4YT5A

Hmdii from methanocaldococcus jannaschii with bound methylene-tetrahydromethanopterin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 111
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt5A01
4YT4A 2FSVA 1VI2A 1ZMOA 4Q39A 3X2FA 2EHDA 3PIDA 3IDSA 1HF3A 3S2IA 1DC3A 3HSKA 5TJ9A 3HG7A 2ZB4A 4B7XA 3D1LA 3SLGA 1O8CA 3UCXA 2WD8A 3JD1A 4FFOA 5BNFA 3FTNA 4DRYA 1D7OA 1K2WA 5J23A 4MP8A 4AJ1A 4NPCA 1UR5A 1U3TA 3ZH2A 2NQ8A 3NGXA 4KUEA 1XQ1A 4XR4A 2QQ5A 2VNAA 3WSWA 1SZJG 3UXYA 3AK4A 2GSDA 3E9MA 4LMRA 1DO8A 3SVTA 3ASUA 4E6PA 4J1TA 1T2FA 3UUWA 1U8FO 2IRWA 4YJHA 1LC0A 1UJMA 3F4LA 1SB8A 4QSMA 5K9ZA 3D4OA 3AI2A 2UYYA 1TI7A 1EDZA 3BHJA 4N7RA 2O3RA 3OJFA 2P4QA 3V5NA 1NQTA 2JJYA 1X1EA 3CTMA 4MKXA 3A4VA 2X86A 1PJQA 1BHSA 1KEUA 2YV2A 4HNGA 1JTVA 1ZVMA 3RIHA 1EUDA 2H9IA 3WIDA 4E5YA 4D46A 4UUPA 4YACA 4DIBA 2JHGA 2TMDA 2DLDA 1Y9EA 2C7GA 2FHSA 5ER9A 2OP0A 1E92A 1EVYA 2CZCA 3RUFA 4MVJH 1NP3A 2JKVA 4N5NA 4M49A 5ICMA 5T57A 1W8DA 1XA0A 1ULUA 2VZ0A 4BNGA 4Z0HO 4DTIA 3PDUA 3E03A 2BGMA 3R3JA 1R4NB 3GUCA 1P9LA 3KBOA 4OYRA 1D3AA 3VZPA 4E5PA 3QWIA 4MVJG 1UXKA 2EKQA 4OHUA 1X0XA 2Y66A 3WICA 4BNMA 4GX1A 5KJCA 4I5EA 1EUCA 3GVXA 1GUZA 4RVHA 4O1MA 3G1TA 2AA3A 2W2LA 3DZJA 1GEGA 3K6JA 4GWGA 4YJGB 3FWNA 2WYUA 1V35A 3AWDA 4DUPA 3DQPA 4CQMB 1Z74A 1LEHA 1PZGA 3H9EO 3IL2A 3U3XA 1AGNA 1EBFA 2WJPA 2V6BA 3E5RA 4OQZA 4WLNA 3N74A 3ZNQA 3DHEA 3M1LA 3GEDA 5IDWA 2HCTA 1K3TA 4UVIA 3QVXA 4ND5A 2NVUA 2BFAA 2NU7A 3S1LA 1DHTA 3DR3A 4BNXA 1X7GA 1ZIDA 1BG6A 3U4DA 2HMSA 2WMDA 3B1FA 1PJBA 1FJHA 4JP2A 4CMBA 4XRGA 1U4SA 4YAIA 2EGHA 3WWYA 3NGLA 5T6BA 5CEEA 3KYDA 3FSRA 5I7SA 4GMFA 3W4KA 2BF7A 1PS9A 3AFMA 2YJZA 1DIBA 2PKQO 1YRLA 2B5VA 4ZD6A 5K6AC 4XRRA 1VJ0A 2ET6A 3G3EA 4XYBA 4ZHSA 3ZGYA 2C5AA 2R6JA 4D41A 4PG8A 1ZK2A 1CERA 4BNKA 2WTBA 1UXHA 3ZWAA 1NASA 2ZATA 1HYGA 2G1UA 2V65A 2AG5A 2VZ8A 4QQRA 4HV4A 1DC4A 1I33A 1YGYA 1GR0A 1OMOA 2Q46A 3H5NA 3RBVA 4P38A 4IINA 3U4HA 2X23A 3ZW9A 1Q7BA 2P5UA 1GYRA 3NJ8A 4TRMA 4Y8VA 1N7GA 3ONFA 1H2HA 4CMJA 3D3WB 2I65A 4MJLA 1MV8A 4NHEA 1LRLA 2CMDA 1V6AA 4BQRA 3RC1A 4PG4A 5A03A 3N58A 3I83A 4C7KA 3WLFA 2B35A 3VZSA 3ZWOA 3GT0A 2Q2QA 2DC1A 3B1KA 2Y1OA 3IJPA 3VAZA 1BGVA 3DMTC 4WKGA 1VRWA 1QYVA 1HLPA 2EGGA 3WGZA 2BI8A 1N2SA 1N1EA 3WGQA 5G0TA 4JCOA 3ENKA 5F21A 5BR7A 4ZQBA 3GC6A 3SXPA 5DF1A 1P77A 2OBYA 1U28A 2JFHA 4NDNE 4XZ3A 4ALIA 1EZ4A 5THQA 1UXGA 4OMUA 3ORFA 5JAMA 4MIEA 2JCXA 1JN0A 4CMAA 4J0EA 1YOVB 3KZVA 1ISMA 1KS9A 4OSPA 2P9GA 4ALJA 3PLRA 3Q11A 1OFGA 5DZSA 4DXHA 5G4KB 1EE9A 3EUWA 1FF9A 3JQAA 2AG8A 1ZFNA 1RWBA 3GHHA 4MO2A 1LTHR 1U3UA 3ADPA 4Y6RA 4B4VA 3GA0A 4MIOA 1KVSA 3H5RA 1QMGA 5TSDA 1J4AA 2UAGA 5T64A 4ZQHA 4CMIB 3L0DA 2EKLA 5L45A 5COQA 4F46A 4CQLB 5JLAA 5I7EA 3F5QA 1IPFA 4YYZA 1ADBA 3P2YA 4BS9A 2E6UX 5DT9A 3RC2A 1WXDA 2NTVA 1LSUA 1ML3A 2DBZA 4FGSA 3O03A 3PVZA 3LU1A 5IN4A 5JC8A 1ZSVA 4TRNA 2NVBA 5JS6A 3GUYA 3KUXA 4UUMA 4GLLA 1Y8RB 2ZB3A 1DRUA 5H82A 3AU8A 1VJ1A 3LC1O 1O94A 1KY5A 4U7WA 1I8TA 5CDUA 3WJAA 4O59O 5KWEA 3UFXA 3WQSB 4MVJP 4QEDA 3K8ZA 3INGA 3L6EA 1MGOA 1I30A 4QT0A 1B26A 5I9NA 1DBVO 4RF4A 3QQPA 1E7SA 5DP2A 3A9WA 2Q49A 2YY7A 3PEFA 1TT5A 4BO3A 5GZ6A 3JQFC 3MZ0A 2XAAA 2Z1NA 4BKQA 5IDQA 4MINA 3WSVA 3NTRA 3ZWBA 1AHIA 3GVPA 3ZV6A 1HZZA 3K2EA 1MC5A 2ZYDA 1P1IA 5F5NA 4DQVA 3WTBA 2YQ4A 4E2XA 5L7TA 1XELA 2V7PA 5IXYA 1QV7A 1UAGA 4GVLA 5G4LA 1CJCA 1GQQA 3P5SA 3BMQA 3RC7A 4UVGA 5GZ3A 2OORA 1O9BA 2AQKA 2JCVA 2YFQA 4RZIA 4BO0A 5A5EA 1B0AA 2X9VA 4C7JA 1D1SA 1EVIA 4QXMA 1VM6A 4ALNA 1YDWA 5AOVA 3JQDA 4BO1A 1EBUA 5DNAA 4CM4B 4ZQEA 2PH5A 3NTQA 3GNSA 3KSZO 1DLIA 4XQGA 2HJSA 2DUUA 1DRVA 1GD1O 3M2TA 3QVWA 3WX0A 4RCVA 4IS3A 1VC2A 1XLTA 2OP1A 4PFJA 1JAYA 2QX7A 3IP1A 5CG1A 2A35A 3WQQA 2HMVA 4YJHB 4Y98A 1NXQA 5KJFA 4HBGA 3TWOA 1HDGO 3MWEB 1SOWA 3CIFA 2W98A 2CUKA 4OQYA 3C24A 4TZKA 1ID1A 4BO8A 1R6DA 1LDGA 1MFPA 4R9SA 1HL3A 1YVEI 4A73A 5A3VA 8LDHA 5DDIP 4AJ2A 3FPCA 3NEPX 2Q1UA 2NSDA 4E5MA 3R0IA 2PD6A 5B37A 2IDZA 4CUJA 1F17A 5IZCA 4GGPA 3LVFO 1NBOA 1ZJZA 4PLVA 5F3RA 1QXSA 1ORRA 2O3QA 5ITVA 4HFMA 2UVDA 1C0KA 2P68A 3WYEA 4G65A 1ISGA 4PN3A 3CSDA 5JY1A 3GFGA 2GF2A 1ZK0A 3DWFA 3KM0A 3PFWO 3OIFA 1K6XA 1X7HA 2BI7A 4WEOA 4XWYA 4ZVVA 2P9EA 5C37A 3DTYA 4FFPA 4BNVA 3A28A 5BT9A 1QLHA 1X14A 1YH3A 4DBVO 1GV1A 3GRPA 4KWIA 4NMHA 3T7EA 2GCGA 3BA1A 2Z95A 1EVJA 1V3VA 3QY9A 4IDBA 3H5AA 1A72A 3C1OA 3VDRA 4D3DA 3HDHA 3BTVA 5JYEA 4ND1A 1I36A 1XCBA 4BNIA 3PYMA 3KO8A 1E6UA 1ENYA 1LDBA 3TDKA 5C7IO 2VYND 3GDOA 4RV9A 2W2LD 1JKJA 3N7UA 5HM8A 1O6ZA 3IAHA 4PLHA 4Z6KA 5L4LA 1R4NA 1F8GA 4J16A 1PQUA 4ALMA 3UW3A 5A02A 2F1KA 4CR7A 3D5QA 3RVDA 3ICPA 1SMKA 2YDXA 4HY3A 4NG5A 2GN9A 1F14A 2NVUB 2EXXA 3OECA 2PV7A 3VKVA 2I9PA 2C7VA 2GASA 5TLSA 2Y0EA 4OOFA 5JBIA 1V8BA 1BRMA 4DWVA 3ITDA 4J43A 4CM5A 3CE6A 4YJGA 1M6HA 3UOGA 3A14A 3JQGB 1JAXA 5JAQA 3WLEA 5A1TA 3DDNA 3ASVA 3BIOA 2WE7A 4KMSA 4CQMA 1T2DA 1YL7A 1NR7A 3RUAA 2VZ9A 1WNTA 4IQ8A 2V6FA 5TQVA 1R15A 8ADHA 3PPIA 1NFRA 2RH8A 4MPDA 4MP6A 4R1NA 4KTVE 5JC1A 3ZWWA 4NJOA 2VRCD 3FNFA 4JLWA 5TNXA 3HWRA 3F47A 1X1TA 1KVQA 2F00A 4I9NA 4J7XA 4OXNA 1TVEA 3BTOA 1YL5A 2VHXA 3OM9A 3PGXA 1P74A 4LRTB 1T2CA 4GVXA 5GMOA 1U2GA 4BNUA 5IF3A 1A27A 3QLJA 1P33A 1HE3A 1T26A 3QVTA 1A9YA 4XYLA 1H94A 4D0SA 3ZHBA 4E30A 3Q2IA 1WDLA 4AJIA 1LSJA 3PZRA 2E37A 2O7SA 1JWAB 4GBJA 1ZW1A 3DZFA 4DVJA 1Q7GA 4AJPA 1YJQA 5ES3A 1IHYA 1ULSA 4IZHA 4PRKA 3RKRA 5DBFA 5IN5A 2HRBA 4PIVA 2CF6A 2ZTMA 3DOJA 5KJEA 4Z9XA 4UUOA 3GPIA 1O5IA 1H6DA 3HFSA 4AJLA 5ENDA 2GDZA 3AM4A 2GZ3A 3GH3A 3V1UA 1SAYA 2B5WA 1WDKA 4FOOA 4RJTA 4OKIA 3I9KA 2QYTA 3C1AA 3GG2A 4Z9YA 5JDIA 1PQPA 3E18A 3VKUA 1NAHA 5A5FA 1GEEA 2RCYA 4AICA 4OKNA 3VH1A 4YXFA 3RFVA 2CY0A 1HDOA 2SCUA 3OFSA 4CL8A 3ZHZA 5CFZA 2FR8A 3PK0A 4MKZA 1XEAA 1MUUA 3W6ZA 2AE1A 4HFRA 4NIMA 5TC4A 4G2NA 4M86A 4LMPA 1HT0A 5G0SA 4CM3A 3C7DB 4R51A 2IZ1A 3ON5A 1WZIA 3PGJA 2PZJA 1Y5RA 4FR5A 4BNJA 5EMHA 2JFFA 1SPXA 2V6MA 1YOVA 1ADFA 3DBHA 1PJCA 4W99A 4E5NA 1P44A 1P0CA 4KWHA 2VTEA 4BGVA 5B12A 4DREA 1E1KA 1J0XO 1GQ2A 4WUVA 2CDCA 5B4TA 2V6GA 2Z1MA 4XIJA 4Z0TA 1WWKA 1E7YA 1H93A 2QG4A 3DBLA 5JY6A 3CUKA 3KLPX 1X0VA 3TL3A 4RPKA 5CEJA 2Y1GA 4BNWA 3RWBA 2ZCVA 1N7HA 3PIIA 2NV6A 2NVWA 3WIEA 1XG5A 4IJWA 1RKXA 3SX2A 1UDCA 2OZPA 2EJWA 2J5RA 4CQLA 4ZU3A 2X58A 1E3WB 3K31A 4WLEA 3JYNA 4W7IA 2DTDA 3KETA 3LT2A 3OH8A 4CLHA 3HB4X 3F1KA 4J91A 2ZKLA 4LCEA 4M89A 2FPPA 4Y6PA 1S6YA 4OL9A 4DYDA 3VC7A 3ANNA 4BO7A 4AJOA 1QP8A 5JW6A 5FYDA 3HZZA 4W9NC 4IDFA 1QSGA 1Y8RA 1LLCA 4IY1A 2Y0DA 2G17A 3PWSA 4J1QA 1LRKA 4TZTA 3LC2O 2HDHA 3VPFA 2CSUA 4HNHA 2NQTA 1BMDA 1XHLA 3L77A 1GPJA 3WQRA 3WGOA 2FR0A 2NTJA 4B7UA 2Q4BA 1GYPA 1UP4A 2FPGA 3PHHA 2AQ8A 4Y67A 3OICA 1IULA 2POQX 2VRBA 3H8VA 4K6FA 4J7CA 2B4TO 3QRWA 4LVCA 4AJJA 4X54A 2ZJ0A 5TT1A 2XF8A 3I5MA 1FMCA 3HN2A 4EGFA 4DLLA 4E12A 4WNIA 3WWZA 2VCYA 2HSDA 3JSAA 4UVDA 1ZMTA 3ANMA 2GPTA 2Q99A 1EQ2A 2E48A 3WGTA 1DSSG 3BHMA 2UV8A 1LBEA 5B4VA 1KVRA 2HKIA 3KHUA 3S8MA 4P8RA 4ID9A 3C85A 3BAZA 4DPLA 3QIVA 5EINA 5A04A 4JP3A 1FK8A 3EAGA 4BO5A 3JYOA 4YWJA 3B6ZA 4YR9A 4BO2A 4A2CA 3A06A 3WGYA 2PH3A 5FWNA 4L9RA 3VVBA 4CM4A 1R0LA 3DO5A 1NQOA 2J5KA 3E82A 2RAFA 3GK3A 4IMPA 1QLJA 4GL4A 1LDEA 2VUSA 4IUYA 2ZCUA 1ADCA 1T25A 5CG2A 5TJHA 5I8WA 3IP3A 3HHPA 2HJRA 3ZWYA 1DJNA 4E5KA 3L4BA 3PQDA 4IXWA 1JDJA 2ILTA 4E21A 1SBYA 1LU9A 2IXBA 1MFZA 1ONOA 1RYDA 3GFBA 4XDYA 4BGIA 3I6IA 3NT2A 3NYWA 4PLZA 4WGGA 2X5JO 1B3RA 1JVBA 2PWZA 2R2GA 1MB4A 3S2GA 1KOLA 3ZU5A 4R1TA 2X6TA 3T4EA 1BVRA 1GADO 2BKAA 1FDVA 1M76A 4YTEA 2JD1A 4RF5A 1RM5A 1MXFA 5DN9A 2W2KA 5EL0A 3DZGA 2VWHA 3LYLA 2BFOA 3DBRB 1UZMA 1PJSA 1VL0A 4NFSA 1EDOA 1VKNA 3AY6A 4WCFA 5IJZA 2CFCA 3GLQA 4BGEA 2P9CA 1GV0A 4XQCA 5ENVA 1ISHA 3EK2A 3WFIA 1NFFA 4D43A 3MJ4A 3GY0A 3QV1A 3U4CA 3Q0EA 5HTOA 1C0LA 1LDMA 4I8XA 3RBXA 1ZCJA 4IJKA 2Q1WA 1DFIA 2I66A 4UEKA 5F1OA 3K92A 4FW8A 3CKYA 1WLYA 5JPIA 4XGIA 4YVFA 2IZZA 3GZNA 4ZA2A 3ZI0A 1SNYA 2YFHA 3S2FA 1MG5A 4UEJA 4BGUA 4BNLA 1UDAA 2DTEA 3S55A 1G1AA 5T8KC 3PHJA 5L40A 1H0KA 5CAEA 3JV7A 1EEHA 1UDBA 2I99A 3DAPA 4PVCA 3EDMA 4NBWA 1BDMA 2ZK7A 4GGOA 1O0SA 1WP4A 2JAPA 4LISA 4ZGWA 4ZICA 3MCVA 3PZBA 4ROSA 4B7CA 4YAGA 3WGIA 4YRAA 4CQMD 4YA6A 1Z6ZA 1HDRA 1KC3A 3H9JA 1B14A 1E7WA 3H9GA 1B8UA 4RF3A 3ONEA 4MVJM 3IOYA 3L4SO 5KVVA 4H7PA 3GRKA 4FJ2A 3TZCA 4Y6SA 4LRSB 4NNJA 2G0TA 2VWQA 4DPMA 3UCEA 4J1NA 1TT7A 1UP6A 1WZEA 4CLRB 3BMNB 1NM5A 2Q2VA 3K30A 4MKRA 3DZIA 1H9BA 3JQGA 3DMYA 4JROA 4U0JA 1PIWA 5DCUA 1ZZEA 2D8AA 1AE1A 4OM8A 1QV6A 4JJFA 1OOEA 3ZDFA 2JHFA 3TN7A 3ST7A 2P91A 4R3NA 3ROMA 5JCJA 2NM0A 3VH3A 4RF2A 3PYLA 2VOJA 4RL6A 4BB5A 5EQFA 1M66A 1WAMA 4XB1A 4YAKA 4WK6A 1LNQA 4IIUA 4RGBA 4CJXA 2VWPA 2X9NA 3DAGA 3CH6A 4J4BA 4ALLA 4PGFA 3OEWA 3D0OA 4HFNA 4NR0A 3HDYA 5JCXA 1HTBA 5KCZA 3U62A 3TF5A 1NQAO 3UVEA 2DFDA 1OBFO 1DPGA 2HK8A 1Z45A 4Q3DA 4WOJA 4BNYA 4TRJA 3WGGA 2IYOA 4O5OA 5L3ZA 3GAZA 4FN4A 1C1XB 3QVOA 4Q9NA 4GAEA 4RLHA 4I9HA 4WE3A 1PJ3A 3F3SA 2GZ2A 3FWZA 4PLPA 1YBAA 1MP0A 2XPCA 4J9UE 4LCJA 1QYXA 1U8XX 4C4OA 1LQUA 3W4IA 4CV0A 1LC3A 2J3IA 1T4DA 1BVUA 1UH5A 4CUZA 4IIVA 4L74A 4JN6B 5BNTA 2X7HA 4WJZA 1SC6A 1PS0A 5F1PA 1NVGA 4RVFA 4FPXA 1G6KA 3NRCA 3CXRA 3AUTA 4YQZA 1P0FA 1C1DB 3CZRA 2Y1FA 4DIFA 4DL9A 1J49A 4UULA 3DBHB 1ONPA 3GN1A 4Q3EA 4D3FA 3NV9A 3OMLA 3C3XA 4BV9A 1V3TA 1D8AA 4R69A 5U1PA 2HK7A 1PQWA 3D3EA 4B8ZA 1C14A 3DZKA 1A71A 1H6AA 3DBLB 3DXFA 4P4GA 4R16A 5A05A 1U3WA 4BL5A 5KVSA 2HRZA 2I3AA 4A03A 3C1TA 1GZ6A 1ZSNA 4MVJI 1UP7A 4A0SA 3WNQA 3QHAA 2FZEA 3P19A 5BSHA 1R16A 1CDOA 2DBQA 4G81A 4II3A 1ZEMA 2DU8A 3JQCA 4JX8A 1G0OA 2JL1A 3FN4A 4F6CA 1ENZA 1J5PA 3FD8A 4AFNA 2IEBA 2IODA 4JXKA 1LQTA 5HA5A 3QWAA 1F0YA 3F1LA 3JQ7B 3RFTA 5U4QA 1H6CA 3ZNNA 4MVJE 4DA9A 3MJEA 4YT8A 1YDEA 3ZU2A 3U9LA 1CIVA 1HE4A 1U7TA 4YAJA 2BLLA 3PQFA 3G1UA 2Y93A 3DOOA 3AI3A 1IZ9A 4P22A 4NFYA 5CPFA 5KKAA 4ND3A 4DLBA 1U4OA 3TNLA 2DBRA 3I9NA 1SO8A 4YQYA 2VHWA 3LT1A 2CVQA 2ZYAA 1D4FA 4YT5A 1KYQA 3I9JA 4M55A 5TT0A 2CVZA 4GQAA 3GEGA 3RUHA 4E13A 4LW8A 4R5MA 1E3WA 4FDAA 3ETDA 1FDSA 2PGJA 3PHLA 4CV3A 4J49A 1AHHA 2PLAA 4NBRA 5L7WA 1B15A 3I9LA 3GVIA 1VJTA 2BMAA 3WG9A 5K6AA 3FR8A 4ND2A 3SBOA 3COSA 3T4XA 1P1FA 4RPJA 3OJEA 1ZH8A 4W4TA 1N92A 4D79A 4WASA 1VPDA 3FNHA 3JD4A 1JWBB 1SEPA 4Z9FA 4JBHA 3VPHA 1M75A 3EVTA 4E2ZA 4N18A 2GN6A 3EVNA 3HQ4O 2PZMA 4D7AA 1ZK3A 3CPSA 2AEFA 3GHYA 2NU6A 3MOIA 2PGDA 1XR3A 3IS3A 1PWXA 1YKFA 3K9QO 1EVZA 1XGKA 4GKBA 1IL0A 1BWSA 4BMNA 3R1IA 5ILOA 3E48A 4TROA 4A10A 1U3VA 3BZUA 3JQ8B 3UCFA 3LC7O 1IOLA 2C20A 1DFGA 2PKRA 4CMGA 5HRUA 2HMTA 4JK3A 1XSEA 3DMTA 2DKNA 4ZQGA 1Z82A 2VTDA 4EUFA 3TPCA 4KDEA 1YB1A 1E77A 1BTOA 3NUGA 5T5QA 4PLWA 1I2ZA 3K73O 1BW9B 1NFQA 3F4BA 4WLUA 1B2LA 4R54A 5CDYA 1HDXA 2X5OA 2FPIA 4F6LA 3JQBC 1E3IA 1PZFA 4RVUA 3C7CB 1I10A 2LDXA 4QX6A 4CLDA 1NHGA 3RJ9A 5JAZA 3ICCA 3JCZA 2C59A 3G79A 3I6QA 3I9MA 4FD3A 4GX2A 3RASA 4NJMB 4NK4A 3BHIA 1VKOA 3AUSA 4HP8A 1QRRA 2YZ7A 1YL6A 4FS3A 1R4MB 1BXGB 2Z5LA 1ZUD1 3EZYA 4PLGA 2W2KB 1GQYA 3EW7A 3VH4A 4W7HA 4B3JA 1Y7TA 3H9UA 2TMGA 1E7RA 3HDJA 3KV3O 4A26A 3NAQA 5TIIA 1YS4A 2LDBA 2EIHA 3M2PA 4E3ZA 3AI1A 4WCFB 4HKTA 3QE3A 1T24A 1PJ2A 1E1NA 2DTXA 2ZB8A 1UUFA 5FEUA 4FGWA 3QWBA 4UUNA 4J90A 2GN8A 5DOZA 1DAPA 3DZHA 3DEYX 2OMEA 2D2IA 3FNEA 4OOEA 4YDRA 1DIGA 3AOGA 4B4WA 4JGBA 2C54A 1M67A 1X15A 1YQGA 2AQHA 1YQDA 2FR1A 2RH4A 1E5QA 2DPGA 2O7QA 2JAHA 5C7OO 1PL7A 3ROQA 4CODB 3GZNB 9LDBA 2NTNA 2X22A 2XXJA 1DOHA 2X8LA 5KJ6A 5JDIC 2JD0A 1DFHA 4JBIA 3KYCA 4R01A 5JO0A 1ZKMA 1ZO8A 1RM0A 1UZNA 3ROKA 2BGKA 2FRDA 2GNAA 2BRUA 3OP4A 3RC9A 3DBRA 1K0UA 2FWMX 1N9GA 2C82A 3VPSA 1EK6A 1IY8A 4BNTA 4ZN6A 1GCOA 1ZK1A 5F1KA 4OSOA 3MJSA 2GN4A 4O6VA 1T1SA 4K28A 1I01A 4J2HA 4FC7A 2QZZA 3D5TA 4G5HA 4NQZA 5DP1A 4EUEA 4EEXA 2AEJA 2XOXA 3RI3A 5JAIA 4ZRNA 3JTMA 2VOEA 2O2YA 1KC1A 2YHUA 2C2YA 1WMBA 4LSMA 5DBGA 4NBUA 3AOEC 1MG0A 4HX5A 1QYDA 1B7GO 1LLDA 2HMWA 4EI2A 2EP5A 2ZB7A 1YXMA 5IFLA 4TKMA 4AJKA 3D7LA 4DPKA 3PJEA 1EUZA 3WJ7A 3H9QA 4IBOA 5MDHA 3K2BA 3AJRA 1JLLA 1W6UA 3ABIA 2O4UX 2X9GA 4W82A 3R3SA 1UAYA 1HKUA 5G0UA 1P1HA 4WLOA 5C7LO 1RPNA 3GNQA 4EJ6A 4CLRA 3SLKA 3BMNA 3PQEA 3LDHA 2HUNA 1QYWA 4DIOA 4R1UA 3ROPA 3ZWCA 3HE3A 1I24A 2EWMA 3UICA 5ER6A 1E1MA 1P31A 4MIYA 1VL6A 2WDZA 4F3YA 4E2WA 2VYVA 4WEQA 2VUUA 1JKFA 1PZEA 5LC1A 4KUHA 3HJAA 1SB9A 5DBIA 4J9VA 4CMKA 4L75A 4ALKA 1NPTO 4R41A 3GNTA 2AE2A 4EW6A 4EUHA 5KNLA 3NX4A 1KEPA 4H15A 3ZWNA 3RKUA 3VZRA 4Y9DA 1LJ8A 4YT2A 1F12A 4PZCA 3RFXA 3OQ6A 5JDCA 5CPBA 1E6EA 3G17A 4H3VA 3W6UA 1U7HA 2DFVA 4J6FA 4AJHA 2I67A 3EC7A 1LSSA 2VHYA 3Q3CA 1DHRA 7ADHA 2OBNA 4F45A 4RORA 1YQXA 4B3IA 1C1XA 1ZNQO 2EG9A 4CM9A 4FFMA 1AXEA 4PZDA 4EJ0A 3ANLA 1I32A 4YEDA 2YYYA 2HU2A 3Q9NA 3I1JA 3TQHA 4WLFA 3JD0A 3L9XA 1ZJYA 2CNBA 3GMSA 1LI4A 1B3BA 3JQAD 3LSYA 3OA2A 4HUJA 3NDJA 3OJOA 3H3FA 4RPGA 1O95A 1ONNA 4IGEA 1L1FA 3AM3A 5CDGA 3F9IA 2RIRA 2ZTUA 5DULA 1EK5A 1C1DA 1PGPA 4RDIA 3M1AA 4K6CA 1J6UA 2WM3A 1H6BA 5AVOA 2OXIA 3WDSA 4L8VA 1HZJA 2PKQP 1VE9A 4KDFA 3R6DA 3FPLA 1GDHA 3GVHA 1XIVA 4LN1A 4NK5A 4TRRA 5BSFA 1GUFA 3WMXA 4LGVA 4HADA 2GR9A 4J1SA 1DRWA 3ZWXA 1I3KA 4DMMA 2VQ3A 3PLNA 5CDTA 4XYGA 1X13A 2WD7B 4M54A 4D3SA 3VPGA 2AQIA 4L76A 2B83A 1NVMB 3KB6A 4GH5A 5EQDA 2P4HX 2C07A 5EN4A 4AJEA 5JSFA 1GZ4A 2BHLA 3AUAA 2GO1A 3I3OA 4R1SA 1YO6A 2J3JA 3OETA 4WCDA 5T67A 2D3TA 1PL8A 4UEOA 3TOZA 3NTOA 1AXGA 4IGFA 4RPLA 2Q3EA 4S1VA 4RZHA 4JIGA 4K9DA 1O89A 1ZEJA 3QSGA 4XX0A 3JQ7A 5AXBA 3GPDG 3JD2A 4GLOA 2PD3A 2A9FA 1LLUA 3TSCA 4FFNA 1T4BA 3OHSX 1R0KA 3Q1LA 3VDQA 4B3HA 1NX6A 4J0FA 2WYVA 4NBVA 4YJFB 5HS4A 5IAAA 4BO6A 2YHIB 3KXDA 4BUCA 2YDYA 3GVCA 2AW5A 3PP8A 4PLYA 3KEQA 4OAQA 4U0KA 3PWZA 3AY7A 3UHAA 1BSVA 3H4VA 4RDHA 1H2BA 1EFLA 3EYWA 3PI7A 1CWUA 4RQTA 4GMGA 1R66A 4IDCA 1B16A 1RYEA 3FI9A 2GERA 3A1NA 3RU9A 3LK7A 1YJ8A 2WSBA 2BD0A 3PHGA 2OGUA 2FSSA 4BQPA 4BNZA 1NPDA 2H1SA 5KKCA 3WBBA 1I0ZA 1GAEO 1HWYA 3L07A 5G2OA 2PA3A 4FSHA 3DHYA 3ZV3A 2OUIA 2W4QA 5C5IA 4RPHA 2DM6A 3FCOA 3TZ6A 1U1IA 3C7AA 4M1QA 4A27A 3WBFA 1GUYA 3ETGA 1NQ5A 4QFDA 3TZHA 1GFSA 3H6KA 3O26A 4IDEA 3TRIA 5COBA 2R00A 4J7UA 3Q9UA 4GKVA 2XXBA 3U5TA 2ZTVA 5A9SB 2VT3A 1L7DA 3GDGA 1S7CA 2EW2A 1ZSYA 2Y1CA 3KTDA 1A9ZA 1U5AA 3HFGA 2J3KA 1RM3A 5GZ1A 4U8GA 4DMLA 2Q45A 1QORA 4NBTA 2BH9A 1NHWA 3OEYA 3PWKA 4NFHA 4GSKA 3CINA 4PG7A 2O4CA 5IDXA 4XEHA 5I9MA 3D4PA 3H3JA 3JQ8A 4PG5A 4KUGA 1ENOA 1XWFA 2X0JA 4ITUA 1C0IA 5I9LA 5L4SA 3K5PA 5JYDA 5LDHA 5TF4A 2J5QA 1LSOA 3PFFA 3G49A 1BW9A 1Z73A 4NI5A 4D42A 7MDHA 1HSZA 1XU9A 1KEWA 2E82A 2WEKA 2HMUA 2QHXA 3C8MA 1Q7CA 2I3GA 4GSLA 1P1RA 2O3SA 5CP8A 2PR2A 4QUKA 4R9RA 1A5ZA 4TKLA 3ZU4A 1HEUA 3B1JA 2G82A 3KVOA 3MJVA 3WGHA 4BO9A 1I2BA 1I2CA 4B79A 3EGOA 2Q1SA 4NJMA 2UUOA 4DC0A 4RLSA 2PTGA 1ADGA 2Y68A 2YV1A 2I6TA 3KLMX 1N1GA 1TLTA 3AW9A 1R4MA 1BXGA 2Y0CA 3KYCB 4MVJF 2O2SA 4IJUA 1E0DA 4LVUA 1XYGA 4TMFA 4UREA 1Y8QA 4PLTA 5DCYA 4RO0A 1CEQA 3KRTA 3OA0A 1GTMA 3BMCB 1N9GB 1MX3A 2NUAA 1SCUA 3I4FA 1OI7A 1LXCA 1LLQA 4BMVA 2FP4A 1YE3A 4WLVA 3DHNA 1Z75A 4GWKA 1PSDA 5AYVA 3GZ4A 3WNVA 1HE2A 4IJVA 4HFJA 5LCXA 5JO9A 3OJ0A 2YQ5A 4XJTA 3DFUA 2DVMA 1PJTA 1NWHA 4JJGA 1PWZA 1XQ6A 1GZ3A 5ITWA 2O3TA 1EFKA 4EEZA 2O3JA 3MJCA 5A3JA 4BNFA 4TQGA 4CMEA 3VTFA 3RUEA 4W9NA 1V3UA 2NNLD 2X0RA 5G0WA 3JQ9A 2DBVO 4E4YA 3UF0A 1HLDA 3GF4A 2AXQA 4I08A 2G76A 3H2ZA 1I3MA 4IQGA 3SC4A 1DC5A 6LDHA 5KJ1A 2NU9A 3GDFA 3GG9A 3CZMA 5JFOA 3BTUA 1U2DA 3NJ4A 2VYNA 2GZ1A 4DYVA 1ISJA 1YONA 1E5LA 4A5OA 5IZ4A 2GLXA 1Y6JA 3AU9A 2Q50A 3DFZA 1A4UA 4PRLA 2RHCA 2AMFA 4XD2A 3ZU3A 2VN8A 1NVTA 4CLOB 1Q2XA 2VUTA 5FI3A 3RUDA 1L7EA 4Z0PA 2Y67A 4OH1A 1Q1NA 4CV2A 5L9AA 2D59A 4QTZA 3IKTA 2EV9A 1HXHA 4UAGA 1DAOA 4E0BA 3BMOA 1ZK4A 3IKVA 3ZHXA 1GU7A 3LF1A 5FF9A 2HLPA 3NT4A 2QRKA 5EIOA 1Q0QA 1E7MA 3E9NA 5AXCA 3ZNPA 1WW8A 1BXKA 2HAEA 2VYVD 2A4KA 3NDRA 2Y99A 1U5CA 3JD3A 4KOAA 4WOKA 3WYBA 4KP7A 4BNHA 1CQJA 5TRTA 3DONA 4FOSA 3DL2A 3W8DA 1ISFA 5K0ZA 5KIAA 5COAA 1C0PA 2RBEA 4ZQFA 2YW9A 3L6DA 4WNCA 4YPOA 2D0IA 2E49A 5AXDA 4XJSA 1GY8A 3M6IA 2VRCA 2X5KO 5A9RA 2UDPA 1YB4A 2JD2A 2BFPA 3L9WA 1KERA 4JBGA 5EERA 2HO5A 2WWRA 3FBGA 2EKPA 4CM9D 2E4AA 4OO3A 1IPEA 1ARZA 3UAGA 3ZV5A 5I7VA 3QVSA 4IQ0A 5TGDA 2QRLA 3GGGA 3DAFA 3NDIA 1PEDA 4D44A 1IUKA 2JFGA 5MGBA 1R0SA 4XKJA 5CDSA 5L7YA 3U0BA 3LZ6A 3FBTA 4IDDA 3TL2A 3ZW8A 2O48X 5H81A 1A4IA 3OSUA 1E7QA 2YV3A 3JQEA 5L51A 1I3NA 4YAEA 3WOHA 4IXTA 2IEDA 2C2XA 2B69A 1CF2O 3QA9A 3KSDO 1KIFA 4TSKA 1AUPA 1PJLA 4R68A 1ENPA 4J3FA 1C3VA 2O3UA 4FQ8A 3H65A 4CM8B 3PJFA 4E32A 3WTCA 3U4IA 3GQVA 5FFFA 2VWGA 1HDCA 3PTZA 1B8VA 1QR6A 2EW8A 3JYLA 3WR5A 3DBVO 5I8ZA 1T2EA 3SJUA 1CETA 5EJ2A 2AHRA 4DGSA 1EMDA 4EDFA 1MLDA 5KTKA 1FDWA 3MTJA 1F06A 2DUWA 3FTPA 3GAFA 3MWDB 4Z3DA 3V2UA 1JW9B 5IZCC 3X2EA 4Q3BA 1P1KA 4MVJA 1P3DA 5T8KA 5A06A 3JYQA 4XGKA 3IC5A 2B36A 4TVBA 3QJ5A 2PZLA 2P2SA 1K6IA 4QFCA 3NKLA 4D45A 3PJGA 4QO7A 1TEHA 4ND4A 1W0CA 3O8QB 4L4RA 3VHRA 4BMSA 2ZTLA 4MDHA 3S2EA 1JU9A 1NWCA 2X4GA 3DOCA 2DQ4A 3OIGA 1LX6A 2WD7A 5B4UA 2GD1O 3CEAA 4PCVA 1GCUA 4I9UA 4BKRA 4QECA 4CM7A 4FJ0A 2GGSA 3D64A 5JXWA 5B1YA 2O50A 4BB6A 1IYZA 2GRAA 3OQ1A 3V1YA 1A7KA 4NZ9A 3EMKA 2NU8A 5BSGA 1LA2A 1M2WA 1K6JA 1KBZA 2WE8A 1GL3A 2PY6A 1Y81A 3I4CA 1EE2A 3V2GA 4GX0A 4XQEA 3ETEA 1PJ4A 2QZ9A 2D4AA 4OIMA 5DOVA 1YWGO 4DC1A 3U09A 3SEFA 3JQ6A 1VL8A 4AG3A 3WFJA 3K96A 1JVSA 4CM6A 3B20A 4ILKA 4YJFA 3INRA 2YHIA 4URFA 1A7AA 1E3SA 1MC4A 4II2A 4OGWA 5IXSA 1Z7BA 2CDBA 3UN1A 3ZWPA 3ENNA 5AXAA 5CEFA 2QYSA 1GYQA 1BDBA 4TWRA 1PZHA 1WVGA 4BNNA 1UZLA 2RHRA 1FXSA 1U9JA 1NAIA 3IUPA 4LK3A 1G0NA 3ITKA 2B4RO 2NADA 1I3LA 3PDJA 3H7AA 1CQIA 3AUUA 4BO4A 1TXGA 5BNIA 1V9LA 3HDQA 4B8WA 4N5MA 3D4NA 3VZQA 3ZWVA 1DIHA 4BV8A 5TX7A 1P45A 4U6QA 2A94A 1ZXBA 3V2HA 5THKA 1F8FA 3LT4A 1PR3A 1VSVA 3O38A 4WPGA 5G0VA 1UXIA 3ZV4A 5U9CA 3KYBA 3FHLA 5HS6A 1JKIA 5A9SA 1E6WA 5L95A 4AJ4A 2B4QA 4IDAA 3OJLA 2DT5A 2ZJ1A 2QRJA 5KVCA 1KEVA 3STHA 3FR7A 4B4UA 3G0OA 3ADOA 1YBMA 1W73A 3RUCA 3E9QA 4U6SA 4BKPA 2DAPA 2OHXA 4Q3AA 1HDZA 4NU6A 2ZQYA 2FN7A 3RROA 1PGNA 1N8KA 2CVOA 4KZPA 1Y8QB 3E5MA 1EQUA 4FBGA 1KVUA 4XDZA 5EPOA 4FIZA 1E3JA 3DC2A 4UVEA 2C5EA 3I23A 4R3WA 3TZQA 1MA0A 3HN7A 3RSHA 4ZRMA 4INAA 3CMCO 4PZEA 3RU7A 4AL4A 3ULKA 1AN9A 5KVQA 2H6EA 2VNSA 5JDCC 3RJ5A 2PFGA 4K26A 1OC2A 4R4JA 5DCWA 4ZJUA 1LDYA 3Q6IA 4YRDA 3OBBA 4IS2A 1PS8A 4PLCA 1Q0HA 1KVTA 2EJVA 4AVYA 3PJDA 1K89A 1OAAA 2DPHA 1LUAA 3O9ZA 1W4ZA 3OIDA 3HB5X 5L53A 3QW2A 4CPDA 2G5CA 5EESA 3SC6A 2WYWA 2X1HA 4BKUA 4EZBA 5L4NA 2X0IA 3BMCA 1B8PA 3RQSA 3GEMA 4FFLA 4IDGA 5TS3A 5CHEA 3IIEA 4CM1A 1Y9AA 3DB2A 4YB8A 3ZCXA 2VHZA 3MEQA 4OXYA 2A92A 2Q4EA 4RQUA 4J2OA 3LLVA 4O0LA 3DZBA 3VOSA 1NNUA 2Y05A 2CF5A 4FB5A 3RBZA 3JQFA 9LDTA 4KQXA 2I76A 3W4JA 1QYCA 2Q2WA 1PR9A 4CR6A 1HDYA 2ZIZA 4R5HA 2J3HA 4YRBA 3BYZA 2J8ZA 4Z3KA 1H9AA 4XIYA 5BSEA 3AY3A 4IZIA 4MP3A 4Q3NA 3GMDA 1JA9A 3E1KA 3U49A 5FI5A 3LT0A 3PHIA 3HUDA 1PGOA 1HSOA 1OZAA 4GX5A 4RVGA 2H63A 3OF2A 3BMOB 1LRJA 2Q1TA 4NH4A 2QIOA 3EHEA 1VSUA 2W90A 4PLFA 4DBZA 3O4RA 1CYDA 2BGLA 3IJRA 4JNKA 4HWKA 4P4NA 1T2AA 3NT5A 4A7PA 3WYCA 4XQ9A 5JCJD 5GY7A 1E3LA 3VVCA 4CLOA 1PU2A 3KYDB 3UGKA 2EP7A 1P1JA 4XCVA 3PYXA 3BTSA 1I5RA 2CD9A 5JMPA 4J4TA 2AEMA 2Y1EA 4CMHA 3L6OO 3ZWMA 1ISIA 2NLOA 3LQFA 4FCCA 4CV1A 1T1RA 4P4LA 4KTTE 1OC4A 1VLLA 3AFNA 1FDUA 1DB3A 3UH1A 3GOHA 3WXBA 4L4SA 1X7DA 3JQBA 3I52A 1R12A 4QO8A 3P7MA 2PGLA 2ZYGA 4IMRA 4OXKA 1HYHA 1PX0A 1XKQA 3V8BA 4WECA 1DDOA 1Q0LA 4DQXA 3UKOA 4L73A 3MTGA 5BQFA 2PNFA 1WMAA 2VHVA 3RAJA 3V1TC 5AQ1A 1TA4A 1SOVA 3IMFA 1R37A 2YUTA 3LLSA 3ONDA 1Y5MA 3WMWA 2D5CA 3PRJA 4GPD1 1DXYA 4M87A 1NR1A 4S3MA 4EBFA 2BFMA 5IDYA 4TVOA 3W8FA 1M6WA 1MXHA 1DIAA 4CMCA 4JQCA 1CRWG 3TOXA 2O23A 2Y1DA 5HBRA 2PZKA 3MJTA 3LF2A 1KY4A 2GUGA 1IHXA 4FJ1A 4NU5A 1WDMA 2HQ1A 3QWFA 4L4XA 2R00C 1XDWA 1IZ0A 1KETA 1QG6A 3BXXA 3ZZNA 4UVHA 5I7FA 3TFQA 4N5LA 4D0RA 4W6ZA 3GN2A 3MOGA 4XGNA 3D3WA 4FFRA 1HE5A 2OFPA 1FDTA 1K5HA 4XB2A 4MOWA 3W1VA 3E8XA 3JQAB 5JE8A 2H5LA 2IZ0A 4KQWA 5JMWA 1HETA 1ZBQA 2FY8A 1Y1PA 4N54A 2GYYA 3RUIA 4MVJD 1E3EA 2C29D 3F6YA 4CUKA 2D1YA 5KOIA 1PGJA 1IE3A 3GGOA 3FRJA 3HADA 4CM8A 2EEZA 1H5QA 1PGQA 1IB6A 2FMUA 3VTZA 5F5LA 3L4BC 4GI2A 5IG2A 3JYPA 3H2SA 5A4DA 4CR8A 3DTTA 1JQBA 3TJRA 1UXJA 1YBVA 3EZLA 3SJ7A 5A9TA 3QWHA 2HK9A 3W8EA 5JNLA 5G4KA 4E31A 2P5YA 4RVDA 3RD5A 4XA8A 2FZWA 1E1LA 1PTJA 3KSUA 2FOIA 4ONEA 4J4HA 3AOEA 4XR9A 4L0QA 1DC6A 2QW8A 4LSWA 1HYEA 3HNPA 5C3MA 3KOUA 4Q3CA 2IYPA 4EITA 2JCYA 1WPQA 3PXXA 2D5AA 4O63O 4YBZA 4EJMA 4E2YA 1DIRA 3O8QA 5ICSA 6ADHA 5ADHA 2I5PO 3B70A 3IQDB 4WCFC 1YB5A 4U5QA 3TZKA 4CMIA 1HRDA 3OQBA 3RCBA 2BELA 3T7CA 5ILGA 2C0CA 3WS7A 3ZNOA 5LDGA 2OL4A 4XYMA 4I5GA 4DQUA 4K1LA 1TT5B 3CMMA 1BXZA 2OOSA 4XYEA 2IXAA 2X0NA 3WB9A 4PVDA 3FNGA 3P2OA 4CLEA 4CMEC 4FC6A 3FF4A 4HXYA 3VPXA 1RM4A 4CLXA 4BIIA 1NPYA 1QKIA 3AM5A 4BVAA 3INTA 2VT2A 3JQ9C 2ZQZA 1Z7EA 2CDAA 2B0JA 3I9OA 3QP9A 3E6AA 1NTOA 1DLJA 2NWQA 2EF1A 4YJDA 1SEVA 4H16A 3F5SA 3KEOA 4I1IA 3ZHYA 3BMQB 4BHTA 5H83A 4IPTA 3TFOA 4AJNA 2IE0A 4OJNA 4JJIA 4BOYA 1ZXLA 4B4OA 1GPDG 1LDNA 1N5DA 3ZN2A 2EERA 4I5FA 1NYTA 3GGPA 1XU7A 1RJWA 4EYEA 2J6IA 2NACA 2UUPA 3F46A 3IUSA 4M8SA 4E33A 1TB4A 4RVSA 4YCAA 5HWSA 3EY4A 4I5DA 1V0JA 4IM7A 4CL3A 4PG6A 2PK3A 1DEHA 3VH2A 4DLAA 2PD4A 2W8ZA 2B37A 1D1TA 4BKOA 1DJQA 1PL6A 3GR6A 2OO5A 3Q2KA 4ESOA
chains in the Genus database with same CATH superfamily
2XUIA 2QT1A 1EXNA 4FFOA 4CFYA 1U3TA 4FFBB 2V7UA 2XQKA 3W34A 2C77A 1ZD9A 5K3CA 4LZWA 4S24A 4KMOA 4MWTA 1LC0A 3SMQA 3TRHA 3OJFA 4U02A 5GONB 2G9RA 1JTVA 2CHVA 3WIDA 5EZ5A 3DTVD 5DNVA 3RDPA 2R5WA 2XQGA 1OXMA 1B1CA 2CZCA 1XCGB 4IF4A 1QHFA 4UHHA 1M6NA 1WSAA 3PGVA 5H70A 1Y6FA 1JSCA 4BWVA 2SNIE 4MVJG 1YASA 3OURA 1JLKA 2YC4C 1K27A 5EIEA 3ZBUA 4IRMA 3NMIA 4ER0A 3DQPA 1PZGA 3LWDA 4LLEA 1QF9A 2PQ6A 4OQZA 3PNQA 4F97A 1KMMA 3IELA 1JB9A 3BICA 4IIBA 5IDWA 2B25A 3ET4A 1L4LA 4L95C 4XVCA 3FYCA 2HSGA 2MSNA 3CH5A 3OBIA 1GARA 3M79A 2PVSA 4IHJF 5HF8A 3BIWA 5AK5A 2WL8A 3M6XA 2G9QA 1VJ0A 1MH1A 1ONBA 4U1RA 1ZK2A 3G89A 3BXZA 2OXFA 2VHTA 1USWA 4CQJA 1GRRA 3MBIA 3CFYA 3KHSA 3VHXB 3D81A 2ECKA 4JT8A 4E70A 2B6HA 2YJ4A 2GF0A 5HXAA 3BOSA 1V2GA 1PKEA 4HS9A 3Q8XB 4KAFA 4CIBA 1R6XA 3CLSC 4JCOA 2NAFA 6PFKA 4EJSC 2MR5A 4IIXA 4ZOLA 5ALZA 4I1RA 3EGDB 5ALFA 1L7RA 4OXQA 3LW7A 4PFSA 1CYEA 4BJ3A 1IAVA 3NRBA 3NV7A 3DCNA 5CDHA 3GHHA 2HNKA 1JNYA 1U3UA 3GA0A 2YZSA 3AR9A 4UM7A 2QN9A 5T64A 2VPYA 1X19A 1KSGA 3UXHA 4N3NA 1LF5A 4RCYA 2CE2X 4AMGA 2WJYA 4GKJB 2MDTA 5DLJA 4MS3A 5JS6A 4GLLA 3FUXA 1DRUA 1BFUA 5KTRA 3UJBA 5JSZA 2DWQA 4JBNA 1JQJC 4B4KA 4CIPA 3HVUA 1J56A 1DBVO 2MMCA 2W00A 2HREA 5HVNA 2HTEA 1C8BA 4NZYA 1U8YA 1J06A 3UZUA 4QAQA 1P4RA 4DE5A 3VU8A 2YIMA 3E84A 1MB2A 4D4IA 4YUXA 3PFIA 3F6EX 4X64B 1IUPA 3NAMA 4CM4B 2RJNA 1AMOA 5BVGA 5B1AC 3ZD9A 4IS3A 1G17A 1U0EA 3UT5B 1NXQA 2EGUA 1AQNA 3L92A 2H2FA 2CUKA 2J6BA 3I34X 1C80A 1U6IA 5FADA 4GGPA 1N5MA 4DLSA 4PTLA 3FDXA 4IDQA 1ZK0A 3KM0A 1BWRA 2C9CA 3PX2A 3WBJA 1OT5A 1WVIA 3BA1A 4JP5A 2QUPA 4TTSA 1T8WA 2DGDA 3P9RA 3CLTC 3OPNA 2G25A 2P65A 1FMTA 3SXUB 3EHNA 3IAHA 4EKEA 1QQ6A 4KO2S 1F8GA 5KOHB 3CVUA 2JVIA 3D8SA 3ZD8A 1BRMA 3CEXA 4QDZA 1I0LA 4PU0A 3V3KA 1OZGA 2HJVA 1V95A 2JHCA 2NPIA 1TO2E 3VAYA 4L07A 4MCAA 3PQ6A 5TGZA 3RVKA 4V0RA 3OCXA 5JI3E 2W6CX 2JG3A 3CG4A 4J7XA 3BTOA 3PGXA 3BRJA 1P74A 3T9EA 3B9QA 1T6BY 3QVKA 2WOJA 5KTSA 4KSYA 1E2FA 2XT0A 1ZD5A 2WMYA 3DZFA 4WBNB 1NLYA 1ZYRF 2ATXA 4GM1A 1H0RA 3ROGA 4OI1A 2KYHA 1R0RE 2FZGA 3O9MA 2W2MA 1SAYA 3JQQA 5A5FA 1KP3A 2ASVA 1Z0FA 1JR2A 2VCAA 2CY0A 2QMOA 3RHFA 2CLCX 2JI8A 2FR8A 1W34A 4IDOA 4KREA 1N0UA 1RLUA 1T6QA 1W88B 4MYHA 2IEYA 3R7CA 3HUEA 1H2ZA 1O03A 2ZXFA 4LYAA 1QRDA 2BKVA 3BVPA 1ESEA 3SZLA 1E1KA 1FLDA 2GCIA 3TDMA 4AU1A 5CVJA 4G4IA 2B4YA 4D9BA 3CJQA 1Q6ZA 3ITFA 3IX7A 1U0FA 5ALUA 1IK6A 4MRSA 1EGVB 4LX0A 5F5FA 3K5IA 4OHZA 4IJQA 3MTEA 2ZKLA 3BFXA 3CBQA 2FPPA 4NV1A 1QP8A 4E11A 3V4VB 3OIYA 4IY1A 2XX3A 1G5TA 2AKAB 3LC2O 3R75A 5BY2A 4R81A 3L77A 5EGYA 2Q4BA 2CLLB 3RIEA 5KTTA 5E3JA 1IG0A 1UMCA 1YZTA 4HUTA 3BHMA 2F8TA 4BO5A 3C6YA 3DD1A 4HPJB 4ZVTA 3PPXA 3L0IB 5M5BA 1JIQA 5FWNA 4OHWA 3NOXA 1CUWA 5EKTA 4GL4A 2JGIA 2ZCUA 1DADA 1T25A 3W1EA 1Y3IA 2I6SA 1CY4A 1U89A 4E21A 5IAGA 4IIJB 3NT2A 3CNOA 4LA4A 3T8YA 2R2GA 3S2GA 3D3NA 2DCMA 4LYGA 3T4EA 4NC3A 2WYIA 4RF5A 1KMHA 2W2KA 4ZAZA 2HRDA 2BGWA 2BKXA 3MJ4A 5HTOA 3L7AA 4IEEA 3L1IA 4EW2A 1WCXA 1OT3A 4LS3A 1IDN1 2BJVA 1WLYA 2OHIA 4BNLA 1B8OA 3PHJA 4A1OA 5CAEA 3WISA 1UDBA 2RD2A 1KYYA 1K68A 2EU8A 3W7AA 3N2YA 4TN5A 4LISA 2EYUA 2ORWA 1PFKA 3ZTYA 1M2FA 1TUBA 3QKIA 3O75A 2Z83A 1PWHA 2G0TA 2C5LA 3SCZA 4K03A 2FEPA 2HQOA 1QHXA 4ZAGA 4A8PA 4J29A 8GPBA 1ZZEA 1MB3A 1U9YA 5CLGA 3M4ZA 3EFOB 1SKQA 1WXGA 5EQFA 2QVGA 4UOEA 2FU5C 1M2VB 4CDYA 4HFNA 2J0XA 4G24A 5AI6A 1Z45A 5L3ZA 4FN4A 3O1LA 5LQSA 4GAEA 3BJMA 1YHZA 3M6FA 2GZ2A 2FMFA 3KSBC 3MAJA 3GLHA 1JKXA 3ZIAD 3SLRA 2BR5A 4TWBA 1GPKA 5BNTA 1F9AA 2QD1A 1E99A 4Q1CA 3T94A 1WHTB 4Y2PA 5F98A 3M5PA 1A95A 3VU3A 1TWCA 1NXVA 2Q3JA 3GOQA 4XWTA 4D3FA 4DILA 3LW8A 1NC1A 1UODA 5ECYA 5U1PA 2DI3A 1SXPA 1C14A 3HBJA 5IT5A 5JCPA 2COUA 4Y18A 4MV1A 5FPQA 4BMZA 5IM4F 4RH3A 3C87A 4UHFA 1Y4DE 4DLYA 4II3A 5B58T 1GL9B 4N0DA 1FQJA 5LMZA 3QWAA 1NU6A 2I7TA 3ZU2A 1CIVA 4KXLA 4UZEA 1L6IA 2E1RA 4KHZA 4KQGA 1LBSA 2Y93A 5J40A 1YDMA 2DBRA 2ZREA 1G8AA 4ICIA 2R02A 2CHFA 4ETWA 4E13A 3SHTA 4FDAA 5KSWB 2DLNA 4DIEA 2QPOA 3AILA 3SBOA 3TLAA 1XQXA 4BQNA 2FQYA 1P1FA 2C7QA 1LPEA 4G0NA 4CT5A 2WK1A 4L22A 4YAFA 1DCMA 2NU6A 2FI1A 1PWXA 1YKFA 5G1PA 2ZXRA 1XGKA 5A2GA 1BWSA 3KD3A 4NDAA 4LWZA 1B0ZA 5H16A 2NZ8A 3LC7O 4DABA 2HMTA 5FBQB 1XSEA 3DMTA 1E77A 4B5KA 1EFDN 3BB1A 2RAUA 4F6LA 2KMLA 3TLGA 2F8SA 5KTOA 5AW2A 2VATA 2QWXA 1G9XA 5DCLA 3K1YA 2F22A 2YZ7A 5LKRA 4L8LA 1FY2A 1MQVA 2PJZA 3VH4A 1AKYA 4MQ4A 3AKZA 4DT1A 3M2PA 4FGWA 1G8MA 5CA0A 3OD1A 5DEIA 4OYLA 1Q1ZA 3M5WA 2D2IA 4OOEA 4RIEA 3AHJA 2C9MA 1M1YA 4Y2XA 1OFUA 5KJ6A 2PMEA 2Q3HA 3IQFA 3L43A 4ZJYA 2FRDA 2MIIA 1Q17A 2GAFA 4G1BA 1ZAYA 1DL5A 3Q7QA 5B58C 2W6ID 4UU8A 5C2JB 2IBFA 2OJQA 3G85A 1VCNA 3DYBA 5LXTF 1MG0A 4HRVA 4IHKA 2C5GA 5F3WB 4XIFA 4DPKA 1QCYA 3H87A 4PCUA 4LJ6A 3MBOA 2X9GA 5DBHX 1UAYA 3EQ9A 2IVFA 3B3GA 1HMOA 4O4JF 4IDNA 2AWCA 3UMCA 3VNRA 4PO8A 1M2KA 5EJEA 3ZS8A 3VR5A 4H31A 2FE1A 2XCIA 3GAMA 3HJAA 2ZI7A 4L75A 4D92A 4N49A 1NPTO 2QAGC 3DV0A 3RKUA 3G17A 1CDZA 1TO1E 4NXNB 3Q3CA 4FWIB 7ADHA 4EF4A 4EHBA 1I32A 3K0FB 3TQHA 4WIAA 4LACB 1QYIA 3GD5A 4HLNA 3N7TA 5ALEA 5JZMA 3H3FA 1D0VA 2GFQA 2ZQ5A 1BD4A 2H59A 5BPFA 2DECA 1XEWY 3LRXA 4LJLA 1MX5A 4KDFA 2V0CA 4RANA 3FPLA 1K04A 5KYNA 3TTVA 2CJYA 4EG4A 1ZICA 1X13A 3SS9X 1C7ZA 1GZ4A 2NSJA 5BUZA 2VJMB 4OHKA 4RZHA 2W8BB 2YWCA 4FOPA 2O54A 1F2UA 3WDKA 1IN7A 3ANSA 2OOCA 3EVGA 2IF0A 3HXOA 2CNWA 2XNJA 4BVGA 1OYOA 4D25A 1OH5A 4L15A 3HABA 4EHLA 2GWHA 4YRMA 1B16A 2ADOA 1XVUA 3AEQB 5HOEA 4WMLA 3C3WA 2JLQA 5KNDA 2H1SA 3R8XA 1MJFA 1U3FA 4QAJA 3LDGA 4JUDX 3RS2A 1OW3B 3FCXA 4RY0A 2VTKA 1U1CA 2Q9AA 3TZHA 1KFEB 3LY5A 1OROA 1DBWA 3OX2A 3E2PA 3EVBA 2X4LA 2J0EA 4NFHA 3KVRA 4ND8B 3D4PA 1C0IA 1JG3A 1YFZA 1KI2A 3TW6A 2G9ZA 3TLKA 5B57C 2X0EA 3O0TA 2AUTA 1H2EA 4WFIA 3U6KA 3EXAA 4NARA 1YIDA 1BGXT 4TKLA 3WGHA 4WZAA 2AOUB 2P6UA 2V8BA 4XGQA 1KKLA 1JU4A 1VXOA 1BXGA 4G25A 2GZRA 1NVAA 4LVUA 4MI1A 4RO0A 1N9GB 1SCUA 2WJWA 3IE0A 3WLLA 1PSDA 4W8OA 3X1ZA 3OJ0A 2EWVA 1XQ6A 3AQIA 3K1IC 2L69A 4R84A 4TQGA 2RC5A 4JB0A 1RQRA 4B6PA 1HY5A 4HHEA 2DB3A 1QIJA 3IHWA 4S35A 2AMFA 4NS4A 2WPNA 2IDJA 2A6PA 3PGKA 2QROA 2R65A 5CDFA 1KJJA 4K9QA 2JGFA 4O3MA 1OZ0A 3BMOA 4HF7A 2CXPA 4C3OB 4YMTA 3GFOA 1KWKA 2A4KA 4KP7A 4GLBA 1ISFA 1FBNA 3L6DA 1CEXA 2O0MA 4H7IA 1GGFA 1KERA 2B8TA 3FOEC 1ZI9A 5LYJA 1J99A 4HNAB 3T7IA 1JV2B 2RBKA 3ZTZA 1ZDMA 1ZITA 2ZI3A 2XA9A 2ZBUA 1WASA 5H81A 4D6XA 1T0IA 3R4CA 4MR8B 2Z5FA 3KQWA 4YAEA 2ZRBA 3ABQB 1RHQA 4MRMA 2MCFA 3UG6A 2D2XA 2O7RA 1KIFA 1XLTC 4N3AA 3ED1A 5SZIA 3WTCA 3EVZA 4HDRA 2ZIGA 3DBVO 1LPPA 1KSFX 5KTKA 1FRNA 3C3CA 3KCQA 1EVKA 3GAFA 1NI5A 5LN1A 5A06A 3HA7A 3V4ZA 4NRDA 3QJ5A 1K6IA 3RAFC 1WTCA 5C8YF 5TJ5E 1VRCA 3HJUA 1JU9A 4DBRA 1CUGA 3DOCA 1L0BA 3OFJA 1V2HE 3CEAA 2XEDA 5JXWA 4BB6A 2AXNA 4PW0A 1M2WA 3WV4A 4C0BA 4ARSA 3I4CA 1EE2A 1Y89A 3CJTA 4OFZA 3PNVA 4DLVA 2OR3A 3AF2A 3EDYA 1IXRC 3UWMA 4DA0A 4YJFA 1BHJA 3N8DA 4D1YA 1JLSA 1U7UA 4DWOA 5JT1A 1Y63A 4FQ7A 4IIGA 1SCIA 2B4KA 1WMFA 3JVIA 4I66A 4MYTA 4DF3A 3IUPA 1I3LA 3VVMA 1LY1A 5BNIA 5EE3A 3D4NA 3L7IA 1FVFA 2QTCA 2L81A 4Q18A 3TMKA 2P6PA 1KRXA 2YICA 4OUDB 1TVKB 3O38A 3CX4A 2X8AA 4PHGA 2X14A 1UXIA 2FSIA 3KYBA 4RJ2A 2B4QA 2VDQB 2DT5A 1A98A 3FUVA 4YNBA 3STHA 3TIGA 2H4WA 2Y3HA 4R8LA 4I9GA 4WHMA 5KDDA 2BVNA 5SYAA 1A2BA 2VPZA 4PR3A 3VYUB 1Y4SA 2YJGA 3KH2A 4QNRA 6YASA 4HGPA 4K26A 4GOXA 3S27A 4ISCA 2JGKA 2BGJA 1XEFA 3ROEA 3PJDA 5KZMB 1W4ZA 3H6HA 3Q5EA 4C9BA 3IFSA 4JC4A 2X1HA 2OHHA 1M8FA 3R3XA 3DZ8A 2VSXA 3ZG1A 4HH1A 4S1NA 4LPKA 2QJFA 4O25A 5KNBA 3W4JA 4IH4A 1FVOA 2J8ZA 2EIJC 4IZIA 1SBZA 4Q3NA 4DQKA 3N1UA 1JDNA 4MS4A 3DJUB 3HJRA 2FUKA 4HQLA 2IL1A 4X7RA 5JCJD 4CLOA 2CNDA 1E9CA 1ULAA 2P75A 2IH4A 4G4SP 4V39A 1RCPA 3ECCA 3D6UA 1Q95A 1I6KA 2FUG1 4WABA 1Q0LA 4CDNA 1MT3A 3THYA 2AF4C 5BQFA 1A04A 3W06A 3RAJA 1UFQA 5IT0A 3T9FA 1FP4A 1KJWA 4MJ3A 4TQAA 4AO7A 4LI0A 2WI8A 3PGA1 3R0VA 1NF8A 2X3YA 3X1WA 4C87A 2CDNA 2PZGA 2IHKA 4WAUA 3ZZNA 2J3DA 1FJXA 2OQMA 2OFPA 5KPJA 4CT0A 4JASB 2O2JA 3NHYA 2XRMA 2GBPA 3JQAB 2FMXA 2AU5A 4PFPA 2IZ0A 2IPXA 3DB1A 4PXYA 4JOQA 6NULA 5JJLA 3F6YA 3ZBPA 2QR2A 4LBZA 5IBQA 5LQUA 4GI2A 1N1DA 1WKVA 4ZZ2A 3L06A 3SJ7A 2QSZA 3KZOA 1DDGA 2R05A 4W7SA 4JLNA 5D7NA 3W0LB 1V1MA 4EUKA 1HYEA 2O8FB 3PXXA 4O63O 5EHNA 2HWWA 5ADHA 3IQDB 3ER6A 3FYUB 3WV5A 2BELA 1EFUA 1XCPA 4EO9A 5JALA 2A6HF 1OV4A 1BXZA 3AEUA 2PRKA 3B5IA 3OOSA 4FC6A 1QIMA 5DW3A 3C3YA 3INTA 4AF8A 3PF8A 4DR7B 2WABA 2MWQA 4O2AB 1FPMA 4H16A 4TSRA 1I14A 3DNPA 4BY9E 3L0PA 1A5SB 2J6IA 4AY2A 2UUPA 3O31A 1NSTA 5ES4B 3MUOA 2R25B 3PCRB 4DNXA 2PK3A 2PD4A 5TVGA 5EZYF 1YZNA 5C51B 3ABKC 1O8CA 3AETB 4BFLA 3LSTA 4OXXA 4FWBA 1KI1A 3GEIA 3H2JA 3ASUA 4RY8A 3ONVA 3MRSA 1B1AA 4YJHA 1YJ5A 3LHKA 4CKBA 3BHJA 4IRXA 4YMWA 1X1EA 5T1DB 1AV7A 3CEHA 4YRRA 1YD7A 1X7XB 4JJKA 2JGEA 2O2DA 2JHGA 1Y9EA 2YJ6A 2CCJA 4U3JA 3AOUA 1XRRA 2Q6VA 1ULUA 1NRWA 3LDAA 3GD7A 4OMDA 4PX9A 4I1UA 3R3JA 1P9LA 3CX6A 4M99A 2WU4A 3GPCA 3I32A 5AT1A 4KYIB 5JRZA 4J32B 3ICWA 3QZUA 1Z74A 1JUDA 3FOFC 4D3XA 5IXJA 2D7DA 2V6BA 1N7IA 5EMKA 2NU7A 3S1LA 1DHTA 3AEXA 1DI0A 3EF1A 3M9LA 2EFJA 1K8YB 5H3LA 3AFMA 1OWPA 2F9FA 2A0YA 1GS9A 2CLMB 3UB4A 3W2HA 3RJZA 4D41A 2YN0A 4X84A 3TUJC 1NOIA 2C8KA 1QUEA 4DUGA 1BMFD 1RAEA 1KEZA 1H3FA 3KKMA 4HLQB 4BQRA 7GPBA 3RC1A 5A03A 3QUSA 4KWEA 3ETJA 2BI8A 1DQPA 4E7SA 3S1SA 4JYZA 5DF1A 4KSBA 4R7ZA 4ARCA 1WZUA 3W77A 2HSJA 1M74A 1EFHA 5G4KB 2AFVA 4RKEA 4MUAA 4ER7A 1TKBA 5AHXA 3G9XA 4MIOA 2IGBA 1VCOA 5BN5A 3ZDRA 5EE5B 3IQZA 1FBTA 1VMIA 2EJUA 3AQ4A 2Z5VA 3F5QA 1ADBA 1HG1A 4CCSA 2I54A 3L41A 3KWJA 2NTVA 4EO4A 3NVDA 5AK6A 3KUXA 4UUMA 1AHNA 1YJAA 5CK4A 2OAP1 2H4HA 5EG5A 1I2AA 3QA3E 1LVGA 2RHHA 4QDOA 2RD9A 3V8PA 2GEFA 1QOPB 5A6SB 3W2EA 2A30A 2GHTA 3VDXA 5I9NA 4RF4A 3H2BA 1M0SA 4BRWA 1AHIA 5SY6A 3O8OA 4WDQA 5JH7B 3DMPA 2GZSA 1GQQA 1I7PA 3RC7A 4ZCRA 3WB1A 1P0PA 2JB9A 4YRLA 2XA2A 4ALNA 5EHQA 2EFHB 4MUMA 1SZDA 3RYFB 4RE5A 4MVCA 4IG4A 3ZJYA 1ZKDA 5AKYA 3QVWA 3F7OA 3T3EA 3L2OB 4YCCA 3G9TA 1HDGO 3W7VA 4AULA 4BDSA 4ED9A 1RZRA 1LDGA 2P7HA 3R5SA 1PFGA 3K0AA 2NSDA 5AHWA 5B37A 2BFFA 3R23A 2FFRA 4AUNA 5FA6A 4IH1A 1JBQA 2H51A 5I5EA 2XCSB 3IAAA 5TEWA 4B85A 3SYTA 5EKXA 2BEWB 3L1VA 2IYYA 4YDSA 7REQA 4BN4A 1QLHA 1X14A 3A11A 2XD4A 3SFZA 1V3VA 3T41A 4ND1A 2ZPUA 3X2SA 3NOVA 4CF6A 2AWOA 2E5FA 2OUKA 3W9SA 2YVQA 4L8WB 3M81A 2ID7A 5FWXB 5FTJA 3SKVA 2E7ZA 5L3QB 1JKMA 3NS7A 3F73A 5BQPA 1XTZA 3VKVA 2EXXA 3I4UA 3AHCA 1I13A 3WKEA 2EBFX 1V8BA 1T4MA 5E9WA 4BC1A 3ITDA 3L7OA 1G21B 4CM5A 2JGRA 2A5JA 2X51A 2XVMA 3A14A 3ZDQA 5B3KA 3DDWA 4WH0A 1OWMA 5MGNA 4GICA 1NFRA 4L8YA 4N65A 2B1JA 2JJ8A 4EP1A 1UBJS 3GRYA 3U2QA 1NVBA 2AOVA 3ZWDA 1A27A 4U7PB 4CG1A 1T26A 2GPBA 4DJDC 4QRHA 3QXJA 4Q48A 4E30A 1ST2A 1NSGB 3C48A 1M34E 4PQYA 5KO2A 4AJIA 4FEYA 1RKEA 1VSBA 2EDCA 4NMLA 2A86A 2F1IA 4OLHA 1KI4A 3MAAC 3PUJA 2VUIB 4LY0A 2WG2A 4FOOA 4RJTA 1K1EA 2OBLA 4XEVA 5JBNA 2HWUA 1F2DA 1HDOA 1G2QA 3PK0A 3R44A 1XNJA 4M86A 3CW9A 5G0SA 1CNEA 1EHYA 1GZ7A 4UMVA 3PD0A 2YN4A 3F7TA 3R7NA 1P62B 5KNCA 4TMVA 3H7IA 2QU7A 4E15A 2O5VA 4LQ4A 2QL9A 2VTEA 3VQTA 3KLOA 4Z2AA 4XIJA 3H19A 4G5RA 1ZH6A 3U9JA 1NRXA 3HJTA 2Q6LA 2WUFA 5B2ZA 4E14A 2B9VA 1EQAA 3B82A 3OT4A 5CVCA 4WLEA 4FHGA 4J0KA 1TF7A 3H11A 4K87A 5E6UA 2QDKA 1COWA 1T6YA 2WDPA 5JECA 2YYZA 2PSDA 2VTBB 2YVKA 2WKQA 4CBVA 4LDQA 1P2DA 1XHLA 3NHWA 2V3WA 1S3FA 3VV2A 3BEHA 2J45A 1LKXA 2VBIA 1XAJA 1WXIA 2N0SA 2VCYA 3JSAA 3P9PA 4MA5A 1ORJA 1O6FA 1GTG1 4WQMA 2QRNA 3MGGA 1N1MA 2QXTA 2A57A 2CYBA 3A06A 1P8JA 2WG1A 3AERA 5DTRA 3HC7A 3VTAA 3TIVA 4LY6A 5DTQA 5F2KA 1LDEA 2ZZNA 2QL7A 4EK9A 1TCUA 1RE0A 1CE8A 3WXMA 4U5EE 3R0QA 3LAYA 2EX4A 3DVRX 4UXIA 5LLSA 4XDYA 4BPBA 4O6YA 4MV0A 1D1PA 2X6TA 1A0OA 4Q05A 3IPYA 2P3LA 4EHFA 4QPCA 4TS4A 1YZVA 4YO7A 1ZJ6A 5EJ7A 4KYVA 2ECPA 5E4TA 2LGJA 1SNYA 1A50B 4UEJA 2IDMA 2FQXA 1M2OB 2NYVA 1EHIA 4YJ2B 4PVCA 1CX9B 4GGOA 4ZGWA 4BCDA 5ESRA 4UTVA 2OSBA 2WSLA 5EIBD 3QOWA 1NNI1 5ESWA 5I47A 2QSYA 3UCEA 3T3PB 4UXJA 2WHPA 1X86B 4KPFC 2B78A 2Q5FA 4UARA 2GI4A 3FCSB 3NMKA 3ETLA 4Q9AA 4JJFA 2XLVA 2WF9A 3PYLA 4KGVA 2Z2IA 4YAKA 4P32A 3T54A 1DMSA 2IGTA 3DAGA 1ZW6A 1FU4A 1SU4A 2P9HA 1NQAO 4YO8A 3HXQA 1QR2A 2R7RA 2Q6IA 4RK0A 4RK7A 5I7HA 2CBGA 4MIKA 3M4YA 4MV5A 4JQSA 3RSOA 4YN3A 1VP3A 1KZ9A 3E9YA 4TXMA 3AL2A 4J0IA 1LC3A 3ESYA 1UH5A 1U63A 2YHBA 2HXGA 4AT1A 1SC6A 1NVGA 4LBWA 1E9RA 3VR6D 3CXRA 3L1UA 1H42A 4DL9A 4D26A 2BJWA 4UMDA 3ZZ1A 1Z6TA 3H0KA 1O5OA 5KVSA 2J46A 4A03A 1M2GA 4MO9A 4BFUA 4KGZA 4N3CA 4FGJA 1MX9A 2IS1A 1E4EA 4URYR 4DQ0A 1PFYA 2EBUA 2XRFA 4ENWA 3RKOF 2OOKA 5HJEA 1JFSA 4A8JC 4L2IA 1PW5A 3GJZA 2ZRFA 5GVRA 3S84A 1UJCA 3J06A 1QH1B 4LW8A 2PGJA 1HBJA 4X41A 2GH1A 1XJCA 2WWXA 2IFTA 3FR8A 2XYHA 3FCCA 1ADYA 5F5XA 3JD4A 1IEWA 3VPHA 5D5HA 2XKJE 3KD2A 4HDKB 4P82A 2ZBPA 1EVZA 3JQ8B 3H1GA 3KJNA 2NUTB 4NX2A 3UMKA 1E3IA 1PRYA 1IQPA 3ICCA 4QOFA 1VKOA 2IOHA 1QRRA 2AVKA 4IEIA 5IMBA 2BBTA 1EWKA 1UJ4A 3ESRA 4JYCA 4D2IA 4FEGA 5FORA 2V96A 4UUNA 2X8JA 5DOZA 5AW5A 4JGBA 4YGXB 3HH8A 2RH4A 1L6RA 1T35A 3GZNB 1NOKA 5B64A 3ROKA 4OA5A 3L8IA 1EK6A 5E2AA 1O54A 4KQ1A 3HEMA 4J2HA 2GYVA 2CHUA 1RQXA 1YJXA 2AEJA 2FK8A 4S2EA 5JAIA 5H7XA 3KB8A 1WV1A 3H17A 2AK3A 1DELA 3AIMA 4YJ3A 1JFFB 5KMGA 1EUZA 3AL3A 2J1LA 4AO8A 1WL8A 3T99A 4L0CA 4AS1A 3GNQA 2A78A 3T9CA 3LX5A 4QQKA 2ZJ2A 4HTFB 1JKFA 2GXAA 1OXTA 4KUHA 2YKZA 1SB9A 4WWHA 4KE6A 4N40A 3QKWA 1Y1SA 1PX2A 4H3VA 4UATA 3W6UA 4J6FA 4AJHA 2BZSA 5F76A 2UYOA 1NQWA 1FS6A 4F0JA 4CM9A 5K3OA 4DLTA 3T4UA 4YEDA 4UJ3A 3S2YA 4REQA 3D6MA 2WP0A 5J4HA 3RRMA 3V7FA 1A7JA 1UOEA 4IGEA 5B1EA 5J2TA 2ZTUA 5DH9A 3B8HA 1TMKA 2XBUA 1I6LA 3IT3A 3OZUA 2GOYA 1ML4A 2JFQA 4J1TC 1GDHA 4NK5A 4ZT5A 3OZDA 3HB7A 4JCZA 4PBRA 1C3OB 4AECA 1VIMA 4HAZA 1R0YA 1DKPA 3I3OA 4OQXA 4GD3Q 3SIWA 3D0KA 1RZ3A 4F56A 2Y4OA 3LEVA 4H4CA 2G70A 2EQBA 2Y3DA 1TM2A 1SBQA 2VDUE 1PJ8A 5HS4A 5AHRA 2HMQA 4RDHA 4YP5A 5DNWA 3G2JA 2ODWA 1VSTA 3KEGA 1T8RA 1DRJA 2EAUA 5BMVA 4CT4B 4FSHA 4GO1A 4XPZA 1WDTA 4IYJA 3WL6A 3R7WB 4OD0A 4YMLA 4TYNA 3O1IC 4B75A 2QF7A 1I3CA 1YVUA 3KELA 3A1TA 2G1AA 5I9LA 5CT8A 5L4SA 1G3RA 3I01M 5C4IA 3NB0A 3EWAA 4B3TB 5K0IA 3FOCA 1I51A 3TW8B 2ADFA 3SZOA 1A5ZA 1P4AA 4LF5B 1I2CA 4ZLCA 4YASA 3MWLA 3AUFA 1Q57A 4EA9A 3M1YA 2Y68A 3KLMX 4UCQA 1R4MA 4NJEB 4EKGA 1E0DA 2JK0A 3BJEA 3DTVB 3PMRA 2B1IA 2AX4A 1OTHA 1SXIA 2DVMA 3DW1X 2FW9A 1SH7A 5JISA 2O2GA 4JI7B 4CMEA 4UBNA 5JZBA 1A5BB 4I19A 1K97A 2ZRKA 1BAPA 3RYCB 5LOVB 2G76A 2J32A 3GDFA 2UYGA 1NQVA 5D1NA 1XVLA 2BSAA 3NBYC 4JENA 1D4AA 1XDSA 1AGYA 1JYFA 3AR7A 4QTZA 4FYPA 4G07A 4B3BA 1DG3A 4YAUA 1ZK4A 4MMXB 2XECA 2Z57A 3FYUC 1GWNA 3TUZC 4V2UA 2CXOA 4BV2A 5M2QA 5K0ZA 3L18A 3E61A 3ZD6A 4X94A 4YPOA 2JFXA 4G0ZA 3A37A 1VRVA 1M1NB 5EERA 3FOPA 3ND5A 3QVSA 2WPDA 2C0QA 3QLVA 3ELBA 2P67A 5LP6A 5AOCA 1YZUA 5F5HA 3KKLA 2P5TB 1YFKA 1KZHA 1P0QA 4R7TA 2W70A 5F2NA 1L3PA 2R44A 3EMBA 3ZDXB 4E1AA 3FTPA 1MW9X 4B6JA 3CRQA 4RBNA 2OLEA 4TVBA 2I3BA 4G0YA 2DQKA 3K15A 4D6YA 1L7NA 5B1HA 1IEVA 4KLRA 3R0XA 5C8VA 4RAQA 3A1FA 3D64A 4N6CA 1IYZA 1BCSA 3IKLA 2GD0A 3ML1A 4DR6B 1E1RD 4R05A 3DE5X 2FWJA 4UNRA 2XLDA 4H1VA 3JQ6A 3OCYA 4GYJA 4PBSA 4Q34A 2O52A 3KZNA 2OECA 4F4CA 2VL7A 1UINA 2CDBA 3SFVA 3HCNA 3UPTA 3NBUA 2MMGA 1FXSA 1E0KA 4DRJB 1FMLA 2B4RO 3EA5A 4BO4A 1KAOA 3VR5H 3VFDA 4OAOA 5TX7A 4R2WA 3V2HA 1LFDB 3P4XA 4G37A 1GKKA 3MUEA 3QU4A 3OESA 2W4IA 2ZR0A 4JOCA 1B2RA 2CCGA 2ORED 3GJXC 3FTQA 1YBMA 4U6SA 3KWFA 5HFNA 4XDZA 3RS0A 3RNLA 3MCWA 4R3WA 2ESRA 3CWQA 2IOYA 2PL5A 5KYGA 4PZEA 2FG6C 4F21A 3RU7A 1Z2AA 5YASA 4MW6A 5FHRA 3TD2A 4ZJUA 1R00A 2M2IA 1Q0HA 1KNXA 3Q40A 2XUJA 1UBSB 4KX5A 4CSAC 1ZVKA 3H0EA 3T61A 3QBVA 4QC2A 1EG2A 2QMHA 3BEOA 4C88A 5CFRA 1MAVA 2Q6KA 4FYWA 3DZBA 2I2AA 4B3DA 2OV6A 4AE4B 1MABB 1JA9A 3EPHA 3GL9A 2V7QA 1OZAA 1YJCA 3T12A 2JFUA 4XCQA 2XJ9A 1J0DA 3L3BA 4P4NA 5EWLB 1P6XA 4KIJA 2HA2A 5GY7A 5BR8B 5F2OA 1ZHXA 5KNDH 1VMDA 4LGCA 4PGHA 4DRXA 2C92A 1PNVA 1V11A 5HF9A 4Z4CA 4G0VA 1AM4D 4Q4AB 3I52A 1RNLA 4QOJA 5FIUA 4B43A 2QBYA 4WECA 2DE0X 5HRAA 2YWXA 1YA8A 4HAYA 2VHVA 3K66A 4JVNA 2D5CA 3L7BA 2LE0A 5TQJA 4WNYA 3B1ZA 2OZKA 1TTPB 1K8RA 5J3JA 1E8DA 2HQ1A 1XD2B 3LVBA 4HDNA 2WAOA 3CB2A 4F9EA 5T4BA 4EI9A 4R98A 5I9TA 2XLMA 1K5HA 3GLRA 2EX0A 5BQIA 4F7DA 3DE9A 4RK6A 2D1YA 5DK6A 2HIHA 4AROA 4PZLA 3Q5GA 1QH8A 4ZOBA 4PO1A 4MA4A 3EZLA 2W6JD 4F93B 1K4YA 1PTJA 1V7PC 3HUTA 3SIRA 4YBZA 4JP1A 2I5PO 2EDAA 3TZKA 1KIMA 3V2IA 2CJWB 2OL4A 3FZEA 3DLCA 2ZZMA 1EWVA 4PVDA 2JFVA 2IOFA 4HXYA 1RHUA 1GLVA 5JZOA 1X7WB 3OZRA 4JBXA 2QE9A 1ZP6A 3TE7A 3VRHA 3KEOA 1NE2A 4QVIA 5E6RB 3BFJA 4AO6A 2QTRA 3K8OE 1WE2A 4M8SA 1AT1A 4CKWA 5IKEA 1RCTE 3WLQA 2HV6A 4NPHA 3TZLA 2JA2A 3S2IA 3SLGA 1D0YA 4E46A 4PO9A 2F6RA 3NGXA 5ALVA 3W05A 4A8HA 4N4WA 4GEHA 1B76A 4DJ5X 4OJMX 2VBGA 1OH6A 4AX8A 1WZ2A 4MQLA 1GGEA 2H85A 1U0TA 4MRRA 3A4VA 4G9EA 3A0UA 3OOEA 4R2KA 1PFVA 3RSZA 3LBIA 2A69F 4MW3A 1E92A 3P1JA 3EWNA 1MC1A 3OIVA 1P7YA 1QAMA 3V4OA 3TVDA 1SMYF 1E58A 3KBOA 3TJMA 4E5PA 1T8YA 2P1ZA 3LDUA 4OHUA 4LRYA 1P2VA 3EGIA 5CBPB 3I04M 1GEGA 1XZNA 2O2HA 4GU5A 3MMXA 3O3NB 5IJ0B 2E4WA 1C2YA 1D4OA 1J21A 3WLOA 3S29A 1YAUO 7MHTA 3NPAA 1SUDA 4XIIA 1NF3A 2HBYA 2R85A 3B1FA 3B89A 1PJBA 1Z3CA 2GA8A 1ZR4A 1G21E 1QG0A 1ND5A 4TMTA 3KUUA 3MBGA 1JJFA 4ZDJA 1UXHA 3O4VA 3DMFA 5ALIA 5H9WA 4B6SA 1I33A 3Q7RA 1P5FA 1P9RA 4AY5A 1JDPA 1CLUA 4TRMA 4Y8VA 4HLCA 5A0FA 3ZGZA 3SYLA 3BJRA 4Z4HA 2PBRA 2ZRMA 3B1KA 4WKGA 3KOMA 1GGHA 3K0CA 3GC6A 4HRXA 1OSNA 2W11A 2P9GA 4LJSA 4YCMA 1QIGA 1R9NA 4LWQA 4QICA 3ZXYA 2WU8A 3RADC 2IIQA 1JLRA 1C7JA 4E03A 4I55A 2WFLB 3ORSA 5KNBH 1Z7YA 2Q9BA 2V98A 1KOJA 3HJBA 2F2TA 3R5KA 5EUQB 1X6VA 1H85A 2ZUEA 1Y8RB 4M21A 1F51E 2I4NA 2BRUC 1NSYA 5AC5A 1H65A 3UFXA 3U7QB 2UXBB 4PS0A 1J23A 4D4GA 1N32B 2ACWA 1Z5OA 4DSNA 2J9WA 5H8WA 5SY9A 2SKEA 4BE9A 7AT1A 1MN6A 4RZQA 1KK0A 1MC5A 2HH9A 5IJAA 4BQSA 3K1JA 1UJNA 3CR3C 4UVGA 3T0IA 1SZIA 2R7KA 1EBUA 2QE7A 4M7RA 3RVBA 1Z12A 3QYPA 5K8JB 1DRVA 5BYAA 4IDPA 4B35A 3WX0A 3U13A 4Y98A 4NLLA 2O0JA 3C24A 1MFPA 4RZUA 3G82C 4AJ2A 4I1YA 1CF4A 2ZRPA 3EGXA 1PFQA 3LVFO 3MXOA 4JJZA 5F3RA 2UVDA 3AR6A 3V4SA 4PN3A 2D1FA 3GFGA 5CJPA 2XE8A 1H22A 2JIMA 3O8BA 2R1VA 3VDNB 2EFYA 1U5BA 2DR0A 1CR2A 1EP9A 4OQPA 2HYDA 1DEKA 3A9UA 2PRSA 4KNWA 1I36A 4Q9HA 3KFXA 1N2CB 3KUDA 1P5HA 4WV3A 2PL9A 1A1VA 4LXYA 1ABFA 1GUAA 4EWCA 4RD4A 1X8JA 2RHTA 3M6AA 5AOBA 4D98A 3OFVA 1S5PA 1QF7A 3VPCA 3L7DA 5K3BA 2C7VA 2Y0EA 1NZDA 2VJKA 1DKRA 5DB4A 5FD8A 5JAQA 3I6ZA 2AC7A 3LFTA 4OREX 3BREA 1NR7A 3DPSA 3P5BA 1S2MA 1W9HA 1R15A 1BVHA 2RH8A 2GEBA 4B82A 2VHEA 2VKQA 1YL5A 5IF3A 4CIWA 1T2CA 4JQOA 3UMHA 1V16B 2Q3DA 3WYGA 4GP6A 2A59A 3TJ5A 4PF1A 2NGRA 1TADA 4EAQA 4MKFA 2PVCA 3UMJA 1RKBA 1T1IA 4N0MA 3V80A 1AKUA 1XD8A 4CNQA 1NBME 2QYTA 3GG2A 2PZEA 5JDIA 1QS0A 2RCYA 4AICA 1L4YA 4YXFA 1XBTA 3G68A 2SCUA 3R5TA 4N41A 1MUUA 1E9DA 2R6HA 3ESXA 1YYXA 1NYRA 1NL3A 2PO7A 5HYVA 4PM4A 1OUMA 4FR5A 5EFZA 4BQEA 1QKJA 4ECEA 5L0GA 3C8UA 5A4FS 2XTNA 4NZNA 4NENB 1UIRA 3DBLA 1Z39A 2VPPA 4C6HA 4MLZA 1LBTA 3G23A 4H7EA 2CNOA 4AAYA 1JLMA 4F7WA 4Z9AA 3KETA 1YT5A 3MWKA 2BBOA 1WW3A 4FGKA 2X40A 4ZLDA 2V6JA 4X6YA 2HHAA 4JW1A 1KI3A 5AM4A 2HDHA 3ACCA 1BMDA 1GPJA 2IX3A 3HLTA 4GVPA 1WHSA 1CJMA 3OPYI 1AZTA 4I3HA 5D00A 4J7CA 1WLSA 2FA9A 2J3QA 1RWXA 3PUYA 3WLAA 4GM4A 1DSSG 4ZO8A 1AZSC 1NG1A 3NP7A 5E2QA 3ONWA 3L6UA 3NAGA 3BAZA 4DPLA 5EINA 4F84A 1XEXA 3KXIA 1ZVVA 2PH3A 4LG1A 1SQGA 3AUYA 4IMPA 4IUYA 4YCLA 3IHTA 3TAXA 5KYWB 3AR4A 2REQA 2ILTA 3FPJA 3DLAA 3NYWA 1KORA 4CTNA 4R1TA 2OVBA 3TLXA 5B3JC 3IDAA 4NE9A 5DSTA 1S9DA 1G3QA 3OSZA