4YT5A

Hmdii from methanocaldococcus jannaschii with bound methylene-tetrahydromethanopterin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 111
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt5A01
4YACA 3KOUA 5G2OA 1QYVA 1XHLA 5U4QA 3VAZA 4CQLA 3KLMX 1H9BA 4NK4A 4IDFA 4CR8A 2X6TA 3AOEA 1IE3A 5IJZA 2O3TA 1GL3A 3JQAA 1KY4A 3LU1A 3VH1A 1T2FA 3ONEA 1W4ZA 4CLEA 3A28A 3KLPX 4M1QA 1U3WA 3GA0A 4GX5A 5KVVA 3Q9NA 1M2WA 2X5OA 3E48A 3E9NA 4MIEA 4E33A 1SCUA 1GPJA 3M6IA 3DWFA 4ILKA 5C3MA 2JD2A 4ZU3A 4A0SA 5EQDA 5A3JA 2NLOA 4D3DA 5G4KB 3PJDA 3DEYX 2F1KA 5EINA 3VZQA 1OI7A 1ONPA 1VKOA 1T2CA 2FZWA 4YYZA 4XDYA 3TF5A 3DMTC 2NVBA 4BMVA 5HRUA 1C1DA 2P4HX 3ADPA 5G4LA 1XCBA 1D1TA 3TQHA 1EMDA 4OO3A 3ANMA 5TX7A 3RU9A 1EDZA 1K6XA 4KP7A 4OM8A 3OJEA 3L4BA 2GN4A 3NDRA 2E49A 2ZCVA 1KETA 3GPDG 2QW8A 1DEHA 3V2GA 1WW8A 5THQA 1VJTA 1NVMB 1KBZA 1HYEA 3ANLA 5A9SA 3AJRA 4B4OA 1J5PA 1F12A 1ZFNA 1ZCJA 1T2EA 1NNUA 3BMOB 4MVJE 4UUNA 1QLHA 4PRKA 3JQBA 2PWZA 1VM6A 1TT7A 3HUDA 5C7IO 4R5HA 4E4YA 4EYEA 2GGSA 3JQFC 4J1TA 3ETEA 4BNZA 5L51A 3CZRA 3VZSA 3WGQA 5LDHA 1P3DA 4MVJD 1SNYA 3DZGA 2HMWA 4II2A 2EV9A 3KSUA 1WLYA 4BB6A 3CH6A 3UICA 1RWBA 1I5RA 3ZH2A 4KMSA 2AQKA 3GGPA 4WCFB 2JHGA 3QV1A 4E2XA 4R3WA 3DAPA 3AW9A 4M89A 3OJOA 5HA5A 1LUAA 3MZ0A 4MKZA 4MPDA 3JYLA 4XQEA 3WWZA 2UAGA 3EW7A 1Q7BA 2YQ4A 4PLGA 3I4FA 4J7CA 3G79A 5I9NA 3ZDFA 3MJ4A 5F21A 4ZVVA 1G6KA 1YS4A 3JQ9C 4BKOA 4EJMA 3FSRA 1O89A 4YJGA 2J3HA 1NWCA 4WEQA 2TMGA 1O8CA 1GUZA 2AHRA 1N1GA 3BMNA 1P1KA 2HQ1A 4LVCA 1KVQA 4UVDA 4MVJG 1BHSA 1GY8A 1Z6ZA 2A4KA 3GDFA 4R5MA 4JGBA 1GZ4A 3LK7A 2UV8A 4A5OA 2VWQA 3LLVA 4W7IA 3C7AA 1X7GA 3F1LA 4BNTA 4BNMA 3VVBA 1NTOA 4QXMA 1PS9A 3GUCA 5B4TA 3NKLA 1L7EA 2EKQA 4NHEA 1ADBA 5KJ1A 4G65A 4I1IA 1ZSNA 5ENVA 1RYDA 4Y8VA 5DOVA 4O0LA 3OP4A 3VKVA 3A4VA 3ZV5A 2VYNA 3WIEA 3BHJA 4Z9FA 2Y05A 3RWBA 4P4GA 4HY3A 1LEHA 2Z1MA 4OGWA 1PR9A 2PA3A 4E2YA 4OOFA 2DBVO 1R37A 1SPXA 1ENZA 1RPNA 2IZ0A 4FPXA 3RUEA 1KVSA 5FI3A 3DMTA 3VH2A 1WZEA 2HMSA 1Y8RA 4BO8A 3FBTA 4GX1A 3K2EA 1X7HA 4QFCA 3RIHA 4R4JA 2Y1OA 1O95A 5DCUA 3ZHXA 4L76A 4PG6A 4H7PA 3S55A 4YBZA 2DPHA 3MTGA 2Y66A 3H4VA 5C37A 1ZMTA 4D7AA 5JCJA 2HCTA 4F6LA 2HJRA 3OIDA 5IDXA 4WNCA 2FPGA 4WE3A 3KUXA 4KWHA 2BF7A 3F4BA 3FTPA 2WYWA 5COBA 3ZWYA 4IZHA 1SOWA 1PGNA 5GMOA 4NI5A 3ZW9A 4OQZA 2GZ1A 4EW6A 5BSFA 3RKUA 1IPFA 1JWAB 1LQUA 1Y1PA 4MVJH 3DFZA 3NDIA 1ML3A 3E82A 3HADA 3TOXA 1LBEA 1E3IA 4R41A 1U5AA 1PL8A 2O48X 1F17A 1ZEMA 5C5IA 1UJMA 1A7KA 3JQFA 4LRSB 2GPTA 4YPOA 2QIOA 3C24A 3QW2A 1GFSA 1QP8A 3WBFA 3ZWWA 3VZPA 4B7UA 1DDOA 1CETA 4JN6B 1Y9EA 5A06A 2I76A 4AJJA 3BTOA 5TT1A 4EJ6A 3NT5A 1IYZA 3DZKA 1E1MA 2IXBA 1PQWA 1BW9A 4ROSA 4ZRNA 2FY8A 2ET6A 4MO2A 1UZLA 4YTEA 2PR2A 1A9ZA 1SAYA 3E18A 3PFWO 4E6PA 2Q1TA 2QZZA 4ESOA 3TZCA 1O0SA 2EGGA 2V6FA 5TJ9A 1O6ZA 4BO9A 2DAPA 4GPD1 5KJCA 1Z7BA 3GN1A 4CLOB 2CSUA 3PQDA 4WCFC 3I9KA 1BVRA 1IB6A 1QSGA 3GAZA 3JQ9A 1DLIA 5DULA 2DC1A 1NAHA 1I3MA 3AI2A 2HJSA 2V7PA 4BGUA 2J5QA 4TQGA 3VZRA 5JS6A 5L7TA 3CINA 4LISA 3DTTA 4LVUA 4TVBA 1RKXA 4W9NA 3L9XA 4DIOA 5JC1A 1UP4A 1LXCA 1LQTA 1ZVMA 2CF5A 3OJ0A 1EE9A 3GG9A 5JBIA 4Q3CA 5CHEA 1NPDA 1IL0A 5ER6A 5HS4A 3ICPA 5ICMA 4CV2A 1TA4A 4TZKA 4J91A 2PKQO 5CG1A 5HM8A 4EEXA 3B6ZA 1QV7A 5KJEA 4TROA 1PWXA 1Y7TA 3E5MA 4WLUA 3GR6A 3JD2A 4R68A 4XRGA 2C20A 2X0RA 1O9BA 4RVHA 2JCXA 4Y9DA 5JDCC 1LDNA 3DAFA 1K6IA 2B5VA 1ZNQO 1ZXLA 3AY7A 5C7OO 5CDTA 2PKRA 2DQ4A 3KTDA 3LT1A 1C3VA 3WTBA 1E1NA 4RO0A 4LMPA 4KQXA 1MG0A 3I23A 3PK0A 4RVSA 5JLAA 1CWUA 3WGHA 3AFMA 3BHIA 1QRRA 1OAAA 3E03A 4XKJA 4FFRA 2NTNA 2UVDA 5L4SA 1CDOA 3X2FA 3N58A 3OA0A 1HXHA 4MP6A 2FSVA 2HRZA 5T67A 3WWYA 1WMAA 4CM7A 2WEKA 3ZCXA 5I9MA 4BNJA 2OP0A 1XR3A 2D4AA 3C1TA 2JFGA 3ZHBA 3PQFA 2WE7A 4HFMA 4U8GA 3VTFA 3WQSB 3NT2A 3A1NA 1GPDG 3MJEA 3D7LA 4ZHSA 2YDXA 4O63O 5ITVA 1N8KA 1DJQA 2G0TA 3GEGA 1ISFA 4JBGA 1GUFA 3Q2KA 5DCYA 1JVSA 1TB4A 2ILTA 1YBMA 1MC5A 3RC7A 4ND3A 1XELA 1HT0A 4B4VA 4CL3A 2ZQZA 2ZYAA 4TRJA 3IC5A 4GMGA 2YHUA 1SZJG 2D5AA 1YWGO 5DBIA 4R1NA 5ADHA 4HADA 4M55A 3PIIA 3LT0A 3DZBA 3NTRA 4INAA 4HV4A 3GRKA 3D5QA 4PLFA 3DOOA 1PR3A 3H2SA 3ZV3A 2JAPA 1ZK0A 4YVFA 1Q7CA 3GNQA 2CD9A 2Z5LA 4D0SA 5H81A 4WCFA 1LTHR 4WJZA 5F1PA 4CMBA 4KTTE 2C07A 1HTBA 5AXDA 2EHDA 4GKBA 2Q45A 1X1TA 4N5MA 4QSMA 3FRJA 2B4QA 4OOEA 2FPPA 4IGFA 1I33A 1R0KA 3AY6A 3OJLA 1N92A 2O4UX 3HG7A 1ZZEA 3BTUA 3L07A 1QYWA 3PJGA 1MFPA 1UAYA 4IGEA 1T4DA 3K8ZA 4B3IA 2HK7A 1ZSYA 2EWMA 4CPDA 2HMUA 1H9AA 2G17A 4NFHA 4E5NA 1GTMA 1J49A 2VWHA 3JQGA 3HHPA 1P45A 4G2NA 3VH3A 3RCBA 5EMHA 1IOLA 4QQRA 1PEDA 4CQLB 1HE2A 3BZUA 4JJIA 4C4OA 2FPIA 4ZQGA 1UH5A 2BMAA 3LZ6A 4DTIA 2YV3A 2FP4A 4YAIA 4YA6A 5JDCA 1ENYA 1YONA 1UR5A 1DPGA 1B8VA 3O03A 3G49A 4GL4A 3WGYA 4K9DA 4AL4A 4BGEA 4JCOA 2OHXA 1H6BA 3O38A 1YDEA 4J9UE 4RPGA 1Z74A 4U7WA 5TS3A 3ENNA 4ONEA 3NGXA 3H2ZA 3CKYA 4WLOA 3TDKA 1EVJA 1UP6A 2FSSA 3PQEA 4KUGA 4BO7A 4JK3A 4NBWA 3QWAA 1C1DB 2EXXA 3HN2A 4S3MA 1W0CA 1JQBA 3NX4A 2WD8A 4CMKA 1PSDA 4W7HA 2EKLA 4DC1A 1P9LA 3PYMA 1WDMA 1VLLA 3PRJA 1V8BA 5IXSA 1KS9A 3RFXA 2W8ZA 4U0JA 5G0WA 5CEFA 2B4TO 2YYYA 4F6CA 1EBUA 3TZ6A 4XGIA 3NJ8A 3FTNA 4AVYA 2NUAA 1U4SA 5GZ3A 1PS0A 1WZIA 1X15A 3C85A 1VJ1A 3BA1A 4RPHA 1QLJA 3DQPA 4RVGA 4D42A 1C1XB 2R2GA 3I9OA 1ZH8A 1FJHA 4CLDA 1NAIA 3COSA 3JTMA 1I2BA 4R9RA 4WK6A 5JY6A 3MOIA 1Y5RA 3L0DA 3HE3A 1ISMA 4AJKA 1YQXA 1NVTA 3OQ1A 4RQTA 1UXKA 4B7XA 7ADHA 4LW8A 1E6WA 2DTDA 1YKFA 4PRLA 1XYGA 2H63A 4R51A 2J6IA 1CQIA 4N7RA 2VUSA 3O8QA 1T2AA 2VTEA 1E1LA 5KJFA 3P19A 4E2ZA 4OHUA 4MP8A 1P44A 1PGOA 1WMBA 3CPSA 2C7GA 1Z7EA 4DC0A 4CV1A 1DHRA 2AMFA 4CMJA 4PVCA 1O5IA 1WXDA 1ZJZA 3G1UA 4YJGB 4P38A 4RLSA 1HRDA 5L95A 3SXPA 2POQX 1H93A 3L4SO 4IJKA 4YJDA 3OETA 4D41A 3GT0A 3UFXA 4XYMA 4ZGWA 1ZK2A 3HNPA 4HFNA 1P1HA 4LCJA 5BSEA 5T64A 2W98A 5CPFA 2Q4BA 3RUHA 1HWYA 1A7AA 4I08A 4FS3A 1AUPA 4BKUA 2DTXA 2JFFA 5AOVA 3KYCB 4EGFA 2RBEA 4D3FA 3KO8A 3WGZA 2OOSA 4FD3A 1U9JA 2VHYA 2HLPA 1A27A 4IIUA 3W8EA 1A9YA 1M66A 3QLJA 4M87A 2RH4A 2B0JA 2ZB8A 1GCOA 3EZLA 5G0UA 5B4VA 1KEPA 2NNLD 1AN9A 2A9FA 3G3EA 5DBFA 2BI8A 3G1TA 4CJXA 3U4HA 4D3SA 4JLWA 2O50A 3HZZA 4GLOA 2IE0A 3AI3A 3SVTA 2OBNA 2GSDA 1IY8A 4K26A 4XIJA 2QYTA 2WD7B 3EVTA 3OF2A 2PD4A 1BXGA 3GOHA 3ETGA 2X9NA 1ZIDA 3K2BA 4IINA 2JD0A 3JQAD 1R15A 3TPCA 3QQPA 3TZHA 2VHZA 1EE2A 1F8GA 4CM4A 4Z3KA 5K9ZA 2F00A 3OECA 5EQFA 4UVEA 4DPLA 2ZCUA 4KDEA 4UUMA 3FF4A 3L4BC 1E3LA 3NDJA 3PTZA 4MKRA 3WSWA 1LLUA 4UUPA 3IP3A 1KC1A 4J0EA 1SBYA 3RASA 3WMXA 4XQGA 1C0LA 3MOGA 5CDYA 4CMEA 3PHHA 5ILOA 3FD8A 2P9GA 3AM3A 3ONDA 1JA9A 5I7FA 3PZBA 1JWBB 5A02A 1EFLA 3CMCO 4AG3A 5KVSA 2O4CA 2HKIA 1DIAA 4OYRA 3FWNA 5L45A 1U5CA 4RV9A 2AE1A 1NFRA 1QR6A 4JIGA 4WGGA 1PGQA 2PGJA 4E5YA 4JJGA 1P0CA 1ZSVA 3EMKA 3IJPA 4J1SA 1XKQA 1XWFA 4ZA2A 1B7GO 4LRTB 2FHSA 1V0JA 3JQ8A 4LN1A 5HS6A 3ZU5A 2BH9A 5BNIA 3PWKA 3NRCA 4QFDA 1HDCA 3DR3A 2E4AA 1ADFA 1BDBA 2JCVA 1HDRA 1L7DA 3GHHA 3OMLA 4MOWA 1XLTA 2VYVA 1E77A 4LCEA 3RUFA 4EDFA 5B1YA 3GNSA 4PLYA 3QSGA 4K6CA 4NQZA 1CRWG 1TXGA 1YDWA 4GH5A 3GRPA 4XA8A 3UAGA 3ZWBA 4DIBA 3ZWAA 1E3WB 4Z3DA 1JVBA 1N7HA 1YBVA 3S1LA 2GRAA 5BSHA 3GVXA 5KIAA 3AM5A 2X86A 3H5NA 4U6QA 2X5KO 1I24A 4BV9A 3PYLA 5I7EA 4TWRA 3H9QA 4X54A 3I9NA 3KRTA 1KVUA 5ICSA 4Z6KA 1NR7A 1YE3A 1DB3A 3A9WA 3WX0A 2OL4A 1EVZA 3E1KA 4RQUA 4YDRA 3H7AA 4H15A 1IHYA 4HKTA 1VJ0A 1ISHA 2GR9A 3D3WA 3NUGA 3WYEA 2VUUA 5FFFA 3EUWA 4F3YA 3KZVA 4M86A 3QWHA 3QVWA 1I30A 2PGDA 4DLLA 1ENOA 1E7WA 4JJFA 1AHIA 2AA3A 4JROA 4OQYA 1Y8QA 1ZK4A 3SC4A 1E5LA 3NV9A 1DOHA 3PFFA 3S2IA 2QG4A 2DVMA 3KEOA 3UCXA 1UXIA 1FDSA 5DF1A 3I9MA 4ND2A 1P33A 2NVUA 3H3FA 3K73O 1YL6A 4DQUA 3LYLA 4L9RA 1F0YA 3HB5X 5A5FA 4JBHA 4MP3A 3K92A 2DFDA 1NPTO 1Q0QA 3D4NA 1R12A 3K6JA 4RVDA 1VSUA 4R69A 2R6JA 1DO8A 4NJOA 3BYZA 5KOIA 1NBOA 2XXJA 2OUIA 5ER9A 4FC6A 1LC0A 4O5OA 4XJTA 2AE2A 4BO5A 1LRKA 4FC7A 3WJ7A 1JKFA 1YQDA 3PZRA 3ZV4A 2PTGA 4FW8A 4UVHA 3LVFO 5BNTA 5JXWA 3R3SA 1BDMA 3TFOA 4CLHA 4WLNA 3MWDB 1C1XA 1F8FA 3VVCA 5F5LA 1FMCA 1V6AA 3PHIA 4UULA 1UXJA 2VRCD 1U3TA 3BMQB 1DJNA 1X0VA 3E9QA 4CLRB 2Y1GA 5JCJD 2IODA 3PGJA 2C5EA 1E3EA 3PP8A 4J90A 3HN7A 1C0IA 1KVRA 1DAOA 1RM3A 2LDXA 2AQ8A 2VHXA 2Y68A 3BTSA 4YJFA 5A5EA 2BFOA 4E30A 3Q11A 5A04A 3UXYA 4GGPA 1T1SA 2IEBA 3ZU3A 2EG9A 4M54A 3I9LA 3PLNA 3JV7A 2QHXA 1I0ZA 1FDVA 2RH8A 5AVOA 4RF3A 1B0AA 3QVTA 3ZWOA 3D5TA 1GADO 3ROPA 5JYEA 1LLCA 4FFOA 4D46A 1LRLA 5JCXA 3B1KA 2I3GA 4FB5A 5GZ1A 2D59A 2C29D 2IZ1A 3D64A 4IDDA 2BHLA 4LGVA 5CFZA 2O7SA 3ZHZA 1NASA 5DT9A 1VC2A 3H3JA 4BOYA 1JTVA 1XEAA 4EI2A 3W6UA 3JQCA 3FPLA 3JQGB 1R6DA 3HDQA 4XX0A 4RPJA 4W9NC 1T2DA 1E7YA 1HSOA 4XDZA 4BO2A 4E2WA 1BWSA 2RIRA 3TOZA 4IJWA 4YXFA 4ND5A 4QECA 1KEUA 1PQPA 1OBFO 2EP7A 4GAEA 2VOEA 3KYCA 2QX7A 5F1KA 4TVOA 3OIFA 3V1YA 5A1TA 3PHJA 3ABIA 2GUGA 1GQYA 1QORA 1O94A 4GLLA 2O3RA 5ES3A 5G0VA 1E5QA 4HFJA 5CAEA 3DBHA 4HNHA 4DQXA 2NU8A 1OMOA 4DBZA 1HSZA 3QWFA 4RPLA 1N9GB 3GHYA 1LDMA 4YJHA 3ITKA 2JL1A 5JMPA 3OA2A 5TC4A 4W4TA 4F45A 3IUSA 1SOVA 4L4RA 3UF0A 1CEQA 4KTVE 1DLJA 2AG8A 2WD7A 1EUCA 2R00A 4J2OA 3UOGA 2RHCA 4J16A 4MIYA 4EBFA 2Y1DA 3GPIA 3U9LA 1E3JA 5EIOA 2G5CA 3GGGA 1H94A 4FDAA 4A73A 5A05A 2VZ9A 5JAIA 2P91A 4RF2A 3UCEA 4CLXA 2Y99A 3M1LA 3OHSX 3S2FA 1QMGA 1PJLA 2CFCA 3WFIA 3WIDA 3SLKA 2IXAA 3DZIA 3TSCA 1MP0A 4MJLA 1V35A 5DCWA 1HLPA 3RFTA 1I01A 2V6BA 4RF4A 4JP3A 4BB5A 4L73A 3VPFA 1DC3A 5U9CA 1BG6A 4DBVO 1X0XA 1PS8A 4A27A 2NM0A 4CM1A 2GCGA 5DOZA 1NXQA 2B36A 3P2YA 3VPGA 1AE1A 1U28A 2EW2A 3OEYA 3RUAA 2PK3A 4GX0A 4I5FA 4LSMA 4I5DA 3INRA 3JD1A 4EITA 4BNHA 3O8QB 3FWZA 3GVPA 1OFGA 3HFSA 3MJCA 4IJUA 2VZ8A 3HFGA 4ZQBA 1LLQA 1YGYA 3JYOA 3EY4A 2DBRA 1E7QA 2UYYA 1H0KA 4CMAA 3D4PA 4ZQEA 3PLRA 5EN4A 4Q3AA 1CIVA 4CM9D 4GQAA 4GSKA 1PWZA 2YQ5A 3WNQA 2I5PO 1ONOA 3E8XA 2VN8A 3QA9A 4CMIA 3STHA 3RJ5A 3H9JA 4PLHA 3EC7A 1MLDA 1E3WA 3QE3A 3HJAA 4Y6SA 5AXAA 4CV3A 3ZWCA 4AJLA 1JW9B 3AUSA 2B35A 3ZHYA 1S7CA 5L7WA 1PL6A 4MKXA 4NU6A 3AUUA 3K5PA 3DBRA 4ITUA 3ROQA 2YZ7A 1W8DA 1K5HA 1LSJA 1QG6A 1U2DA 1W73A 5HTOA 4YAKA 4YT2A 2E37A 1B26A 2W2LA 1P74A 3ZU4A 2PD3A 4DIFA 3F5QA 3Q6IA 4KQWA 4PLTA 4IMPA 3JQ7A 1PU2A 3W8FA 2BGLA 4MVJF 2XF8A 1WWKA 4AJEA 4RVUA 4GBJA 1T4BA 4J49A 3SC6A 3GLQA 4B3HA 3WYCA 5JAZA 4P22A 4OJNA 4J1QA 4PZCA 4DUPA 2I9PA 4UREA 2AEJA 1HE5A 1DSSG 1EEHA 2ZJ1A 5IF3A 1BXGB 4B7CA 1M76A 4XGKA 3PXXA 3LC1O 2PLAA 1EK5A 3R0IA 2PNFA 1MXHA 1U8XX 1S6YA 2EEZA 2GD1O 3H9EO 4N5NA 3WJAA 4CM4B 2HSDA 4G81A 3FHLA 2P5YA 1ONNA 4HXYA 4BO4A 2ZB4A 2YV1A 4IQ8A 5ILGA 1GAEO 4OSPA 4FR5A 1FDWA 3UGKA 4IPTA 3WOHA 2CVZA 2VT2A 4DMMA 4OXKA 4N5LA 4WLFA 9LDTA 3N74A 5DZSA 2BRUA 4HFRA 2VOJA 3W8DA 1Q1NA 5TJHA 3RUIA 1E92A 1YRLA 4A7PA 1X14A 1QV6A 5H82A 5JNLA 1E1KA 2IRWA 3RKRA 3C3XA 1I2ZA 2D8AA 3ZWNA 5JW6A 4WECA 3BMQA 2Q2QA 4YEDA 2DTEA 4CLRA 4EEZA 2B4RO 3GVIA 1H6DA 1HDGO 4JBIA 1Y5MA 2O2SA 4IY1A 3HDHA 1DRUA 4FOOA 1NHWA 5IN4A 5BNFA 4PZEA 1PTJA 1XGKA 3F6YA 3I9JA 2C2YA 2AW5A 2CDAA 2NTVA 2V6MA 3JQ8B 4JNKA 4PG5A 3ZWXA 1YB5A 3VDQA 4IXWA 1D8AA 1PJ3A 1ISJA 4JP2A 1VSVA 1M6HA 3WXBA 1NPYA 1BSVA 4YRDA 3JYPA 1T24A 1YVEI 2B69A 2HO5A 5COQA 2E6UX 2VT3A 3TNLA 3U5TA 3IL2A 3PJFA 4IUYA 2BGMA 1I10A 1EBFA 1EUDA 4CM8A 4ALJA 4NBRA 4W82A 2VWGA 4D0RA 3JD0A 4RLHA 3RU7A 2QYSA 3GEMA 3O4RA 3VDRA 2EGHA 4ALKA 5GY7A 1DRWA 1IZ0A 1JDJA 4PLWA 3OJFA 3DZJA 4LK3A 3IOYA 3JD4A 1A71A 1N5DA 1HF3A 5L4LA 1B2LA 1RM0A 1MG5A 3U4DA 3D3WB 5IZ4A 4BQRA 4PLCA 3ZNQA 5JMWA 2Y0EA 1R16A 3JSAA 1A5ZA 1UDBA 1P31A 5TLSA 1Y8QB 1CJCA 1L1FA 4PGFA 3VH4A 3U4IA 4EZBA 3EYWA 2HAEA 2EP5A 3QWIA 3AI1A 3LSYA 4Z9XA 4ID9A 4WNIA 2NVUB 1WP4A 1U3UA 1DHTA 2B37A 3U4CA 1XSEA 1K89A 1U7TA 2DFVA 3NTQA 1GDHA 4ALIA 3B1JA 4FGSA 2VTDA 3KV3O 3IMFA 1N9GA 2DBQA 2ZKLA 3A06A 4NR0A 5L4NA 3KM0A 3DZFA 4IZIA 3Q2IA 4TSKA 2GDZA 3RUCA 2EF1A 1ZMOA 3GF4A 1V3TA 3UHAA 3WLFA 5AYVA 4XJSA 4J6FA 5JC8A 3EK2A 3JYNA 4XR4A 2Q3EA 3NJ4A 4MDHA 1D7OA 3IJRA 1H6CA 4XYGA 3RI3A 1DIBA 1K0UA 2EERA 1H6AA 2DUUA 3C7CB 1KEWA 2J5KA 3I3OA 1PJQA 4ZQHA 3K96A 2GZ2A 1JU9A 1T25A 3SX2A 3RFVA 3P7MA 2ZQYA 3C1AA 1HEUA 3ASUA 3QP9A 4BL5A 3HDYA 4ZJUA 4CQMA 4FGWA 4XWYA 2CDCA 4CMEC 2BFAA 2EJVA 1ENPA 2H9IA 1HETA 3RC1A 3W6ZA 3TZKA 1ZK1A 1KVTA 4QO8A 2XAAA 4Z0PA 2X5JO 2XOXA 3JD3A 3UVEA 1GCUA 4K6FA 3QIVA 3GN2A 4YJFB 4AJPA 4E32A 1Y81A 2X0IA 1UUFA 2PKQP 2YHIA 2O7QA 2WE8A 1YH3A 2ZTLA 3EHEA 1PX0A 2FN7A 2AQIA 2DM6A 2OBYA 5IDQA 2W4QA 4CUZA 4O1MA 3PYXA 5F5NA 4CMHA 4UEJA 3A14A 1I2CA 1CERA 1EVIA 3DAGA 4J43A 5EESA 2YFQA 1C0KA 3H9UA 4BNVA 1FDTA 2IZZA 5JFOA 2EKPA 4RVFA 1D4FA 3H9GA 5IAAA 3K31A 2FR1A 4CUKA 5L40A 4OMUA 1NR1A 2Q1UA 5K6AC 1KOLA 3QVSA 1QYDA 4YQYA 3VTZA 1DFHA 2Y67A 2RAFA 2XXBA 2PZKA 5A4DA 2GF2A 4N54A 4PG7A 5TSDA 4Q3BA 1PL7A 2ZYGA 3PPIA 1WDKA 2G82A 5EERA 4DGSA 3ST7A 2RCYA 1ISIA 2HU2A 1J0XO 1DBVO 4RDIA 4FJ0A 5T8KC 4CR6A 2NSDA 4NPCA 2G76A 2OO5A 4AJIA 5KNLA 2Q2WA 2FZEA 1SEVA 2HRBA 4UUOA 4WLVA 1F14A 1SMKA 3W1VA 2Q1WA 4OH1A 4GVXA 1ZK3A 3LDHA 2X23A 4BNUA 5KKCA 1GQ2A 3DBHB 4D79A 4IBOA 4J2HA 4NBTA 4BKPA 3ZN2A 4YJHB 2HK9A 1MB4A 2O3UA 4I5GA 3K30A 2I65A 4FFLA 2A94A 4S1VA 5JYDA 4P4LA 4NG5A 3KEQA 3QRWA 2D2IA 2IEDA 1MGOA 3S2GA 4MINA 3WG9A 5KTKA 2AG5A 2O3QA 3H65A 4FFPA 3VOSA 2AQHA 4PG8A 1P77A 1T1RA 5C7LO 3WSVA 3I52A 1K3TA 3W4IA 4RGBA 3DONA 4C7JA 1KIFA 1E7MA 1TT5A 3UUWA 1M67A 3NYWA 4BQPA 5JO0A 3NGLA 2PZJA 3DL2A 4IDEA 1XDWA 1LDEA 4CM3A 3H5RA 5COAA 5A9TA 1HE4A 1ZO8A 3TL3A 4DA9A 1PZFA 1DC6A 1XQ1A 2DT5A 3RBZA 4YCAA 3ITDA 2BD0A 2EJWA 1A72A 1QYXA 1NQ5A 1JN0A 1PJBA 4L75A 2P9EA 1EZ4A 3RC2A 1PJSA 1HL3A 3RJ9A 3QVOA 3D1LA 4M49A 4WASA 2WDZA 1XU9A 1E6EA 1SB8A 2X1HA 4J4TA 3RBVA 1YJQA 4WKGA 4AFNA 1LA2A 3RD5A 1GU7A 2Y1FA 3ZNPA 4EUHA 4AICA 3KYDB 2FR0A 3E6AA 2P2SA 3CIFA 3WGOA 1AGNA 1YBAA 4O59O 2BLLA 4B8ZA 4PN3A 3GH3A 3FR8A 4I8XA 5JPIA 2FRDA 3DMYA 3KSZO 4I5EA 3FR7A 3Q9UA 2ZJ0A 3DDNA 1R4NB 2NACA 1WNTA 1CYDA 3V2HA 1C0PA 3UW3A 1LSSA 4CMIB 4U6SA 2NU7A 5K6AA 1ZBQA 2WWRA 3LC7O 2GERA 4MIOA 5EL0A 5BR7A 2ZTUA 3B1FA 3C1OA 1W6UA 1GV0A 4LMRA 4TRMA 6LDHA 1NM5A 3JCZA 4PFJA 5L53A 3AFNA 3ZWVA 3GY0A 3CUKA 3C8MA 5IN5A 1R66A 3MJSA 3DTYA 3DBRB 4IQ0A 3DBLB 3Q0EA 3N7UA 4DYDA 1LSOA 1N1EA 1SO8A 4ND4A 3SEFA 4ZRMA 3W4KA 5T8KA 3U49A 5DP1A 1U8FO 3WLEA 3DOCA 1OOEA 5I8ZA 2V6GA 5B4UA 1A4IA 1QXSA 2C7VA 2ZTMA 1BMDA 3L9WA 1AXEA 2X9GA 3B20A 4OXYA 1LI4A 3JQ7B 4L4XA 4WCDA 3CTMA 1IULA 1Z75A 3HB4X 4CV0A 4J4HA 5DDIP 2TMDA 2YV2A 1V3VA 4NNJA 3R6DA 3UKOA 2J3JA 3MCVA 5I8WA 1EK6A 1ZJYA 3LQFA 2VNAA 3WGGA 2JJYA 4R1UA 2NADA 4XRRA 1PQUA 1TEHA 5JE8A 3OIGA 2YFHA 2D5CA 4Z0HO 3OH8A 3RQSA 3E9MA 2BGKA 2X0JA 3BIOA 2C5AA 2OORA 2CDBA 1YQGA 1GEEA 1WVGA 2R00C 2VYND 4IMRA 9LDBA 1UZNA 4XQ9A 4BNXA 4AJHA 2AXQA 5JY1A 4E13A 5G0SA 2WYVA 2BKAA 3ANNA 3PI7A 4G5HA 1D3AA 3T4XA 4YR9A 3QHAA 2NTJA 2ZB3A 4UEOA 3KYBA 3OBBA 1HDYA 2O3SA 3DFUA 4NJMB 3U09A 4GMFA 2WSBA 2DKNA 3TZQA 4YT4A 2X7HA 4J4BA 4YRAA 2PZMA 1R0LA 4E31A 2PFGA 2X0NA 1P0FA 1XIVA 3F9IA 3PIDA 4E5KA 4TMFA 5JSFA 1DIHA 2JKVA 1NVGA 1X7DA 1JKIA 3L6OO 3I4CA 3ON5A 4R3NA 1MFZA 5CEJA 1LDYA 4U5QA 2I3AA 2I6TA 4YAEA 3D0OA 2VRBA 1TI7A 1GYRA 4W99A 4IQGA 1E0DA 1LC3A 1CQJA 3KBOA 3INTA 3AK4A 4FCCA 1JAXA 4J7UA 3WR5A 4QX6A 4BS9A 1VE9A 4RDHA 1FDUA 1VPDA 4I9NA 4BNLA 3WS7A 4QEDA 5BT9A 3KXDA 3ENKA 3T4EA 3GDOA 4Q9NA 3LF2A 4XGNA 4PCVA 4CM8B 1LX6A 3KVOA 3KETA 1EUZA 1K6JA 4BO0A 1Z73A 2O23A 3GMDA 2X9VA 4WOKA 4YWJA 3EZYA 3F3SA 1PIWA 3FNEA 2QRJA 4XYEA 3AY3A 3CZMA 4H3VA 1T26A 3DC2A 5IDYA 4DL9A 1KERA 4NDNE 4WLEA 4XB1A 1EQ2A 3ZW8A 1B3RA 4OAQA 3HSKA 4UAGA 5JAQA 2Q4EA 3PVZA 4R9SA 2CF6A 4Q39A 1HDOA 1Z82A 1IZ9A 3PGXA 3I83A 4L8VA 4DPMA 1LU9A 4BNFA 4GGOA 1E7SA 3GZNA 1ADCA 3MJTA 1PJTA 2HMVA 2GN6A 1JAYA 4Y6RA 2I67A 5CPBA 2HMTA 3KB6A 4RJTA 4OKIA 1UAGA 2GASA 3GQVA 4NBUA 2J5RA 1WAMA 4ALNA 1GV1A 5T6BA 1HE3A 1GEGA 2I99A 3P5SA 2NVWA 1MUUA 1UXGA 4BO3A 1G0OA 1DAPA 4IS3A 4KOAA 5KJ6A 4FJ2A 4CUJA 4NMHA 1XG5A 2WMDA 4QT0A 4NFYA 4AJNA 2PZLA 4NBVA 1ADGA 4IM7A 1GZ3A 4AJ2A 5MGBA 4L74A 2W2LD 4BV8A 5DBGA 3WMWA 2B5WA 1YO6A 4RZHA 4XCVA 1C14A 2WYUA 4URFA 2RHRA 4TRRA 2J8ZA 1FK8A 1JKJA 4CR7A 5IZCC 2D1YA 3AUAA 3MWEB 2VNSA 3T7CA 1VI2A 4DLAA 2Y0CA 2UDPA 4NIMA 1VL0A 2W2KA 2GNAA 1NWHA 3L77A 5FI5A 1LSUA 1SC6A 3ORFA 5KKAA 4NFSA 2NQ8A 4ALLA 5TIIA 1ULUA 4CQMB 2VRCA 3OFSA 4BNYA 5A03A 1UDCA 2GN8A 1P1RA 2C2XA 3GNTA 1B3BA 4TKLA 8ADHA 3QJ5A 3ZNOA 1RM4A 1Z45A 3C7DB 3H5AA 2J3IA 4IIVA 4MVJA 4NK5A 5IFLA 4YQZA 3RUDA 5F3RA 4E5MA 2FR8A 2Q50A 2YHIB 3BMCA 3WQQA 1E7RA 1I3KA 3M1AA 1PZHA 3FCOA 3OEWA 2GZ3A 2NQTA 1ZKMA 3NTOA 3O26A 5AQ1A 2PY6A 3NT4A 1V3UA 1WPQA 3IIEA 3KYDA 4BGIA 5J23A 1I8TA 1OC4A 2FOIA 3FNFA 3JQDA 5TRTA 4BNIA 4OIMA 3ULKA 3QVXA 1GYPA 4UVGA 1J6UA 3DHYA 4HNGA 3TN7A 1Y6JA 3RC9A 3OM9A 1R4NA 4WUVA 3G0OA 4J1NA 4MVJM 2BELA 2VCYA 3B70A 1PJCA 4TRNA 1IPEA 5DP2A 4B8WA 3LF1A 4H16A 4BGVA 4BNWA 6ADHA 4FSHA 2FMUA 1HYHA 3PHLA 3LLSA 3DO5A 2VQ3A 4NU5A 5K0ZA 1B15A 1YOVA 4XR9A 1DXYA 1MV8A 3AU8A 1G0NA 3SJ7A 1G1AA 5FYDA 2Z1NA 3VPXA 3DBLA 1VRWA 3KHUA 4IS2A 1MX3A 4Q3EA 3WNVA 3ADOA 4BKRA 1BXKA 2CZCA 3KSDO 3ZNNA 5FWNA 4GVLA 1UP7A 1FF9A 5ENDA 5IXYA 3OQBA 1D1SA 1LDBA 3U0BA 3CXRA 1PGJA 3IKVA 4R1SA 2C82A 2V65A 4XEHA 3PEFA 1Q0LA 3I6QA 4DQVA 1PZEA 4QTZA 4ZD6A 3FI9A 2Y1CA 1UXHA 5I7VA 2GO1A 1QYCA 4Y67A 1ID1A 3CMMA 4GWKA 2JAHA 5BQFA 1TLTA 2ZYDA 3AM4A 1DIGA 3GVCA 1X1EA 4XZ3A 2YY7A 4KUEA 3DB2A 5U1PA 1RM5A 5KCZA 1GR0A 2UUOA 4E12A 4K28A 1M75A 1EQUA 2DBZA 2JCYA 3FBGA 1HLDA 3R1IA 5IZCA 4UVIA 3MEQA 4CM5A 1TT5B 4ZN6A 3VPHA 1U3VA 1ORRA 5TQVA 4BNKA 3RROA 1QKIA 1ZUD1 3FPCA 4I9HA 2X22A 5G4KA 3INGA 1NP3A 5TNXA 3DOJA 3BAZA 2UUPA 2DUWA 2NU9A 2PH3A 2P5UA 2WTBA 2FWMX 2BI7A 2Q2VA 1HKUA 1AXGA 1NFFA 1Q7GA 4NJMA 2O3JA 1I3NA 3EDMA 4Q3DA 1DC4A 4BVAA 1BGVA 4JX8A 2OGUA 3LT4A 3PDJA 2Q49A 1NQTA 2IYPA 3EVNA 2E82A 4WOJA 4E5PA 4YT5A 4OXNA 1SB9A 2X8LA 3AUTA 4N18A 3ZZNA 1EFKA 5T5QA 1ZEJA 3SJUA 4A10A 5L7YA 5MDHA 4AJ1A 4GSLA 4A03A 2Q46A 3IUPA 4HP8A 2A92A 2VHVA 2EW8A 4D44A 5L3ZA 1N7GA 5BSGA 4IDBA 4FBGA 2P4QA 4FOSA 3S2EA 3BMOA 2VWPA 4RCVA 4BO1A 1DC5A 1V9LA 5KVQA 4CQMD 3ETDA 4MVJP 3T7EA 4CM9A 3RSHA 1PZGA 3PWZA 3Q1LA 3F5SA 1ARZA 2D0IA 4ALMA 2PGLA 2QRKA 3WB9A 2QZ9A 3TFQA 4DREA 1PJ4A 1NHGA 2PV7A 3IAHA 5JAMA 2OP1A 4J9VA 5H83A 3D3EA 5B12A 5A3VA 5DNAA 1JLLA 1KYQA 3R3JA 1H2HA 4LSWA 2ZTVA 1AHHA 3DXFA 3RBXA 2ZATA 3WTCA 3DHNA 2P9CA 4FIZA 1LRJA 1R0SA 3ZWPA 4BNGA 5AXCA 4IDGA 1P1JA 5LDGA 2NWQA 2OMEA 3DBVO 1Q0HA 3M2PA 3SLGA 1ZXBA 2HDHA 3WBBA 4DVJA 1XQ6A 3LT2A 5EPOA 1R4MB 4FN4A 4PVDA 5LC1A 8LDHA 4E3ZA 1IUKA 1M6WA 2GYYA 4BNNA 3ICCA 2B83A 2JD1A 2Y0DA 4RL6A 4B4UA 2CNBA 3L6EA 5CP8A 4HX5A 1MA0A 1WDLA 2I66A 4CMGA 1GZ6A 1N2SA 1BTOA 1P1IA 2OFPA 4EUEA 4PG4A 2E48A 2IYOA 3RVDA 4DRYA 4PLZA 3D4OA 4B3JA 3JQAB 7MDHA 1B14A 3GFBA 1PJ2A 4EJ0A 2YW9A 4RORA 1E3SA 5CDUA 3P2OA 4MVJI 3GC6A 2WJPA 4ZQFA 3WICA 2CVOA 3IP1A 5THKA 4BO6A 1NYTA 2YUTA 1H5QA 4OSOA 2C54A 4XYBA 4AJOA 2W90A 5DN9A 4YRBA 1SEPA 4OKNA 1HZJA 1I36A 3PHGA 1GYQA 3FNHA 4M8SA 4E0BA 4EUFA 2VZ0A 3V2UA 4AJ4A 4B4WA 4YT8A 4HWKA 3F1KA 5FEUA 5KWEA 5A9RA 1ISGA 4KDFA 4J7XA 4YB8A 4WEOA 4TKMA 1DIRA 3I6IA 4KWIA 1U1IA 2IDZA 3IS3A 4ND1A 2P68A 4R01A 4JXKA 4DXHA 4E21A 1YL5A 3MJVA 1UZMA 4BIIA 1NQAO 1HZZA 2VHWA 2YDYA 3VPSA 3ROMA 4Y6PA 1HDZA 3Q3CA 1NX6A 3CE6A 1P1FA 4JQCA 2NU6A 3UH1A 3F47A 3FN4A 4XYLA 2PD6A 2CUKA 4P8RA 1LNQA 3HQ4O 5ITWA 1BXZA 2D3TA 1VL8A 5A9SB 1X13A 2G1UA 3ZWMA 4XQCA 3TWOA 1EDOA 4BHTA 3M2TA 4DPKA 1LDGA 4FJ1A 4J0FA 2HK8A 3GFGA 2HUNA 3ZI0A 1RJWA 2X4GA 3NEPX 2QRLA 2ZIZA 2XPCA 4A2CA 4BUCA 1FXSA 4CODB 3GK3A 3FNGA 4II3A 2AEMA 4GX2A 3BTVA 3CEAA 4FFNA 3V5NA 3F4LA 3WGTA 3GDGA 3GG2A 4BKQA 3EAGA 3GUYA 4KZPA 1YB4A 5EJ2A 1EVYA 3DHEA 1DRVA 5HWSA 5CDGA 3OSUA 2Y1EA 3HWRA 4F46A 3UCFA 1BRMA 3AOGA 1MXFA 2CMDA 3IKTA 5CDSA 3QY9A 5IDWA 5F1OA 2ZK7A 4CLOA 3WFJA 4B79A 1XA0A 3GZNB 1Y9AA 2VYVD 2OXIA 2LDBA 4R1TA 5JDIC 2DPGA 4XD2A 2Y93A 2CVQA 4DLBA 5CG2A 3RAJA 4DYVA 3ZV6A 4FFMA 1ULSA 2WM3A 2X58A 1GUYA 3I1JA 4PZDA 1KY5A 3BMNB 5KVCA 4C7KA 4PLPA 2Q1SA 1HDXA 5GZ6A 2BFMA 2JHFA 1K2WA 3L6DA 4QUKA 2A35A 4NH4A 3UN1A 4J3FA 1LLDA 5B37A 4GKVA 1HYGA 2J3KA 1LJ8A 1OZAA 3GEDA 1ZW1A 3CSDA 4RZIA 5I7SA 4XB2A 3JYQA 1GQQA 1XU7A 5JO9A 4CMCA 2YJZA 3E5RA 1F06A 1MC4A 3QWBA 3VHRA 3AOEC 4L4SA 4KUHA 2DLDA 5HBRA 3V8BA 2H1SA 4P4NA 5LCXA 2GLXA 1Q2XA 3ROKA 1B16A 1NFQA 4RF5A 4OL9A 1YXMA 3AU9A 1Y8RB 2JFHA 1A4UA 2W2KB 3TJRA 2OZPA 2C59A 3S8MA 1I3LA 2BFPA 4QO7A 1DFIA 3O9ZA 4Y98A 4CL8A 1GD1O 4D43A 3WDSA 5TF4A 3H6KA 5G0TA 4DWVA 2SCUA 3PDUA 4CM6A 3JQEA 5TT0A 4Z9YA 1U4OA 3JQ6A 5L9AA 3GZ4A 1IHXA 5T57A 3BMCB 4IXTA 3ZGYA 4WPGA 3V1UA 1J4AA 1VL6A 1CF2O 2AEFA 3ASVA 1YJ8A 3ZU2A 1B8UA 4HBGA 1KC3A 3ONFA 3OICA 2PH5A 3GMSA 4GWGA 4L0QA 3LC2O 1VKNA 4PLVA 5I9LA 3VC7A 4Q3NA 3V1TC 1I32A 5CEEA 3JQBC 1PGPA 5AXBA 4BMNA 4W6ZA 4BMSA 1YL7A 4YAJA 1U7HA 3GAFA 1BW9B 3BXXA 1RYEA 4O6VA 2EIHA 4PIVA 3WQRA 2QQ5A 2Z95A 3GGOA 4IJVA 4IDAA 2C0CA 4Z0TA 3U3XA 4GI2A 4DMLA 3IQDB 4U0KA 3DZHA 1UDAA 3AWDA 4NZ9A 1YOVB 5IG2A 3WGIA 4R16A 4R54A 4K1LA 5TGDA 2ZB7A 1YB1A 4A26A 2Q99A 4HUJA 3U62A 3X2EA 2CY0A 3NAQA 3BHMA 4XIYA 3SBOA 1TVEA 4I9UA 3PJEA 2O2YA 3W4JA 5JDIA 2DU8A 1E6UA 1B8PA 1U2GA 4IDCA 3OQ6A 3PWSA 4FQ8A 3H8VA 3EGOA 2GN9A 4TZTA 1BVUA 2H5LA 3K9QO 3F46A 3TL2A 1R4MA 3IDSA 1KEVA 4YAGA 3TRIA 3WYBA 3MTJA 3HDJA 4UEKA 1H2BA 2NV6A 4D45A 1OC2A 2VUTA 3I5MA 3GVHA 3G17A 2H6EA 3VKUA 1DFGA 5FF9A 4RPKA 1NQOA 4ZICA
chains in the Genus database with same CATH superfamily
1HM5A 1KS2A 5FBQB 2D2FA 1Y8AA 2GJKA 1IE3A 4LNUB 3JQAA 3DOEA 1UCFA 3Q88A 4M1QA 3K0CC 2V0GA 3C3KA 4ILKA 3DFFA 2IU3A 4MARA 1POXA 2VUHB 3D2BA 2BR5A 5C5DA 1SCBA 3AM1A 4H9GA 1EMDA 5TX7A 4OM8A 4OMFG 3NAZA 2C3PA 4RABA 4YWQA 4O4HA 2W42A 1RIFA 4ZAVA 1V4AA 4I8DA 3OCYA 2JF0A 2HA4A 4REQA 4EI9A 3ETEA 3K9WA 2GBFA 5DI9A 4EY4A 3R3XA 4BB6A 2EFJA 3QU9A 2FWNA 3GZJA 2I1LA 5EPEA 5THXA 2UAGA 2V7BA 3JWHA 2RFLA 4O4LF 3A6ZA 3K4PA 3MJ4A 4AK9A 4GOLD 2TMGA 5A6VA 1KVQA 1TKBA 1OBCA 1YUNA 2A4KA 3B8HA 4EWLA 4A5OA 4MS1A 1L7EA 5K3BA 4KK3A 4O2BB 4I1IA 4L8YA 2ZWPA 3ZV5A 3I28A 4A4AA 3THRA 1FFXB 2HLDA 3I72A 5HMMA 2H0RA 1OLXA 2AYZA 2EZ8A 3VUEA 1QU2A 4XPIA 4GX1A 4ZYLA 2PHZA 5KWSA 3WIOA 4L6CA 3BCUA 4A91A 1PV2A 4TTAA 2XE6A 1LGYA 3BRSA 2AN9A 2F9MA 3L34A 1KQNA 3SBEA 3CVWA 4MVJH 1E3IA 5CITA 4R41A 1QHXA 2IYTA 3C4QA 3DVAB 1Z4MA 5KDLA 2XSZA 2WIDA 3H5LA 1BU5A 2PZFA 3O55A 3I05A 3PFWO 1QR2A 4ESOA 3TZCA 1E64A 2DAPA 3NDBB 1WJGA 5KYGA 3NETA 3DBIA 1NC1A 4KE9A 4Z0NA 2V7PA 2VAMA 3FMFA 4FNMA 4YCNA 2PH7A 4TUYA 3HDTA 3LW8A 5CHEA 5ER6A 2AX3A 3RT1A 5FP0A 4K6OA 3VI4B 2VF5X 1TA4A 1XZMA 3K1AB 4EEXA 5KJEA 1Y7TA 3T5AA 2MYNA 4O08A 1GPYA 1K6IA 1R8SA 3AY7A 1Y3FE 1FQKA 1UBLS 1GGHA 3NYJA 1S2DA 1MG0A 3SZMA 5D84A 1FS6A 2Y8EA 4RE6A 10MHA 3D8BA 3K0HA 3TTVA 3ENQA 2P79A 3OM1A 1KYWA 2AN5A 5DS6A 4QXPA 2YDXA 5ITVA 1ISFA 2A9QA 1QK4A 4F3NA 4F3CA 1FXWF 2O54A 4QODA 3A1TA 4I50F 4R1NA 1SN7A 3LT0A 2BHTA 2PMBA 5BQ5A 5CI9A 4RK0A 4HD8A 4BLQA 3RQGA 1Q7CA 4RPCA 1IRIA 2CD9A 2VXYA 6CHYA 3LS2A 4WCFA 1Z4QA 3K0KA 5HZGA 2R8YA 2F4NA 2PFDA 1T5SA 4IO1A 5IASA 4EPYA 4NBKA 3OOSA 1BKYA 4YDHB 3HA7A 5LU8A 1NLYA 1V8OA 2XRHA 2PRZA 1EWTA 2FPIA 1APBA 4MRMA 4J76A 3X1DA 1NRXA 3KWLA 1IAVA 2VDLB 5E1OA 5BR8B 3OZCA 2J5BA 5AHKA 1J8QA 1JUDA 1S1MA 3L6CA 2FSSA 1J1IA 4NBWA 4KN6A 4S3MA 4YAUA 3JCUQ 2Q5CA 2XGOA 2O2JA 1V8BA 1KK2A 4CEJB 1IZMA 2G5TA 4EG8A 3C85A 4PX2A 2R2GA 2O2CA 3I9OA 2IZOA 4AUNA 3AHJA 4M9QA 4HDRA 1Q1AA 2CVHA 1YQXA 1DUIA 4QNMA 1DAIA 2PS0A 1T4CA 1T0IA 5I48A 1ACMA 2BJVA 2VUSA 3UK7A 4XTCS 2VTEA 2KJQA 4B83A 4AULA 4MP8A 1WG8A 2ZJ3A 1Z7EA 5IC6A 1UC9A 4ENVA 3KKBA 4DA4A 1DDGA 5HQJA 1VA4A 4AYXA 4QDLA 3GMIA 1C7RA 5BT8A 3OETA 2I15A 4XYMA 5BSEA 4WZAA 4OGFA 2C5LA 4N5DA 2Y76A 3GEBA 4K8OA 4OXRA 2ZVQX 1B0ZA 2VPWA 2R7TA 2HWYA 4RFLA 2GFHA 2ZYTX 2VB6A 3CR8A 3G1TA 3NNSA 4CJXA 3IQXA 4GLOA 2VBCA 3GI1A 3GLSA 2QYTA 1GQFA 2CYAA 4YCBA 2WJ3A 5JVDB 2X9NA 2JD0A 4CU2A 4DXAA 3M6WA 1N1DA 4KDEA 2GTPA 3NRJA 5AVJA 1XJQA 3Q3HA 4EO9A 5K0CA 3N2KA 3WNDA 2YYAA 3HLYA 3HB7A 3O4GA 3BFVA 2O5VA 4O4JA 2WAXA 4PZYA 2KQ9A 3JARA 5CFRA 1ADFA 4M6WB 5CA1B 3QEBZ 5A62A 1XAHA 3HP1A 1XLTA 3RUFA 2MHCA 4U02A 5T4FA 1CRWG 1T6YA 1YDWA 4XA8A 3BGDA 3G9UA 4DIBA 1ZQ9A 4P3KA 1ODFA 4MDEA 4IOMA 1OFUX 1KVUA 3LX5A 3OT4A 2XNHA 2OL4A 2BGWA 3OCXA 3U4QA 4F4HA 4HKTA 2JEYA 1NUPA 4RS4A 5KNBA 4JJFA 4OQYA 1LM3B 4WADA 1JZTA 3FOWA 3B5EA 2OCDA 1Q11A 3AF3A 5HXAA 1O77A 3ZDCA 1YL6A 4L9RA 3DVQX 2ALJA 2A58A 1R2QA 5B3JA 4B75A 2WIKA 1SUAA 4L2IB 3O91A 4DEVA 1M10A 1S8OA 4LC9A 3KPJA 3WJ7A 1ZM3A 2WF8A 4ZMRA 4BNDB 3NBAA 4JUIA 5J4LA 2VRCD 3H2BA 2H0QA 2PXAA 1Q57A 2QM7A 1NUQA 2W2OA 1ZMRA 4LDQA 2Y68A 2AC7A 2TSYB 2PCJA 2HLNA 2FFHA 1K05A 1W1UA 2QRHA 2ONYA 3VA7A 3HXQA 2AOVA 1N3LA 3LDUA 1R6DA 1DGQA 1CF4A 4DVYP 3W6NA 2BFBA 2F3PA 2RIRA 4QPNA 3WAQA 2VS1A 4YXFA 4JI5B 3RAFC 2FP4B 5DYTA 5F1KA 2YIMA 3KS9A 3M6UA 4NULA 3COYA 4LUCA 3B0VC 4NCXA 4LYJA 4YCCA 1OI4A 2P65A 2RI0A 5AUPB 3K7EA 5KX5F 5JMPA 1OGJA 4CNBA 1N8TA 1SOVA 9ABPA 4MIYA 5AM3A 4KWTA 3AGTA 5DM0A 4GKKB 3HN6A 2OAGA 2Y99A 3GXBA 4KAJA 2J9RA 5FAKA 3TSCA 1Z6PA 1NY5A 4EHDA 1GKKA 4YMLA 1P39A 1BG6A 2DB3A 3AG3C 2B2NA 5AKLA 3AT1A 4YGYA 3K2IA 3LHKA 2PK3A 1SXJB 5GPBA 2YFKA 3DKIA 3SAJA 3T6JA 1YZHA 2ST1A 2DGJA 4BYMA 4ENRA 2J87A 4CM9D 2WT8A 4AY4A 1A5TA 4N6GA 1ZIXA 1QNFA 3EC7A 2Z5GA 4Q4CA 3HJAA 3ZWCA 3FM9A 3U6BA 3HJRA 3DLTA 1RXVA 4G23A 2NSJA 3KPYA 2IDKA 1O57A 3FCCA 1L7NA 1B26A 4JCZA 4WTOA 1T9BA 3U19A 1ACJA 4YAFA 3ZCSA 2HMAA 2YXBA 5C1BA 4XSHA 2I9PA 1E2DA 1QJ4A 5CK4A 4LJYA 1CVLA 4WV3A 1CJMA 2EZUA 4NZZA 4N5NA 1PR5A 1KEEB 1AB5A 4X61A 3R44A 4KYVA 4W5QA 1GQRA 1G20A 1XFDA 4N5HX 2YWHA 4N06A 3N74A 5DHPA 1Z5GA 1DKRA 2X7XA 1NU7D 3RS5A 2BVNA 3JAWB 1U0OC 1JJ7A 2QWXA 3BB4A 4B6SA 2HJ9A 3I2YX 1HA3A 2IWRA 2Z5FA 3I9JA 4F84A 1RNLA 3OOHA 1FMVA 1Q16A 3HTXA 4XIFA 5JG7A 3MQ4A 2GAQA 3IL2A 4X7BA 4B1FA 1EGAA 3GELA 3E9DA 1SPBS 1K5PA 1DRWA 2LFFA 1H4VB 4GP9A 1E20A 2CXSA 4Z7JA 5F98A 2IV2X 3MPOA 2CYDA 4WJLA 3LPAA 4BBZA 3P52A 4NMWA 4BQRA 4RKFA 3L7BA 2Y0EA 1A5ZA 1P31A 2QUPA 5IJAA 4MWEA 3RVBA 1X7XB 2ZRPA 4FEAA 3QWIA 2HZBA 1RZRD 3OJCA 3G9XA 3QBDA 4XI9A 2DFVA 3L7KA 1TF5A 1RJEA 2FWAA 3OOYA 3FWHA 3RUCA 3ED5A 3UHAA 1V3TA 1MN6A 3ANSA 4HDNA 5B1SA 3AJAA 1KEWA 4RKYA 3K96A 2GZ2A 3UA3A 4A8HA 5JT1A 3ASUA 1Z13A 1DOVA 2XOKD 1EDBA 2CEAA 2EJVA 1QAMA 4YUAA 2D2XA 3WGVA 4RELA 1VKHA 1EWQA 3QPBA 2FN7A 2I4OA 5F5NA 4YMGA 1VOMA 1V43A 2HU5A 1G64A 5FUYA 4N40A 5GAJA 2XGSA 4WWHA 2ZSKA 2C8VA 1C41A 4UHEA 4QGSA 2XWSA 1QE5A 1L5OA 3VU9A 1PL7A 3A10A 1ISIA 4Z5XA 1E9BA 3OSZA 1YRBA 3G5TA 1XCPA 2Q2WA 3O9VA 2FPWA 2JGDB 4CEHA 4TMKA 2FQXA 5JJLA 3TOMA 4NBTA 1Z5WA 1I1OA 1P0MA 4HAVA 3OPVA 2TRSB 4C4RA 3C8DA 3SKVA 3WL8A 1Y33E 3MAAC 2AQHA 4B3FX 3WSVA 4ZVOA 2GBPA 3GT3A 2ASEA 2BZSA 1RTTA 1Q14A 2ZBVA 4FYWA 1L4MA 4H2DA 3DL2A 4HAZA 1OZFA 3HYNA 1NQ5A 1PJBA 2EP8A 1G16A 1IXKA 4Y9TA 1E18A 4C3VA 5C8YB 4HNAA 4DCTA 3KYDB 1H22A 2WSLA 3INNA 3EIQA 5JPIA 1QOZA 4I5EA 3OM8A 4INJA 1G5PA 3PC8A 2IW3A 4QYIA 1CRQA 3OE4A 1WW2A 5BMVB 1XQVA 1ZBQA 4XPZA 2YWAA 1NM5A 1N6NA 2NNWB 1CUUA 3HCBA 3ND5A 1ADYA 4IQ0A 3DBRB 3EIFA 4R2LA 2X5XA 5J3JA 4XEKA 1OOEA 1DTSA 3RTEA 4TMWA 2K7FA 2LV8A 4I55B 3I9FA 1LI4A 4OXYA 4WCDA 3OPXA 2W2MA 4JGGA 4G7HF 4B74A 4JR1A 3DDZX 2NADA 3RF6A 3OTWA 3HO1A 4LFBB 1NJGA 4P7KA 2FPMA 2QI9F 3P0FA 3T4XA 4J3NA 3TPZA 1SUDA 1KYYA 3FXHA 1R6AA 3U7FB 1NVGA 3IURA 3I4CA 2JC3A 4R3NA 4OJKA 5GVRA 2OHJA 3D0OA 4U9IS 4P0TA 4MQ6A 4EKGA 2XCUA 4FYVA 1YR8A 2V54A 3AK4A 2ZR7A 2XUAA 3AEZA 3T3EA 3T4EA 4UU1A 1DJPA 4HPWA 2WJWA 3DJNB 4YWJA 4QOGA 3TFWA 3W3AA 4CCSA 3DZ8A 1MJFA 4R9SA 4JVMA 1Z82A 4L8VA 3I83A 2A0FA 1LFDB 1HQCA 3MJTA 3E9ZA 5B30A 1DCFA 1PNQA 1IN4A 3NS7A 4RJTA 3JVVA 1QG0A 4KX3A 4NBUA 4UAVA 3S7TA 3IAAA 3JZ0A 3P5SA 3F8SA 1JLMA 3DP9A 5KJ6A 1X94A 4TXHA 1XG5A 4W5RA 2EKBA 2QGZA 3SXZA 1DZ3A 1QOPB 5A5DA 3WMWA 2B5WA 5IKEA 4PFPA 2WYUA 1UEJA 2QQ0A 3L77A 3F9RA 1YZNA 4KIWA 3ETLA 2NQ8A 2P7IA 1N2JA 1U89A 3L7AA 1OVGA 4EKYA 3ZNOA 3S9OA 5LXTA 1V2GA 2Q50A 3DXYA 3KUDA 1E7RA 1U0SY 2PU5A 4E14A 4IKOA 3OEWA 2R3SA 4P84A 4M3NA 2CCYA 2OO7A 3ULKA 1EX9A 3IPRA 3C6ZA 1DP4A 1HW1A 2NXWA 2XD4A 2M6SA 4GO1A 5DP2A 5DN6D 4H16A 1M83A 2B0CA 2FMUA 1EHCA 4C5AA 1AK2A 4AKHA 3U8VA 2Z1NA 3V8VA 1NYRA 3N7AA 2ZI5A 4QQNA 4QTUB 2JFUA 5DGXA 2X77A 4P92A 4EA9A 1F3OA 3GFTA 4ZD6A 1JQAA 3QM1A 4GWKA 1Z29A 1G4AE 4OUDA 1ESNA 2MYTA 4PE5B 2OCBA 2O2XA 1Q1QA 1EBBA 1JIXA 1U3VA 5ECGC 4REMA 4B17A 4NATA 2QXTA 2HA2A 2WTBA 1AXGA 5TB5A 2WWTA 1DC4A 4JX8A 3PDJA 2Q49A 1OXXK 2ZT6A 3QBVA 1E5TA 3AUTA 3CCFA 1CR0A 2DE0X 3KQTA 5CCBA 5C46F 4H08A 4NMMA 4IDBA 3FIJA 3EF3A 2R79A 4DLKA 3P4XA 2V4UA 4J7AA 4FI3F 4BDTA 1C3JA 3FTEA 4KOEC 3BIFA 4U2FA 5A3VA 1BU8A 5DNAA 2H4FA 1J33A 3VXKA 3RBXA 2AXEA 3T54A 1IG3A 1FQOA 3D7SA 2M9MA 4C78A 4QHTA 3LT2A 4PVDA 3UBTA 121PA 2B83A 2FV8A 1CEYA 4OP3A 4B4UA 4KN5A 4Y2JA 3KYIB 2QTVB 3Q7TA 5LLSA 1P1IA 5DNCA 1S0UA 4NX2A 4BCDA 1L3CA 2XCQA 3GC6A 1C9KA 1FFTC 1PT6A 1K6EA 3L8ZA 1ISGA 3ER9A 1G55A 4ND8B 4LRQA 2LNDA 1J2TA 4LRYA 3DOIA 4CTKA 3R5XA 1FE8A 2F8SA 1WSBA 2A5FA 4YP6A 2J41A 2XB9A 3TS1A 1KIMA 5HMLA 4DA8A 4EDHA 4MHTA 3A7EA 4BEBA 1KBOA 2WZGA 3I12A 2HUNA 2M6KA 2X0EA 3QBTA 3Q40A 4X1YA 2JHPA 4CODB 1UM8A 3TGPA 5MN6A 3P1JA 3OZ7A 3V5NA 4MNTA 5DIFA 2DY1A 4BKQA 4CHTA 3VZBA 5FTWA 1SUIA 3UCFA 2CMDA 2X8WA 1XA0A 1QQBA 1I5NA 2O2GA 4R9NA 2JGNA 4RHXA 3RGGA 1II0A 4MAFA 3ZV6A 1M0TA 1GZHB 1KY5A 1Q5PA 3RAEC 3BBPA 1ZHTA 3L6DA 4HAYA 3G59A 1BX1A 4QUKA 3A9UA 4J3FA 2A1TR 2NSGA 1UJNA 1YZLA 4UNPA 4CMCA 2WSYB 3QUCA 3QWBA 4C6HA 1X7YA 1Q2XA 3U3DA 1BCSB 2WTUA 4HATA 2KGOA 5D8DA 4S1PA 5K3EA 1I3LA 2KYHA 4Y98A 3PD0A 5DTRA 2R96A 1OWLA 1WXEA 1E8NA 3VU1A 5EJ7A 2FEWB 4MW9A 1NXTA 4BASA 1ADJA 1VOTA 1WD7A 1DKOA 1Y4SA 3NVDA 3AJEA 4M1KA 3ZQYA 2A3RA 2XE8A 3U7QB 1K66A 3OCWA 2BN4A 2PXCA 3SIWA 4MX8A 4G0QA 1LPPA 3AHDA 1ZA1A 1FTSA 3CPJB 1JAHA 3WNBA 2C0CA 1GFZA 3ORQA 4R16A 1YB1A 3ZZ0A 1TVEA 4C88A 3E35A 4NU8X 4UBNA 4MUXA 5KHLB 4TZTA 1YCFA 2QZPA 4LVNA 3TRIA 4D45A 2MJLA 3I8XA 1QYVA 4EQ6B 2DR0A 4CQLA 2CHVA 4NK4A 2PQ0A 1VQ1A 4ZJZA 2KJGA 1T2FA 1WXFA 2ZEJA 2PUAA 1IQUA 3GA0A 2J31A 3ZLBA 1M2WA 4LXQA 5SYAA 3RABA 3DEYX 4D56A 2XXAB 1IC6A 1OI7A 2FZWA 1B76A 1LTKA 1I2AA 2P4SA 3RU9A 1GHTA 2RSEB 2GCIA 3B89A 2ZCVA 3ETCA 1DI0A 3D7MA 2E4YA 4CZ2A 1QLHA 2WHPA 3HJTA 1SGWA 4BNZA 1XTUA 3IPYA 3WGQA 3AWIA 2ARKA 4ZI3A 2EV9A 4P9NA 3I42A 1O2DA 2CCGA 2CXTA 3RM3A 3GJSA 5PNTA 2C03A 3BCHA 2AWOA 4MW0A 1QB8A 3GEEA 3Q87B 3DYIA 2R05A 1XRRA 5LA6F 1R9MA 5I9NA 2OGZA 1IBRA 2ZJFA 4ER0A 5EGYA 1DQNA 2HZ7A 3QXHA 3LKVA 3RIPA 2OZEA 1CFZA 4UNQA 3BGOS 4V3BA 3GLIB 1PS9A 2EKQA 5FCDA 2NUPA 1RYDA 4NECA 2UUHA 1MBZA 2Z1MA 4E18A 5KZMB 1Q0KA 4FPXA 1DVRA 1RPNA 3IPLA 3DQQA 2HMSA 4HX2A 4EJSA 4L28A 4PNEA 4MS4A 1O95A 3S55A 3QLTA 4C7OB 3T7TA 2FPGA 3NAGA 1LB1B 5F9FA 4MYUA 3K0AA 1NF3A 2GZ1A 1IPFA 1JWAB 1LQUA 5GM1A 2Q3MA 3IJ5A 3G02A 3THXA 5BN1A 2QU7A 1XKLA 2R7LA 1F2DA 2QIOA 4B7UA 2EIMC 4XUCA 1CETA 1Y9EA 2WUVA 1T43A 4WA7A 4CTOA 2HDWA 2IXBA 3CCBA 1APCA 4AWXA 2XS8A 2IBMA 1C9YA 4E09A 1O0SA 2V6FA 1ORWA 3KP1A 2CSUA 5DCLA 3ZHQA 4QUEA 3JQ9A 1I3MA 2WMOB 3RSCA 4F91B 3HP7A 1V6CA 3U3RA 4OYYA 1W6RA 3AEKA 3M1IA 4QREA 2X2PA 4FM9A 2HLHA 3MERA 5CFLA 3B6ZA 2IITA 3E5MA 5K4HA 1DBWA 4X85A 4RVHA 4BWVA 1MIOA 1MNDA 3T7IA 2DLNA 1BAPA 3MWGA 2W6JA 3QUSA 2R48A 1X87A 4C20A 4EKDA 1QX3A 1J24A 5L0HA 4RO0A 1N2CB 1XVTA 4XKJA 4D81A 3L8MA 3V4LA 4GLBA 4QPDA 5L0GA 3VR2D 5F7JA 4MQEB 3UK1A 2JK0A 1JDPA 3TDMA 5E4YA 2ILTA 3ROZA 1JB1A 4ANFA 4ND3A 4IIJA 4UHJA 3P9XA 3HBAA 5LWQA 1ZVJA 2O8DA 5ADHA 3B78A 3D0RA 3DZBA 3GX1A 2YZMA 2EFGA 3DOOA 3H2SA 1WOLA 5ED0A 2VCEA 3BJZA 5AW3A 3DNFA 3V7OA 4GKBA 4OOEA 3WHLA 3L07A 4IGEA 2JAOA 1T4DA 5EP1A 1ZSYA 1RJ9A 1NN1A 2VWHA 1PYDA 3TB6A 3VX4A 5EMHA 3KQOA 4XVHA 1UH5A 4GMDA 2JFZA 4JZKA 1LPMA 2C5SA 4AL4A 5HRAA 3MB5A 2AN3A 4U7WA 4G7ZF 3BHNA 4HEHA 3S40A 3WLJA 2OHIA 3U9JA 3HN2A 1IBMB 1W0CA 1XVAA 2DT8A 2Q29A 3NUQA 1NMYA 3WK8A 4ER6A 4ZCQA 4YLEA 1DUSA 4F6CA 1EGVB 4B3TB 4FYKA 2D4HA 3FTNA 2Z2YA 2WY2D 1X15A 2EX0A 2R1TB 4D42A 2X0CA 4ZIRA 2A84A 3CVJA 2PX6A 4MV9A 4XAQA 3IQGX 4F3RA 4PRLA 1O6GA 1CQIA 2YXLA 5KTTA 3DE5X 4LECA 4BFUA 1E1LA 2KB0A 3GJ5A 4JGIA 1VE6A 4HVAA 1W4CA 1DHRA 1WEHA 1DMRA 4GYYA 1D2MA 1GU1A 3IILA 4P38A 1DCKA 2PL3A 5LQAA 3C63A 3T34A 1O08A 4PCLA 2H4HA 3R0QA 2CDNA 2YN0A 2C3UA 3X3HA 2Y3GA 4D3FA 5IM5A 2UYQA 4L9WA 2Y1WA 2YZNA 2OB1A 1CZOA 4P82A 4CKYA 3R7SA 3O83A 2R11A 4E70A 4XIJA 2WAMA 4IINA 4CKBB 2IPNA 2WU1A 2CDQA 1GPNA 3TPCA 2F00A 3EWNA 1CZRA 2OT3B 1GPKA 1ODCA 1TF7A 3RRJA 5AW4A 4XQGA 5D85A 1ZY2A 1F0PA 1POWA 2GK4A 3JVDA 1EFLA 1DCMA 5DX8A 4AG3A 1RCTE 2O4CA 4DR1B 5L45A 1XTVA 5DVZA 2PGJA 2HB6A 2WZBA 1QIMA 1UFRA 4LRTB 7REQB 4N49A 4FHCA 1G8YA 4F4DA 1AG9A 4TSRA 1J2RA 4NQZA 2FI1A 4O3FA 4Q9LA 4OGGA 4R83A 4OQFA 4ESEA 3AM5A 1Q0TA 5B53A 2O14A 1W44A 4DLZA 3WX0A 3WAJA 1IHYA 3KKQA 1M2GA 3WYEA 2UZ1A 4CIYA 1A2QA 1HKHA 3QWHA 2JARA 2AA3A 1KZ7B 3PLAE 2IOQA 1QC5B 3T5TA 3OT5A 3PFFA 5ALXA 1HDIA 1AUOA 3AX6A 5CU7A 2P9BA 1P33A 1KBQA 4DQUA 3K92A 1PNRA 2J7PA 1VSUA 5H0IA 2ANBA 4HHEA 2HC9A 1TUGA 2ODAA 3WA6A 1E86A 3ZGOA 5IHPA 4ABYA 4WLNA 1CGOA 2Q00A 1A3CA 3W90A 1A50B 4DWOA 1T9KA 4E30A 3WB1A 2QNIA 2P7HA 2HHCA 2RH8A 4MCIA 2CJXA 3HK2A 5BR1A 4E2FA 5AM1A 4ECAA 2UVQA 2IEYA 5NULA 1JTVA 4XWJA 3FPLA 3HDQA 3UPTA 4D2IA 3V7YA 3G2OA 3UM9A 3FAZA 1OZHA 5JMOA 3V1YA 1XVUA 2XADA 3ABIA 1DEXA 3DBHA 4DQXA 2JDIA 2R97A 2C5GA 4RFSA 5B2FA 5HCUA 1FRQA 3OZSA 2VH1A 3UOGA 3LY7A 4B6GA 1FOEB 3RYCA 5F52A 4AZ0A 3GFQA 3QYJA 4CLXA 1ZN2A 4RMNA 2ZD9A 5DCWA 1CP2A 3P9ZA 4TTPA 3K1IC 4DBVO 3T3MB 4Q1EA 4M46A 4IUCS 4BNHA 5KQRA 3G2KA 4JUDX 2WJIA 3BVPA 3PBKA 1ZC3A 1OV6A 1CFJA 5DIZA 5GGYA 3M79A 4AY2A 1ONOA 3ZQ4A 1THTA 1RRGA 1M2EA 4G41A 2WNIA 3ER8A 5F5XA 2W2PA 1S7CA 1W0JA 2M1ZA 1GVNB 3JRXA 4C0JA 4YT2A 1DOZA 1EJBA 4ZU6X 1GWNA 2GJSA 4JT4A 4PY2A 3QZCA 2D1FA 3BORA 3JQ7A 3W8FA 3C8GB 3V32A 2PJZA 2JEOA 3SDZA 3WMEA 3ESBA 1RWPA 2A6PA 2Z58A 2FN4A 1U8XX 2EEZA 4B6IA 4QPCA 3H1FA 1UPCA 2YV1A 1GAEO 3UGKA 2CVZA 5K99A 5LP6F 1N2ZA 5EQJB 4N5LA 4D8UA 2BRUA 1T10A 4NG4A 2SNIE 2IRWA 1ZRSA 3MWDA 3I6YA 1SKAA 4N8EA 4DCSA 2B4RO 1AF4A 3P32A 4PTLA 1SD5A 4DY4A 4BB0A 3CUVA 3F8WA 1Z7Qc 2IT1A 1A9TA 3A4YA 2PUFA 3W7AA 4IUYA 3LKDA 1L5SA 1TMGE 4NMXB 1QH1B 3THYB 1HR0B 3FYUC 2G1JA 4LK3A 3JD4A 4R0MA 4HQKA 5AMXA 1CJUC 4MUBA 1UIRA 5K0JA 2XI4A 3GJ8A 1YZQA 1EI7A 4PNZA 1U2TA 4ER3A 2Y3BA 1CP3A 2D1SA 1AMUA 3FTFA 3B6IA 3GJ3A 2XJ4A 1FVOA 2IW1A 4ZEVA 3ICQB 1TWCA 1FUKA 4NPAA 2CKMA 3D8SA 1XZQA 3U2LA 5JS2A 1JU9A 4L3OA 3P7MA 1NR5A 3QP9A 4Z8YA 4CQMA 3F6PA 1XMSA 1WUIS 2QUJA 4HTAA 4DV7B 4TWIA 2BFCA 2RGXA 4IR7A 1MAVA 4DUGD 2YHIA 3KQUA 4XOUA 5HSWA 3RTAA 5E6UA 5EP4A 5BPHA 4O1MA 4UEJA 3MTIA 5JNVA 4HAIA 4EGCB 4WACA 1XROA 2RH9B 3H9GA 5IAAA 4FKBA 2CJWA 5AHWA 4E4RA 2JPUA 2DSTA 4JLPA 1KOLA 4ZV7A 4AF8A 4A2PA 4QBIA 5TVGA 4JKYA 1PVDA 4BQIA 2FRVA 4Z86A 1F14A 3AESA 2X23A 2BM8A 2L42A 4CF7A 1ZA2A 1MB4A 1GP2A 1C9MA 1ZN7A 3IEEA 1P1CA 3V3KA 3Q1KA 3MF4A 3WG9A 4FFPA 4X0EA 5LQKA 2BEVB 3N75A 4C7JA 3ELWA 4MUMA 3MS7A 4B80A 1BD3A 2PZJA 5BUZA 3QTBA 4CM3A 1YLMA 1U2RA 4IDHA 1HE4A 1ZESA 4E1BA 1AY0A 3RBZA 2J0UB 4A3SA 3F71A 1A72A 5K8LA 5LQSA 1TYAE 2A9VA 1IEQA 3QUBA 2CW0F 1LVGA 4GZ5A 1VMKA 4M49A 4J4TA 4AFNA 4AZ3A 4DCUA 1OXVA 1W75A 4KRYA 1JILA 4FD2A 4DSUA 5EE9A 4WGFA 1EFRA 1LH0A 3WY9A 4KITB 5AKZA 3L0IB 5K6AA 4PC1A 2WWRA 1ZRMA 4PJNA 4X9XA 1JBQA 3C8MA 3UMIA 3UJNA 4PZLA 4NYJR 4Y6LA 4N7BA 1FFYA 4ZRMA 2C4UA 4XM0A 5JJ5A 2BW0A 4C3DA 2X9GA 1HG0A 1SKYB 1SU6A 4EH1A 1GAWA 4CEIA 3D3QA 4HNQA 5K45A 4N0QA 3GWZA 2VSQA 4XCXA 1EK6A 1ZJYA 5BYBA 3SZGA 5BURA 3PTAA 3GYGA 3OIGA 2YFHA 2XH8A 5J2UB 2OU6A 3E9MA 3ZW7A 4F4BA 4BECA 3WZ2A 4JSYA 1PT8A 3PEYA 1WVGA 4NY3A 4IMRA 4J16C 4C08A 2AXQA 1WBDA 2AI1A 1LK5A 1KKLA 2NYVA 4YR7A 3D0QA 3EFBA 1G2OA 2HF7A 3PRKE 4JIMA 2ORVA 3FDZB 4PSUA 4U5QA 3A04A 2P78A 4RZXA 4NENB 5BQOA 3RFYA 1PFYA 4XGNA 3CAXA 1Q0MA 2Q5EA 4ER5A 1ZD9A 1EUZA 3ISJA 1XXLA 1QRTA 2GJ8A 2H1CA 4Y2XA 3CZMA 3B38A 1SVUA 4TQAA 4NDNE 5IT4A 3UWMA 2CMGA 3CBGA 2RDMA 4H60A 1YR2A 1UK7A 2HMVA 1JAYA 2O8CB 1NBBA 4G4SP 1U7DA 3I2KA 4WDRA 3CKKA 4K7JA 1H8HD 3I1YA 4M1SA 4Q24A 1H2YA 4QJ4A 1GPUA 3BEDA 1Z34A 2IA5A 2WMDA 1F2TA 2C2BA 2VT7A 2W48A 1NY6A 4URFA 2W4BA 3VKHA 4NIMA 3JQQA 2XQGA 2GHIA 1SC6A 3ID6C 5TIIA 3HU1A 5CFNA 3P96A 4YRPA 2J0EA 2NU6B 3NTVA 3THWA 3C7DB 2FUKA 2FR8A 1A1SA 1I3KA 3AG2C 3K72B 4N7MA 2JIPA 4XLLA 4DFDA 4IIFA 4RH1A 1JHYA 1XRLA 5KOJA 1U0EA 2M6RA 5A6KA 1RW4A 1Y6JA 4J1NA 1ESZA 3UC9A 3DL4A 1S2LA 1H9TA 4RKWA 4HGPA 1A5AB 5KMGA 1U6IA 1XMXA 3R0VA 4Q3EA 2NAPA 3AR4A 3BQNB 1O3UA 4IFIA 1VRVA 3AVOA 1MOPA 1ID1A 1ULZA 5KCZA 1Z4NA 2H52A 1K88A 4XPYA 4MSUA 2J3LA 4TV8A 2MMCA 4I9GA 3R0ZA 1Q6YA 1FW6A 4M0FA 4MLCA 3BAZA 5B1BC 3DWWA 1Y3BE 3H5WA 1MAHA 1RRMA 3MRTA 1P9OA 1BGVA 3CPHA 1SZDA 1U5BB 2JLCA 2BGIA 5KOHA 4N18A 5REQA 3D2LA 2J46A 1VYIA 5JARA 1BH2A 2V97A 2ACKA 2WINI 3SU8A 4NTBA 3DUFA 5EZYF 3TFQA 1UODA 1NRJB 5KQPA 5JAMA 3QX3A 5H83A 2RGUA 4BX3A 5B12A 4C4ZA 2WZQA 5LDGA 2QVLA 3DBVO 1R4AA 4QVGA 1CPYA 4LI0A 3FJOA 2OOCA 4DVJA 4HN9A 4U8HA 3KKKA 4OQXA 2WB4A 1YTLA 1KAOA 5FOXA 4ZVMA 4FCVA 4LXGA 3N9IA 1CPQA 3P0EA 1QO9A 5CDUA 1LZKA 3EDQA 1V48A 3TNFA 4QRIA 4OKNA 3TJ6A 3E70C 1Y5IA 4HWKA 5A9RA 3MGGA 1YMQA 4KWIA 3FROA 3ZCQA 3W8NA 2GO7A 2CSXA 3FCUB 2VIIA 3UXEA 1NBWB 5L0IA 4NYMQ 1HLFA 3CE6A 1P1FA 4JDPA 1N75A 1EDEA 4V38A 4LHZA 3CT4A 3IHUA 1ZVZA 3GFGA 2X4GA 3LFUA 1KR2A 4QAQA 1YKSA 2X6QA 1FVFA 4QU0A 3GDGA 5AJUA 4Q21A 1EHIA 2C0PA 1EVYA 2NUTA 3B3AA 3LOQA 3T5DA 1GTSA 1JPJA 2P0EA 3E7XA 4YMUA 4QLOA 3UN1A 2DFPA 5HCNA 2YJZA 2ZE6A 4AU1A 1YARO 5IJ9A 5HBRA 2PN1A 2QJTA 1SUEA 3AU9A 3SXMA 3FMPB 1IRXA 1Z8FA 2IXTA 2WR8A 1AT1A 1MQSA 1TO2E 3ZHVA 1DC7A 1GKIA 4INZA 5T57A 1IHXA 2Q7XA 2L6FA 3BMCB 3RFUA 4K03A 2AEFA 1YJ8A 2VPZA 2D13A 3PKJA 3ZCUA 1G6OA 3JAKB 2PUVA 1JTEA 4LOHA 1AEPA 4MLZA 1YR1A 5JADA 2ZSIA 2A0BA 2EQAA 4U0KA 4G56A 1P91A 5DE3A 5IG2A 3VO1A 2Q99A 4Q7QA 4K1OA 2MYUA 2WNHA 5E38A 4PQGA 4NF2A 1U2GA 4MEJA 2CV2A 2ATIA 4MV7A 3QF4A 3H8VA 3EGOA 3H83A 1Y63A 2YWXA 4YRSA 4J6EA 3ILHA 2PBFA 1R5BA 3O9MA 2QSZA 2DYRC 1TX4B 2HRQA 4UD6A 2C96A 3GL9A 5EJ9A 3VAZA 5LB4A 2Y77A 2ACWA 4EW2A 1ZZPA 3A28A 1DARA 4MIEA 4W1PA 1GPJA 2AB0A 2C9DA 5EQDA 3QIAA 1G8SA 4RYDA 2ZRLA 3UH0A 2AZ4A 4Y1EA 1X3LA 3KJEA 3FMGA 2OD2A 3PUKA 1XCBA 2OB2A 3TQHA 4I4TF 1EDZA 3VRHA 2GN4A 3KCNA 1I6MA 2HFIA 2QUZA 3IT3A 5THQA 3MXOA 1RWNA 1E3QA 3AG5A 2BP7B 2JZCA 4J32B 2C58A 3I73A 2BWJA 1E1RD 1E2UA 2VJNA 5E4FA 4MVJD 1V16A 1RWWA 4FFWA 1JLLB 1JQJC 4LTMA 3ZIUA 3SEZA 3DAPA 2BGNA 4QM7A 1MZVA 4QATA 4K9MA 1C7QA 4PZZA 4XASA 3O8LA 5D86A 1QHIA 3RK1A 5BWLA 2Z08A 2IV3A 5DBHX 3HM9A 3T5MA 1RXWA 3QE0A 5IVKA 1Y6FA 3GGJA 4JYAB 3K6SA 4GQHA 3K4QA 1S3GA 4D9JA 4PGHA 3K9LA 3DPSA 1E2BA 4E2YA 2DBVO 4DNOA 4JBXA 2Q3TA 5HX7A 4CG3A 3RIHA 3T5GA 3UC5A 5BOSA 4L76A 1ZHHA 5JUWA 3OCUA 4G0UA 1MRSA 1RFGE 1GRNA 2VR1A 3ZW9A 3TD7A 4D82A 3NDIA 3T6GB 2C4NA 5A06A 3M9LA 2QRQA 1NSTA 1BW9A 3Q7PA 4IHJB 1A9PA 1LD3A 2OZLA 4X1IA 2VSFA 3KKMA 2RD9A 1IIBA 2JFQA 4M2LA 3WNCA 3PX2A 5K1ZA 1V9SA 3UG7A 1NBHA 4ESHA 1Z88A 2J5XA 5AKEA 2HUPA 2J5QA 5IT5A 3GLUA 1RI5A 4Q19A 4UOZA 1XZJA 2JHAA 4LVUA 4TVBA 1ZJ6A 4MPJA 5BV0A 3EXHA 4RJJA 3RAPR 1U2QA 5BN3B 5CCXA 1XD8A 1C9DB 3EQ2A 5A2GA 4DNXA 5KYXA 4V39A 5TPWB 3VOAA 5C3UA 3L7DA 4I0WB 3DEZA 2FTKE 3DWIA 1YMVA 5EFZA 2ORED 3PTLA 4HTFA 4EK9A 3T1VA 3OA0A 4L9AA 2HRZA 4NJEB 5E33A 3MHPA 2PKCA 4PZ0A 1XEWX 3CH4B 3L8HA 1L4NA 3C8HA 3DF7A 1RLUA 2G0TA 2RBKA 4QGFA 4FTWA 4RCZA 4F5DA 1HT0A 1FB5A 2J0QA 3IC5A 4PF1A 3W7VA 2D5AA 5AJXA 4HADA 5FOTA 1KFKB 1ZD8A 3IE0A 3HKBA 4RKRA 4EGSA 2XHEA 3UJAA 4Y9UA 2TYSB 2Q45A 4JOSA 4QSMA 3JY6A 3FRJA 3KZCA 4TMTA 4FGJA 3BC1A 2FKAA 5GIPE 3KUCA 1JV2B 3P9NA 1Z0FA 1RXSA 4JFRA 5ALNA 1DOAA 4YAIA 2GM3A 2DCUA 1QK5A 4ZC8A 4GL4A 1B6GA 4TXNA 3KAKA 5AI8A 2OHXA 3O38A 4R05A 1UKZA 1C1YA 2QN3A 4ONEA 4QIHA 4RD3A 4EL0A 2VK8A 1UP6A 5ICGA 2WBLC 5HUJA 2WWGA 2HJGA 4FMBB 4HGZA 2Q0HA 2E89A 4ZO8A 2EKLA 1VLLA 3QMKA 2ZRNA 3LXXA 4PGGA 4U2BA 3R3WA 3COSA 1ZBDA 4YCJA 1M2OB 2LXNA 1QVWA 4NE9A 1E6WA 1YFJA 5EWMA 1W49A 4K0RA 1OIXA 1ZU4A 3O8QA 3EZXA 2AU5A 1A41A 5E7QA 2QX9A 5EQTA 2ZS8A 3S44A 2M32A 4YJGB 1NT2A 3EYAA 2UUAB 1Q92A 1QQAA 3SXPA 1N2OA 1ML4A 4H6WA 1UBUS 4HFNA 1J09A 1MD9A 1AUPA 2DTXA 4X6UA 3V4VB 5JCZA 4OP2A 2QSJA 4OHRA 4FKMA 4ZVUA 1XZLA 3RLFA 5CAEB 2IPAB 2A9FA 4KWCA 4O1IA 2SBTA 4ZAYA 1LPSA 2OBNA 4UM7A 4K26A 1C7FA 4KPFC 3NIGB 2PEYA 4U2GA 3E2IA 3FFWA 3ZC4A 5CLJA 4OK6A 2GJ4A 1G3IA 5AKKA 4ISBA 3FF4A 3L4BC 4WVLA 2OA0A 2QL9A 4NYJQ 5EIBC 2QTZA 3PMRA 3NVMB 1E0AA 2F90A 1T4GA 4PS0A 1QR6A 1T9GR 1YA6A 3M4XA 3DBOB 3SHQA 3KSRA 3MUNA 1V0JA 5JRZA 5BNIA 4KW7A 3NRCA 2HJWA 5EKUA 1DQPA 1BDBA 4KAAA 1L7DA 1FNSA 2VYVA 2Q62A 3GNSA 3QSGA 5EKXA 1Z68A 2YVKA 3M4NA 3WZLA 4TQ9A 3FLMA 1MEOA 4OIFA 3ADDA 3VKGA 3BD9A 2PGOA 3ABRB 2ID7A 1QVVA 1C3EA 4HS9A 4TTJA 4M86A 1I30A 2PGDA 4OLAA 3D6TB 1JFRA 1F4VA 3S2IA 4G5SA 3FSJX 5K2MA 1U7WA 3H2YA 1HO3A 5A5FA 1TWGA 2DFDA 2PRJA 4LMBA 3EZ9A 4BJ1A 2OZVA 3SC2B 4JT8A 3B6EA 5L0CA 3K1ZA 4K6HA 2RGWA 1BX0A