWA 2WILA 3L0ZA 2PS9A 3GOQA 1N1EA 3VNAA 2EW2A 1LLFA 1NRJB 2QL5A 2HMQA 3FGOA 1OFUX 4E2YA 4WN9A 4ZJPA 2I15A 1RYNA 1XXHA 3O8QB 1KKMA 3K9NA 1KAHA 3JSZA 5FP0A 3TDMA 1Y8QB 4BO5A 4H7IA 3U3RA 4MHSA 2WLSA 2VDUE 3GLIB 4WK6A 4LJAA 1GL7A 3CB4A 2ZAMA 3IQGX 3HXMA 3INYA 4FZJA 4KYIB 4A2NB 5KB3A 5IT0A 1RNLA 2AZ4A 2C2WA 4JSTA 4C1NA 3MLEA 3MT8A 2EBWA 1ZBQA 3SK0A 5I4KA 4BVEA 1I9CA 2W71A 1WNTA 3W3AD 2IS1A 3MRSA 1LCIA 1JLSA 1E5LA 3ESDA 2PUAA 1L1FA 1CUVA 1HYHA 2A88A 3IQTA 3WIVA 2JHGA 1II9A 2A1IA 2XNSA 1R66A 4EKIA 4DLPA 1LBIA 1XMJA 2JIOA 4L5YA 3Q2OA 4ALLA 3OPNA 5IJZA 5T67A 2PH1A 3M5PA 4C78A 4DR6B 5EZYA 5HK8A 3WR5A 3C43A 2XMBA 3TOVA 2PCJA 4R51A 1U8XX 4RK6A 2JAUA 4F12A 3QRWA 1FX0A 1ONBA 3O3OB 4QJBA 1SUDA 3W0LB 2BRUC 4MCIA 2BFEB 1NHGA 2R11A 1MAAA 1JQ3A 3FOCA 4PPFA 1AH2A 3LP6A 5L4LA 1XHEA 1XZEA 2NQ2C 2ZAOA 2NW6A 4LE2A 1Z6XA 2A14A 1N4DA 1Z0SA 4KP7A 4QGBA 4QYIA 3IEMA 3R6LA 721PA 1ISGA 1WASA 5JS2A 2JHAA 3ZHXA 1K9SA 4L4YA 3JTLO 1A71A 2NT4A 4DSZA 2B83A 3UK1A 3KOYA 3G4XA 3HZHA 2OO5A 3SKVA 3NXSA 1I36A 4ZIRA 3IIIA 2P67A 1ZGZA 4BLRA 4GP7A 2WMNB 5EJ7A 1ZNQO 4N65A 4HH0A 1FNTc 2PKCA 4BGVA 3F46A 3GT0A 3UJHA 1TAQA 3KWJA 3ZE0B 2XA2A 3RSHA 4NYMR 2MSLA 5FF9A 4M9SA 3IDFA 1EJ0A 4F91B 3F6RA 2Q3DA 3KJFA 5JVDB 3EW7A 2ZROA 4JBLA 3RQFA 5F35A 5KUTA 3WRXC 3L1IA 3C3CA 2WNIA 1ZAYA 1JA9A 4AJ9A 1A9XA 4B3IA 1MJHA 4XFJA 4MRAA 1Z7WA 1FP1D 4YX9A 4JGGA 4B47A 2AE2A 5DISB 2XIQA 4FPXA 5K0LA 1ENYA 4IIEA 4EECA 4DV6B 2GSDA 1S02A 4C03A 1YI8A 4KK3A 2CLMB 5FBHA 1JIVA 1AN0A 1RAFA 4YMTA 3LF2A 4GR5A 5BN3B 4Y9SA 5KCZA 4LQ4A 3LYHA 3RFCA 2MSCB 1F0KA 4CDYA 1HETA 1YE5A 4QPPA 5B6PA 2H3HA 3BJZA 2Z9CA 4HQOA 2FPSA 3ZHRA 5AC5A 2WUEA 1NC1A 2PG3A 1UBEA 4M0PA 4FQ8A 4ZYYA 1KYXA 3TK1A 4DLBA 3QK7A 1BS2A 4PQFA 5FUVA 1ZO8A 3F3KA 4BO6A 5FYQA 4FYWA 4MW3A 5K3BA 3GODA 2D54A 2FI1A 2RGCA 3MGBA 3IMKA 2JD1A 4WNYA 2B78A 3VDQA 1QHIA 2PZKA 1SXJE 3EPKA 4YJHA 3KXIA 2W2KB 5G0WA 4ZCSA 3R9XB 2DHCA 2QR5A 3A1NA 4QC2A 1GPAA 5GM1A 4BFYA 4V0RA 3JAKA 5F28E 4HZIA 1M0TA 1F6BA 5DO9A 4M99A 2XUJA 3PC8A 4M53A 3IILA 2ZIFA 3F8TA 1RI3A 1PZEA 1M2FA 1T5BA 2UV8A 4IEIA 1L1QA 3H19A 1U8UA 4RIGA 3OQIA 2L6GA 5DBHX 4W7IA 4DV2B 4E3ZA 1NLZA 2C31A 2FPLA 1XWJA 4ZXFA 1VHJA 3G0BA 3GO4A 3ZK7A 1RRGA 3QHPA 3K9HA 4UHFA 2XRYA 1T2DA 1O5IA 3GUYA 3MT7A 1FL9A 5IDQA 3LZ6A 4HGYA 4NZ9A 2JLAA 4W1SA 2PVPA 1H0SA 1VL0A 1F3LA 1QSPA 1FTSA 3DBIA 3O8LA 1JW9B 1MJGA 1WWPA 2QTBA 1U2ZA 3ZU6A 5KVSA 3KSAC 4J6FA 3B1XA 2IXGA 2R8YA 1SQFA 8OHMA 4KMOA 2D1SA 4NNJA 2QQFA 4B82A 3R6DA 1PT5A 2B8TA 2ENWA 2MSKA 5C8YF 4KX3A 2V6GA 2ZJ3A 3PDIA 1M7GA 3KUKA 2Z8YM 2ZJ1A 5CT5A 3ETCA 2QG6A 3QXSA 3OP4A 3CKMA 2EC5A 3AR3A 4URXR 3A4TA 3OU6A 1BHSA 4FXOA 5ARBA 1KMMA 3Q3JB 4KVFA 3IDQA 3AG4C 4NJEB 4X54A 4Y9TA 1MIOB 3QFRA 1Y37A 4G4JA 3MRTA 1DIGA 3WGNA 5AK5A 4HGNA 3GR6A 3WLPA 3SCZA 4U1RA 3B53X 3TLJA 4XJXA 3KKZA 1UKZA 4GRAA 1QYDA 1N3YA 1ZM9A 2J7PA 3IHTA 4PANA 2AQHA 5K3FA 2BDUA 1VLZA 4EPTA 1QP0A 3NJ4A 4DCOA 3NP7A 2BFPA 1ZM4A 2NUAA 2ATIA 4BEBA 1ZDMA 4Q7MB 3LBYA 1DFHA 2AU5A 4YRFA 4V2IA 2CMHA 4J91A 1BGVA 3WV4A 1B8OA 1RBYA 1IWOA 2PL5A 4R1PA 3WYFA 4K8OA 1JEYB 3ST7A 1RP7A 3TPFA 4PVCA 2B1GA 3QKRB 3P19A 4G65A 3P9YA 3T52A 2BFAA 4IQGA 2OQVA 3VYUB 4D8XA 5C1BA 5CB4F 3I28A 3IQDB 1BXGA 1RVDA 4E15A 1OU4A 4RD4A 3EBOA 2EX4A 2BHTA 3CBGA 2QW1A 3C8HA 4IJMA 1RMVA 2IHVA 1VI6A 2HRQA 1UMDB 4ECEA 3RVOA 1JG7A 2KE5A 4FB4A 3NETA 4BO4A 1G4HA 3L8JA 1DRKA 1YZ3A 3RLFA 1PQWA 4R1QA 3U0BA 5DFAA 3AQ4A 3B1JA 2DQ4A 1Z7GA 4P7FA 2D5LA 3KAJA 3X44A 3VKVA 2JJ2A 3DQQA 3RRJA 1KI4A 3WSTA 1E84A 5CG2A 1LI5A 3N5KA 4M60A 1A4IA 1LLUA 4KR2A 1IE3A 2IHUA 3NH9A 4H17A 1P4RA 4X1KA 3WGQA 1C7RA 3DF7A 2ZT5A 3RTGA 3MTEA 4JDPA 4DIFA 2QT1A 5FPPA 4BMOB 2YFKA 5M7EA 5EHGA 3I39X 1Z25A 2Z04A 1OHHD 2ZB3A 1E18A 3D3WA 2EWMA 1JTFA 5MGBA 5HNKA 4DVJA 3RC2A 2XRZA 3RUAA 4IXNA 4OHVA 3QPBA 1T0HB 3PC6A 2DETA 1TKCA 3JR7A 1GR0A 1UC9A 1WU8A 2QM8A 3AJDA 3EZ2A 2XL4A 4B3MB 2OHJA 2JGDB 3G2NA 3V4LA 1GDTA 2WU4A 3OWOA 2HK7A 4AE4A 3NC0C 2D06A 4JJZA 5FTMA 3DO8A 2EHJA 1G5ZA 2NO6A 2GBFA 4TRJA 2Z1MA 1HBJA 4QXPA 1M0SA 4QI2A 1SCUA 1ZIOA 2HJVA 4J0QA 1ADBA 2E4YA 5G4KA 1X8KA 3AJAA 3KVOA 3E70C 3H6KA 4WTOA 2BM9A 5J47A 2WE7A 4BX8A 2A5LA 1V5EA 4AT1A 4UUNA 3K66A 5A6BA 1NRWA 1XZGA 6YASA 1QGDA 1PG2A 1D07A 1J24A 2AHOA 2J31A 3AUSA 3ZWIA 2JCXA 2PBEA 5JXGA 1G8MA 4RZ2A 3UBTA 1W36B 3RJTA 1WDWB 3IX7A 4BNNA 1OIXA 2CDQA 1YARO 5ED0A 3KYIA 2ROQA 3WHNA 3AYXB 4MRPA 1FQJA 2VAXA 3PHBE 2HW8A 2O3SA 1JR4A 4R84A 4YT4A 4Y6QA 5ADHA 3VR4D 5HK9A 3UMBA 2OXCA 1ST3A 2Z0MA 2B5VA 3R7WB 5J40A 5IJWA 1JQAA 4CS8A 4ZLCA 5TQ2B 3I5PA 3L6UA 2QZ9A 1XKXA 1NBOA 2FYTA 5GVSA 3U3DA 1CVIA 3GQBB 3OZGA 4E88A 1NW8A 3AVXA 3KC2A 5BMVB 2Z1DA 1JVBA 3OZFA 1RHQA 1U7XA 1WUTA 3PKIA 2AX3A 4XPYA 3PT9A 2DLNA 3HDVA 3MMSA 2XITA 1F9EA 3JASB 2O5EA 2H6EA 3FHOA 1S1MA 2FP3A 3PNOA 3BBPA 3DP9A 1M2VA 5C8ZA 2YBEA 1C1HA 3G0DA 4X62B 2QM7A 4NBNA 5JUWA 2ZPAA 3E15A 2IIVA 1W88B 5JV5A 1B8VA 1MA3A 3H8VA 4IX9A 2IH2A 3OZAA 4MVJG 1UKAA 1KPHA 4WBXC 5ES4B 1KZHA 2UKDA 5T64A 4EK9A 2GPJA 1BE1A 4DJEC 2NVBA 3K5PA 4HWGA 3NOOA 3C8MA 1R9NA 5GGYA 1PR5A 1YZAA 2EGHA 4OX9B 3VH1A 3TQQA 5GOTA 1YQDA 4ZQCB 1Y81A 2YL0A 1JHQA 3A27A 3EVCA 1WPGA 256BA 1XA3A 3LFTA 1H5NA 3G1UA 5A3QA 3KB1A 4AWAA 4X93A 1H4VB 4FNMA 5DLQC 1ZCBA 3B12A 1UCFA 5EUBA 5DBEX 3LSTA 3C8GA 3SHWA 3MMZA 3QOXA 4ABTA 4QELA 1V71A 2RG1A 5JH7B 2PKYX 4XGQA 2ZXPA 1SXJA 3AEQB 3K1HA 1H3EA 1QE0A 3ZQKA 1MVOA 2V7GA 1GAWA 2RG7A 4QNNA 5A5VA 3LTNC 2BMFA 1YE8A 1YR9A 1OH8A 3GCXA 1QYCA 1Z35A 2WQ6A 4URYR 1HL3A 4CHGA 2ZRGA 4UMVA 5DNVA 4CM8B 4X6YA 1WEKA 1FMWA 5AOCA 2A0BA 4L1KA 4AUMA 5ETJA 3UMYA 1ZH6A 4IMJB 1FRZA 2YMLA 1KYIA 2L82A 4FSXA 1TEXA 3CN9A 3GWNA 1T35A 1DC8A 1TM3E 3RPEA 5A5EA 4MI6A 3V1LA 3KJQA 2G1AA 3K1TA 3ASYA 1SG6A 9ABPA 2GXUA 3E53A 1WHSB 4GD3Q 1T8YA 3I61A 3MC1A 3T0FA 4K6OA 1PWHA 1QK5A 2FJUA 3LTEA 2JRCA 3JWGA 4BNMA 4YASA 5GAJA 2FLWA 5B37A 4EW3A 3AU8A 1DDOA 2Q9CA 5DHSA 1T1IA 1CD5A 4RSGA 4OREX 5H0IA 3IHUA 1YQGA 3F7MA 4KXWA 3MBGA 4H3HB 4DIOA 2W2LD 3RAPR 4ISBA 4M8NE 1QIEA 3Q3CA 1V47A 1CY2A 1M5UA 2UVPA 1ZZEA 1IXRC 4RE6A 3GMTA 2Q7RA 3MD0A 3S2UA 3SMQA 5BY2A 1K08A 1M6WA 3NS7A 2OD9A 1XLUA 1VB5A 1SC6A 3QPAA 3WSVA 2HSGA 2MSDB 1C9MA 5D8DA 3TRKA 3ZBPA 1CW2B 1KMQA 1JHRA 4URUR 4BN4A 1N2IA 3UKOA 3PXXA 3AM3A 2MJLA 1XF9A 2CUTA 1OIVA 5IVIA 2ZRPA 4XEVA 1NYLA 1W29A 2QTVB 1J09A 4TSFA 1JSXA 3RW0A 3CNLA 3BQMB 2H7BA 4N7BA 1WZCA 4BJ6C 1RXSA 4RESA 1FPMA 1ISRA 4XPWA 1YRBA 2C0CA 3HKEA 3FBWA 1P2DA 1TM5E 1JIQA 3SI7A 4F96A 3VHXB 4U2DA 4RH1A 3M6WA 4PGMA 3SOPA 4JB3A 2ZWMA 2HK6A 3IODA 2XDYA 3B3JA 3K9WA 3VH3A 2WUDA 2YZMA 1ZHZA 1EA7A 5H59A 1AKNA 3G9QA 4XB1A 5JNWA 1UWCA 1O6ZA 3KZ1E 1AQIA 4AS3A 3ZV4A 3SC6A 7YASA 3F6BX 2J9BA 5EL0A 1A2BA 2B7CA 2WI8A 3V8QA 2ZIWB 1YB5A 3DS8A 2HRDA 2XDWA 1OAAA 4ALKA 2OHVA 4C7XA 2XH8A 2NUPA 1DAPA 1X7WB 2ECKA 2I2BA 1AZLA 1W1IA 1XKLA 3OZUA 4JJGA 1QYIA 3Q41A 1M66A 3W9SA 4PZPA 4JI7B 2F3QA 3RU7A 2DXIA 1N8KA 3D3NA 3PDCA 1IZ0A 1E5VA 2GN6A 2QMZA 4PK4A 3LUDA 3V4VB 4ZOLF 2ZWPA 2JGJA 1TDJA 1L4FA 3VU9B 1BH6A 5HW0A 3L7IA 2JF0A 1T5TA 3BRWD 2BFOA 2RK3A 2NXJA 5FLXA 1E1DA 5AW5A 1ONPA 5JNUA 2X58A 1DGQA 4KCGA 4JS0A 2ZPUA 3ZBTA 3BJEA 2XJ9A 2JJMA 4YJ2B 4YXWD 4B3SB 2HTEA 5C8VA 2I6UA 4C0LA 3HN2A 4Z4IA 2IXDA 1Q19A 3PC4A 3GRRA 3W5BA 4B6PA 1HI9A 4UCQA 2OYSA 1QPZA 3TQTA 4N06A 1VOMA 3PGJA 2IL1A 4NH4A 3QG1A 3F3SA 3FYDA 5JD6A 2WWFA 3LY9A 3D5QA 4ID9A 1KEPA 3I0NA 2AR9A 4ZRNA 3LXRA 1FC0A 4NMWA 2PU7A 2GQ0A 5J4HA 3UK6A 3NX4A 2XIJA 5CFMA 2ZE8A 3ZWWA 1G59A 1EXNA 3OPVA 5FCDA 2CKDA 2BUBA 4FYPA 4KHPB 3T1OA 1C3LA 4DNOA 3TE6A 2XQVA 2VT3A 5K3DA 1SRRA 1HFEL 3JY6A 4BO2A 5U1PA 1IUOA 3ZE6A 1NXWA 2WZCA 4KO1S 1SKBA 4RFSB 1ZEJA 3EQLF 3KZOA 1KEKA 1WCV1 1ZNYA 1CJVC 4PLYA 2ORYA 3WV5A 4E31A 5DWQA 2BTEA 1OTXA 3ZZTA 2QIOA 4NBTA 1XMQB 3ZKWB 1N2HA 2VXBA 1YR1A 2QRQA 1IHXA 3WYBA 1B7GO 4WUVA 4ITRC 4OHYA 3JQAA 2BKEA 3E9MA 3D81A 1Q1AA 4L72A 1F2TB 3GAFA 4HFJA 4KIGA 1O9BA 3DMFA 3NRHA 1PX2A 3C3EA 4EG1A 3PQ6A 1ARZA 5C53B 4TYNA 2E89A 2E49A 2J9RA 2NIPA 4HDMB 3HZZA 3LPMA 4LWPA 3M4XA 2VVTA 4V39A 5G40A 3W9YA 1B6GA 2MSWA 1E4VA 1S4QA 1O5TA 4DVZA 1IG0A 3BSYA 3JYYA 3M1LA 4FZRA 2VCCA 3NU1A 3FPKA 3NWPA 1PWZA 1TCCA 4RHXA 4W5NA 1Q95A 2ZS8A 3LC7O 2I4LA 4IYJA 3MBKA 1Z13A 1MRSA 1QZZA 2PKQO 4EG8A 3P2IA 2H5JA 5TRTA 2JGFA 3KQQA 3T1YB 2B3DA 4UDVA 1TWGA 3IAXA 2GH1A 5I5EA 3OETA 1ZP6A 3GF4A 3AM1A 1E85A 1ODKA 2EP5A 4LY9A 3IPXA 5IKOA 4M8SA 2Q0HA 3AFHA 4UHJA 2RFLA 1V95A 3EW9A 1ZUD1 3HVRA 3G82C 1VGRA 2G9NA 2ZAYA 1WR8A 2VUHB 5LDHA 4TS4A 3RRNA 5KJEA 3THYA 1EFRD 2HH9A 1UBFA 3T54A 4DUZB 2O9XA 2FOLA 1NONA 1IN4A 4DTIA 4CMBA 3ZW7A 1GL9B 3L6EA 3QUBA 1PGNA 5CPFA 3OCYA 2V9ZA 3W3ZB 1C1XA 1PG5A 1WQ4A 4NCHA 3O03A 2X9GA 3KP1A 1W46A 3NC4A 2P3SA 4Y6SA 4UDNA 1VGVA 2OGZA 1ZQ1A 2REOA 3SD7A 4ZYTA 1ENZA 4UNNA 4YDSA 4IDOA 1ZIXA 3SEZA 3JCUQ 3OA1A 1ZOLA 2CV1A 5JSHA 1K4YA 2BTQB 3T4RA 4GOKA 1YR8A 3IUQA 1DWPA 1AS0A 5A4JA 1QP4A 1SOAA 5AI6A 1N1MA 4HDRA 3OA0A 5K7SA 3R0IA 2YHIB 1V4BA 1YTLA 4AZ3B 3QA3E 2MHRA 3QVKA 3KZNA 2XVXA 4UHHA 4KVAA 3E7FA 1Z5VA 3OH8A 4AECA 1R88A 3WRWA 4CTKA 4GAEA 2QLMA 2WIBA 3T7KA 2J5QA 3H2IA 1N34B 5E9AA 2CHFA 3DHVA 1XZHA 1L5NA 3NNDA 4JYCA 4M83A 4J1TC 2Z57A 2EYUA 4A8HA 5HX7A 3OU7A 1OX6A 1JTEA 2A6HF 4DGSA 4M4SA 5AM5A 1DTSA 4YRIA 1O8BA 5E7MA 2WHEA 1N2EA 3VFDA 4LZZA 1O9GA 3F9CA 3H97A 5BMOA 2CLEB 5JTUA 4QRIA 2CCKA 4WCFA 4ASUA 4Q4LA 1GSHA 4LYGA 1M2GA 3G8AA 5F7ZA 3V1YA 4K88A 5BNFA 2B4QA 4P7GA 1N6NA 3HCRA 1IOVA 5C7YA 1TVMA 1X8LA 5TT1A 2E4VA 2BDTA 1T43A 1PJ4A 4R54A 2FK8A 1LVHA 1Z34A 2ZJOA 1IXKA 5EI5A 2ZT6A 2F48A 4LDNA 4U7FA 1VECA 1WNFA 4PEVA 2ZSAA 2ETSA 4X45A 5FJJA 3OG9A 1GU0A 1Q0SA 1NPYA 3KQTA 4MQMA 2OG2A 3O26A 3RARA 1AG9A 3DV9A 4FWBA 3VPCA 3RVZA 4FBMA 5HZHA 1OXBB 3ML1A 4TWRA 2XY4A 3QMKA 2FWNA 2HA7A 4XTRA 1LDGA 1C3OA 2WE8A 4WIAA 3T7JA 1JFVA 2G06A 5CIWA 1FSSA 4PM4A 1PDWA 3FLBA 4LZLA 2J0WA 3ZIUA 2JGIA 4ETNA 1DINA 3STHA 4Z4QA 4JZKA 1E0DA 2Y2UA 1T6IA 2Y05A 4R1MA 3KOWA 4KL8S 1QS0B 3SVTA 3E9EA 1PT6A 5AW9A 3OESA 5E3AA 4HLDA 3G1WA 5L0FA 4NDAA 4FFBA 4UQOA 4B31A 8MHTA 2G83A 3QW1A 1CUXA 2H63A 3GGGA 4G8DA 5ER9A 1SOMA 3WLHA 3TZCA 1T4MA 1EVEA 3F7TA 1JRAA 2OAGA 1KVTA 2NADA 3OHPA 2HGSA 5FDFA 1Q44A 5IF9A 2PRKA 1CT9A 1UC4B 2AWNA 3SC4A 3EARA 1L6RA 4PLWA 1G8YA 1EE9A 4EPYA 3K6BA 1OC4A 2I78A 2QEQA 3UG6A 2OXTA 2WB2A 2Z5FA 5ABPA 2I8CA 5F73A 3QXJA 2QBYB 2B5WA 1HYEA 2GARA 1KK2A 1JJ7A 4G5GA 4XASA 3HN6A 1O3UA 4CYMA 1SPXA 4K3VA 5A4IS 3QYPA 4I8DA 1Y5IA 3GJ6A 3OOYA 1NVGA 1KQ3A 2DHQA 5F76A 3G8YA 1RMTA 3HE3A 2VKTA 1UFQA 5F1OA 4RKRA 3OIGA 4BQSA 3TX6A 1WMFA 5KO2A 3GEHA 3GFOA 2XX3A 2IZ1A 1G64A 3IVMA 4JI4B 3G0HA 3MX3A 4C0XA 1AO0A 3UJAA 4EB3A 4YMLA 2Z56A 1VXOA 1XPJA 4EFMA 1FYVA 2BMEA 4GE3A 3UY4A 1S8OA 4BP8A 1QZ3A 3X1XA 2JFNA 1FS6A 1NQOA 2L6HA 4D26A 4YRGA 2PAFA 5DHTA 1JYFA 1YVPA 3O3CA 2YV4A 1SHKA 3SXJA 4B3JA 3V7OA 1KDTA 2V7QA 4AW9A 4L7VA 4HI0E 4RSMA 3BMQB 2PMKA 2W4MA 1T9BA 5KYYB 2UZ1A 1X2EA 3WNQA 3FPGA 1COWD 3R7AA 3DUFB 2ZU6A 4MV9A 2P5UA 2FG5A 1V3TA 3DW3X 3HUTA 2GMWA 4LECA 3H9JA 3QVGB 4OHKA 3RF7A 1UJBA 2C2XA 3PQ8A 1V7CA 4WXPA 3GBSA 3GH3A 5F9MA 3Q9NA 2PUHA 4E03A 4NFLA 5J59A 3T0GA 4B3CA 1E94E 3N7TA 3O94A 4A7PA 1BVHA 5BUOA 1O7JA 1MRNA 4O6MA 1D2CA 1ECJA 5D3KA 3VR3A 3LQYA 1YQWA 3Q0TA 2XR1A 4OOEA 1F6WA 4G8BA 3WLNA 1TW2A 1I8TA 3KJEA 1MC8A 2Q07A 4K9LA 4HAXA 3S1LA 4YP0A 3VJKA 2O8NA 3WP0A 1Y1QA 5A5FA 3MK31 5I9IA 1JKJB 4IIGA 1N2ZA 1BC5A 2NYVA 1E3WA 5IWAB 3D3QA 4I9HA 4LXIA 2HU7A 3D4BA 5C7LO 5DLPA 5ESRA 3KH2A 4QM6A 2GJ9A 3RBAA 2D74A 3T3PB 4HNSA 3EX7C 2AOUB 5AI0A 2XW6A 3B0UX 3ZLVA 4DXAA 3C3BA 5EYPA 4K9MA 4F8JA 2Z5VA 2IV7A 1BEZA 1N5IA 4ZDIA 1CNEA 4X91A 1EINA 2ONZA 3AERA 3G2OA 4EGAA 1NBEA 3H8SA 4U2EA 1NMQA 5IFKA 1E6WA 2J9UA 4EO7A 4CMEA 3ZCPA 3PGMA 3NIWA 4FX5A 3HNLA 1V3UA 2JB9A 3HDYA 3V8RA 5AM0A 2YJ4A 4YC7A 3LAWA 2X5XA 4OI2A 5DCUA 3U6KA 3U4QB 1G38A 5I4BA 3ATPA 3VPHA 4HAZA 1DKQA 5ER6A 1SXQA 2VYCA 2DFTA 4BLPA 3P0IA 3W2WA 3UEOA 1KEUA 2IUSA 5CI8A 3GRKA 1FF9A 2QL6A 2WDZA 3U81A 5A4DA 2WICA 2HPHA 4MQFB 2VHYA 3QE2A 1ZI9A 1MNEA 1TMYA 3RC3A 2WVGA 4UU8A 1RT9A 3NVMB 1SQ5A 4RD6A 4MKFA 4N0EA 3LUJA 3IH5A 1ZD8A 3FFAA 1UMBA 2P8SA 4NXMB 1M6VA 4UM9B 2AMFA 2D0PB 4GU5A 2NAFA 3FDIA 4QOEA 4ZCPA 2HM7A 2MMCA 1CG6A 3WWYA 1Y6ZA 3MPUA 3RKUA 2D5IA 1K63A 5EMLA 2R7SA 1N9ZA 4Y2HA 5CEFA 3POVA 4OD4A 3BL5A 1DU4A 3B1ZA 1NIJA 3R75A 4LISA 1AZSC 3P0HA 1PNVA 2OV2A 2FWPA 4OFWA 2HMYB 6LDHA 4L8WB 2HJGA 3SC2A 3RVDA 1W87A 2XYVA 1SHTX 4KBFA 4AMBA 4Z4CA 4HUQA 5MN4A 4B34A 2QE7A 4GMXA 2CGEA 2AI1A 3IP5A 1JE0A 3M6XA 3HGMA 5JQGB 3K6KA 3O7MA 3EGWA 3GJ8A 4EELA 1NBAA 4LVOA 4DT1B 1CULC 3HCNA 5JI3E 9GPBA 1HV8A 4EGSA 1RIFA 2PV0A 2VJMA 4Z2YA 4NV1A 1ZESA 2J87A 4FNAA 3ZWVA 1FQOA 1BKDR 4O2BB 3UJBA 3EBPA 1A7EA 3H1FA 4FQ7A 4WZZA 3PXCX 1JPUA 3T8YA 2EPMX 4C14A 2ZT8A 2QMHA 3OEEA 4PRYA 4JLKA 1VM6A 1E2DA 4KIUA 5FR2A 2O8CA 3TSOA 2HQSA 4IGEA 1PFYA 2L42A 2AMJA 5HKBA 4TS3A 5JS1A 2OZLB 2GEBA 2N46A 1V5GA 3MW8A 1A2OA 2QS9A 5B7QA 2RONA 1QH0A 3CJRA 4ZO7A 1CJMA 5J43A 1Z2CA 5IAJA 2OXIA 2PNOA 3O39A 3AW9A 2FGKA 3OKCA 1BH2A 1QVWA 3NWBA 3NG1A 3BQNB 3JQRA 2AS0A 3PDHA 4DQDA 4KO4S 3I30X 3LD9A 4DCNA 1VLLA 5EESA 3QW0A 1RBMA 1HEYA 1UAYA 4IIJA 2LRHA 2V0CA 5B53A 2R4UA 4JV5B 3FWZA 3JVIA 1PEKE 1NR1A 4KJXA 5BSFA 2DFVA 2OKCA 4K7JA 1C8LA 4EI9A 3V9PA 5K8UA 2V26A 1JSLA 3BXEA 3PK0A 2EILC 3UMIA 3NVAA 4S05A 1UIRA 1VKNA 3ONFA 3M49A 3BE4A 3AVYA 1XO1A 2JFYA 4YH1A 1FVXA 4XIIA 4L22A 1ZR4A 4KBGA 2ZJBA 4MI3A 2J1LA 1ZONA 4C21A 2GAQA 3NYRA 4Q9AA 3SXKA 5A3JA 1FRFS 1YUBA 4GHWA 1J20A 4F46A 1TTHA 4HWRA 1GU1A 5KWIA 2WEKA 1RM5A 1IHOA 4BOYA 3OKAA 4IAOA 2HF8A 2QI9C 5IN4A 3CSDA 4G5FA 5C0OE 5BR8B 2L2QA 2PJUA 4LF8B 3FYHA 3HJCA 3MNFA 4W1QA 1NXXA 4R2MA 2XMZA 5C18A 3A1TA 4X64B 3BB4A 5J5VA 2GETA 4A03A 4JLVA 4CDGA 1UOQA 2V7PA 3D7NA 1DG3A 2ON6A 2C7VA 2Q3TA 1F1MA 1VJCA 2D59A 4DIEA 4KMRA 4H1HA 3I8SA 3EPPA 2NTVA 3G6WA 2I0FA 1R1DA 3E8SA 4Z49A 3TW8B 1NQVA 1E9EA 3HUFA 4U02A 2QZ4A 4E09A 1JEEA 1YL6A 4OHCA 3TECE 1AK2A 2BFCB 2HJMA 3CKYA 1C9DB 4JP2A 4IH9A 3OWHA 1ZI6A 2R7UA 3FCOA 1VHLA 4C6SA 2ZTVA 4BB9A 1UT5A 1NMEA 4AL1A 1LU9A 2VH1A 4ZPXA 3K1ZA 3R1IA 4HXYA 4HX5A 3R20A 1T9GS 1B76A 4QEDA 3RYCB 1KDZA 4CIYA 4CCYB 5F7JA 5IDXA 1I7NA 1R8XA 4KK4A 1M1XB 2ZYSA 1WG8A 4UM7A 5A4KA 3PCTA 3BE5A 1F20A 3RBZA 3OQMA 1WF6A 4MICA 1QAOA 1KE1A 5CA0F 4CLRA 3CSSA 1LK7A 4JGBA 1Z12A 4DMRA 5LZ4A 5CDYA 2H2WA 4S1TA 2G71A 3SICE 4JP1A 2Y3DA 2WM2A 1FR0A 1U0BB 4BFVA 1NVMB 1ZHOA 3O10A 3RKOF 3DDCA 4EHNA 2FB9A 3PPWA 3SS7X 1XQ6A 4CLHA 2VJLA 3GAZA 3HK2A 1EGQA 2DKFA 1GGKA 3DXJF 1ZCFA 4X7PA 3ZQVA 2HEGA 1VOTA 3FNHA 2IY8A 1RPZA 4DR5B 2CJWA 4XSHA 5FO0A 3LU1A 1STOA 1RW4A 3G8DA 4N8DA 3HJHA 4QQRA 2WG2A 4RJIA 4BLTA 1AUXA 1FFTC 1OW7A 1ZRNA 1QGUB 5HKLA 4C89A 4CV3A 5ALEA 4ZI7A 2V5VA 1GRQA 4PBSA 1FJXA 1ZYUA 2L19A 2J6CA 3UJPA 1T1SA 1EUDB 3WB9A 1H4SA 5CPBA 3K0BA 4YRTA 4JLBA 3VR4H 2MHCA 1THZA 4DQUA 2BKXA 1DEAA 3F7NA 4DNFA 1Z0UA 1V4VA 4DYVA 1IQ0A 2CC2A 1AGYA 2HF7A 3A8TA 5MN6A 1CP3A 2D00A 4EI2A 3CY6A 2XECA 4Y67A 3TS1A 2HV8A 3BGIA 1VCMA 3H1GA 2HIMA 2Q1YA 2C5BA 3S2FA 1KSGA 5IYZB 4TQUS 1XDWA 3FD8A 3AR7A 3E84A 3ZDLA 2HLDD 1C2TA 1BYUA 1KARA 3ELYA 3GU3A 4F2HA 1JHYA 3SF8A 4QOJA 2WJ3A 4PFKA 4YMUA 4A9AA 1X0VA 4QNMA 1SHLA 1J9EA 1U6HA 5DS4A 3PUHA 4LTNA 1T4CA 1KVSA 5ITZB 1G3RA 2SCUA 4KXVA 3FXAA 3SLRA 3ANYB 2VP5A 1C4XA 3PQ7A 2CLHB 1O94D 3TLKA 1L5SA 1TNDA 4L4SA 3WLAA 3OJCA 3KB6A 4DSNA 3VDNB 3YASA 4A23A 1JL3A 4CHTA 2KLHA 3EISA 1R4NB 4UVDA 4BC0A 2ZB2A 1PZHA 4U7HA 4CKCB