4YT5A

Hmdii from methanocaldococcus jannaschii with bound methylene-tetrahydromethanopterin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
344
Chain Sequence
DNMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 111
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt5A01
3C85A 3GAFA 2P9EA 4B4WA 4XRRA 5AXCA 3D5QA 3PQDA 3DMTC 2CDBA 3JQBA 3QHAA 3VHRA 2DTDA 3AM4A 1ZSNA 2VUTA 4KUHA 3UF0A 1Y1PA 3HUDA 5HTOA 3DXFA 1LDNA 3DBLA 1KY4A 1V3UA 1ONOA 4JP3A 1YJ8A 1VL8A 4DIOA 2QX7A 1A27A 4D45A 3MWEB 1E6UA 3S1LA 1I01A 2BFOA 4R68A 3IL2A 4NFYA 1YQGA 4FFLA 5I9NA 1YKFA 2E37A 1I3LA 1Y8RA 3WJAA 2O50A 1MA0A 1P0CA 5IZCA 3M1LA 3TL3A 3VPGA 3DONA 3V5NA 1SMKA 3TNLA 2CUKA 3H9QA 1GEEA 3WX0A 4HP8A 4PLYA 3VTFA 4ZQBA 4OSOA 4TZTA 1VPDA 2WYUA 3BAZA 3HADA 5C5IA 3ZDFA 1JQBA 4FJ2A 3MJTA 3W8FA 4RVGA 3GZNA 3ADOA 3INRA 7ADHA 3TFOA 4GL4A 3VTZA 2I3AA 5IXYA 1NAHA 1NASA 1O6ZA 3TWOA 3UN1A 5A5EA 4D7AA 4FR5A 1DHTA 5EQDA 5T8KA 2PD4A 4U6QA 1LDBA 3EW7A 4OMUA 1P77A 1HETA 2J5RA 3I52A 1ZIDA 1OC4A 1SZJG 3IKVA 2VNAA 3V2UA 3ASUA 1GUYA 1ZXBA 3WSVA 1HLDA 3NDRA 3KEQA 4ID9A 2TMDA 1P1FA 2B35A 3O03A 1UDBA 3HFGA 4TSKA 1ISHA 4ND3A 1HSZA 1P3DA 4R3WA 2PKQO 1K2WA 1Y8QB 4DQXA 2O3TA 2H9IA 5JPIA 2JAHA 3ST7A 1EVZA 4ZA2A 2UUOA 4PG5A 2H1SA 1Q7BA 1YOVB 1U2DA 4NBUA 4W9NA 3UUWA 4FC7A 2CD9A 1GYQA 1H9AA 1SAYA 1XU9A 4G81A 1KVUA 3MTGA 1HLPA 5JBIA 3GEMA 4EBFA 3I3OA 3O8QB 5A5FA 3RU7A 2HMTA 5L7TA 3JV7A 4IPTA 3FWNA 3RU9A 3IAHA 1IE3A 1SBYA 1T1RA 2EF1A 3SC6A 2Q1WA 3H6KA 1BXZA 4LN1A 4R51A 5JYDA 4J7CA 1K6JA 2AG8A 1XQ1A 4PG6A 2WD7A 3RSHA 2ZTMA 3KLMX 4LK3A 4OXKA 5JMWA 4M1QA 2I5PO 3P7MA 1QYDA 1K89A 1GCOA 3WS7A 5JNLA 2NQ8A 3INTA 1XHLA 2BGKA 3VOSA 2W4QA 4XJSA 3WLFA 2NADA 2I9PA 3LC2O 2B5VA 5I7VA 3ZWMA 3QE3A 3E5RA 2UV8A 1IPEA 1E1MA 1E77A 1SNYA 2OOSA 3GGPA 2Q1SA 5TT0A 4WNCA 4FFPA 1ISFA 1H94A 4I5GA 1NPDA 3ANLA 5DDIP 3WWZA 2VWHA 2W2LD 3H3JA 4N5MA 4XGKA 3I9NA 4QFDA 2DC1A 3KLPX 3EVTA 4GVXA 1UXJA 4IDFA 4BMNA 4RV9A 4CLXA 5DOVA 2QIOA 3O26A 5TT1A 4FB5A 4BNWA 2Y1DA 4PIVA 3ZN2A 5KNLA 4Y6RA 2GN4A 4B7UA 4YT8A 1B26A 3CUKA 1IY8A 1EVYA 3QP9A 5KKAA 1B15A 5JCXA 4JQCA 3I9KA 3WMWA 2Q2VA 3FBTA 5GZ1A 3QW2A 3WJ7A 4CMJA 4FCCA 4OKNA 5I7FA 1U4SA 1VE9A 1HYEA 1MGOA 4E33A 1FDUA 4ZRMA 4CMGA 2Y05A 4RVDA 3BTVA 1PJQA 3ZNNA 4E2WA 3UHAA 4RF3A 5T6BA 1VL6A 3RFTA 1T26A 2BF7A 3PDJA 3L07A 4G2NA 2OP0A 1YDWA 1A7AA 3I9JA 1A71A 3DFZA 4WLUA 5IN4A 1E7WA 3RASA 3DTYA 2CVOA 4B7CA 1U8FO 4LRTB 1Z82A 1PL8A 4JIGA 1Y5RA 2Y0DA 4IXTA 4JBIA 4P4GA 2HCTA 1PS8A 1UP4A 3HFSA 3KHUA 5IN5A 1VLLA 2VQ3A 3ZW9A 4QEDA 3C24A 2PD6A 1IOLA 3HN7A 4MVJM 5G0WA 1VSVA 2X0JA 3GQVA 3SEFA 3A9WA 3OJ0A 3W4IA 3F6YA 1FJHA 4NNJA 1JTVA 1NWHA 3VKVA 4EJ0A 1LXCA 6ADHA 4XCVA 1CYDA 1P74A 3AWDA 2V7PA 3MJVA 3I5MA 5F1KA 3WFJA 2FR8A 2NNLD 4GMGA 3ASVA 1ADBA 1TT7A 3AM3A 4GX5A 1NVGA 2OBNA 3QJ5A 1I3NA 1E3IA 3QVSA 4ZRNA 4CLDA 2AW5A 5C7OO 1WVGA 4K1LA 4PLPA 4L74A 2NU8A 6LDHA 4YAEA 3U5TA 3IP3A 3VZRA 5JC8A 5BNFA 4ILKA 1RPNA 2O3QA 2YV1A 3K5PA 3GUYA 2X5JO 4QFCA 3S8MA 3DZHA 1G0OA 4F3YA 3OICA 4B3IA 4HUJA 1KY5A 4IIVA 5C7LO 3K96A 2UVDA 5DBIA 1HYHA 4ALIA 1NQTA 4JCOA 5JW6A 1VJ0A 2AE1A 1W8DA 1DAPA 1BVUA 1Y8QA 2W2LA 4WCFC 1DC3A 3M6IA 2G1UA 3ZNPA 1DXYA 3U62A 3GVHA 3F4BA 1UXGA 1JAXA 1P31A 3I9OA 1LSUA 3JQ7B 2VHZA 3NGXA 3Q2KA 2IRWA 3V1YA 1Q0LA 1RM4A 2X0NA 3ON5A 4EDFA 5COAA 3QRWA 2PGLA 3BHIA 3WFIA 1PQUA 2JCYA 3LF2A 5ICMA 3NT2A 4N18A 4BNVA 1IUKA 2CDAA 3FTNA 5KVCA 1O89A 4YAGA 1KVQA 4BO3A 3PQFA 4DMMA 3L4BC 4FJ1A 4FQ8A 4HXYA 1PZHA 3Q11A 1PZGA 2VT3A 4B7XA 3PLNA 3ETGA 3JCZA 5K6AA 4G5HA 1PR3A 1E7MA 3A4VA 5TLSA 3CEAA 1PL7A 3OF2A 5CG2A 2WEKA 1E3JA 2B0JA 2NVBA 4RPLA 1T25A 2DBRA 5JO9A 1C1DB 3ZV3A 1N1GA 1GL3A 2Y1CA 1DJQA 3KXDA 1TXGA 4YT2A 4II2A 1PGQA 2EXXA 4L8VA 1C0IA 3C8MA 2WTBA 4WEOA 4BKOA 4BO7A 4F45A 1Z73A 3RVDA 4BGEA 4PZDA 1TI7A 3PHLA 3PJEA 1CEQA 1EE9A 4KDFA 4Y6PA 1MUUA 3HZZA 2FSVA 3PVZA 4FJ0A 3JD2A 1WDMA 2H63A 4NBWA 2EJWA 1UAYA 1YBVA 4LVCA 3STHA 4DTIA 5ER6A 3EC7A 3X2EA 2GLXA 2C7GA 4CQMA 2NU9A 4KDEA 2DTXA 2UAGA 3WYEA 2HK9A 2OUIA 1HEUA 3OMLA 5EN4A 5I8ZA 1ZKMA 3GF4A 3NTQA 3WR5A 5JYEA 3FBGA 3DZBA 4NMHA 5JCJD 4CLOB 3DR3A 4QUKA 1UH5A 2AQKA 2JL1A 3UAGA 4LCJA 3UICA 3WWYA 3DMYA 3RC2A 3KYCB 2I65A 2AQIA 3GEGA 1LSOA 3DZJA 4CUZA 1PGPA 3LC1O 3H5NA 4A27A 2JD2A 4ZJUA 1DIRA 4MKRA 2Z95A 4B4OA 4RGBA 4S1VA 4WPGA 1CIVA 2C0CA 4E4YA 3PHIA 4IDGA 4BNZA 1HL3A 4DGSA 2F1KA 3GLQA 4H15A 1ZVMA 4GVLA 5GZ3A 3DBHB 2NUAA 4RO0A 4NBTA 5F5LA 1EE2A 4MKZA 4RLHA 3C7DB 1UZLA 2JCXA 4B3JA 2JHFA 5L3ZA 1GQQA 3KV3O 4U7WA 1MB4A 2RBEA 4A7PA 3FNFA 4TVOA 4NFHA 2D5AA 1HWYA 4F46A 3RIHA 4RVUA 4BS9A 1CWUA 4O59O 5DULA 3O4RA 2VNSA 4W99A 1YDEA 5A02A 3WDSA 3PRJA 1LDGA 4HWKA 4R5HA 4D3DA 1DFHA 2ZB7A 1A9YA 1YB1A 4WLEA 4MVJD 4IDAA 5LCXA 3ZCXA 5U1PA 1K6IA 3AY7A 3DWFA 5DT9A 1WXDA 2P68A 5EINA 2QRLA 3OJLA 4CV1A 1GQ2A 1YGYA 3CH6A 5KTKA 2PKRA 1HDGO 3T4XA 3AOGA 4Z9YA 3TSCA 1TB4A 3GFBA 4Q3EA 4TMFA 1FDSA 2Q49A 4EYEA 3P2YA 4XDYA 1QORA 4MP8A 3GAZA 1H2HA 1JWBB 3AUSA 2AEMA 1GR0A 3WYBA 4RJTA 4IS3A 5KVVA 4YR9A 4D0RA 2NVUB 2JJYA 3TZ6A 1PTJA 4AJHA 3P5SA 1CETA 4LSWA 2G82A 1RWBA 1YRLA 3U49A 3U4HA 3BMQB 1OC2A 1J6UA 3SLKA 3WG9A 4YRBA 1DLIA 2O48X 4CR8A 3BA1A 3UCFA 1PQPA 3O9ZA 4HADA 5JCJA 2Z1MA 4I9HA 3MEQA 2X9VA 3SC4A 3ZWAA 1ADGA 4FGSA 1DC4A 1LTHR 1NWCA 2X0RA 4BNGA 4OIMA 5JO0A 4A10A 2HAEA 3PYMA 4DXHA 3DBLB 4OKIA 9LDTA 4XGNA 4NG5A 4RPHA 3PPIA 4BKUA 4CODB 1DOHA 1KC3A 4J49A 1O5IA 1SOWA 5JDIC 1Q7GA 1OOEA 4XIYA 1AXEA 5EL0A 2GCGA 3EVNA 2NTNA 1XU7A 1Z6ZA 1Y8RB 3H9EO 4NR0A 1PJSA 5BNIA 3EHEA 4NBVA 2ILTA 3K92A 4RLSA 3B1FA 4WEQA 3FNHA 1GD1O 4IGFA 1DC6A 4QXMA 5F1OA 4B3HA 3RWBA 4R1NA 3GC6A 1EMDA 1RYEA 2NTVA 3UFXA 1B0AA 1N5DA 3E9MA 3H5RA 4MP6A 4YQYA 5A04A 2ZB3A 2ZYDA 3JQFC 4DBVO 4U0JA 4BO9A 2C20A 4MVJG 3GZNB 1OI7A 2B4TO 3NRCA 4BL5A 5U4QA 5L9AA 4YACA 3WIEA 1BHSA 1PJ3A 3BXXA 4J1NA 1HDZA 3OIGA 1DRVA 1LQUA 3WYCA 4JXKA 3FPCA 5TRTA 3LT4A 4K6CA 4MIYA 4ND2A 5IG2A 5L4LA 1GU7A 1GZ4A 3Q1LA 4I5DA 3GG2A 4MVJA 5EERA 4EGFA 2VWQA 2HU2A 3UVEA 3OECA 4QQRA 3LVFO 5F1PA 1BXKA 3E1KA 2CVZA 1EQ2A 2H5LA 3TDKA 4CLOA 3IC5A 4URFA 4RVFA 3WB9A 3BHMA 4BKRA 1ZBQA 3HDYA 3KOUA 1PWZA 4WKGA 2VWGA 1PJ2A 4PZEA 2YUTA 1LDEA 2Y1EA 1IL0A 4MKXA 2ZQYA 3ZU2A 3F47A 3Q0EA 2NM0A 2Q45A 3FF4A 2D2IA 5JDCA 3GHYA 3OP4A 1B7GO 2VZ8A 4XDZA 4PZCA 2EKLA 4N5NA 4CQLB 1XR3A 4PLCA 3C1AA 1UUFA 1I2CA 4CMEC 4PFJA 1R66A 1MC4A 2EWMA 3VH2A 5L51A 3PYXA 1BTOA 3P19A 3NDJA 4ITUA 4ZQHA 2D0IA 1LLCA 2WD7B 2GF2A 3OJFA 2Y67A 4IJUA 2GN6A 3H9UA 2IZ1A 3DEYX 2VWPA 5TS3A 2Q4EA 2JFHA 4BHTA 1ONPA 1NFQA 4RDHA 4HX5A 1UDCA 2OGUA 3F5QA 1HTBA 5EPOA 3OBBA 1R15A 1UP6A 1ENZA 4II3A 4N54A 3PHGA 4PLGA 1JDJA 4H3VA 3DMTA 4HBGA 2P4QA 1N9GB 3E03A 3QWHA 3GDOA 4XYEA 1E6WA 3GGOA 3GH3A 2IEBA 4JK3A 3H9GA 4W6ZA 4WK6A 4J9VA 1AN9A 1PJTA 1ZK2A 3PQEA 3U09A 2BHLA 1X14A 2YV2A 2VZ9A 4DPLA 4JBGA 4YT4A 2EERA 3PI7A 4UVHA 4ZN6A 3NJ8A 2V6FA 3P2OA 4XQGA 3PHHA 1MX3A 3LK7A 2C5EA 1UR5A 4UUMA 3DDNA 3FD8A 3M1AA 3HG7A 1DO8A 4DWVA 4E6PA 4PN3A 2IYPA 4PLWA 2WM3A 2RHRA 4BOYA 2GASA 4ND1A 4OH1A 3WMXA 5FFFA 3NV9A 4J3FA 3OEYA 3MJSA 1PIWA 3VVCA 1YBMA 3GVPA 1R16A 1D3AA 2Y0CA 3S55A 3LZ6A 2VHXA 1U2GA 5I9LA 3ZV5A 5K9ZA 1HSOA 5H83A 3QWBA 4IM7A 1KS9A 1EDZA 4J16A 1J4AA 5JE8A 5CHEA 1WWKA 4YTEA 4BO0A 1RJWA 3ICCA 3TJRA 4FS3A 4C7KA 4YJDA 1M67A 1ZO8A 2D1YA 4Z3DA 1JWAB 2XXBA 3JYQA 1DIHA 4RF2A 4RPKA 2J5QA 4FGWA 2OZPA 5IDYA 5DZSA 2BELA 3W6ZA 3AOEC 4FIZA 3H9JA 3HE3A 4BGUA 3OA2A 3L77A 3G0OA 5I7SA 5IJZA 5K0ZA 2FWMX 1Q0QA 2DQ4A 1FXSA 4XQ9A 5A9TA 3RKRA 2ZB4A 3E18A 3HWRA 3NAQA 4DYVA 4L4SA 5EJ2A 5FI5A 2C7VA 3VKUA 1QP8A 1R6DA 1W0CA 3RC9A 5AVOA 3S2GA 1ZW1A 7MDHA 1AUPA 2YHIB 3I4CA 5KOIA 2WYWA 1JN0A 3WNVA 4R3NA 3UGKA 3FR8A 2HUNA 1BDBA 4FC6A 2EGHA 4JJIA 1P1KA 2I67A 1P1IA 2O4UX 4IMPA 1L7DA 1YH3A 2QYTA 3GK3A 4BNHA 2BI8A 4WLNA 5F21A 2X4GA 4DMLA 5A4DA 1LI4A 1ZXLA 1E3LA 2RCYA 4CLEA 3JQCA 3RROA 4IZHA 3AJRA 1BVRA 4Q3BA 4RZIA 5JAZA 1ZK3A 3E8XA 2GN9A 3K73O 5AYVA 4X54A 2X5KO 1N92A 3V8BA 3BIOA 5COQA 1XEAA 3CMCO 4CM6A 3W6UA 1PJLA 4WOJA 2AXQA 1PJ4A 1F12A 3GUCA 3JD1A 4QO8A 1HE5A 1E7YA 1ZEJA 4D3SA 1D4FA 3E5MA 1C3VA 4NU6A 4DIBA 1WNTA 3DHNA 4B4VA 4F6CA 2VUSA 3LT0A 4WJZA 1ISGA 3ONDA 1M66A 5DBGA 2RH4A 3BTOA 2IZ0A 1O0SA 3UOGA 2BMAA 4CM8A 4CQLA 5CDYA 1E7RA 2VYNA 2O23A 1M76A 3WBBA 3WGZA 4IJWA 1WMBA 2Y0EA 1R12A 1X0XA 2UUPA 3OSUA 1U3TA 1XQ6A 2IODA 3PJFA 1E6EA 2C2YA 2D5CA 2NV6A 3PDUA 1U7TA 1E5LA 5I8WA 1ORRA 1GFSA 2QYSA 4R9RA 1YE3A 1YL7A 3FI9A 3G49A 5IZCC 2GDZA 1E5QA 4BIIA 2ZTVA 4XR4A 2EKQA 4GPD1 4AG3A 1DLJA 4HKTA 4HY3A 1T4DA 2OXIA 1GCUA 4IDDA 3MOIA 1UZNA 1VSUA 2IE0A 3HNPA 4W4TA 2PWZA 1DIAA 1PS0A 4RQUA 2X8LA 1NBOA 3RAJA 4IINA 4AJKA 1N9GA 3RUAA 1UP7A 5I7EA 4PCVA 1XA0A 5L45A 4WLFA 1KVRA 5B4UA 4IY1A 2ZB8A 1AHHA 4ZD6A 3ZI0A 5A1TA 2O3JA 4BNIA 4CQMB 1F17A 1E1LA 3OJOA 1ISMA 2JHGA 4DIFA 4CM9D 3ETDA 1X13A 3PHJA 3BMCB 4KTVE 4KQXA 3KM0A 3GVIA 3WXBA 3RCBA 4J90A 2PA3A 2D4AA 5JC1A 4I1IA 1ARZA 2GYYA 4U0KA 1LA2A 4Z9FA 4OOEA 5IDWA 1ZZEA 3HQ4O 1H93A 4A26A 4R1SA 4ALNA 2YJZA 2C07A 4W9NC 3PEFA 4XB2A 3GDGA 2YFQA 4L0QA 2QZ9A 3WQSB 1PEDA 1ULSA 4M87A 3B20A 2ZIZA 3A14A 1NFFA 2Q50A 1IZ9A 5A03A 4YYZA 3OFSA 1PWXA 1LNQA 4AFNA 1VKOA 2ZCVA 4OAQA 3KYBA 4GX2A 4DQVA 4GLOA 4O63O 4JLWA 1RM3A 5HRUA 3QLJA 1E1NA 2DBZA 4KP7A 3PYLA 4TRJA 5KJEA 5BQFA 3LQFA 2H6EA 3NDIA 4DVJA 3JSAA 5JAMA 1ENYA 3JD0A 2BRUA 3L4SO 5DF1A 2ZATA 4Y98A 1VJ1A 4YAIA 4E2XA 1ZMOA 4WCFA 1C1XB 4CQMD 3DOOA 1ONNA 2GO1A 1WZIA 2QW8A 3NYWA 5MDHA 2YQ4A 4E5YA 2HDHA 3AU9A 2CZCA 4YVFA 3RBZA 1PL6A 1LSJA 1LC3A 1Z45A 2HO5A 4IDBA 1RM5A 2Y93A 1H9BA 3FSRA 2Q1UA 3T7EA 1P0FA 2YHIA 2CF6A 2FHSA 2EEZA 3G3EA 3L4BA 3H4VA 1HDYA 3DTTA 2ZCUA 2FN7A 2YDXA 1NNUA 1QLHA 1UDAA 2V6GA 5TC4A 1M6HA 1H6AA 1GUZA 3Q9NA 2PZJA 1E7QA 3N58A 4PLTA 1YQXA 5A9SA 5TQVA 5L4NA 3ZWYA 3JD3A 4NPCA 5GZ6A 4TRNA 3JQEA 3MWDB 4PLFA 1P1RA 4YAJA 5BR7A 5FWNA 1I0ZA 1I5RA 2EW2A 2ZQZA 4W7HA 5IZ4A 4P4NA 2F00A 3ZU3A 3VZQA 5IAAA 4IGEA 4OM8A 4RF5A 4CLRB 1Y6JA 5JXWA 1MFPA 3QVTA 4HNHA 4ROSA 3GNQA 3NUGA 4A2CA 4CM9A 4QT0A 4TRMA 3VH4A 3TZHA 2YV3A 4L73A 3ZHBA 1YVEI 2BKAA 4RPJA 3K2BA 1DPGA 1BXGA 1ISIA 1PR9A 2IEDA 1GDHA 4NJOA 5CFZA 1XWFA 4IJKA 1PSDA 4MIOA 1GEGA 1YO6A 5JS6A 3DO5A 1R37A 3OM9A 2NTJA 2PTGA 2DBQA 2BFAA 4TWRA 1V3VA 4P22A 4BNLA 3QQPA 4BB6A 1MFZA 4YJGB 1B8VA 2PZMA 4WCDA 3JQAB 2O2YA 5T67A 1KEPA 4J1QA 2Q1TA 3LT2A 5H82A 4FFRA 4JJGA 4Q3NA 3LF1A 1PGJA 4AJ4A 1OMOA 4R41A 3PFFA 4RPGA 3H65A 2DFVA 2R00A 3ZV4A 5EMHA 3FHLA 3D1LA 3OIFA 4E3ZA 1U5AA 1EUZA 1NP3A 3OQ6A 4KWIA 2D3TA 4NU5A 4XYMA 2QQ5A 3K30A 3NT5A 4OQYA 5AXDA 3H2SA 4CPDA 2EW8A 4CV0A 2JKVA 4RL6A 5HS4A 2J6IA 4I5FA 3DHEA 3D4PA 3ROQA 1CRWG 1ADFA 2EKPA 4E5PA 2LDXA 5AXAA 1EDOA 3PIDA 1GTMA 1NR1A 3UKOA 5L4SA 3OQBA 1X15A 4JROA 1T2AA 4UVEA 1N7GA 1UAGA 4PG4A 2FPIA 1WAMA 1X7DA 3UXYA 3JQGA 3NKLA 3RUFA 3KSUA 5ES3A 1PJCA 3ZHXA 4AICA 1QRRA 3BMCA 4IQ0A 1ZJYA 2X9NA 4PG8A 3LU1A 3V2HA 5L40A 4RORA 2EHDA 2VRCD 4D41A 1A4IA 2GGSA 4IQ8A 3WNQA 1LLUA 4U6SA 4TQGA 4RVHA 4AJNA 2VTEA 4MIEA 3AUAA 1NAIA 1AGNA 3CZMA 4J9UE 4MINA 4DREA 4XB1A 1NVMB 1O9BA 3TF5A 4OL9A 1U5CA 2GPTA 3JQAD 3KSDO 3UCEA 4DC0A 3IS3A 3PZRA 1B3BA 5B12A 2B69A 1T2CA 2PD3A 2PH3A 2HJRA 1J0XO 2AMFA 4K9DA 2A92A 4PGFA 5HS6A 2FY8A 4GWGA 4CUKA 3CZRA 1YB5A 2Z5LA 3D4OA 3BMOA 1ZH8A 1P9LA 5JSFA 4G65A 4JBHA 3WGYA 1CDOA 1H6CA 1DIBA 3VVBA 4D3FA 4AJ1A 3SX2A 3OEWA 3QY9A 3RKUA 1JU9A 2R6JA 3FR7A 4GGPA 3CTMA 3ZH2A 1QYWA 3HDQA 5K6AC 2Y99A 3DZGA 5TIIA 4OQZA 4BNTA 5KCZA 1BRMA 1TT5A 3EK2A 2YZ7A 1R4MB 4OJNA 3RBVA 3LDHA 4R16A 4YBZA 4D46A 4FSHA 2GD1O 4DPKA 2O2SA 2AQHA 4OXNA 4PLZA 2XF8A 4P4LA 1C1XA 2X58A 3MCVA 1OZAA 2ZJ1A 3NTRA 3PGXA 1KOLA 4E30A 4Z3KA 2QZZA 4D42A 1JA9A 4MVJI 5L7WA 2Y1OA 1D7OA 4LW8A 1QV6A 2QG4A 4BNMA 3KEOA 3QV1A 8LDHA 1H6DA 3JQ6A 3TZKA 1CF2O 1F8GA 2GZ2A 3N7UA 4TRRA 3W8DA 1WPQA 1EFKA 5G0VA 3U4CA 2DPGA 5HWSA 3GG9A 4D0SA 2G0TA 4AJJA 3C7CB 1ML3A 3FN4A 1DFIA 4M54A 1QLJA 3LLSA 1B8UA 2I6TA 1R4NB 2OORA 2DFDA 4GI2A 5C3MA 1I36A 3SJ7A 1SCUA 1V8BA 4QECA 4BO2A 4E2YA 1KC1A 4CL3A 1UJMA 1ZK4A 3HDHA 3MZ0A 1FMCA 4R01A 5HBRA 4JJFA 3MJ4A 3GY0A 1JVBA 3VAZA 4CV2A 4MDHA 2VCYA 1XDWA 5GMOA 3RD5A 4CLRA 3NGLA 1E3WB 3E6AA 2XPCA 3BMNB 1S7CA 4KUEA 4P38A 4J43A 1ZCJA 2PZLA 1SEVA 1YXMA 1H6BA 3IIEA 3BHJA 3VZPA 2HKIA 1VC2A 1T2DA 2I99A 3ZZNA 2VRCA 1VI2A 4CR6A 4D43A 4FOSA 3IUPA 3PWKA 1NX6A 3ABIA 3AFMA 2X23A 1HDCA 1TVEA 1GQYA 4OGWA 4WE3A 5F3RA 1NQAO 2AHRA 3I9LA 2POQX 4YJGA 4TKMA 2J5KA 3JQAA 3ITKA 1S6YA 4WNIA 2CFCA 3C1OA 5ENDA 2X5OA 5T64A 1WDKA 2DUUA 2ZYAA 2WE7A 3JTMA 3JQ9C 1GYRA 4NHEA 4J0FA 1JKFA 4AJPA 5T57A 4WOKA 4FFOA 1KBZA 3CSDA 1V6AA 3A28A 1I2ZA 2Q99A 4CMIB 2RAFA 1PZEA 5CDSA 1D1TA 4OYRA 4BNYA 2C2XA 2WJPA 1BMDA 5DCYA 1T2FA 3GDFA 1I10A 1LLDA 1KEUA 1E7SA 5BSHA 2NU6A 1ENPA 1I2BA 1JLLA 4Z0HO 2GNAA 4EITA 5ICSA 4GKVA 3TQHA 3TZCA 4QTZA 2CDCA 2HQ1A 2P5UA 3ONEA 4WECA 3JYPA 5G0UA 4L75A 3WGTA 1B8PA 1KEVA 3I1JA 4J1TA 2B4RO 2Y68A 2HMWA 4YRAA 1I30A 2PY6A 3G1UA 3KVOA 4NBRA 3H8VA 4FFMA 3OH8A 4GH5A 4BQRA 4R69A 3R3SA 4MJLA 4NJMB 3A06A 4BKPA 5KJ6A 2VHWA 1QYXA 1BW9A 1LU9A 1U4OA 1DRUA 2Q3EA 3ONFA 1O8CA 3X2FA 5A9RA 1ENOA 4B79A 3OIDA 3QVWA 4F6LA 1A5ZA 3HB5X 1V9LA 3F4LA 4CL8A 1UXKA 2IDZA 5COBA 4HV4A 1M2WA 1D8AA 4ZVVA 2AA3A 4CM8B 3FWZA 3LC7O 3IMFA 1X7GA 2VZ0A 2OL4A 1JKJA 4IQGA 4BB5A 4CMHA 1LRKA 1Y81A 3BTSA 1DDOA 5EESA 5TF4A 3WQRA 5ADHA 5LDHA 1R0LA 4MVJE 2B36A 1H2BA 3WQQA 3NEPX 4Y67A 4M8SA 1T4BA 4XD2A 2XAAA 5JMPA 2JAPA 1PZFA 4NIMA 1R4MA 2GZ1A 2P9CA 4J91A 3FCOA 4I8XA 1V3TA 3ULKA 4E5MA 9LDBA 1DHRA 3WGGA 4YJHA 3IJPA 4XIJA 2EJVA 2O3SA 1E92A 1PX0A 4IS2A 4U5QA 3DB2A 4GKBA 4B8WA 5AQ1A 3F9IA 5DCWA 3NTOA 4CM1A 2CSUA 3MTJA 3TFQA 3JYNA 3GOHA 3SLGA 5I9MA 2ZJ0A 3IP1A 4TKLA 1KVSA 4DLAA 1G0NA 5IFLA 4L76A 5ER9A 1JW9B 2BLLA 4IBOA 4CM5A 4J1SA 1HDOA 2O4CA 5CPFA 5THKA 4GX1A 1NPYA 4UUPA 1B3RA 3RI3A 4BGIA 3VPSA 2GSDA 2VHVA 1HZZA 3QA9A 2WMDA 4CM7A 3F3SA 4DQUA 2JCVA 2VYND 4DUPA 1R4NA 2NVWA 3TOZA 4YPOA 2ZYGA 2HMSA 4UVIA 1NHWA 4DBZA 3QWAA 3WTBA 2IZZA 4O5OA 1IHXA 5HA5A 5CDUA 5JLAA 4RQTA 1X7HA 2JFFA 4PVCA 3B6ZA 4L4XA 2HSDA 1E3WA 1SB8A 4GLLA 4RZHA 4J0EA 3BMNA 4FN4A 2J3KA 1I24A 1B2LA 3Q3CA 1IZ0A 1CQJA 2E4AA 3AI1A 3M2TA 3ZWBA 1U3WA 3MJEA 5BSEA 1HF3A 4Q3DA 3H5AA 2O7SA 2GR9A 1RKXA 4BO6A 1LDMA 2DVMA 2FRDA 3JQ8B 2DU8A 2DT5A 5DN9A 5ENVA 3W1VA 1EK6A 4D79A 1K5HA 2P91A 4Y8VA 3GN2A 5J23A 4WCFB 3I23A 1TA4A 4OO3A 4NH4A 3GZ4A 2A4KA 4XX0A 3WSWA 3T7CA 1LLQA 3WLEA 1U3UA 5CP8A 3W4KA 3HN2A 3FTPA 1LBEA 2DTEA 5L53A 2CNBA 2JD1A 1Z74A 4GWKA 4HFJA 4CMIA 1DB3A 3C7AA 1A72A 4IDEA 4MVJF 1EEHA 4AJOA 5ITWA 5C37A 3B70A 3DOJA 4IIUA 2LDBA 2Z1NA 3HHPA 4XGIA 1DRWA 4IUYA 5TJ9A 4GQAA 3S2IA 1D1SA 3U4DA 1T24A 4YA6A 4EEZA 1U7HA 1WW8A 3V1UA 1K6XA 3ZWCA 1KEWA 5KKCA 3U4IA 4JGBA 4H7PA 1IB6A 1ZK1A 2NU7A 5G0TA 3RC1A 1PS9A 1IHYA 4CMKA 4OHUA 4WGGA 2YDYA 4UREA 5A9SB 2I76A 3F1LA 2A9FA 4KZPA 3RUDA 3DZKA 1DEHA 4ZICA 1OFGA 4IMRA 3AI2A 3ZU4A 3ZWWA 5IDXA 4R1UA 3KYDA 3GVXA 3D64A 1DC5A 2FZWA 2FP4A 4NJMA 4ZQFA 1BWSA 3TRIA 2VYVA 1MG0A 4DYDA 4WLVA 1ZK0A 1ZFNA 3COSA 4A73A 5JAIA 2C29D 1XG5A 5G4KB 1MC5A 2HMVA 3JQBC 4M89A 2VN8A 3TPCA 1BXGB 3AFNA 2NSDA 3G79A 3HB4X 3ANNA 4NFSA 3B1JA 3GHHA 1K3TA 2C82A 2WSBA 4J4HA 4UUNA 4NK5A 5DNAA 1KERA 3RBXA 4TZKA 4BO8A 3IKTA 2E49A 8ADHA 1XYGA 4GGOA 2V6MA 3F46A 5IDQA 3PWSA 1NHGA 4J2OA 3L6DA 3INGA 3PFWO 2P4HX 3ICPA 2VTDA 2D8AA 2AQ8A 4CMBA 5IXSA 2DM6A 4UEJA 3TZQA 3HJAA 3IQDB 3SJUA 3EYWA 1GAEO 4BNNA 3MOGA 1BGVA 5CPBA 2NQTA 1MXFA 4YRDA 1H0KA 3AI3A 2B83A 1GY8A 3ZWNA 1HE2A 4R4JA 2HMUA 3Q9UA 3D3EA 1GZ6A 1Y9AA 4TROA 1O94A 3UH1A 1U28A 4Z0PA 5CEJA 3DOCA 3ZHZA 4R5MA 1A9ZA 3QVOA 4LRSB 3PZBA 4BNJA 1VL0A 3GGGA 2AEJA 1M6WA 1MXHA 3TOXA 1Z7BA 3U3XA 4E32A 1LRLA 1LUAA 1UZMA 5JFOA 5T8KC 5TJHA 4EUHA 2V65A 2IXAA 4UVDA 1YL6A 4YXFA 3EZYA 3JQGB 1EK5A 3PP8A 4K28A 1PGNA 1IYZA 2X22A 4ESOA 1Y7TA 4A03A 2DBVO 3FPLA 3H7AA 5JY6A 2W90A 2NLOA 1L1FA 1JVSA 2I66A 4PLVA 5TNXA 1N1EA 3VPHA 1ZSYA 1RYDA 1SEPA 2YQ5A 1F06A 4PRLA 3I9MA 1HDRA 4RF4A 3VC7A 1MG5A 3VPFA 3WGHA 1P45A 1U1IA 3IDSA 4XA8A 4JNKA 3VPXA 3G1TA 4L4RA 1SPXA 3PJDA 1YQDA 2A35A 1AE1A 2W98A 1UXIA 4XRGA 3LSYA 4CJXA 1YBAA 1KETA 3E9QA 4EUEA 5LDGA 5JY1A 2V6BA 3KBOA 2PNFA 3WTCA 5GY7A 1V35A 3OHSX 2NACA 4I9UA 4CM4B 5EIOA 2DUWA 3BMOB 2CVQA 1UXHA 3GA0A 1P1JA 3N74A 4YT5A 2J3HA 3ENKA 4BNUA 5MGBA 1LQTA 1LX6A 3RUHA 2FOIA 2RHCA 3L6EA 4KTTE 1VKNA 2CMDA 1DIGA 5TX7A 2RH8A 1QSGA 4M55A 3VDQA 3ZWOA 2HK7A 2ZK7A 1TT5B 3E9NA 3I4FA 4FBGA 5DP2A 4YDRA 1FF9A 3RUIA 1N8KA 3JQ8A 1YS4A 2YW9A 4HFRA 4NZ9A 3ORFA 2P5YA 5U9CA 2B37A 4BUCA 4J7UA 4CR7A 3EMKA 3K6JA 4KOAA 5KJFA 1EBFA 3CPSA 5DOZA 5L7YA 3IUSA 3W8EA 1PJBA 4Q9NA 5CEFA 1F0YA 5CEEA 1LDYA 1EFLA 3CXRA 3G17A 1W4ZA 2CY0A 3GMSA 5G0SA 4E13A 1IPFA 1JAYA 4J6FA 3KB6A 4ZQGA 2X0IA 3TN7A 1QR6A 3RFXA 4FFNA 3C1TA 4K6FA 5ILGA 4S3MA 2C59A 4Z9XA 1H5QA 1QYVA 3ZGYA 4RDIA 3VZSA 4M86A 3BTUA 1HRDA 3LLVA 3LT1A 3I6QA 2HLPA 3PK0A 1LRJA 2EP7A 4BO5A 1Q7CA 3I83A 3K31A 1EZ4A 3L9XA 4XZ3A 1E3SA 3WOHA 1ULUA 4MVJH 4QO7A 3ITDA 2EV9A 2P2SA 2A94A 2BI7A 2NWQA 4ALKA 5IF3A 1WMAA 3DQPA 5AOVA 4RCVA 5BNTA 4MO2A 3CIFA 4FD3A 4FPXA 5CAEA 1KIFA 4GSKA 4Q3AA 5FEUA 4ALLA 2C54A 3GRKA 1GPDG 1EVIA 1MLDA 2BGMA 4BNFA 1AXGA 1I33A 2YYYA 4EW6A 1NM5A 1TEHA 4H16A 1HXHA 3W4JA 3CINA 3ZHYA 1MP0A 4OXYA 2YFHA 4GBJA 4L9RA 5G4KA 5BSFA 3ROPA 2D59A 3I6IA 3S2FA 3ZNOA 4W82A 4MP3A 2BFPA 3OQ1A 3HSKA 3GEDA 1ZUD1 1T2EA 4R1TA 2VT2A 4XWYA 2E82A 4AVYA 4BGVA 2B4QA 4BNKA 3PXXA 2EG9A 2Y1FA 2RIRA 1YOVA 1C0LA 3FNEA 3V2GA 4YAKA 4PLHA 1FK8A 4LMPA 1HYGA 3CE6A 3PWZA 4W7IA 3NX4A 5CG1A 4BMVA 1R0SA 4GX0A 2GUGA 1U8XX 3DZFA 4PVDA 2HJSA 1RM0A 2QHXA 4J7XA 3O8QA 3LYLA 4E12A 3VH3A 1R0KA 2QRKA 3QWFA 4UAGA 4CMAA 1C0KA 5A3VA 4KMSA 1WLYA 1I32A 4ONEA 3K9QO 1CERA 3PGJA 5CDGA 3JYOA 5BSGA 2GN8A 1W6UA 1HE3A 3EZLA 4TVBA 3ZWPA 3DL2A 2WDZA 5FF9A 1B16A 4ND5A 2AEFA 3AW9A 2OHXA 4KQWA 3ZU5A 3R0IA 2PR2A 4U8GA 1Q2XA 2OMEA 1WZEA 1NPTO 2PK3A 3RFVA 2X1HA 3DHYA 3RUEA 2FR0A 3IOYA 2ZTUA 3ZW8A 1HE4A 1M75A 5KJ1A 2YY7A 3WGQA 1XLTA 1HDXA 2G17A 5TSDA 2IXBA 3SXPA 1BW9B 5A3JA 2J3IA 1K0UA 5BT9A 1XCBA 2SCUA 2XXJA 3NJ4A 5TGDA 4ALMA 3ETEA 1Y5MA 4AJLA 2X7HA 2FZEA 4DA9A 1DAOA 4O1MA 1QXSA 4E2ZA 2CF5A 4XYBA 3DC2A 3QWIA 1F8FA 3DFUA 2PZKA 2YHUA 4QSMA 4CM4A 4YEDA 2WWRA 1CQIA 5T5QA 1DJNA 4N7RA 1J5PA 4Y9DA 4DLBA 3D4NA 1LSSA 4IZIA 5G2OA 1XKQA 1BSVA 1GZ3A 3PIIA 2O3UA 1ZSVA 2EP5A 4CMCA 2VRBA 5DCUA 1ADCA 1EUDA 2ET6A 2FMUA 4JX8A 1NQOA 4IJVA 3JD4A 1MV8A 2R00C 4XYGA 3RJ5A 1LC0A 1EBUA 1QYCA 2DLDA 2W2KB 4AJIA 4YJHB 4LVUA 2GERA 3DZIA 2OO5A 4UEOA 5B4VA 5DP1A 3HDJA 3WBFA 4E0BA 4R54A 5LC1A 2E6UX 3PLRA 1ZNQO 4UEKA 3D5TA 4AJEA 2PGJA 2Q2QA 3QIVA 4DC1A 2GRAA 1PGOA 1Q1NA 3D3WB 4XYLA 4LCEA 3OETA 3K8ZA 4Z0TA 1LJ8A 3Q2IA 4CLHA 5FYDA 5AXBA 1QV7A 3GN1A 3O38A 1LEHA 5HM8A 2J3JA 1HKUA 1NYTA 1TLTA 3EGOA 4WLOA 2BD0A 3ZWVA 5JDIA 3EAGA 2DKNA 4BO4A 1G1AA 3JQ9A 3Q6IA 4J2HA 2Q4BA 2OBYA 4GMFA 3AUTA 4UUOA 2C5AA 2WD8A 5KVQA 1X1TA 1GADO 2I3GA 3AM5A 3R6DA 3QVXA 2PGDA 1QKIA 5C7IO 1ISJA 3AY3A 4O0LA 1YWGO 4CV3A 4GSLA 4XR9A 1XSEA 1Z7EA 2Y66A 3B1KA 3JQDA 1HT0A 2AG5A 1OBFO 4Q3CA 1C14A 1EQUA 1W73A 1XGKA 3JQFA 2VHYA 4NDNE 3ZNQA 1YJQA 2HRBA 3ROKA 4ZHSA 3PTZA 3U0BA 1XIVA 4N5LA 1J49A 1A4UA 1OAAA 4LSMA 4FW8A 4NK4A 1FDVA 5B37A 3FNGA 5ILOA 4BNXA 3D7LA 3R1IA 4K26A 5CDTA 3H2ZA 3DBRB 2EIHA 4O6VA 1NFRA 4I5EA 4RVSA 1T1SA 1EVJA 1GYPA 2FPGA 3K2EA 3JYLA 4PRKA 5A05A 1C0PA 3AU8A 1DSSG 2GZ3A 4GAEA 4AL4A 4YJFB 2PKQP 4E21A 1N7HA 4DPMA 3GVCA 3KTDA 5JAQA 1O95A 1SO8A 4DRYA 4MPDA 1E0DA 2TMGA 4C4OA 3T4EA 4HNGA 1P1HA 4HFNA 3RJ9A 2VUUA 4FDAA 5B1YA 2W8ZA 1WDLA 4LISA 2UDPA 3JQ7A 3E82A 1IULA 3UCXA 1Z75A 4WUVA 3TL2A 4B4UA 2PFGA 3KZVA 3F1KA 4MOWA 2IYOA 1XELA 2BFMA 4YB8A 4DLLA 3EUWA 1AHIA 4CMEA 2Q46A 5L95A 4FOOA 2X9GA 1ZJZA 3RC7A 2PV7A 2VOEA 1GV0A 4ZU3A 1NXQA 2G5CA 4CUJA 2Q2WA 2B5WA 3OA0A 4A0SA 4NI5A 1Y9EA 1CJCA 3E48A 1JKIA 3OJEA 2WYVA 4CM3A 1SOVA 2R2GA 5FI3A 1HZJA 1C1DA 2P9GA 4NQZA 2FR1A 2O3RA 1NQ5A 4E31A 4M49A 5KVSA 1NR7A 3ADPA 3KYDB 1SC6A 2AE2A 4D44A 1VM6A 1BDMA 2BH9A 3SBOA 4Y6SA 4EJMA 4BKQA 4J4BA 3GMDA 1YL5A 2HK8A 1VJTA 4INAA 2EGGA 4Q39A 4B8ZA 3DAGA 1FDWA 1B14A 3GRPA 3KETA 4XKJA 3A1NA 3WGIA 1P44A 1I3KA 5KJCA 4EEXA 3KUXA 3GPDG 5A06A 2E48A 1YB4A 4YWJA 1VRWA 4I08A 1N2SA 1GUFA 3DAPA 3CMMA 3KYCA 4EJ6A 1KVTA 1KYQA 3MJCA 4PG7A 1SB9A 1GPJA 4R9SA 4WASA 1NTOA 1I8TA 3DBVO 4XQEA 3RQSA 4EUFA 4Z6KA 2X86A 5H81A 1FDTA 2JFGA 4LMRA 4J4TA 4BMSA 3ANMA 4AJ2A 3M2PA 3WIDA 3BYZA 4UULA 1I3MA 1QG6A 3U9LA 5G4LA 5F5NA 4KWHA 1DBVO 3H3FA 1ZMTA 2W2KA 3GT0A 3V1TC 4DL9A 2VOJA 2FSSA 3DBHA 1U3VA 3L0DA 1A7KA 2FPPA 1E1KA 3AK4A 4ND4A 1NVTA 1P33A 4XEHA 3ENNA 3VDRA 3ZV6A 3RUCA 3DAFA 5DBFA 1F14A 3CKYA 4ZQEA 3L9WA 1V0JA 4BQPA 4C7JA 3BZUA 4JP2A 3L6OO 3D3WA 4XQCA 2VYVD 3GFGA 3ZWXA 2HRZA 2QRJA 4I9NA 1DFGA 3IJRA 5THQA 1WP4A 3D0OA 2OFPA 3AOEA 4OOFA 2O7QA 3EY4A 3C3XA 4JN6B 3AY6A 2Y1GA 3R3JA 5KWEA 3UW3A 3SVTA 2XOXA 1U9JA 1ID1A 3F5SA 5EQFA 1X1EA 1L7EA 2ZTLA 3GR6A 2BGLA 1BG6A 4UVGA 1PU2A 4BVAA 2J8ZA 2ZKLA 4QX6A 3FRJA 5JDCC 1GV1A 4EI2A 5KIAA 1E3EA 1X0VA 3WICA 4BV8A 4KUGA 1G6KA 2JD0A 4ALJA 2PH5A 3KSZO 4ZGWA 5B4TA 3S2EA 4XJTA 1ZEMA 3EDMA 2WE8A 2PLAA 1QMGA 4YQZA 3GNSA 4BV9A 5ITVA 1PQWA 2OP1A 4E5NA 4EZBA 2DPHA 3DBRA 1EUCA 3VH1A 2DAPA 2NVUA 3NT4A 4IDCA 3GNTA 4OSPA 3PJGA 4YJFA 4BO1A 4IXWA 4A5OA 3BMQA 4LGVA 3AUUA 4HFMA 2UYYA 4E5KA 3QSGA 4P8RA 4MVJP 4YCAA 3ROMA 3WGOA 3KO8A 3GPIA 2G76A 1Q0HA 1YONA 3KRTA 2X6TA
chains in the Genus database with same CATH superfamily
2IPAB 2P9EA 5AXCA 4JB3A 4Y0VA 4P5PA 1KY4A 1V3UA 4A5SA 2WSSD 3GRYA 3S1LA 2HLNA 4PC7A 4F6RA 4PSAA 2WJ6A 2CV1A 1BMFD 4WFJA 3HADA 1TNDA 5CBPB 5BYKA 5JZVA 3PD1A 1PFVA 4JB0A 1T9HA 1GTL1 2RD2A 2ZYIA 5DXJA 3DM9B 2W4IA 1ZMRA 2DCMA 3HKDB 5DHPA 3HBFA 4INJA 5DXAA 1J8YF 1TZKA 3LMKA 1D2MA 3O7WA 2V54A 1HLPA 1PUXA 2IC5A 3TL6A 5CXQA 4IPTA 3IAHA 3SS7X 1CUSA 5JYDA 3KFXA 4LY6A 1XQ1A 3RSHA 4JJ6A 1JDTA 1V71A 5F73A 4GXTA 4QTTB 1FPQA 3TI9A 1LVHA 2VPXA 1E2EA 1K89A 2Q4OA 5CM2Z 4ZYTA 5HZKA 4WNCA 1JDVA 4FGLA 2PSFA 2A68F 1T43A 3W8NA 4D8UA 1TL7C 1S4QA 3N05A 2DSNA 5CVUA 3QEMB 2JS7A 2GRUA 5H3LA 2ICAA 2IX3A 1EUDB 3I9KA 2FFBA 2D7DA 1JZSA 2OKUA 5HCNA 2XJ4A 3EULA 2H0AA 9ATCA 4CJOA 3N6VA 3CZ5A 3HTXA 1T26A 3EF3A 2R7TA 4ZO6A 2FP3A 2P1DA 4GHWA 4QKQA 2CVOA 3HJFA 3CN7A 4AI6A 3V9AA 1VLLA 2QL6A 3VAYA 4IGAA 3S2YA 5HKBA 4MVJM 1Q0MA 4DMKA 3GQVA 4KIFA 1GN8A 1NWHA 3N0TA 3DCNA 2V7PA 5IYZA 1XL0A 3NIFB 2F90A 5LPNA 1A7EA 4I2NA 4K6MA 2D1TA 5KOHA 1XLVA 3J80A 3GUYA 1XK6A 4QFCA 1GPMA 4HUJA 2JLYA 4QNMA 1NQTA 4AP5A 2PUBA 1L8LA 2Q9BA 5IMSA 3MTIA 2UUCB 5FBQB 4MR9A 3S2SA 4V0SA 1ZRMA 3B6KA 5I4CA 2GCIA 1KL7A 3PQFA 2X8JA 3T61A 1NVVR 2VCHA 3PLNA 4TXJA 3R9XA 3IUMA 1DTWA 1SOUA 3V33A 2P2LA 5NLLA 1JDSA 1HY3A 3UFXB 1XCJA 3KXDA 1FUIA 3PJEA 1EE9A 3U7EB 2WTEA 4NEQA 3SS9X 2OCGA 2RHJA 3NWPA 1DINA 2EJWA 4ZAYA 3K16A 2GLXA 1EJ6A 2ZUVA 1G66A 4KDEA 2DTXA 3VISA 1ZKMA 4ME6A 1GUDA 3NAZA 2VF7A 4L6CA 2X9QA 4UDNA 5LXTF 4B3RB 1AS0A 1J0CA 4NRDA 3T6JA 2ZIAA 2WKSA 2PJZA 4GVLA 1GCAA 3BE5A 5HP4A 3DBHB 4JELA 3VHXA 1JLMA 4P3KA 3HP1A 3S8YA 2D5AA 2EJTA 5DULA 1TUIA 5H4HA 4W99A 1OIVA 4S05A 5T4FA 2O2DA 4ZCQA 4HWKA 4D9EA 4ETNA 3LCRA 3GYBA 5ULLA 3AYZB 3KPHA 5LMCA 3TPFA 5AKEA 4A8JC 4EYQA 2V4MA 1NF3A 3CLTC 3BN3A 4OQMA 3H2VA 2QTLA 2PH7A 3BSFA 4Z1OA 2H1LA 1ZD2P 5JJLA 1O96B 5SY9A 4NPHA 3NPAA 4PFOA 4F2WA 5GVSA 1J6UA 3P4YA 3DKRA 4TTRA 2G0NA 4H2DA 5JSZB 4CKYA 2IVFA 3UOWA 4F8JA 4PPYA 4OIMA 3D1VA 2BFCB 3GFPA 5B1BC 4CODB 1T8SA 3U61B 4OCZA 2I2BA 3A7EA 1ZR4A 4TTSA 5E38A 3BRCA 3KUCA 1XU7A 1Y8RB 4EJFA 1BXRB 1PJSA 1FFXB 1Y4SA 4RA6B 1L8XA 4QARA 4F3RA 1RYEA 1OXTA 3LQQA 2QYHA 3JQFC 4BO9A 2JHCA 4CT5A 4MITA 1PJ3A 1BEEA 4PX3A 1RVDA 3LT4A 1J5EB 4I4TF 4UTZA 3A3PA 1ZGHA 2Q41A 3AR7A 3UVEA 3LVFO 1WRBA 3PXUA 1IWOA 1NJGA 4CLOA 5J4YA 3SD7A 2BGJA 1HNXB 5DASA 1A8HA 1JQDA 721PA 5BRNA 2WZFA 1HX7A 5FEMA 4QQNA 4LE1A 3Q4GA 2P90A 3V8RA 2ZBFA 1I2CA 3P0RA 4GO1A 5CD1A 1B0PA 3VH2A 3OZAA 5EHGA 1WQ3A 3OWOA 3HLTA 4ITUA 2PZBA 1F2TB 4MYUA 1O8BA 1PZNA 1YZKA 1ORJA 1CUYA 3TS1A 4RQBA 4BFYA 1NFQA 1DARA 5AICA 3K1IA 1H3NA 3NFYA 4FGZA 3UBTA 4PLGA 2HV7A 4HBGA 4O33A 4LQDA 4BVKA 2IWRA 4XVHA 3U09A 3PQEA 1SHUX 3AJDA 2R44A 4HDKB 2P1RA 4UVHA 2V6FA 1X1SA 1MX3A 3TUZC 2HWWA 3QJYA 3SSAA 2P65A 3HWWA 2MSDB 1ID8A 2DI3A 3EZFA 2FN3A 3VVCA 3GVPA 2Y0CA 1DUSA 2IWHA 1N75A 3IA7A 3BWEA 4MTCA 1SQ5A 2C4UA 3QKUA 1GAQA 3L7LA 4BO0A 4H1VA 5IVDA 3PDWA 3B36A 3TNFA 1M9NA 5AW6A 5T4EA 3JYQA 3U5SA 4ZC8A 2J5QA 1IRXA 1FUYB 1W75A 5HSGA 4PAWA 1VCIA 3G0OA 3BREA 3MW8A 3E22A 3ZDCA 1QNFA 2FF5A 4I1SA 1I4ZA 3BWVA 2EGHA 1Y8AA 2Z2KA 4Q9IA 3GK3A 4Y6QA 4LYDA 3ZE9A 1N2JA 2QUZA 4EVQA 5T41A 3PNPA 1ELOA 4LQ4A 4X54A 2Q7XA 3KZCA 5FPPA 1ZN2A 2WHRA 3H2HA 2YRFA 3UOGA 3EQLF 3NYJA 5CDYA 2C4HA 4ZYWA 1WMBA 4JSRA 2G08A 1WZNA 1DJMA 2D5CA 2XCTB 3HL4A 5K8TA 1NXTA 4R9RA 5HBGA 1QHIA 4B3FX 4E0HA 3FVTA 4TQAA 2R0QC 4S0ZA 3I2GA 4RQUA 1FU7A 3TGWA 1HY5A 4ZHQB 3IBCA 1KO8A 4XVCA 1KVRA 2XBUA 4MUYA 4QDXA 4CQMB 1FMFA 2LXNA 4AP9A 4J90A 1FQWA 2ZJBA 3CTPA 4Z9FA 1Z47A 2E85A 3PC8C 2B30A 1FIUA 4JLSA 1ONBA 1VKOA 4LTMA 4MWSA 3IVMA 5TARA 2MYTA 3SKXA 4V03A 1RM3A 1H2AS 5KJEA 3LQFA 1ENYA 1KMIY 4M21A 4P32A 3OD5A 4C7VA 3MYIA 1CC1S 3ZJ4A 3B85A 5BUZA 4EAAA 1FSSA 2I2DA 2YQ4A 1NJ1A 3CF0A 4QPPA 3K1AA 4CKBA 3S27A 3O2NA 1C9NA 2P75A 1JF8A 5CTJA 1QLHA 4RHYA 4LGYA 1BZYA 2DJ5A 1H6AA 5JRAA 3TG8A 5D01A 5FRDA 3JD3A 2ZJ3A 3JQEA 1CY4A 5FWNA 1I0ZA 2QI9F 1LBQA 2BEVA 5JI3E 1MEEA 2J0XA 1G8MA 1XRJA 3D2AA 1OY1A 4L6IA 4OEHA 4D4XA 5FLEX 3ZHBA 3K2BA 1XWFA 4ZO4A 2ZBRA 4BNLA 2RGAA 4PYRA 4UM5A 2GHIA 1Q74A 5CM9C 2EPLX 4YK5A 4EMSA 4HDSA 1FTYA 1OMOA 2OQMA 3HS3A 1C7RA 5IBQA 1Z5UA 2BDTA 3D1LA 3ZZ0A 1NP3A 2C9MA 3WWCA 4ZIRA 3KQPA 2JKVA 4OJKA 5ICCA 2J6IA 5F9FA 3Q72A 4UARA 4RNDB 2QR3A 3OA1A 1NR1A 4D9BA 1AMUA 2CXXA 1P5RA 4UVEA 3GFSA 4PG4A 1K04A 1Z2CA 4YDQA 3MHPA 3U56A 3QBDA 4WNAB 4YV1A 4PJMA 4TQGA 2PUGA 1CRQA 1W49A 2GTPA 3H75A 3FHJA 3HN6A 5JADA 3AVTA 3DL7A 2CLFB 3AI7A 2WVNA 3ZXXA 1YMUA 1CDOA 3VVBA 2DHCA 1QYWA 2OXTA 4CS9A 3GRRA 5TIIA 1BRMA 1JEJA 1U0OC 3B8EA 3UXHA 4G0NA 4EB8A 1B8NA 1PAUA 5MN4A 3DE4X 3PGXA 3KTOA 3ES9A 3CKMA 3A05A 4KG7A 2JJQA 4MUXA 4MRAA 3QPWA 3UA3A 2BN4A 4LW8A 4R2IA 2VB6A 2GCEA 3AYXB 1F8GA 1WPQA 1EFKA 3HKEB 5G0VA 2ZVJA 5HQTA 3NEAA 4DCCA 4M54A 4IUDS 1QGOA 3TSZA 1I36A 2PTHA 4PYIA 4XVQA 1W5BA 1E4EA 3T9BA 2C97A 5GMOA 1P19A 1H6BA 4U3JB 2VRWA 4M2LA 4JV5B 1JKFA 2CEKA 2NPOA 4DWOA 1Q5PA 4WOKA 3HKCB 2C8LA 1BE0A 2VH3A 2HOQA 3CY6A 4KXQA 4RTJA 2GNAA 4CTMA 1Q50A 5B3JC 3G13A 4QA9A 3WGTA 5BSUA 2H5IA 1TQ8A 1DKPA 4H6XA 4B84A 1CJSA 5A9RA 3QVWA 3Q2OA 1A5ZA 5COBA 5IARA 1OH5A 4QBFA 4CIHA 3CLUC 1JKJA 2ZXRA 4EL5A 2WAYA 1Y81A 3WQRA 4YPVA 2IPXA 5E1BA 3K0KA 4M8SA 2DFPA 3IR5A 4OBXA 1OKKA 4XD2A 2XAAA 2NXJA 5CYFA 1PZFA 3FDZA 1EFVA 3UMCA 2P9CA 3AVUA 1VCMA 2WJ4A 5EJIA 4XTCS 3DB2A 4LJ4A 4JASB 2HTFA 2WU3A 3ZQ6A 1RQ2A 3IHUA 4PSUA 3TNJA 3GLGA 1CS0B 3H8JA 3SP1A 4M9CA 4XTKA 4MO9A 3QF4B 4ESVA 5CUQA 4HWRA 2AD5A 1X7HA 4G26A 2AVDA 2MMGA 2HM7A 1J8VA 4D3XA 1HF3A 4P34A 5JJKA 3HV0A 3FCSB 5DN9A 4KIWA 1Q6ZA 1TWHA 4Q4AB 1LBEA 3Q88A 4H18A 2LCHA 1F6DA 5M3BA 5C37A 3U7QB 3H6GA 5TJ9A 3LPLA 3R2PA 2DE0X 1M6NA 1ZU4A 2XE7A 1JEDA 1IHYA 1ZJWA 4BFCA 4BFSA 4IMRA 1V45E 2C42A 4LTNA 1EH5A 1BR2A 1FBTA 1JSRA 5H02A 5DIFA 1JR4A 1UKEA 1FUEA 2R8OA 2TRSB 4XM2A 4UUNA 4B87A 4QICA 2XHEA 3UG7A 1G5PA 5K8VA 4P9TA 3O2JA 4A1FA 1QPBA 2PXHA 3WV5A 3CUWA 4AW9A 4C5CA 2QVGA 2J0QA 1ZAYA 3S0JA 5CPBA 1G3MA 1YU6A 4HT3B 4MVCA 1GZ6A 3UC9A 3HSSA 2ZJAA 5EAIA 2Z09A 4BNJA 5GJWC 3STTA 3M6AA 2AC7A 3IDQA 5ALSA 3N8GA 4YXFA 4ESOA 2GNPA 4B32A 4JOBA 4EHLA 2W90A 4A92A 2I66A 2QTCA 3A1DA 1MENA 5DGTA 1MG5A 2IXNA 4YCCA 4BRWA 5ALMA 3VPXA 3PJDA 4XRGA 4LF7B 1V1MA 3KQOA 3D43A 1KE1A 4BV3A 1ECLA 6ABPA 4P7KA 3TJMA 4G0YA 3WK7A 3OCUA 1AU9A 3LUCA 2G36A 1R8SA 3TLXA 2QRUA 4I4TB 1VKNA 3T1QA 1CJBA 3BRQA 2OG2A 5LKRA 1FP7A 4DXAA 5K0JA 3W8EA 1PJBA 3ZZMA 2GD6A 2RHGB 2YJ3A 3WYDA 1NW8A 2JBAA 3C1TA 1QIDA 2WWTA 3IEIA 3RHFA 4DDKA 1M8GA 1ZD5A 3MWEA 2PMBA 3LLVA 1MZPA 2OAP1 4HS9A 3PDHA 3C14C 4ZALA 3ITDA 4DSAA 5B64A 3DMPA 3BRWA 3UGTA 2VDLB 3Q8XB 1SBZA 2OAGA 1GPDG 2OGZA 1AKRA 5K6TA 2XNDD 5BSFA 3ROPA 3URMA 4KC9A 3S2FA 3TMKA 2V8BA 2GSWA 4WY2A 1T2EA 1T3TA 2YRXA 1YOVA 3H2KA 1FFBA 3D2LA 2NAPA 4QTUB 1FTNA 2CC2A 4XPIA 2X6RA 1CQZA 1G9TA 2HJSA 1UK9A 3E15A 4OVKA 4CMAA 2FOXA 1CERA 2JI8A 4PO8A 3AEKA 4JKIA 5E7QA 4YIKA 3ZU5A 2B6HA 2Y3DA 1VE6A 2JNWA 3I2HA 2CJPA 1T4MA 4OFXA 5J1TB 4R1QA 1AQLA 4F4UA 3U9JA 3SM3A 1G4UR 5EVJA 3PGMA 5FORA 1XDUA 2X7HA 4XSGA 5AW9A 3W04A 4UOQA 3SY8A 3L5KA 4LQLA 2IXGA 1CJUC 2VRBA 4HDRA 4KE8A 1G8PA 4W63A 1E9CA 2WIAA 5EXTA 3JZMA 2KM1A 1XF1A 4MS1A 4AXXA 1MOSA 3OTQA 4QUHA 5LC1A 2KYHA 4MJ3A 4N7BA 2P1ZA 3DWGA 3I8OA 4S1WA 1SUWA 3W05A 3GN1A 2VSFA 2BD0A 3DWEX 1N8TA 4DJAA 3PHF2 3ESCA 2FSGA 2WD8A 2I3GA 5KUTA 4MKFA 2JVIA 3MBKA 2PGDA 3KJZA 4CV3A 3CUUA 1Z7EA 1UAAA 4EW2A 4Y2QA 5BWBA 1XGKA 2G9RA 1VLQA 2V0GA 2AOXA 1RTTA 1RQ7A 1XIVA 3C45A 3DE7X 1K92A 2I33A 3D6JA 4P54A 1JR8A 5AVRA 4UFNA 3C18A 2GK4A 3F8TA 1NRJB 3PGLA 2K6GA 1H2RS 1YULA 4Q37A 4DPMA 3WJ1A 1FDOA 1HYBA 3A2MA 1W36C 1OCCC 1UFQA 4DBQA 3QXGA 4RKYA 1QAOA 1L6RA 3MWJA 2XA2A 3FNRA 2PIDA 2SNIE 2WTXA 4RZUA 1TF2A 1ST3A 4CMEA 4QFMA 3SBDA 2GCNA 4Y2RA 1L4LA 3U3FA 3T4RA 3U13A 1K7YA 2R2GA 1PTJC 3M7IA 1K88A 2H8AA 3KYDB 1N0HA 4UU7A 4IF6A 2G09A 4GWLA 4B8ZA 1OROA 5LQUA 1ODKA 1B14A 3OMWA 4X41A 3LUDA 1I3KA 4MS2A 3PNQA 2RGGA 5SICE 2JDIA 3WG7C 4O4LF 1AZTA 3IOCA 1GPJA 4IFTA 2LFDA 2XXAA 3ANMA 4QZVA 2EFEB 4B75A 3V1TC 4Q16A 3T6KA 3Q7LA 1MT3A 3DAFA 4B5KA 3BZUA 5KAPA 3HB0A 3HYRA 2C1ZA 1V48A 4JX9A 5WRFA 1ICIA 4C7OB 3IJRA 5CX1A 1TJ3A 3WMRA 1WP4A 4GMHA 4EKIA 1XZPA 3SVTA 2V98A 2IP4A 4NZNA 4DUGA 2YASA 4IJMA 2Z9BA 1RR6A 4LHEA 4OHMA 3ZHRA 5JIBA 5FBZA 2W9YA 3K15A 2JFZA 2O07A 1Y9JA 4MB6A 2IDKA 1QMGA 1X1RA 2QBYA 3GGSA 4NS4A 4BV9A 4IWYA 4ODIA 3QIAA 4E5NA 4F56A 3DBRA 1USWA 4G0VA 2VKTA 1CJMA 3KVVA 4H7DA 5E9AA 3GBVA 1IAVA 3DDSA 4FNOA 2LCFA 1H4SA 1WOYA 3BMQA 3T95A 3C41J 3SIPA 3T3GA 1YONA 4I14A 3ZDZB 3IXQA 2CDBA 3JQBA 1I4WA 2VT7A 4QYMA 1ZL2A 4F3NA 1P7YA 2H8KA 1ONOA 2LK4A 1X7XB 2QX7A 2VNKA 2BFOA 4RTLA 4KNYA 1HZZC 3DTVB 3UKJA 5JSKA 5J43A 3AL2A 1Y1TA 3TL3A 1D5CA 4QNRA 1Q3TA 2G5GX 4DV4B 2F67A 1A8PA 1FEZA 2H59A 3H11A 4R0MA 1TWGA 4FR5A 1DHTA 5LD2C 5J40A 2XBMA 5ALVA 3RB8A 4IH1A 4UE2A 2Q07A 2WZGA 2ZANA 3IVAA 2EZ8A 3RIXA 1K2WA 1DQPA 4KQ6A 1U2DA 2YWXA 1GYQA 2XSEA 4R3UC 3I64A 4U7PB 4EBFA 4H17A 1OBVA 1ZITA 3TQCA 3NM5A 2V97A 2ATVA 2W2OA 1W59A 2V8OA 5D3KA 2ZTMA 5UKDA 3VC3A 4LK3A 2JAXA 2REQB 4L5AA 1ZM4A 3QI7A 1AV6A 3IQIX 1R6XA 1OFIA 1K4MA 4UHJA 1YRQA 1ZESA 4FGJA 2GN0A 1SXJD 1H1DA 3EW9A 5CW2A 2GCPA 5IUKC 1OCRC 3EVTA 4IDFA 4RV9A 1GPWB 5DIZA 2IM8A 2R1VB 1R6BX 3CJRA 3KQLA 1NI5A 2GN4A 5F2NA 2EL9A 1B26A 3QP9A 2E1RA 3OQJA 5L0HA 4E11A 1Z0IA 4JQCA 3WMWA 3CA8A 3FROA 1Z2OX 1K86A 1E1RA 3T1TA 5I7FA 1V47A 3ZNNA 1U7WA 1SUIA 5JD4A 2OY0A 2WUWE 2DUNA 1R10A 2ZUSA 3DFZA 1E4OA 3V9PA 3O8NA 1LW7A 4URZR 1ZDMA 4DG5A 3AHHA 4QEDA 4C6TB 4KIJA 1F3LA 3SEFA 3KYIA 1ZGGA 4C5AA 1BRTA 5I47A 3EMDA 4O6NA 2BBOA 2N1BA 4OQEA 4CFSA 3BA6A 3WYNA 3OU6A 3EXEB 1Z6AA 1FFWA 4CF5A 4F3YA 1KY5A 4WXHA 3CJTA 3B9QA 1XMJA 1DAPA 2WV7A 2L9JA 3HNJA 3ZK9A 3VDNB 4BFLA 3Q2KA 2PVSA 4KGXA 4RSGA 2VDOB 4DSTA 2XTJA 2VT3A 3EBPA 4WH0A 1PR3A 1XRPA 3H13A 1PL7A 1X8JA 2YX1A 2WEKA 5JNWA 5JO9A 3RARA 2R4QA 1TO6A 4MJ7A 1VYHA 1RXQA 4IAOA 4E6EA 1TI7A 2E5LB 4F93B 3A9VA 2X3FA 4J7TA 3M6MD 5ER6A 3X2EA 3TTTA 2UAGA 2R65A 4KH1A 1CGOA 2C98A 4HGRA 3WWYA 1PDVA 3VU9B 3LEVA 4IIYA 2Z6VA 1EQAA 4MKRA 4A2NB 1R27A 4HVAA 4LVNA 1F1MA 1E0JA 2GK3A 5GZ3A 4I66A 1WVIA 2FPPB 3MMSA 3EDCA 4F06A 5JNRA 2C96A 3WL6A 4TMTA 4O59O 2VNSA 3WDSA 5ALZA 4KX3A 1MIOA 1XLTC 2N3ZA 4F2PA 3AY7A 5DT9A 3IPXA 1OLUA 3RSLA 3QU4A 5DHQA 3IX7A 1FDSA 5KINB 1XT6A 3AR9A 5JSLA 1X38A 5JARA 1R4ZA 3EMVA 2ORWA 4BQIA 3SU8A 4PRYA 2M6KA 5JZOA 4JC8A 3FAPB 5D00A 4AJHA 1BCRA 1QK3A 3MEQA 2PL3A 1LTHR 3VYVA 3S44A 1TQ4A 4QODA 5D1HA 2HL6A 2OCLA 1PUIA 4FZRA 1U81A 1Z8HA 1CPRA 3IJEB 5BWOA 4CCYA 4XTRA 2IJGX 1B0AA 3E9MA 4MP6A 1R8QA 4N8DA 2CN1A 3CF6R 4L5BA 5GJBA 3WIEA 1WETA 1HDZA 1RQGA 2FNAA 3O6XA 2D0OB 4MIYA 3I5XA 1GU7A 4I5DA 4GKAA 2ZLBA 4PC6A 5CVTA 1G4WR 1JQAA 4E2FA 1UINA 2YUTA 5FCDA 2UXCB 3V5YA 4CN8A 1TC2A 3NFRA 3GIWA 3RT9A 1JH8A 4P33A 2YWEA 1RI5A 2WD7B 4GDMA 1HEIA 2QMOA 2VPQA 1C9YA 5E2IA 5H0IA 1FFCA 5I45A 4HX5A 4PGGA 5D5PA 1HTBA 3BXFA 3U0VA 1C4XA 4RTNA 3PHGA 2DWQA 2BFBB 1N9GB 4DV1B 1FP1D 3E5HA 4JK3A 5ICFA 1RXVA 1L4UA 2ZDHA 1UPBA 3WLAA 4YT4A 2ZUEA 1PBNA 2V7EA 1T4GA 3RSFA 5BNZA 2BF4A 3C6YA 4LF5B 2C5EA 1XMPA 1XCMA 4ENQA 4E6PA 1E85A 2OJQA 2JI6A 4BOYA 5KNCH 2Q29A 3OEEA 4X71A 3S55A 3DCYA 1OYYA 1M72A 3QWBA 2B94A 4NE2A 3B12A 2BKVA 1YZAA 1S5PA 3BXOA 2BFNA 3KQTA 1DIHA 3ZIUA 1MTZA 5AHRA 1F48A 3NBZC 4FGWA 3MFQA 4JHLA 2G5TA 2IH5A 3WHIA 1FMWA 4C3EA 1L5QA 3JATA 3KWFA 3F7MA 2O2XA 5DTRA 3ZGOA 2HV9A 3NAQA 3R6LA 3P9SA 1W0CA 3PNSA 2AV6A 3S2GA 1CUEA 1FZQA 5A4AA 1K40A 3UGKA 2QYTA 1RQXA 2DWOA 1WCIB 3UMBA 1OTHA 4UNRA 5JAZA 4MTOA 3E8XA 4BLUA 4CM6A 1E5XA 5IRCD 3JD1A 4HG2A 3LWDA 1ZN8A 1KO7A 1LCIA 2QZSA 2RH4A 1QQ5A 3WLHA 5F12A 3HA7A 2W71A 1F0PA 5HF9A 4QFBA 1XQ6A 2IODA 3T9EA 4Q4DA 521PA 1IMJA 3PSHA 3F49S 1GFSA 3M6VA 1PDOA 4H77A 1DPFA 1WW2A 2WLTA 2G71A 4P3OA 5ALXA 1RPZA 4DA8A 2EKQA 1XVIA 1NW4A 4CJGA 3OZUA 3HNPA 2OESA 4YL3A 1PHPA 4BQQA 5I7EA 3HVHA 5B4UA 4PWZA 5A1TA 4TXMA 2G1AA 3I9V1 3BMCB 3GRZA 2B7BA 2QE7D 1D9ZA 2IIPA 4G8JA 4LKRA 2IHJA 2WFLA 2OBBA 1H93A 1WXXA 4IVQA 5CB0A 3HACA 1HNWB 1RKQA 2QZ9A 1ULSA 4X1IA 2PUJA 5A03A 4RSHA 4MPTA 2KLBA 5ALOA 3SHQA 3GROA 4O2BB 4XH9B 4V0OA 3L0YA 1R0BA 3VPBA 1XHFA 3HJRA 2HLDA 5HV9A 3DF7A 5DF1A 3H5LA 3I3SR 4O4LB 4WCFA 5DBEX 3TSOA 5B7GA 2GO1A 3EFEA 3B13B 3FDIA 4OI0A 3KR0A 3WHKA 1GA4A 1COWA 2YYAA 2HO5A 1Z45A 1P17A 3UK1A 4G67A 5EKDA 3WC4A 3GRAA 5KTOA 2DP4E 1TK9A 4NZZA 2FHSA 2GZAA 3DTTA 3MINA 2LKCA 4Z4HA 4BP1A 1KEKA 3ESRA 5DYWA 1MRSA 1YYXA 2CVFA 2AK2A 2XCRB 4YAJA 4CBVA 3O8LA 4W7HA 1TFUA 5HM6A 3UQZA 1SFRA 4XEVA 3STYA 3GNQA 4BZXA 3VH4A 4L73A 2JH9A 4K2HA 3PKZA 3NRJA 4X84A 1ONSA 3W06A 4JT9A 1I7NA 3QQPA 4F1JA 4TWIA 4J0DA 1GSAA 1G59A 4LKOA 4AY6A 5EMHA 2ZRFA 2GOYA 1YZYA 2FZLA 2ZAMA 3UA4A 3FPGA 1NUPA 3N8IA 3LHIA 1ZOOA 2R7QA 1W5AA 2AOTA 4M1WA 3JAKB 1QE3A 2Z15A 4L72A 1X1BA 1UBMS 2YMPA 1PF7E 1ACMA 4PCUA 1ZJYA 1XAIA 2PX6A 2O0KA 1I2DA 4HEAJ 1U8EA 2VSYA 3KHTA 3ENQA 2NZWA 3B53X 5EE3A 3ZJUA 3HNLA 4H4CA 1QIJA 3SYLA 1MW9X 3TSAA 1TJYA 3KB1A 4AJ1A 2JHAA 3FR7A 5A69A 1R4MB 4MUNA 3QI2A 1HFEL 2R8ZA 2F1RA 5FUQA 1KOLA 5CRIA 1ORDA 3E8SA 1JA9A 1W4AA 4P9FA 1WATA 3ACDA 2JZCA 6REQB 3QNMA 2G9QA 5AM2A 1O58A 4TRRA 1IDN1 3W8DA 5BQ3A 4HWTA 4XQ0A 5HWSA 4K9NA 4D0SA 1W88B 4X92A 1DFIA 1U0HC 3UK2A 5K4GA 1B8UA 3PUJA 1Y1RA 1TYAE 5CCXA 3W8HA 5GONF 3AF4A 4KNVA 1DZIA 4JJFA 1XDWA 1N8SA 3KQSA 4Q12A 1ZCJA 4O2RA 3BHJA 4N7MA 2BEUA 2XQKA 4Q9KA 5BRAA 2ID8A 2A8YA 5HIIA 1GQYA 1QKKA 2POQX 4TKMA 1BJKA 4TKUA 3RQFA 3VKHA 3QH4A 2XNKA 4XLPF 1J9GA 4OYRA 3GDFA 2NU6A 3I2FA 4YUVA 1X39A 5FWYA 1FP6A 2DF8A 1LPAB 3ML1A 2P5UA 4LZZA 1KEVA 2I4IA 4YRAA 4MHOA 1XTZA 3IHKA 3SZOA 2WKPA 4CEIA 3SVZA 1SXQA 4FQ7A 5FTLA 3P2JA 5FJIA 3DE8A 2WB4A 3NMUF 4A82A 1HV8A 1SBNE 1J2TA 1BOOA 1S8NA 1UJ2A 4YCSA 4RDAA 5LDHA 4MWZA 2FW7A 2GEJA 2GESA 5DGHA 3K7DA 2X2FA 3M0EA 3ULKA 1C7JA 1NUQA 1X7ZB 2OV2A 3MG9A 2ZROA 2VO1A 1XVAA 3BIFA 3HP4A 2QB5A 3IJ5A 4TKLA 2BLLA 4IBOA 5FP0A 5CPFA 4OHOA 1VRCA 2H8GA 2VHVA 1DBWA 1G7RA 1R4NA 1TGVA 4YPOA 3ICQB 1GARA 3DAYA 4DBZA 5FQOA 4FR2A 4WTOA 3WTBA 5ESRA 3OZGA 1RBYA 1O87A 4WZZA 2B92A 5CFNA 5B7PA 3OQIA 2GB4A 3CT6A 4ZDWA 3GODA 2E4AA 1GXSA 5HUQA 4EP1A 4Z54A 1NT4A 4KDRA 4WN9B 5BQ5A 1Z7WA 1L2TA 4NH4A 4POOA 2ANCA 3L1VA 3FTPA 2XLEA 4OQDA 2CNBA 4MUKA 3LQKA 5D91A 3NOOA 1Z5WA 1I1OA 4NC9A 1A9RA 3C7AA 1JEOA 2DHEA 1ZYRF 2JLUA 1UJ5A 3QE0A 4AYTA 3LC0A 1EFHA 1Z4PX 1K6XA 1P4AA 3OHMA 4TMZA 5JCOC 4K0KB 5AR1A 3NBQA 4N6OA 3DVAA 3TQTA 2I1LA 1AKTA 3G9QA 2H08A 4MQ6A 3E7DA 4H1WA 3RRBA 4RTRA 5IBPA 1AUQA 4DYDA 3NGMA 5ALGA 1KF0A 2HMVA 5P21A 4KPEC 1BXGB 1VIYA 2O7RA 3M5CA 3EQ7A 1KERA 4YRRA 5DSZA 8ADHA 2Y2VA 3KDSE 3W5UA 1A5BB 5CD9A 4GDFA 1T5BA 1V39A 5KTPA 1NBAA 1BGVA 4REQA 2X1MA 3ZQYA 1C30B 3IURA 2IS4A 1F2UB 1KSHA 5L3QA 1M6WA 1OXUA 4MYCA 4IAQA 4WGZA 1WS6A 3VVLA 3V32A 3KWLA 2NLOA 5CA0A 1LV8A 1YQTA 5TGZA 4GQHA 4Q4ZF 1LJLA 2IY9A 3LCJA 4RF4A 1RXYA 4Z4CA 4F38A 1Y7HA 1JYSA 3WGHA 3K1HA 3IDSA 1D2RA 3BF8A 3BIXA 4XFKA 4IOMA 4QYWA 4N65A 1IM2A 2W5UA 3GRFA 1UXHA 3PQ7A 1DC8A 1LQTA 4GR9A 1GU1A 4FHCA 4P84A 2RH8A 3VDQA 2VDWB 1XMOB 4IOJA 3TEFA 4YDRA 1G64A 3K0FA 1K97A 4WUTA 1L5HA 3C3WA 4UNPA 5D1NA 2CY0A 1QR6A 2P61A 4X6UA 3TLYA 1MMNA 2VATA 3JTEA 2RG7A 5FUYA 2PRIA 1YR9A 2ISQA 1L0BA 4HFFB 2X14A 3CZCA 5JXIA 3X44A 2ZRLA 2LPMA 3HUUA 2A94A 2NWQA 1CSEE 3OCCA 1KIFA 4ALLA 1VYIA 3RS5A 1NM5A 1HXHA 3W4JA 2EQAA 4QAQA 1PE0A 4RPCA 5AM3A 1RMTA 2R8YA 4AVYA 5TMDA 4GYJA 5HMLA 3CE6A 4HS4A 1E2DA 3E3MA 1Y80A 5BOVA 2XH8A 3TQFA 2EZ9A 3EPJA 3BF7A 4YL0A 4F5EA 4ONEA 1WXQA 3PGJA 1JLLB 3KJNA 4EM6A 4UBLA 3KVYA 5CFQA 4ND5A 1NV8A 1WE2A 1K6EA 2ZJ5A 1YVRA 4X7BA 3DHYA 1IZYA 1UDRA 3RUEA 2ZTUA 2YY7A 4NCHA 1UJNA 5LA6A 1E18A 4FAPB 4B6IA 3GA5A 4HQFA 1QXSA 4E2ZA 4A8JA 4DMCA 5LBIA 3MCUA 4I50A 5JNUA 2P4SA 1VOMA 3L6CA 2C9BA 4JX8A 3WL4A 3DL4A 4OFWA 4G4SO 2YC4C 5LIPA 4LVUA 5C4GB 4DV0B 2WTMA 2F43B 4WIAA 5B4VA 1QVAA 5AH0A 3Q85A 3WBFA 1JG3A 4UEKA 2KGOA 4A2WA 3MBIA 4RGVA 3OETA 4HLNA 1KNXA 5H68A 3DLBA 2PX0A 5L0JA 3NVMB 1NYTA 3EGOA 4WLOA 3LSTA 3H5OA 3ZVNA 1RXUA 4FE3A 1USUA 2QPLA 5CTAA 4BCBA 3B1KA 2ISCA 4KJXA 4Q3CA 4ULVA 3JQFA 3ROKA 3PTZA 5DX0A 1A9XA 4FW8A 4LJYA 5B37A 5IWAB 4NNOA 1E6CA 2AUNA 4NNPA 4R32A 1GYPA 3QUAA 3O4VA 1DSSG 3HVJA 4OY3A 1DMRA 1L7AA 4US1R 4DRYA 3ET5A 1SH7A 1N2OA 1IULA 5JJBA 3N5CA 3AL3A 3T52A 2VA9A 2X9GA 4PNHA 1FLDA 4YI3A 4DM3A 3KAQA 1Q0FA 2B5WA 3NTUA 4HTFA 1BJRE 2I4RA 1THGA 2PBLA 1EI7A 1SVKA 1ZGZA 1PL0A 2E21A 1FC0A 2YZGA 4OK6A 1SC6A 1K7EB 2FP4B 1N3IA 3WGKA 3SVLA 4RIFA 1Z2PX 1C81A 5LU8A 1SCKA 3G7UA 1OI4A 4NYJR 4QD3A 2W6PA 4Q00A 2ZWPA 5H5JA 3EARA 1Z8NA 5D85A 3GB9A 5IK2A 5IT5A 4XB6B 3L0DA 1A7KA 1YZFA 1JI3A 3ENNA 2XY4A 1OR8A 2YWFA 2C2GA 1M8KA 3OC6A 3VJKA 6PFKA 3VI4B 5THQA 1V4NA 3T4UA 2EEPA 3R5FA 2LIVA 2Y1GA 5KWEA 2XOXA 1ID1A 5CLLA 3LRPA 5IHXA 4GSYA 4FEAA 3FLBA 4YQZA 2JIRA 3GNSA 3DO8A 2A86A 3OX2A 2RI6A 2EKBA 1QH8A 4U7TB 2IYYA 2XT0A 3RS0A 1H8EA 2Z08A 2QMHA 3QSGA 3FVVA 2FFJA 3GPIA 2Y1LA 3QE2A 3AF2A 2W9XA 3G1WA 1WVMA 3VSAA 2NO5A 5HTOA 1AQNA 1KAMA 2Z8YM 2RGNC 1GKUB 2G1PA 5FULA 5ISMA 4UAJA 2Z6QA 3BB1A 1P0CA 3A4YA 3CHYA 2WA2A 2ZRHA 4PLYA 4TZTA 1PK7A 4FJ2A 4LNAA 4Q15A 5IC5A 4EDHA 1UBEA 3F5MA 1NU9C 4D96A 4PR0A 3BGVA 4NP6A 4GNRA 1ZIDA 2E7ZA 4C4YA 1EG2A 3O4JA 3EVBA 3RYLA 3E61A 4ZA2A 2CLCX 2I7TA 5EUMA 2Z4TA 2CD9A 3PC8A 5GONB 3RE1A 3GEMA 1ZN9A 2FXIA 3JV7A 3FWNA 4NENA 1SBYA 1T1RA 4LAFA 3H6KA 4LN1A 4J7CA 2WHXA 1P8AA 1ZQ1A 4V0KA 2M64A 3HVUA 2QT9A 4OXKA 1FFEA 4E88A 2O2ZA 2R66A 3LG2A 5LQDA 4MB2A 1XAJA 4IP0A 2Z56A 3MRVA 1G5IA 2IZOA 1XL1A 3ZH9B 4HB2A 5DDIP 3NPMA 1MH9A 4N5MA 4FNAA 2WF5A 5K0EA 5E6UA 1G21E 5DOVA 4FB5A 1RZRD 1GDTA 2Y1DA 4QVIA 1YRYE 1BX3A 4JLUA 4EWCA 5A6AA 1EVYA 2R84A 2B78A 3DOUA 1Q0DA 2HF2A 3DC7A 4KMOA 3U1BA 2GAQA 5DHRA 5JD3A 4RVDA 4E2WA 2PT9A 4W5TA 2BF7A 3L07A 2GTHA 1TZBA 3UMHA 1B1AA 3I9JA 1E3DA 4B7CA 3HJGA 1YE5A 1PL8A 1KHTA 4JBIA 2HFJA 3ZW7A 1HMYA 3LCUA 5G0WA 3O1HB 4HZIA 2PRZA 3W4IA 4X62B 4OXXA 1RWNA 3I5MA 1Q14A 3R8CA 2O8FB 1TT7A 2OBNA 5CK4A 4ZRNA 4K1LA 1P5HA 3WRWA 4QGAA 3BOSA 1ZIXA 3K96A 3KT0A 1HYHA 2P40A 1O9GA 3ZD9A 1FOEB 3TX6A 4Z4EA 2ID4A 1V16B 2PN1A 2VHZA 1BJTA 4TX1A 4F84A 3THOA 1X3SA 3BHIA 3FTNA 3ZDBA 3GXBA 1PR4A 3MT9A 4FQ8A 4OQNA 4EB6B 5D87A 5AKKA 4Q7CA 4W8KA 2QX8A 3P45A 5TLSA 2VASA 3CEAA 4R7TA 3QFRA 3QVGB 4XARA 1QTNA 2FX5A 1V8ZA 3RG2A 4QJIA 5DNUA 3CNQS 4NULA 4YP5A 1QOPB 3ZJTA 4ZK6A 4LF6B 4KQFA 4FGUA 1PEKE 3EAQA 1FCJA 4JL6A 2IL1A 4FEEA 4TZ6A 3RQGA 1MRNA 3GEGA 2L7AA 1OBOA 3HLYA 4EKWA 3DGFC 1CIVA 4QOSA 5JNSA 3HZOA 2V7QA 1J1UA 3G23A 1GQQA 4DZRA 1B2RA 4Q9JA 4JI2B 2RBEA 1N5KA 2JK1A 4ZI7F 4TVOA 4BRUA 2QLFA 4C30A 1T36A 1YDEA 4WBXC 1ORIA 1A9YA 1WDTA 3STUA 5JWRA 3R3UA 5LZ2A 5MFZA 1WV1A 4TWAA 3NAGA 2E4YA 1NMQA 2WWVD 1TB4A 3GFBA 4Q3EA 4G0WA 4EYEA 3FYHA 1ESNA 3ZCTA 2DFNA 2QUBA 5B3JA 5DM60 2A33A 5FL3A 2NVUB 2RONA 1TAUA 3UUEA 2V0NA 4U2FA 3UV7A 3ZWAA 2X9VA 3JASB 3K72B 3L0SA 4YDHB 5FJJA 2AEEA 1TQ2A 5LP6C 3N2LA 5EZQA 1GD1O 5KB3A 4LC1A 2I3BA 1N3YA 4A91A 3BQNB 3EOAI 3HCEA 3GJ0A 4K3UA 4NATA 3OFKA 3N7AA 3OIGA 4UCQA 3ZY5A 3OKCA 4I55F 3THYA 4ARBA 2CVZA 3IC5A 5BQXA 3CLSD 3KWJA 1LTQA 2FZ5A 5ECWA 1ETUA 4PZEA 5LBTA 3T7SA 4UM9D 1MQSA 3OLZA 3PR3A 4PZCA 2EFGA 3BJRA 5BOSB 4H7EA 4EPYA 1IXSB 4LTDA 4JC0A 5IJXA 1GA6A 5EXSA 4DLZA 2QAGB 2IZ1A 1DEXA 4F2HA 4V1CB 3TLJA 2HMYB 1TYDE 2V7VA 3MAAC 1E6WA 1FSGA 4JP5A 2YV2A 2B4YA 1EK2A 3AP2A 2NUTB 1MVOA 4PAGA 2IFTA 4HLUC 3HG7A 2WM3A 3DXJF 4ZKDA 5B3IA 4EPRA 3OEYA 3UJHA 1YBMA 2V1UA 2CUNA 3DLTA 1IPHA 3IRUA 4B6QA 1EDZA 3H97A 5JE8A 4C7KA 4YJDA 1ZHYA 4UFOA 2Y27A 2J85A 1U11A 4BGUA