1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
1K04A 3BRJA 3AE4C 2JPUA 3AEBC 1PV3A 4NQFA 2L6GA 3U0CA 3AE3C 1O3UA 4R32A 3RQGA 3GM3A 2YWAA 4XEKA 3AEAC 3JZ0A 1ZZPA 1ZOYC 3RQFA 3RQEA 2FBWC 3AE9C 3SFDC 3TULA 3AE7C 1OW7A 3C8GB 3AECC 3K7DA 1UFBA 3GM1A 1WOLA 2L6HA 3ABVC 4XEVA 5F28E 1WTYA 3GM2A 3C8GD 1JOGA 1KNYA 1YQ4C 2L6FA 1K40A 3O10A 2KK1A 3L8JA 3JYYA 2PBEA 2H88C 3U3FA 1WWPA 1V4AA 3C18A 3C8GA 3B71A 1OW6A 1YQ3C 1QVXA 2G3AA 3AE5C 2H89C 2HSBA 2Q00A 1OW8A 1KTMA 2LK4A 4YTPC 3MFNA 2WQYC 3AE2C 3S9OA 3AEFC 4EBJA 4EBKA 3AE8C 3AEDC 3AJMA 3AE6C 3AEEC 3L8IA 4YXDC 3AE1C 4XEFA 3SFEC 2JX0A 1K05A 1ZP0C 3AEGC
chains in the Genus database with same CATH superfamily
1K04A 3BRJA 3OEOA 1LTAC 4DBQA 1KQSO 2JPUA 3RK3C 5APSA 2E75B 2QE7H 1FAVA 2LD6A 1Z6AA 2A0BA 4JYCA 4IGGA 4ZNCA 4WB4A 1HWTC 1M1JB 1JCDA 4OGQD 3GANA 4Z9IA 3F89A 2M3EA 4CIPA 4WY4D 1ZOYC 4IJJA 4JYBA 3SNHA 1L0NJ 2V26A 3O6QA 2O01N 1AEPA 3O55A 3WU2H 1KB9E 2BEZF 1FBMA 3EFGA 2E5TA 2CPBA 3ABLC 1BCCG 3PRJA 3JCUQ 1RCPA 2OQQA 3H1HG 3TK1A 3U9MA 3L74D 1LIHA 1PZQA 5KYYB 1HGVA 1WRGA 1CPRA 1LTJC 1NTMJ 1VQ5P 1URQB 1Q86Q 4IAQA 1BGYE 1SP4A 5DS4A 1BZ4A 1AJYA 2XLWA 4G0HA 3OA7A 5APQA 4YL3A 5KLVG 2YZSA 2ZXEB 2OOCA 3A0BE 4MVSA 1ZMEC 2FXPA 3HJCA 5EGYA 3L71J 3MUDA 4U5HA 1WWPA 2J9BA 1KORA 3V7OA 1VQ6P 2VB6A 3C8GA 3FOOA 1SYQA 2KXPB 3CXHI 4Y99C 4KNWA 1NBBA 3TK0A 5KYUB 3L1MA 4XTKA 4GIFA 3V5YA 1L0ND 3HD7D 5BQGA 4O79A 2AEMA 2MHRA 2H89C 3AE5C 1BCCE 4B6IA 1M2VB 1XTGB 4JTDB 2XLMA 4ER9A 2KYVA 2OEVA 1FE6A 2Z4EA 4MVOA 2A06E 3WODF 1NTMD 1BBHA 4H13C 2BC5A 1YA9A 3AEEC 1NOHA 3PH0A 1GL2A 2XZRA 5B5EE 2KS1A 1GQAA 1FZCB 2J5UA 4U3FE 4GT1A 2KLVA 3WMM0 2LIGA 3S27A 1NYHA 2HODA 2PP6A 3L71D 3QVZA 2IYPA 3L72G 2KSFA 5L0DA 3FGAD 5TJ5E 2OYIA 2Y9ZA 2A68F 2KNCB 3PHF2 1IW7F 4NC3A 1EQ7A 4PV1C 3Q2YA 4PFOA 2F22A 1SQPE 3GM3A 4I1MA 1L2PA 1FZEA 3MLGA 1SQBG 3CQZA 2I1JA 3QH9A 1H0TA 2YO2A 3SSUA 2ZAEB 3ZSUA 1RF0C 1TWCA 1SQVK 5HSWA 3SFDC 1VQ7P 4YN0B 3IQ6A 2FYNC 3AE7C 5AW1B 2FY8A 1PGQA 1CZQA 2NUPB 3AQBA 1Q82Q 1VQPP 4C7OA 1QKRA 4Y28J 3GM1A 4OWFA 3H1JJ 5H2FH 4H44D 3QW1A 4C7NB 4DCKA 5APVA 4XEVA 1DD4A 3AG3C 5JSLA 3ZDLA 2OG2A 4N06A 3FX0A 1JR8A 4MQ9F 2FYUG 1T6IA 1ZLLA 2XL4A 4RO0A 2E75D 1PL5A 3L72E 3SXKA 1X22A 4QI2A 3CCMP 1K40A 3K5BA 4LDQA 4EI2A 3UGOA 5BVZA 3TGUJ 3CPWO 2R9RB 3OWTA 2LSEA 4ANJA 3FMSA 2H43A 1FDIA 2E74C 3NMJA 4PFPA 3VM6A 2BCCG 1USDA 2AXTE 4BXLA 1RE4C 4JE9A 3W2WA 4WJ0A 3H1IG 3HD7A 5CCGC 2P7JA 1Z23A 4BJ5A 4D4XA 4L73A 3JRTA 2LXCB 2BASA 2J9VA 1R5SA 1NTZG 1BSHA 2DYRC 3V5BA 3H1JD 3Q5PA 4DRHB 1HGZA 1ZXGA 2D2CC 3DAFA 3CCJP 2H7HA 1DX7A 3AEFC 4H13B 1S9KE 4LACB 4ZKPA 1NWQA 1M7LA 2KZIA 4HYTB 2YL1A 3PMRA 5CI8A 2N1TC 2MJZA 1U0BB 4E7ZA 1SFCA 1HJ0A 1FZGA 4U5DE 1IFIA 4DZOA 4RJTA 3RYLA 2JEEA 2RD9A 2X0CA 3TGUD 2OCCC 2YO3A 3CD6P 4HKZH 1FZAA 3GHGC 1FZFA 2HJMA 1X79B 2LP4A 2IYOA 2CCYA 4HEAJ 2O1KA 2IX7C 3L73G 1R5ID 3UNGC 2BCCE 2ZT9C 5AW0B 3SWFA 2LFFA 1YBKA 5CJ4A 3H1IE 1FZBA 2JJLA 1RKEB 1SMYF 1Z7Qc 3UMKA 3EZHA 4JKVA 5AC5A 4LLHA 2YL3A 3B5ND 1QPUA 1NTZE 4PD4E 4XLPF 2XLOA 3JTLO 4CPGA 1R5LA 4H54A 4WABA 1OW7A 5TISH 2Y0DA 1MMNA 3QTHA 4L75A 2R32A 4JBZA 1H9GA 1E85A 2OYHB 4A4AA 1S3JA 3KKBA 4YWQA 1BGYJ 3RK3D 2QJPB 2L5GB 3BRTB 4AL0A 1APCA 2R7WA 4AYCA 1UIIA 3H2UA 2XL8A 4GOEA 1Y9BA 3T6GB 2EINC 3A0HE 3H6PA 3X2QC 2W6JH 1M1JA 2FFDA 1AFOA 2QM7A 3F5HA 1V4AA 5AVWB 3PLNA 1LT9B 1D1CA 5A6BD 2Y3BA 1ST6A 2L9JA 2YIUB 1HW2A 5L0FA 1E84A 4W7YA 1K73Q 1BR1A 1OVRA 3Q5RA 4XPXA 1BCCJ 2B0JA 1KB9D 3NFQA 1NKNA 5KYYA 1A02F 3CAXA 5D92A 2D2CB 1ZR4A 2QSIA 4QI0A 1KQGB 3LNMB 3ZQYA 1T9KA 3HLZA 3A3YB 1BGYD 3V4WA 3VP8A 2WTYA 3TNUA 2DB4A 4BRYB 3QVYA 1RF1A 1BSNA 1OMIA 1NZEA 5DS5A 3J06A 3C62A 3K1HA 5KKZB 1VDFA 3T6BA 2O9XA 5E33A 3IAOA 2K88A 4U3FJ 2IXNA 4RBNA 1AA0A 1T6QA 1JNMA 5KTBA 4GQHA 1HE1A 5DVWA 4NPFX 3L70G 4G7HF 1SQVG 1EZVE 5AVSB 3ZWIA 3VOPA 3RK2C 2L6GA 5KAIE 3DAGA 1SQPJ 4DJ9A 2BL2A 2POHA 1M2OA 2M3BA 2P0NA 3O6QB 3M0DC 1Y47A 3B5NA 4D6TE 1X0TA 1LE4A 3U2MA 1BCCD 4O6YA 4U9EA 2AEJA 2N9BA 1AUEA 3ZVRA 3CXHH 1M1KQ 4H13D 1ZR2A 3H25A 2O3JA 1Q0FA 4OIQF 2A06D 2PFDA 1YHQP 2QLAA 2QJYC 3MBGA 3ZQVA 4PJ0E 4IRUA 3FAJA 3I5CA 1VF5C 4H0LB 1YYJA 1KMIZ 2VH3A 5JUAA 2RH0A 2R7UA 1OWAA 2NUTA 1E83A 3RF3A 1OCZC 1N7LA 3FHDA 4JC7A 3L72J 4U3FD 2ZYAA 5JS5A 2WWWA 2XM4A 5FCLA 4PV1D 1ZRTE 1KZUB 3L70E 2P7VA 1LKXA 2O01J 4BJ6C 4RESB 2KK1A 2YKQA 3GWNA 3D6YA 2A45I 1SQBJ 3CC2P 4WGYA 5COFA 5DQTA 1SQPD 3JYYA 1NAYA 2Q3IA 3RL0B 5A6BA 2KSJA 1LS1A 2XRHA 2W90A 1LI7A 4GDOA 4U5CE 5CIVA 3WU2E 4UB6H 4KBLA 2FGYA 2WPQA 4C7NA 2R5DA 3B0UX 2J7PD 1OW8A 3G50A 1G1IA 1M57C 2XSEA 1L4AC 2R3CA 2WMMA 3UR3C 4EHPA 1GL2B 3L36A 3JCUH 1QL2A 1SS1A 3DE8A 4EDFA 1NSGB 2KS1B 4YXWH 3L72D 3EJNA 3EZIA 1LTTC 3AE6C 2HR3A 4OIRF 3AE1C 1KU2A 4XEFA 2LKMA 2OYIB 1GTWA 3DM9B 2IPPA 2E74D 1VQLP 3H65A 2EILC 1GZLA 2HSQA 2KUBA 4Q5SF 2OGUA 2BCCJ 2KSEA 2JP3A 2IBZG 5CCGD 1VL2A 3DZAA 1TFKB 3GF3A 1A7VA 1EDLA 1H0TB 2C0WA 3H1IJ 4WY4B 1W5CE 1O3UA 2QTVA 1PD1A 2XL6A 1NTZJ 2YVKA 2D2CD 1MUUA 2JKVA 2EPLX 1JY3N 256BA 3B29A 3EGDA 5A6JA 2KJGA 4L6RA 1KN7A 4R4MA 1Y6DA 3AE9C 3RL0g 1JUNA 2N1TD 2QJYB 3KPEA 1FMWA 3U3BA 1S9KD 3BASA 1N8RQ 1GW3A 2Q7RA 5BU8B 1HVVA 3GW6A 4A2NB 1NU1K 2J0WA 3CX5E 3VF0A 4FESA 2W6AA 1GM5A 2GUSA 3TSIA 1LVKA 3IHUA 2E42A 3EGXA 2ZT9D 2NZ2A 1JM0A 3E70C 3M15A 3G4ZA 1PPJG 2IBZE 1TWAA 1ZW2A 2YEVA 4XPWA 4PJLA 4ULVA 3GORA 1RJ9B 2BCCD 3CWBG 2W27A 3MZWB 5APTA 3Q7LA 3CL3D 3SEOA 1RF0A 3RBXA 3I55P 2M4EA 3H1ID 1SQXK 1ZHYA 1MFZA 3HD7B 3U3FA 1NTZD 1HUCA 2Z5IA 4PD4D 3LEOA 1X8YA 2RKLA 5EHHA 3II6A 2AWCA 3IF4A 3CMEP 1OW6A 2M5AB 3Q5SA 4MN4C 3IEEA 3V2PA 4IWBA 1QVXA 5A69A 2OYHA 5CHXA 2G3AA 4H0LD 2J7PA 4XQ1A 2Y3GA 3O6XA 3NKEA 3M1CB 3U2LA 3T4RA 2ZYDA 3T9OA 5KAFH 3Q7GA 4DRJB 3B0VC 2AVKA 4HFFB 3LUTB 4C3BA 5AVYB 4EBKA 1PPJE 4W80A 1LTSC 3AJMA 2Y69C 3CWBE 1EKYA 1JTHA 3SZRA 2Q6QA 3V2NA 4EYYQ 3S4RA 1RE4A 2XLEA 1CSBA 4ASVA 3TJ6A 2YMKA 5KLIC 3RW0A 1LGHB 1KB9I 2YKZA 1PIXA 2R02A 2CW0F 2ETSA 5GPGB 1LWUB 2E76C 4I6MC 1S5LH 4D6TJ 4CIHA 2UUHA 3I5PA 2KGOA 3R2PA 3IPMO 5IY5C 1T6UA 3RGUA 2E5YA 2K1AA 3CCEP 2AWYA 4H44B 3H32A 2FBWC 2N1TA 3ECSA 3FAPB 4CJOA 1Z56A 3KH2A 1GMJA 3SYNA 2JWDA 4GYTA 2Q1KA 3KDPB 4KI2A 2IXPA 1QL1A 1S5LX 2NPSC 2WPRA 2J8WA 3GM2A 2FXOA 3RK2D 3L70J 4IL6H 2FFDB 1A7DA 3EHNA 1JMBA 1Q0DA 3AQCA 1J1DC 1L0LG 4CS8C 3GODA 3RIPA 1EZVD 2FFHA 3EFOA 3R4YA 4MVZA 3RBZA 3ZIBA 4IFMA 1QVGO 2E87A 3LS0A 4IB4A 1NTKG 4D6TD 1EQ1A 1N73C 4BG0A 3K1IC 2C04A 1BDCA 1QZXA 3DWWA 2P67A 4U9DA 4ASWA 1VQNP 1WT6A 4I44A 1VF5D 1HY5A 2EPKX 3NRHA 3TQOA 3MP7B 3VAYA 4IL6X 4MVUA 4LLCA 3TNUB 1RE3A 3KYQA 1H8AA 5JT4A 1RF1B 4N4WA 2QVAA 5GTIH 2IZ1A 1OCRC 1J8YF 1D1AA 2D4UA 4OD4A 2YKOA 5AVRB 1CW5A 4CSAC 4U7JA 4E0HA 1MQVA 1ZRTD 1T8ZA 3AG4C 4JEAA 3L70D 3NKDA 3G4XA 3CC7P 1L0LE 1G5ZA 3HUSC 4YXDC 1RXQA 3KL4A 2WPSA 4JIOA 4X0RA 3USSA 2JX0A 3S84A 1W2WA 1NTKE 3JSVC 1G4US 3H1HE 2Q9BA 3OA1A 3S90A 4RKUJ 3B5NB 1MMGA 1R4TA 2R7OA 2A45H 3HNKA 3SXYA 3V5XA 2UWJE 3EH2A 5CMZA 4R32A 1M57D 1NLXA 1L4AD 2J9UA 3O8ZA 1FMVA 5KLVE 3NDBB 1TR2A 4C3EA 1HF9A 4HH2A 3ZG1A 2EIJC 3M4BA 4LDKA 4BEMJ 4YL0A 4JCZA 1TKNA 2WT7A 5TJHA 3RK3B 2NUTB 1BR4A 4G7ZF 2WSCH 2A0UA 2PFXA 5BQHA 4ONSA 2B87A 3UMHA 5A6KA 2NPSB 3B8EB 5F28E 5BQIA 1JAFA 2OU6A 1R8EA 2WVQA 1TWGA 1SQXG 3LIDA 2IOQA 4KC9A 2B9BA 3GEEA 2B88A 1KILE 4WY4A 2QG4A 4XLNF 3M0DA 1KILC 4O6NA 1N73B 4Z9JA 1JOCA 1A0BA 1JY3P 3CCRP 2CNWD 1LTGC 1LTJB 3WG7C 4ULWA 2I1KA 3S1KA 1TQGA 2H7BA 3JC22 1ZHTA 2KI7B 1IFPA 2KNHA 3L4FA 1V74B 2QEXP 4JURI 1L0NK 2ICWG 3CX5D 4P9FA 1SQQG 3MFNA 4BJ6A 2AP3A 4YPCA 1SQBE 1VQOP 1KFMA 3KZIH 3HUSB 1RJ9A 3CWBJ 3P8MC 2IBZD 1OFCX 4Y99B 4Z1MH 1MNEA 1NTMK 3VYWA 5KYNA 4NTFA 2R7XA 4XE5B 1NJIQ 1K05A 1ZP0C 2OTKE 1PP9G 3GEHA 4MW3A 1OVUA 3ASNC 3GMAA 2L91A 5B3SC 5DLJA 2PGDA 3P7KA 2Q7CA 3LJBA 5COGA 1PV3A 3WHNA 4GODA 5BU5A 2M5AA 5B1AC 1RMVA 1N86A 4TLFA 1YDIA 1JRAA 1BDJB 3LESA 2C9NY 3PTZA 3KPHA 3KHUA 3EGDB 4B86A 2FYUE 1L4AA 4U5GA 4EIYA 1S2EA 2W6BA 1YVIA 2SPZA 1U57A 4I1LA 1U6HA 3EG9B 1SQQE 3V4QA 1M56C 3K66A 2R3SA 1P84E 2BE5F 2YLDA 4J7TA 2B89A 3CLQA 2A1DD 3EGXB 1PPJD 3K7DA 4PV1B 1YJ9P 1K8AQ 1GW4A 5AW3B 2CK3H 3CWBD 1FNTc 4PJMA 2W4BA 4TT3H 1VQ9P 1HMOA 5E3CA 1ZVZA 5CJ0A 2WVRA 3POVA 2DYSC 5KYXB 3VTPC 2YRFA 2ITAA 1GGQA 2E76D 5KYWA 2FYNB 2VRSA 1LWUA 5B1BC 1LP1B 2PRRA 5B66E 3M0AA 4C46A 3IQTA 4UB8E 1ZHWA 3G4SP 1D0ZA 3AG1C 4OIOF 1OR3A 2V7QJ 1LS4A 1YA7O 2CNWA 1LTBC 3B4SA 5DJTB 3ZDMA 1KB9H 2I15A 3JRMO 2YXQB 1YJNP 2Q9IA 4IFDK 2KW3C 2PX3A 3SP1A 2XXAA 5APXA 2R44A 2VCCA 3US6A 3L73E 1TWHA 2NPSD 2P6VA 5L3VA 3C9IA 4MS2A 3M9BA 3SXZA 3UMIA 3A0BH 1EZVI 1JTHB 2E74B 3HE5A 3U8PA 1L0LJ 3V2RA 1KQFB 3X1OA 1LTIC 3U59A 1OX3A 5BUOA 1LT1A 1OQCA 1NTKJ 3U5SA 1HE9A 3MTUE 3H1HJ 1OCCC 1NU7D 3VMZA 1KYOE 1N2DC 1FOSE 3R7CA 1YARO 5T3TA 4WGZA 1FDMA 5B3IA 2YHSA 2XKMA 5KLVJ 3H32B 2N1TB 2QRXA 1VYKA 2OEXA 3WUTA 1OKKD 1IFDA 3S28A 1KQLA 3RFYA 4N78E 2H7VC 3AEAC 1WGWA 3QWOC 1JO5A 3GHGB 5CBOA 3IR9A 5JLIA 2RSEB 4DRIB 3DM5A 3TULA 4CJGA 1JY2N 3GWLA 5B5EH 1JPNA 4GEHA 3N2ZB 2ZT9B 4CDYA 4DOJA 2MKVA 2XU6A 1L0LD 2RN0A 4I1OB 1FTSA 3EPVA 3PCVA 2YLIA 3L37A 3CCSP 1FU1A 3EFOB 3SWYA 1NTKD 5AW8B 4JW1A 4BJ1A 3BRVB 3D70A 3H1HD 2H8PD 1YQ4C 2L6FA 1HMDA 3IQCA 4YT8A 1K9MQ 3O10A 4MTFA 2M64A 1Y8AA 3L75G 3M4CA 1S5LE 4PACA 2DGJA 1S05A 2Z5HA 2MWQA 5KLVD 2H88C 5K5GB 3NYJA 4G78A 1AQ5A 3B0PA 3KMIA 1RQUA 1G4WR 2EPOA 2K9JB 2HPCB 1C17M 2V3CC 4N3YB 3B9QA 1J1EC 2XLVA 1AQTA 1NKZB 1ORSC 1DEEG 1NGMB 2NPSA 4PR9A 1SQVE 1NTMG 2WVOA 3CMAP 1KTMA 1E79H 2A6EF 2PP4A 4CS8A 1VOMA 2IBFA 2P1JA 2WSFJ 2VC9A 4IL6E 1KILD 4DVZA 1ZHZA 3AE8C 3IQ5A 1LPEA 3E9VA 2NRGA 1YTZT 3CCUP 1W2EA 3L71G 1Y4CA 3DI5A 2ZVOB 3L8IA 1N73A 3RVZA 4CX9A 5EFWB 1JY3O 1M6TA 3L75E 3ITFA 3K1IA 2G3VA 3DD7A 4NTBA 2AXTH 1FR0A 1LTJA 2XM0A 2ZXWC 2EPNA 4OVNF 3C8VA 2FYUJ 2A45G 2YMYA 1GK6A 5DQZA 1RKCA 2WT7B 1QLEC 3CX5I 1OKKA 4JTAB 5F5HA 4BJ5C 4C7RA 2XLDA 3V2QA 5E79H 4G7OF 1SQQJ 2HMZA 4CSAA 1ZZPA 4C3DA 4U5BE 2GFHA 3RQFA 2B87B 4RDAA 3HUSA 2Z15A 1YAUO 4W8KA 2YL0A 1SQBD 2KLUA 4BJTA 3RK2B 2VASA 3NMKA 4YT5A 5T1DB 3ITKA 2AEFA 3KYJA 2TMVP 4HB1A 1SFCC 4J30B 2I8DA 1GU5A 2AU5A 5KLVK 5AVVB 2R5BA 2Y0EA 4ZLDA 4FAPB 1HH0A 3EHMA 3HTKC 3LAYA 4I2LC 1KV4A 1I4YA 2FKWB 2P1AA 4QDLA 1OXBA 2Q9AA 4HE8D 3H1KG 1N7SC 4K35A 2FYUD 4PD4H 4HJGH 1VF5B 3L8JA 2J46A 4KT0J 1M56D 5L0HA 1SLQA 1OR2A 3EG9A 3K33A 1NH4A 1SQPK 1RY3A 2XS1A 1SQQD 3TOMA 3LLKA 2R05A 2ZVNB 3FWNA 3E1IA 3V6IA 1P84D 2LQGA 1Z63A 1YQ3C 3L73J 1IC2A 1ZW3A 3S0XA 4AX2A 1T01A 1Q0KA 3C7JA 2W83C 2NSGA 2WSEJ 1GDTA 3UIAA 5CCHC 3LW5H 1VLTA 4CBEA 1LM3B 2HV6A 5KYXA 2QNLA 1HBWA 4JZAA 4CDVA 1KILA 3A0HH 4UDVA 1LP1A 1FAPB 2AXCA 1I4ZA 1H88A 3C1LA 3SFEC 3H1KE 1L3PA 3JT1A 2HJ3A 3AOUA 2HFED 3ABKC 1L4AB 5H2FE 1NVOA 3JYHA 3I4UA 1OCOC 1I5NA 1SQBK 1CGOA 4MVMA 3TF5A 2KQ9A 1CI6B 3U9JA 3D6ZA 3MIWA 2HV7A 2PX0A 3L73D 4XEKA 1SR2A 5DJUB 1URQC 1VYIA 2PNOA 1NAFA 5AW7B 2V4HA 1QEXA 5E2QA 5AW4B 2XNDH 3U8VA 2R7SA 5CCGA 3ATPA 2ZYGA 3NTNA 3M9HA 4DJGA 3FOPA 1OVVA 4I3MA 5KYWB 3HTKB 4DVYP 3NYMA 3N0TA 3C8GD 5KAIH 3NG1A 1KYOD 1A41A 2J0XA 2K9YA 1FFHA 1VQMP 2A6HF 2WZLA 3K6BA 3JSEO 2ZXOA 1N7SB 3M79A 2IM8A 1DH3A 1W2BO 1RHZB 4I7ZC 3VRCA 1USEA 3ABMC 1B68A 4OIPF 1ZW0A 1XZPA 3FXHA 2XXAB 4N78D 3Q6MA 4YT4A 3GHGA 1MNDA 4BPMA 2X51A 1G2CB 3ZC4A 5L0JA 4PJ0H 4H4KC 1T3JA 1YZCA 1Q0GA 1JY2P 1NTZK 2KK7A 2GWWA 1YITP 1ZU4A 1SQVJ 4DBRA 2P2UA 4ZKUA 5COMA 1BGYG 2HS5A 1QGKB 1A7EA 3HE5B 2QUPA 2QA4P 4AE4A 1FZCC 2NPUA 3CSKA 3DJNB 2LR2A 1MMDA 1O87A 4MVRA 3T6JA 1FC2C 2KOGA 1IO4A 4WVZA 1TU3F 1VB5A 4E18A 3UGPA 1C03A 1NO4A 3L75J 3HNLA 4MNDA 1FFTC 4LDRA 5TISE 1IJDB 2XV5A 3G3ZA 1XWJA 4JJGA 1ZV8A 1EC5A 2GDCA 2GA1A 2HFIA 2K9JA 2HPCA 4CS9C 4NQFA 2GAQA 1YYCA 1DD3A 1Q81Q 1QSPA 3EWKA 5AGFA 3TD7A 1HTLC 3C8ZA 3T97B 5KJ7C 2P61A 3HNIA 4QMAA 2YQYA 2HMQA 4AK9A 3OAKA 2A06G 3RH3A 3U1CA 1JEKA 2P10A 1SQVD 2LFDA 1YIJP 1SZIA 1WMKA 2WVNA 1H6GA 2KB7P 5KLIB 2R25A 1VMAA 4KHXA 5K0IA 4W8PA 3FVYA 4U3FG 1EDJA 2YLGA 2E76B 4P6IC 4E17A 3WUVA 4K0DA 3L75D 2E43A 3EQLF 3VP9A 2H8AA 2NSFA 2G62A 1KNYA 1NU1G 2LXBA 1UIXA 3BCCG 3F47A 5JRAA 2VCAA 3VN0A 1QLED 1SQPG 3WAQA 1Q7YQ 4I7ZB 5HV9A 3E7KA 3E1RA 1X9VA 1T5OA 4NCQA 2WZFA 4MTGA 3HE4A 3NMDA 4JQ0D 2Y3HA 3S29A 1RQVA 2PBEA 3N24A 1IFNA 4F4BA 3V5ZA 2Y3DA 3WUUA 1QQ3A 1CPQA 2WSCJ 3FXEA 3GF7A 2Y9YA 4LLEA 3CX5H 4Z9HA 3QMKA 4RD9A 1SFCD 4XWJA 1YYXA 1AVOB 1J1DB 4R4LA 1PGJA 2WB7A 3PJSK 4JPZB 1H9TA 3G71P 4K1OA 1BE3G 2FAPB 1S4XA 2ASRA 2WQYC 1EA8A 3AE2C 5FZTA 1M90Q 1NU1E 3BCCE 3BVHA 1ORYA 1N7SD 1G1JA 4JEBA 3W67A 4CDAA 4Q4ZF 3CXHE 3H1KJ 3W4YA 1XTCC 1ORJA 3VMYA 2QJKC 1VLSA 3CZ6A 4O7GA 5AW6B 3FXDA 2L81A 1KC8Q 4O6MA 1P84I 1EI7A 5AVZB 5JVEA 1DEBA 1D1BA 2WZGA 1SQXE 3U0CA 4CS7A 2GA0A 1V54C 2OYHC 4IARA 1DIPA 5GTHH 5CCHD 2OJQA 1LJ2A 2QY9A 3MYIA 1Z5ZA 2QJPC 3JZ0A 1MKMA 1BE3E 2M0BA 3I5QA 2O1JA 1IZNB 2C9LY 2OARA 4PD4I 1F1MA 2WSSH 1TFOB 1IFJA 4EKWA 2Y0CA 1KFNA 1S1CX 3VMAA 1LE2A 1YJGA 4E0IA 1N1CA 5APYA 1GS9A 3AGTA 4EOTA 1OIPA 2QM8A 3H1KD 4OH8B 4UB6E 4U5EE 3ASOC 3EH1A 1LT9C 3TJ5A 1IK9A 3G9RA 3KXDA 4LGDE 1DOWA 3I56P 2OTJP 1YZAA 2YIUC 3W2VA 1EDIA 4NPDA 1NG1A 1S72P 2CDQA 3DXJF 1RH5B 1CI6A 2XNXA 3JCUE 2B0HA 4E7SA 1URQD 1EXIA 4OD5A 2J9WA 2ZFCA 5E79E 1MZ9A 2FXMA 1D0XA 1LNQA 1EXJA 2C03A 3HKKA 1H7IA 1PP9E 3H1LG 2HYNA 3B71A 4P9TA 5KKZC 3HRNA 3NMIA 1Q90D 5L0IA 3HTKA 1KILB 3VYIA 4EBBA 2P58A 1KYOI 2LK4A 4YTPC 1VTMP 2RMZA 3DJUB 3MGNA 3S9OA 2WZ7A 5F5FA 3F46A 1N7SA 4GKGA 2G3KA 1Q0MA 4K7BA 5AC4A 2QJKB 3L34A 3OJAB 2V7QH 3P8CE 1C02A 5JP7A 3AEGC 1NU9C 3TOLA 3MX3A 1G2CA 2Q9CA 2GUVA 1JY2O 3H1LE 2Q4FA 4J7YA 3AE3C 3Q1MA 4H0LC 5CCHA 4MW8A 4XPYA 1RE3C 2YWAA 1T6AA 1NHLA 3QZCA 1Q2NA 3MUDC 4IAOA 4GOFA 3TYYA 3G6EP 1D0YA 2HLOA 3IFMA 2YNYA 3AECC 4YK5A 3NXSA 1WOLA 3AGUA 4ZMDA 5A6AA 2QE9A 3CCLP 3LNRA 3MD0A 1IZMA 1EZVG 2J58A 3RL0C 3W8IA 1JOGA 4EUKB 2JO1A 2WL8A 4J32B 5KJ7D 3Q6NA 5KAFE 4D6TG 3EFFK 3L74G 3T97A 3C63A 1URQA 4JF7A 1V55C 5APWA 4Q7CA 2YL7A 1L7CA 1FS0E 1GL2C 3CCQP 1T2KC 3C18A 3QW0A 3KYIA 4M63A 4AE4B 2EPMX 3AG2C 4W7ZA 3PHLA 2YKPA 2ZXPA 2OYIC 3N4XA 2BEQD 1VPCA 3RKOF 1T3UA 3IN6A 2HKVA 3D71A 5CI9A 4MVQA 3LIEA 1VQ8P 4EWCA 1HJBA 4PJJA 5KYUA 2JR8A 2J45A 1NU1J 3BCCJ 4AQRD 1VQ4P 2HUJA 2L7AA 4YT2A 4OGQC 4BEJA 4D4NA 1L0NG 4WY4C 1M2VA 3GEIA 3AEDC 3M06A 1PFIA 3JSZA 3L74E 4AL1A 1WASA 3P32A 2KC3A 1LI5A 2IXOA 2M8RA 2CGEA 1J2JB 1MV8A 2KIKA 1VK5A 4JTCB 1YJWP 2IYLD 3FWLA 1SQXJ 3PP5A 2J59M 2OJED 4IOIH 1AVOA 4WBAA 5AVTB 4NPEA 1S7ZA 1FZCA 1Z3IX 1VQKP 2O01H 2G8YA 1O5HA 1M8OB 3GLMA 1SF8A 2ZPAA 3RQGA 2W9YA 1BE3J 1MMAA 3ZTMA 2KNCA 1XZQA 3CI9A 1GK4A 2WSFH 2N9YB 1FDOA 2ZXXA 1FOSF 1QVFO 4DT0A 3NYLA 2EIKC 1L0NE 3U1AA 1NU1D 3BCCD 3C8GB 1U7JA 2GM4A 1YI2P 2R7TA 2L6HA 3CXHD 5EK0A 4N6CA 3PDMP 4CS9A 3HD7C 1L0LK 2WPVB 1WATA 3VMXA 2Y39A 3CEXA 5E3AA 2NUPA 3DKAA 4PJNA 3HE4B 2LCHA 1JPJA 4KJMA 5CBNA 1NTME 2OTLP 2R03A 5KJ7A 3EQ2A 5GTIE 2D5RB 2R7RA 1NTKK 3BATA 3KQGA 1GU4A 1A02J 3H2VA 2OYOA 3M91A 2IBZI 1E2XA 2QIWA 3A7OA 3TDKA 1SQXD 4HFKB 3W68A 3HNJA 4N6HA 4U5FE 1AV1A 1P84H 3L71E 3M9QA 3CCVP 3SWKA 3DE9A 3N7NA 1PP9J 3A9CA 2K3RA 3A2AA 1BE3D 2HODB 4DXWA 3RVYA 4K3AA 2FYZA 2EIMC 2IDBA 1HW1A 1PGOA 1FJPA 2XS8A 2ZXRA 4MTOA 2NG1A 2HSBA 1IFMA 2CYDA 2MYSA 1EDKA 2K37A 1YLMA 4OGQB 1BDDA 1DOVA 2KP8A 2A69F 5B66H 4O9BA 4UB8H 3ZTZA 4L76A 2I8BA 4JVSA 5L0GA 1J1EB 1LWUC 4EIJA 4A7PA 5AVXB 4C7OB 3H1JG 5C39A 2OQMA 1GD2E 2H7OA 4LC1A 2KZJA 3O39A 4H44C 2JDIH 4OINF 1PGPA 4DOZA 3AE4C 1OXKA 3MHVA 3H1LJ 2VCBA 1E5WA 3AEBC 1JMMA 3FDQA 3SXMA 2DW3A 1PP9D 2E75C 4KNVA 3Q3DA 1H89A 4YL1A 1JB0J 2WSEH 3A11A 4NTAA 3OW2O 3TGUG 2HG5D 1U89A 4IFFA 4XFJA 4NY3A 3LW5J 3W8HA 4XA4A 1ZYRF 1OXZA 1OZHA 1FJKA 3RQEA 1M1JC 2FFDC 1RKEA 2OKUA 3LEVA 2HZ8A 1G8XA 4L74A 2R7VA 5AW5B 2JD3A 4BWNA 3MYFA 1CGNA 2W8ZA 1UFBA 1NFOA 1KYOH 1PCXA 2JWAA 3ABVC 2UUIA 3LS1A 3P8CD 2CPSA 5D91A 3H1JE 1WTYA 1U7MA 2WITA 1CGME 3CC4P 4PK4A 2W4MA 5T3WA 3L0IA 1YTZI 2DI3A 1ZHXA 3H1LD 1D7MA 1JCCA 1BR2A 4YJWA 3KZIE 1RF1C 2YXRB 5AW2B 5GTHE 1SFCB 3TGUE 1ZN5A 2FYUK 4M3LA 3DMDA 5AW9B 1PD0A 1J8MF 4FWVA 1E86A 1JMWA 5APUA 4AUWA 2Q5UA 1MFTA 1SQQK 3LLIA 4JRZA 1LT9A 2XDJA 3RL0D 2Q00A 5DS6A 5M1BA 3BEHA 4FX5A 3A5TA 1IK7A 3L35A 2IFNA 2IZ0A 1AVYA 2Q3EA 2KYHA 4N6JA 1ZU5A 2ZJSE 2PF4E 3GG2A 3B5NC 1NFNA 2IFMA 1SVFA 2PAJA 4JJFA 5L3QA 4EBJA 3L74J 5AVQB 2IXMA 2W45A 4ZLCA 1QX8A 5AVUB 5L0CA 2XLHA 3RK3E 1UG7A 2ZD9A 1GL2D 2C0XA 1T2KD 4WWIA 2R7QA 1KD1Q 4BRYA 4JCHA 5L8RJ 4LERA 2Q3TA 1WN0A
chains in the Genus database with same CATH topology
1K04A 3GMAA 4H44C 3BRJA 1NYHA 3AE4C 2YMKA 3C8VA 2JPUA 2JP3A 5KLIC 4RKUJ 3AEBC 1VL2A 1PV3A 2E75B 3FGAD 4NQFA 3GF3A 1PIXA 2ZT9C 2L6GA 1DD3A 2E75C 3U0CA 4PV1C 3AE3C 2G8YA 3EWKA 3Q1MA 2E76C 3Q2YA 3Q3DA 1JB0J 3T97B 3GLMA 1O3UA 4H0LC 4R32A 3D6ZA 1DIPA 3RQGA 3GM3A 4XFJA 2YWAA 2D2CD 1U57A 1HF9A 2P10A 3LW5J 4OGQD 4XEKA 2QJPC 3AEAC 3JZ0A 1WMKA 1MKMA 1ZZPA 1ZOYC 3RQFA 3RQEA 4H44B 1FDOA 4R4MA 2FBWC 3AE9C 3SFDC 3RL0g 4H13D 3TULA 2FYNC 3AE7C 3O6QA 3H25A 1OW7A 2BEZF 3AECC 1S1CX 2ZT9B 3C8GB 2QJYC 3K7DA 2MKVA 1UFBA 1GMJA 4Y28J 3GM1A 4PV1B 1WOLA 2L6HA 2E76B 1VF5C 2OQQA 4H0LB 4H44D 1KMIZ 3ABVC 4XEVA 5F28E 1DD4A 1WTYA 1S5LX 1R8EA 2WPVB 4TT3H 3GM2A 3C8GD 2ZT9D 2NZ2A 3G9RA 1AJYA 1JOGA 1KNYA 1KILE 3D70A 2E75D 1UIXA 1PL5A 2YIUC 1ZRTE 2JO1A 4PV1D 2K9YA 2E76D 1YQ4C 2L6FA 4I7ZB 2O01J 1K40A 3O10A 2QIWA 1Y9BA 2KK1A 1ZMEC 4I7ZC 3D6YA 2FXPA 1EXIA 3R4YA 1VF5B 2V7QJ 3L8JA 4KT0J 3JYYA 1RQVA 2PBEA 2H88C 3U3FA 1WWPA 1V4AA 1FDIA 1KORA 3C18A 2E74C 1EXJA 1RQUA 2WSCJ 3C8GA 3GF7A 3B71A 1VF5D 4GDOA 5KKZC 1OW6A 1YQ3C 3Q5RA 3Q5SA 2IDBA 4IL6X 4R4LA 1NGMB 1QVXA 2G3AA 1Q90D 4H0LD 2H89C 2BEQD 3AE5C 2HSBA 2Q00A 2WSEJ 5M1BA 3IN6A 1OW8A 1IK7A 3D71A 2D2CB 1KTMA 2LK4A 4OGQB 4YTPC 2QSIA 3Q5PA 3MFNA 1KQGB 2WQYC 2D2CC 3AE2C 2WSFJ 4OGQC 3S9OA 2E74B 3AEFC 4H13B 1TU3F 4EBJA 4EBKA 1KQFB 4U7JA 3AE8C 1OMIA 3AEDC 4H13C 4Z1MH 3AJMA 3AE6C 3AEEC 3L8IA 4YXDC 3AE1C 4XEFA 3SFEC 1HJ0A 3RK3E 3IAOA 2JX0A 2QJKC 1K05A 1ZP0C 3AEGC 2E74D 5L8RJ 2J5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K04 A;  3BRJ A;  3AE4 C;  2JPU A;  3AEB C;  1PV3 A;  4NQF A;  2L6G A;  3U0C A;  3AE3 C;  1O3U A;  4R32 A;  3RQG A;  3GM3 A;  2YWA A;  4XEK A;  3AEA C;  3JZ0 A;  1ZZP A;  1ZOY C;  3RQF A;  3RQE A;  2FBW C;  3AE9 C;  3SFD C;  3TUL A;  3AE7 C;  1OW7 A;  3C8G B;  3AEC C;  3K7D A;  1UFB A;  3GM1 A;  1WOL A;  2L6H A;  3ABV C;  4XEV A;  5F28 E;  1WTY A;  3GM2 A;  3C8G D;  1JOG A;  1KNY A;  1YQ4 C;  2L6F A;  1K40 A;  3O10 A;  2KK1 A;  3L8J A;  3JYY A;  2PBE A;  2H88 C;  3U3F A;  1WWP A;  1V4A A;  3C18 A;  3C8G A;  3B71 A;  1OW6 A;  1YQ3 C;  1QVX A;  2G3A A;  3AE5 C;  2H89 C;  2HSB A;  2Q00 A;  1OW8 A;  1KTM A;  2LK4 A;  4YTP C;  3MFN A;  2WQY C;  3AE2 C;  3S9O A;  3AEF C;  4EBJ A;  4EBK A;  3AE8 C;  3AED C;  3AJM A;  3AE6 C;  3AEE C;  3L8I A;  4YXD C;  3AE1 C;  4XEF A;  3SFE C;  2JX0 A;  1K05 A;  1ZP0 C;  3AEG C; 
#chains in the Genus database with same CATH topology
 1K04 A;  3BRJ A;  3OEO A;  1LTA C;  4DBQ A;  1KQS O;  2JPU A;  3RK3 C;  5APS A;  2E75 B;  2QE7 H;  1FAV A;  2LD6 A;  1Z6A A;  2A0B A;  4JYC A;  4IGG A;  4ZNC A;  4WB4 A;  1HWT C;  1M1J B;  1JCD A;  4OGQ D;  3GAN A;  4Z9I A;  3F89 A;  2M3E A;  4CIP A;  4WY4 D;  1ZOY C;  4IJJ A;  4JYB A;  3SNH A;  1L0N J;  2V26 A;  3O6Q A;  2O01 N;  1AEP A;  3O55 A;  3WU2 H;  1KB9 E;  2BEZ F;  1FBM A;  3EFG A;  2E5T A;  2CPB A;  3ABL C;  1BCC G;  3PRJ A;  3JCU Q;  1RCP A;  2OQQ A;  3H1H G;  3TK1 A;  3U9M A;  3L74 D;  1LIH A;  1PZQ A;  5KYY B;  1HGV A;  1WRG A;  1CPR A;  1LTJ C;  1NTM J;  1VQ5 P;  1URQ B;  1Q86 Q;  4IAQ A;  1BGY E;  1SP4 A;  5DS4 A;  1BZ4 A;  1AJY A;  2XLW A;  4G0H A;  3OA7 A;  5APQ A;  4YL3 A;  5KLV G;  2YZS A;  2ZXE B;  2OOC A;  3A0B E;  4MVS A;  1ZME C;  2FXP A;  3HJC A;  5EGY A;  3L71 J;  3MUD A;  4U5H A;  1WWP A;  2J9B A;  1KOR A;  3V7O A;  1VQ6 P;  2VB6 A;  3C8G A;  3FOO A;  1SYQ A;  2KXP B;  3CXH I;  4Y99 C;  4KNW A;  1NBB A;  3TK0 A;  5KYU B;  3L1M A;  4XTK A;  4GIF A;  3V5Y A;  1L0N D;  3HD7 D;  5BQG A;  4O79 A;  2AEM A;  2MHR A;  2H89 C;  3AE5 C;  1BCC E;  4B6I A;  1M2V B;  1XTG B;  4JTD B;  2XLM A;  4ER9 A;  2KYV A;  2OEV A;  1FE6 A;  2Z4E A;  4MVO A;  2A06 E;  3WOD F;  1NTM D;  1BBH A;  4H13 C;  2BC5 A;  1YA9 A;  3AEE C;  1NOH A;  3PH0 A;  1GL2 A;  2XZR A;  5B5E E;  2KS1 A;  1GQA A;  1FZC B;  2J5U A;  4U3F E;  4GT1 A;  2KLV A;  3WMM 0;  2LIG A;  3S27 A;  1NYH A;  2HOD A;  2PP6 A;  3L71 D;  3QVZ A;  2IYP A;  3L72 G;  2KSF A;  5L0D A;  3FGA D;  5TJ5 E;  2OYI A;  2Y9Z A;  2A68 F;  2KNC B;  3PHF 2;  1IW7 F;  4NC3 A;  1EQ7 A;  4PV1 C;  3Q2Y A;  4PFO A;  2F22 A;  1SQP E;  3GM3 A;  4I1M A;  1L2P A;  1FZE A;  3MLG A;  1SQB G;  3CQZ A;  2I1J A;  3QH9 A;  1H0T A;  2YO2 A;  3SSU A;  2ZAE B;  3ZSU A;  1RF0 C;  1TWC A;  1SQV K;  5HSW A;  3SFD C;  1VQ7 P;  4YN0 B;  3IQ6 A;  2FYN C;  3AE7 C;  5AW1 B;  2FY8 A;  1PGQ A;  1CZQ A;  2NUP B;  3AQB A;  1Q82 Q;  1VQP P;  4C7O A;  1QKR A;  4Y28 J;  3GM1 A;  4OWF A;  3H1J J;  5H2F H;  4H44 D;  3QW1 A;  4C7N B;  4DCK A;  5APV A;  4XEV A;  1DD4 A;  3AG3 C;  5JSL A;  3ZDL A;  2OG2 A;  4N06 A;  3FX0 A;  1JR8 A;  4MQ9 F;  2FYU G;  1T6I A;  1ZLL A;  2XL4 A;  4RO0 A;  2E75 D;  1PL5 A;  3L72 E;  3SXK A;  1X22 A;  4QI2 A;  3CCM P;  1K40 A;  3K5B A;  4LDQ A;  4EI2 A;  3UGO A;  5BVZ A;  3TGU J;  3CPW O;  2R9R B;  3OWT A;  2LSE A;  4ANJ A;  3FMS A;  2H43 A;  1FDI A;  2E74 C;  3NMJ A;  4PFP A;  3VM6 A;  2BCC G;  1USD A;  2AXT E;  4BXL A;  1RE4 C;  4JE9 A;  3W2W A;  4WJ0 A;  3H1I G;  3HD7 A;  5CCG C;  2P7J A;  1Z23 A;  4BJ5 A;  4D4X A;  4L73 A;  3JRT A;  2LXC B;  2BAS A;  2J9V A;  1R5S A;  1NTZ G;  1BSH A;  2DYR C;  3V5B A;  3H1J D;  3Q5P A;  4DRH B;  1HGZ A;  1ZXG A;  2D2C C;  3DAF A;  3CCJ P;  2H7H A;  1DX7 A;  3AEF C;  4H13 B;  1S9K E;  4LAC B;  4ZKP A;  1NWQ A;  1M7L A;  2KZI A;  4HYT B;  2YL1 A;  3PMR A;  5CI8 A;  2N1T C;  2MJZ A;  1U0B B;  4E7Z A;  1SFC A;  1HJ0 A;  1FZG A;  4U5D E;  1IFI A;  4DZO A;  4RJT A;  3RYL A;  2JEE A;  2RD9 A;  2X0C A;  3TGU D;  2OCC C;  2YO3 A;  3CD6 P;  4HKZ H;  1FZA A;  3GHG C;  1FZF A;  2HJM A;  1X79 B;  2LP4 A;  2IYO A;  2CCY A;  4HEA J;  2O1K A;  2IX7 C;  3L73 G;  1R5I D;  3UNG C;  2BCC E;  2ZT9 C;  5AW0 B;  3SWF A;  2LFF A;  1YBK A;  5CJ4 A;  3H1I E;  1FZB A;  2JJL A;  1RKE B;  1SMY F;  1Z7Q c;  3UMK A;  3EZH A;  4JKV A;  5AC5 A;  4LLH A;  2YL3 A;  3B5N D;  1QPU A;  1NTZ E;  4PD4 E;  4XLP F;  2XLO A;  3JTL O;  4CPG A;  1R5L A;  4H54 A;  4WAB A;  1OW7 A;  5TIS H;  2Y0D A;  1MMN A;  3QTH A;  4L75 A;  2R32 A;  4JBZ A;  1H9G A;  1E85 A;  2OYH B;  4A4A A;  1S3J A;  3KKB A;  4YWQ A;  1BGY J;  3RK3 D;  2QJP B;  2L5G B;  3BRT B;  4AL0 A;  1APC A;  2R7W A;  4AYC A;  1UII A;  3H2U A;  2XL8 A;  4GOE A;  1Y9B A;  3T6G B;  2EIN C;  3A0H E;  3H6P A;  3X2Q C;  2W6J H;  1M1J A;  2FFD A;  1AFO A;  2QM7 A;  3F5H A;  1V4A A;  5AVW B;  3PLN A;  1LT9 B;  1D1C A;  5A6B D;  2Y3B A;  1ST6 A;  2L9J A;  2YIU B;  1HW2 A;  5L0F A;  1E84 A;  4W7Y A;  1K73 Q;  1BR1 A;  1OVR A;  3Q5R A;  4XPX A;  1BCC J;  2B0J A;  1KB9 D;  3NFQ A;  1NKN A;  5KYY A;  1A02 F;  3CAX A;  5D92 A;  2D2C B;  1ZR4 A;  2QSI A;  4QI0 A;  1KQG B;  3LNM B;  3ZQY A;  1T9K A;  3HLZ A;  3A3Y B;  1BGY D;  3V4W A;  3VP8 A;  2WTY A;  3TNU A;  2DB4 A;  4BRY B;  3QVY A;  1RF1 A;  1BSN A;  1OMI A;  1NZE A;  5DS5 A;  3J06 A;  3C62 A;  3K1H A;  5KKZ B;  1VDF A;  3T6B A;  2O9X A;  5E33 A;  3IAO A;  2K88 A;  4U3F J;  2IXN A;  4RBN A;  1AA0 A;  1T6Q A;  1JNM A;  5KTB A;  4GQH A;  1HE1 A;  5DVW A;  4NPF X;  3L70 G;  4G7H F;  1SQV G;  1EZV E;  5AVS B;  3ZWI A;  3VOP A;  3RK2 C;  2L6G A;  5KAI E;  3DAG A;  1SQP J;  4DJ9 A;  2BL2 A;  2POH A;  1M2O A;  2M3B A;  2P0N A;  3O6Q B;  3M0D C;  1Y47 A;  3B5N A;  4D6T E;  1X0T A;  1LE4 A;  3U2M A;  1BCC D;  4O6Y A;  4U9E A;  2AEJ A;  2N9B A;  1AUE A;  3ZVR A;  3CXH H;  1M1K Q;  4H13 D;  1ZR2 A;  3H25 A;  2O3J A;  1Q0F A;  4OIQ F;  2A06 D;  2PFD A;  1YHQ P;  2QLA A;  2QJY C;  3MBG A;  3ZQV A;  4PJ0 E;  4IRU A;  3FAJ A;  3I5C A;  1VF5 C;  4H0L B;  1YYJ A;  1KMI Z;  2VH3 A;  5JUA A;  2RH0 A;  2R7U A;  1OWA A;  2NUT A;  1E83 A;  3RF3 A;  1OCZ C;  1N7L A;  3FHD A;  4JC7 A;  3L72 J;  4U3F D;  2ZYA A;  5JS5 A;  2WWW A;  2XM4 A;  5FCL A;  4PV1 D;  1ZRT E;  1KZU B;  3L70 E;  2P7V A;  1LKX A;  2O01 J;  4BJ6 C;  4RES B;  2KK1 A;  2YKQ A;  3GWN A;  3D6Y A;  2A45 I;  1SQB J;  3CC2 P;  4WGY A;  5COF A;  5DQT A;  1SQP D;  3JYY A;  1NAY A;  2Q3I A;  3RL0 B;  5A6B A;  2KSJ A;  1LS1 A;  2XRH A;  2W90 A;  1LI7 A;  4GDO A;  4U5C E;  5CIV A;  3WU2 E;  4UB6 H;  4KBL A;  2FGY A;  2WPQ A;  4C7N A;  2R5D A;  3B0U X;  2J7P D;  1OW8 A;  3G50 A;  1G1I A;  1M57 C;  2XSE A;  1L4A C;  2R3C A;  2WMM A;  3UR3 C;  4EHP A;  1GL2 B;  3L36 A;  3JCU H;  1QL2 A;  1SS1 A;  3DE8 A;  4EDF A;  1NSG B;  2KS1 B;  4YXW H;  3L72 D;  3EJN A;  3EZI A;  1LTT C;  3AE6 C;  2HR3 A;  4OIR F;  3AE1 C;  1KU2 A;  4XEF A;  2LKM A;  2OYI B;  1GTW A;  3DM9 B;  2IPP A;  2E74 D;  1VQL P;  3H65 A;  2EIL C;  1GZL A;  2HSQ A;  2KUB A;  4Q5S F;  2OGU A;  2BCC J;  2KSE A;  2JP3 A;  2IBZ G;  5CCG D;  1VL2 A;  3DZA A;  1TFK B;  3GF3 A;  1A7V A;  1EDL A;  1H0T B;  2C0W A;  3H1I J;  4WY4 B;  1W5C E;  1O3U A;  2QTV A;  1PD1 A;  2XL6 A;  1NTZ J;  2YVK A;  2D2C D;  1MUU A;  2JKV A;  2EPL X;  1JY3 N;  256B A;  3B29 A;  3EGD A;  5A6J A;  2KJG A;  4L6R A;  1KN7 A;  4R4M A;  1Y6D A;  3AE9 C;  3RL0 g;  1JUN A;  2N1T D;  2QJY B;  3KPE A;  1FMW A;  3U3B A;  1S9K D;  3BAS A;  1N8R Q;  1GW3 A;  2Q7R A;  5BU8 B;  1HVV A;  3GW6 A;  4A2N B;  1NU1 K;  2J0W A;  3CX5 E;  3VF0 A;  4FES A;  2W6A A;  1GM5 A;  2GUS A;  3TSI A;  1LVK A;  3IHU A;  2E42 A;  3EGX A;  2ZT9 D;  2NZ2 A;  1JM0 A;  3E70 C;  3M15 A;  3G4Z A;  1PPJ G;  2IBZ E;  1TWA A;  1ZW2 A;  2YEV A;  4XPW A;  4PJL A;  4ULV A;  3GOR A;  1RJ9 B;  2BCC D;  3CWB G;  2W27 A;  3MZW B;  5APT A;  3Q7L A;  3CL3 D;  3SEO A;  1RF0 A;  3RBX A;  3I55 P;  2M4E A;  3H1I D;  1SQX K;  1ZHY A;  1MFZ A;  3HD7 B;  3U3F A;  1NTZ D;  1HUC A;  2Z5I A;  4PD4 D;  3LEO A;  1X8Y A;  2RKL A;  5EHH A;  3II6 A;  2AWC A;  3IF4 A;  3CME P;  1OW6 A;  2M5A B;  3Q5S A;  4MN4 C;  3IEE A;  3V2P A;  4IWB A;  1QVX A;  5A69 A;  2OYH A;  5CHX A;  2G3A A;  4H0L D;  2J7P A;  4XQ1 A;  2Y3G A;  3O6X A;  3NKE A;  3M1C B;  3U2L A;  3T4R A;  2ZYD A;  3T9O A;  5KAF H;  3Q7G A;  4DRJ B;  3B0V C;  2AVK A;  4HFF B;  3LUT B;  4C3B A;  5AVY B;  4EBK A;  1PPJ E;  4W80 A;  1LTS C;  3AJM A;  2Y69 C;  3CWB E;  1EKY A;  1JTH A;  3SZR A;  2Q6Q A;  3V2N A;  4EYY Q;  3S4R A;  1RE4 A;  2XLE A;  1CSB A;  4ASV A;  3TJ6 A;  2YMK A;  5KLI C;  3RW0 A;  1LGH B;  1KB9 I;  2YKZ A;  1PIX A;  2R02 A;  2CW0 F;  2ETS A;  5GPG B;  1LWU B;  2E76 C;  4I6M C;  1S5L H;  4D6T J;  4CIH A;  2UUH A;  3I5P A;  2KGO A;  3R2P A;  3IPM O;  5IY5 C;  1T6U A;  3RGU A;  2E5Y A;  2K1A A;  3CCE P;  2AWY A;  4H44 B;  3H32 A;  2FBW C;  2N1T A;  3ECS A;  3FAP B;  4CJO A;  1Z56 A;  3KH2 A;  1GMJ A;  3SYN A;  2JWD A;  4GYT A;  2Q1K A;  3KDP B;  4KI2 A;  2IXP A;  1QL1 A;  1S5L X;  2NPS C;  2WPR A;  2J8W A;  3GM2 A;  2FXO A;  3RK2 D;  3L70 J;  4IL6 H;  2FFD B;  1A7D A;  3EHN A;  1JMB A;  1Q0D A;  3AQC A;  1J1D C;  1L0L G;  4CS8 C;  3GOD A;  3RIP A;  1EZV D;  2FFH A;  3EFO A;  3R4Y A;  4MVZ A;  3RBZ A;  3ZIB A;  4IFM A;  1QVG O;  2E87 A;  3LS0 A;  4IB4 A;  1NTK G;  4D6T D;  1EQ1 A;  1N73 C;  4BG0 A;  3K1I C;  2C04 A;  1BDC A;  1QZX A;  3DWW A;  2P67 A;  4U9D A;  4ASW A;  1VQN P;  1WT6 A;  4I44 A;  1VF5 D;  1HY5 A;  2EPK X;  3NRH A;  3TQO A;  3MP7 B;  3VAY A;  4IL6 X;  4MVU A;  4LLC A;  3TNU B;  1RE3 A;  3KYQ A;  1H8A A;  5JT4 A;  1RF1 B;  4N4W A;  2QVA A;  5GTI H;  2IZ1 A;  1OCR C;  1J8Y F;  1D1A A;  2D4U A;  4OD4 A;  2YKO A;  5AVR B;  1CW5 A;  4CSA C;  4U7J A;  4E0H A;  1MQV A;  1ZRT D;  1T8Z A;  3AG4 C;  4JEA A;  3L70 D;  3NKD A;  3G4X A;  3CC7 P;  1L0L E;  1G5Z A;  3HUS C;  4YXD C;  1RXQ A;  3KL4 A;  2WPS A;  4JIO A;  4X0R A;  3USS A;  2JX0 A;  3S84 A;  1W2W A;  1NTK E;  3JSV C;  1G4U S;  3H1H E;  2Q9B A;  3OA1 A;  3S90 A;  4RKU J;  3B5N B;  1MMG A;  1R4T A;  2R7O A;  2A45 H;  3HNK A;  3SXY A;  3V5X A;  2UWJ E;  3EH2 A;  5CMZ A;  4R32 A;  1M57 D;  1NLX A;  1L4A D;  2J9U A;  3O8Z A;  1FMV A;  5KLV E;  3NDB B;  1TR2 A;  4C3E A;  1HF9 A;  4HH2 A;  3ZG1 A;  2EIJ C;  3M4B A;  4LDK A;  4BEM J;  4YL0 A;  4JCZ A;  1TKN A;  2WT7 A;  5TJH A;  3RK3 B;  2NUT B;  1BR4 A;  4G7Z F;  2WSC H;  2A0U A;  2PFX A;  5BQH A;  4ONS A;  2B87 A;  3UMH A;  5A6K A;  2NPS B;  3B8E B;  5F28 E;  5BQI A;  1JAF A;  2OU6 A;  1R8E A;  2WVQ A;  1TWG A;  1SQX G;  3LID A;  2IOQ A;  4KC9 A;  2B9B A;  3GEE A;  2B88 A;  1KIL E;  4WY4 A;  2QG4 A;  4XLN F;  3M0D A;  1KIL C;  4O6N A;  1N73 B;  4Z9J A;  1JOC A;  1A0B A;  1JY3 P;  3CCR P;  2CNW D;  1LTG C;  1LTJ B;  3WG7 C;  4ULW A;  2I1K A;  3S1K A;  1TQG A;  2H7B A;  3JC2 2;  1ZHT A;  2KI7 B;  1IFP A;  2KNH A;  3L4F A;  1V74 B;  2QEX P;  4JUR I;  1L0N K;  2ICW G;  3CX5 D;  4P9F A;  1SQQ G;  3MFN A;  4BJ6 A;  2AP3 A;  4YPC A;  1SQB E;  1VQO P;  1KFM A;  3KZI H;  3HUS B;  1RJ9 A;  3CWB J;  3P8M C;  2IBZ D;  1OFC X;  4Y99 B;  4Z1M H;  1MNE A;  1NTM K;  3VYW A;  5KYN A;  4NTF A;  2R7X A;  4XE5 B;  1NJI Q;  1K05 A;  1ZP0 C;  2OTK E;  1PP9 G;  3GEH A;  4MW3 A;  1OVU A;  3ASN C;  3GMA A;  2L91 A;  5B3S C;  5DLJ A;  2PGD A;  3P7K A;  2Q7C A;  3LJB A;  5COG A;  1PV3 A;  3WHN A;  4GOD A;  5BU5 A;  2M5A A;  5B1A C;  1RMV A;  1N86 A;  4TLF A;  1YDI A;  1JRA A;  1BDJ B;  3LES A;  2C9N Y;  3PTZ A;  3KPH A;  3KHU A;  3EGD B;  4B86 A;  2FYU E;  1L4A A;  4U5G A;  4EIY A;  1S2E A;  2W6B A;  1YVI A;  2SPZ A;  1U57 A;  4I1L A;  1U6H A;  3EG9 B;  1SQQ E;  3V4Q A;  1M56 C;  3K66 A;  2R3S A;  1P84 E;  2BE5 F;  2YLD A;  4J7T A;  2B89 A;  3CLQ A;  2A1D D;  3EGX B;  1PPJ D;  3K7D A;  4PV1 B;  1YJ9 P;  1K8A Q;  1GW4 A;  5AW3 B;  2CK3 H;  3CWB D;  1FNT c;  4PJM A;  2W4B A;  4TT3 H;  1VQ9 P;  1HMO A;  5E3C A;  1ZVZ A;  5CJ0 A;  2WVR A;  3POV A;  2DYS C;  5KYX B;  3VTP C;  2YRF A;  2ITA A;  1GGQ A;  2E76 D;  5KYW A;  2FYN B;  2VRS A;  1LWU A;  5B1B C;  1LP1 B;  2PRR A;  5B66 E;  3M0A A;  4C46 A;  3IQT A;  4UB8 E;  1ZHW A;  3G4S P;  1D0Z A;  3AG1 C;  4OIO F;  1OR3 A;  2V7Q J;  1LS4 A;  1YA7 O;  2CNW A;  1LTB C;  3B4S A;  5DJT B;  3ZDM A;  1KB9 H;  2I15 A;  3JRM O;  2YXQ B;  1YJN P;  2Q9I A;  4IFD K;  2KW3 C;  2PX3 A;  3SP1 A;  2XXA A;  5APX A;  2R44 A;  2VCC A;  3US6 A;  3L73 E;  1TWH A;  2NPS D;  2P6V A;  5L3V A;  3C9I A;  4MS2 A;  3M9B A;  3SXZ A;  3UMI A;  3A0B H;  1EZV I;  1JTH B;  2E74 B;  3HE5 A;  3U8P A;  1L0L J;  3V2R A;  1KQF B;  3X1O A;  1LTI C;  3U59 A;  1OX3 A;  5BUO A;  1LT1 A;  1OQC A;  1NTK J;  3U5S A;  1HE9 A;  3MTU E;  3H1H J;  1OCC C;  1NU7 D;  3VMZ A;  1KYO E;  1N2D C;  1FOS E;  3R7C A;  1YAR O;  5T3T A;  4WGZ A;  1FDM A;  5B3I A;  2YHS A;  2XKM A;  5KLV J;  3H32 B;  2N1T B;  2QRX A;  1VYK A;  2OEX A;  3WUT A;  1OKK D;  1IFD A;  3S28 A;  1KQL A;  3RFY A;  4N78 E;  2H7V C;  3AEA C;  1WGW A;  3QWO C;  1JO5 A;  3GHG B;  5CBO A;  3IR9 A;  5JLI A;  2RSE B;  4DRI B;  3DM5 A;  3TUL A;  4CJG A;  1JY2 N;  3GWL A;  5B5E H;  1JPN A;  4GEH A;  3N2Z B;  2ZT9 B;  4CDY A;  4DOJ A;  2MKV A;  2XU6 A;  1L0L D;  2RN0 A;  4I1O B;  1FTS A;  3EPV A;  3PCV A;  2YLI A;  3L37 A;  3CCS P;  1FU1 A;  3EFO B;  3SWY A;  1NTK D;  5AW8 B;  4JW1 A;  4BJ1 A;  3BRV B;  3D70 A;  3H1H D;  2H8P D;  1YQ4 C;  2L6F A;  1HMD A;  3IQC A;  4YT8 A;  1K9M Q;  3O10 A;  4MTF A;  2M64 A;  1Y8A A;  3L75 G;  3M4C A;  1S5L E;  4PAC A;  2DGJ A;  1S05 A;  2Z5H A;  2MWQ A;  5KLV D;  2H88 C;  5K5G B;  3NYJ A;  4G78 A;  1AQ5 A;  3B0P A;  3KMI A;  1RQU A;  1G4W R;  2EPO A;  2K9J B;  2HPC B;  1C17 M;  2V3C C;  4N3Y B;  3B9Q A;  1J1E C;  2XLV A;  1AQT A;  1NKZ B;  1ORS C;  1DEE G;  1NGM B;  2NPS A;  4PR9 A;  1SQV E;  1NTM G;  2WVO A;  3CMA P;  1KTM A;  1E79 H;  2A6E F;  2PP4 A;  4CS8 A;  1VOM A;  2IBF A;  2P1J A;  2WSF J;  2VC9 A;  4IL6 E;  1KIL D;  4DVZ A;  1ZHZ A;  3AE8 C;  3IQ5 A;  1LPE A;  3E9V A;  2NRG A;  1YTZ T;  3CCU P;  1W2E A;  3L71 G;  1Y4C A;  3DI5 A;  2ZVO B;  3L8I A;  1N73 A;  3RVZ A;  4CX9 A;  5EFW B;  1JY3 O;  1M6T A;  3L75 E;  3ITF A;  3K1I A;  2G3V A;  3DD7 A;  4NTB A;  2AXT H;  1FR0 A;  1LTJ A;  2XM0 A;  2ZXW C;  2EPN A;  4OVN F;  3C8V A;  2FYU J;  2A45 G;  2YMY A;  1GK6 A;  5DQZ A;  1RKC A;  2WT7 B;  1QLE C;  3CX5 I;  1OKK A;  4JTA B;  5F5H A;  4BJ5 C;  4C7R A;  2XLD A;  3V2Q A;  5E79 H;  4G7O F;  1SQQ J;  2HMZ A;  4CSA A;  1ZZP A;  4C3D A;  4U5B E;  2GFH A;  3RQF A;  2B87 B;  4RDA A;  3HUS A;  2Z15 A;  1YAU O;  4W8K A;  2YL0 A;  1SQB D;  2KLU A;  4BJT A;  3RK2 B;  2VAS A;  3NMK A;  4YT5 A;  5T1D B;  3ITK A;  2AEF A;  3KYJ A;  2TMV P;  4HB1 A;  1SFC C;  4J30 B;  2I8D A;  1GU5 A;  2AU5 A;  5KLV K;  5AVV B;  2R5B A;  2Y0E A;  4ZLD A;  4FAP B;  1HH0 A;  3EHM A;  3HTK C;  3LAY A;  4I2L C;  1KV4 A;  1I4Y A;  2FKW B;  2P1A A;  4QDL A;  1OXB A;  2Q9A A;  4HE8 D;  3H1K G;  1N7S C;  4K35 A;  2FYU D;  4PD4 H;  4HJG H;  1VF5 B;  3L8J A;  2J46 A;  4KT0 J;  1M56 D;  5L0H A;  1SLQ A;  1OR2 A;  3EG9 A;  3K33 A;  1NH4 A;  1SQP K;  1RY3 A;  2XS1 A;  1SQQ D;  3TOM A;  3LLK A;  2R05 A;  2ZVN B;  3FWN A;  3E1I A;  3V6I A;  1P84 D;  2LQG A;  1Z63 A;  1YQ3 C;  3L73 J;  1IC2 A;  1ZW3 A;  3S0X A;  4AX2 A;  1T01 A;  1Q0K A;  3C7J A;  2W83 C;  2NSG A;  2WSE J;  1GDT A;  3UIA A;  5CCH C;  3LW5 H;  1VLT A;  4CBE A;  1LM3 B;  2HV6 A;  5KYX A;  2QNL A;  1HBW A;  4JZA A;  4CDV A;  1KIL A;  3A0H H;  4UDV A;  1LP1 A;  1FAP B;  2AXC A;  1I4Z A;  1H88 A;  3C1L A;  3SFE C;  3H1K E;  1L3P A;  3JT1 A;  2HJ3 A;  3AOU A;  2HFE D;  3ABK C;  1L4A B;  5H2F E;  1NVO A;  3JYH A;  3I4U A;  1OCO C;  1I5N A;  1SQB K;  1CGO A;  4MVM A;  3TF5 A;  2KQ9 A;  1CI6 B;  3U9J A;  3D6Z A;  3MIW A;  2HV7 A;  2PX0 A;  3L73 D;  4XEK A;  1SR2 A;  5DJU B;  1URQ C;  1VYI A;  2PNO A;  1NAF A;  5AW7 B;  2V4H A;  1QEX A;  5E2Q A;  5AW4 B;  2XND H;  3U8V A;  2R7S A;  5CCG A;  3ATP A;  2ZYG A;  3NTN A;  3M9H A;  4DJG A;  3FOP A;  1OVV A;  4I3M A;  5KYW B;  3HTK B;  4DVY P;  3NYM A;  3N0T A;  3C8G D;  5KAI H;  3NG1 A;  1KYO D;  1A41 A;  2J0X A;  2K9Y A;  1FFH A;  1VQM P;  2A6H F;  2WZL A;  3K6B A;  3JSE O;  2ZXO A;  1N7S B;  3M79 A;  2IM8 A;  1DH3 A;  1W2B O;  1RHZ B;  4I7Z C;  3VRC A;  1USE A;  3ABM C;  1B68 A;  4OIP F;  1ZW0 A;  1XZP A;  3FXH A;  2XXA B;  4N78 D;  3Q6M A;  4YT4 A;  3GHG A;  1MND A;  4BPM A;  2X51 A;  1G2C B;  3ZC4 A;  5L0J A;  4PJ0 H;  4H4K C;  1T3J A;  1YZC A;  1Q0G A;  1JY2 P;  1NTZ K;  2KK7 A;  2GWW A;  1YIT P;  1ZU4 A;  1SQV J;  4DBR A;  2P2U A;  4ZKU A;  5COM A;  1BGY G;  2HS5 A;  1QGK B;  1A7E A;  3HE5 B;  2QUP A;  2QA4 P;  4AE4 A;  1FZC C;  2NPU A;  3CSK A;  3DJN B;  2LR2 A;  1MMD A;  1O87 A;  4MVR A;  3T6J A;  1FC2 C;  2KOG A;  1IO4 A;  4WVZ A;  1TU3 F;  1VB5 A;  4E18 A;  3UGP A;  1C03 A;  1NO4 A;  3L75 J;  3HNL A;  4MND A;  1FFT C;  4LDR A;  5TIS E;  1IJD B;  2XV5 A;  3G3Z A;  1XWJ A;  4JJG A;  1ZV8 A;  1EC5 A;  2GDC A;  2GA1 A;  2HFI A;  2K9J A;  2HPC A;  4CS9 C;  4NQF A;  2GAQ A;  1YYC A;  1DD3 A;  1Q81 Q;  1QSP A;  3EWK A;  5AGF A;  3TD7 A;  1HTL C;  3C8Z A;  3T97 B;  5KJ7 C;  2P61 A;  3HNI A;  4QMA A;  2YQY A;  2HMQ A;  4AK9 A;  3OAK A;  2A06 G;  3RH3 A;  3U1C A;  1JEK A;  2P10 A;  1SQV D;  2LFD A;  1YIJ P;  1SZI A;  1WMK A;  2WVN A;  1H6G A;  2KB7 P;  5KLI B;  2R25 A;  1VMA A;  4KHX A;  5K0I A;  4W8P A;  3FVY A;  4U3F G;  1EDJ A;  2YLG A;  2E76 B;  4P6I C;  4E17 A;  3WUV A;  4K0D A;  3L75 D;  2E43 A;  3EQL F;  3VP9 A;  2H8A A;  2NSF A;  2G62 A;  1KNY A;  1NU1 G;  2LXB A;  1UIX A;  3BCC G;  3F47 A;  5JRA A;  2VCA A;  3VN0 A;  1QLE D;  1SQP G;  3WAQ A;  1Q7Y Q;  4I7Z B;  5HV9 A;  3E7K A;  3E1R A;  1X9V A;  1T5O A;  4NCQ A;  2WZF A;  4MTG A;  3HE4 A;  3NMD A;  4JQ0 D;  2Y3H A;  3S29 A;  1RQV A;  2PBE A;  3N24 A;  1IFN A;  4F4B A;  3V5Z A;  2Y3D A;  3WUU A;  1QQ3 A;  1CPQ A;  2WSC J;  3FXE A;  3GF7 A;  2Y9Y A;  4LLE A;  3CX5 H;  4Z9H A;  3QMK A;  4RD9 A;  1SFC D;  4XWJ A;  1YYX A;  1AVO B;  1J1D B;  4R4L A;  1PGJ A;  2WB7 A;  3PJS K;  4JPZ B;  1H9T A;  3G71 P;  4K1O A;  1BE3 G;  2FAP B;  1S4X A;  2ASR A;  2WQY C;  1EA8 A;  3AE2 C;  5FZT A;  1M90 Q;  1NU1 E;  3BCC E;  3BVH A;  1ORY A;  1N7S D;  1G1J A;  4JEB A;  3W67 A;  4CDA A;  4Q4Z F;  3CXH E;  3H1K J;  3W4Y A;  1XTC C;  1ORJ A;  3VMY A;  2QJK C;  1VLS A;  3CZ6 A;  4O7G A;  5AW6 B;  3FXD A;  2L81 A;  1KC8 Q;  4O6M A;  1P84 I;  1EI7 A;  5AVZ B;  5JVE A;  1DEB A;  1D1B A;  2WZG A;  1SQX E;  3U0C A;  4CS7 A;  2GA0 A;  1V54 C;  2OYH C;  4IAR A;  1DIP A;  5GTH H;  5CCH D;  2OJQ A;  1LJ2 A;  2QY9 A;  3MYI A;  1Z5Z A;  2QJP C;  3JZ0 A;  1MKM A;  1BE3 E;  2M0B A;  3I5Q A;  2O1J A;  1IZN B;  2C9L Y;  2OAR A;  4PD4 I;  1F1M A;  2WSS H;  1TFO B;  1IFJ A;  4EKW A;  2Y0C A;  1KFN A;  1S1C X;  3VMA A;  1LE2 A;  1YJG A;  4E0I A;  1N1C A;  5APY A;  1GS9 A;  3AGT A;  4EOT A;  1OIP A;  2QM8 A;  3H1K D;  4OH8 B;  4UB6 E;  4U5E E;  3ASO C;  3EH1 A;  1LT9 C;  3TJ5 A;  1IK9 A;  3G9R A;  3KXD A;  4LGD E;  1DOW A;  3I56 P;  2OTJ P;  1YZA A;  2YIU C;  3W2V A;  1EDI A;  4NPD A;  1NG1 A;  1S72 P;  2CDQ A;  3DXJ F;  1RH5 B;  1CI6 A;  2XNX A;  3JCU E;  2B0H A;  4E7S A;  1URQ D;  1EXI A;  4OD5 A;  2J9W A;  2ZFC A;  5E79 E;  1MZ9 A;  2FXM A;  1D0X A;  1LNQ A;  1EXJ A;  2C03 A;  3HKK A;  1H7I A;  1PP9 E;  3H1L G;  2HYN A;  3B71 A;  4P9T A;  5KKZ C;  3HRN A;  3NMI A;  1Q90 D;  5L0I A;  3HTK A;  1KIL B;  3VYI A;  4EBB A;  2P58 A;  1KYO I;  2LK4 A;  4YTP C;  1VTM P;  2RMZ A;  3DJU B;  3MGN A;  3S9O A;  2WZ7 A;  5F5F A;  3F46 A;  1N7S A;  4GKG A;  2G3K A;  1Q0M A;  4K7B A;  5AC4 A;  2QJK B;  3L34 A;  3OJA B;  2V7Q H;  3P8C E;  1C02 A;  5JP7 A;  3AEG C;  1NU9 C;  3TOL A;  3MX3 A;  1G2C A;  2Q9C A;  2GUV A;  1JY2 O;  3H1L E;  2Q4F A;  4J7Y A;  3AE3 C;  3Q1M A;  4H0L C;  5CCH A;  4MW8 A;  4XPY A;  1RE3 C;  2YWA A;  1T6A A;  1NHL A;  3QZC A;  1Q2N A;  3MUD C;  4IAO A;  4GOF A;  3TYY A;  3G6E P;  1D0Y A;  2HLO A;  3IFM A;  2YNY A;  3AEC C;  4YK5 A;  3NXS A;  1WOL A;  3AGU A;  4ZMD A;  5A6A A;  2QE9 A;  3CCL P;  3LNR A;  3MD0 A;  1IZM A;  1EZV G;  2J58 A;  3RL0 C;  3W8I A;  1JOG A;  4EUK B;  2JO1 A;  2WL8 A;  4J32 B;  5KJ7 D;  3Q6N A;  5KAF E;  4D6T G;  3EFF K;  3L74 G;  3T97 A;  3C63 A;  1URQ A;  4JF7 A;  1V55 C;  5APW A;  4Q7C A;  2YL7 A;  1L7C A;  1FS0 E;  1GL2 C;  3CCQ P;  1T2K C;  3C18 A;  3QW0 A;  3KYI A;  4M63 A;  4AE4 B;  2EPM X;  3AG2 C;  4W7Z A;  3PHL A;  2YKP A;  2ZXP A;  2OYI C;  3N4X A;  2BEQ D;  1VPC A;  3RKO F;  1T3U A;  3IN6 A;  2HKV A;  3D71 A;  5CI9 A;  4MVQ A;  3LIE A;  1VQ8 P;  4EWC A;  1HJB A;  4PJJ A;  5KYU A;  2JR8 A;  2J45 A;  1NU1 J;  3BCC J;  4AQR D;  1VQ4 P;  2HUJ A;  2L7A A;  4YT2 A;  4OGQ C;  4BEJ A;  4D4N A;  1L0N G;  4WY4 C;  1M2V A;  3GEI A;  3AED C;  3M06 A;  1PFI A;  3JSZ A;  3L74 E;  4AL1 A;  1WAS A;  3P32 A;  2KC3 A;  1LI5 A;  2IXO A;  2M8R A;  2CGE A;  1J2J B;  1MV8 A;  2KIK A;  1VK5 A;  4JTC B;  1YJW P;  2IYL D;  3FWL A;  1SQX J;  3PP5 A;  2J59 M;  2OJE D;  4IOI H;  1AVO A;  4WBA A;  5AVT B;  4NPE A;  1S7Z A;  1FZC A;  1Z3I X;  1VQK P;  2O01 H;  2G8Y A;  1O5H A;  1M8O B;  3GLM A;  1SF8 A;  2ZPA A;  3RQG A;  2W9Y A;  1BE3 J;  1MMA A;  3ZTM A;  2KNC A;  1XZQ A;  3CI9 A;  1GK4 A;  2WSF H;  2N9Y B;  1FDO A;  2ZXX A;  1FOS F;  1QVF O;  4DT0 A;  3NYL A;  2EIK C;  1L0N E;  3U1A A;  1NU1 D;  3BCC D;  3C8G B;  1U7J A;  2GM4 A;  1YI2 P;  2R7T A;  2L6H A;  3CXH D;  5EK0 A;  4N6C A;  3PDM P;  4CS9 A;  3HD7 C;  1L0L K;  2WPV B;  1WAT A;  3VMX A;  2Y39 A;  3CEX A;  5E3A A;  2NUP A;  3DKA A;  4PJN A;  3HE4 B;  2LCH A;  1JPJ A;  4KJM A;  5CBN A;  1NTM E;  2OTL P;  2R03 A;  5KJ7 A;  3EQ2 A;  5GTI E;  2D5R B;  2R7R A;  1NTK K;  3BAT A;  3KQG A;  1GU4 A;  1A02 J;  3H2V A;  2OYO A;  3M91 A;  2IBZ I;  1E2X A;  2QIW A;  3A7O A;  3TDK A;  1SQX D;  4HFK B;  3W68 A;  3HNJ A;  4N6H A;  4U5F E;  1AV1 A;  1P84 H;  3L71 E;  3M9Q A;  3CCV P;  3SWK A;  3DE9 A;  3N7N A;  1PP9 J;  3A9C A;  2K3R A;  3A2A A;  1BE3 D;  2HOD B;  4DXW A;  3RVY A;  4K3A A;  2FYZ A;  2EIM C;  2IDB A;  1HW1 A;  1PGO A;  1FJP A;  2XS8 A;  2ZXR A;  4MTO A;  2NG1 A;  2HSB A;  1IFM A;  2CYD A;  2MYS A;  1EDK A;  2K37 A;  1YLM A;  4OGQ B;  1BDD A;  1DOV A;  2KP8 A;  2A69 F;  5B66 H;  4O9B A;  4UB8 H;  3ZTZ A;  4L76 A;  2I8B A;  4JVS A;  5L0G A;  1J1E B;  1LWU C;  4EIJ A;  4A7P A;  5AVX B;  4C7O B;  3H1J G;  5C39 A;  2OQM A;  1GD2 E;  2H7O A;  4LC1 A;  2KZJ A;  3O39 A;  4H44 C;  2JDI H;  4OIN F;  1PGP A;  4DOZ A;  3AE4 C;  1OXK A;  3MHV A;  3H1L J;  2VCB A;  1E5W A;  3AEB C;  1JMM A;  3FDQ A;  3SXM A;  2DW3 A;  1PP9 D;  2E75 C;  4KNV A;  3Q3D A;  1H89 A;  4YL1 A;  1JB0 J;  2WSE H;  3A11 A;  4NTA A;  3OW2 O;  3TGU G;  2HG5 D;  1U89 A;  4IFF A;  4XFJ A;  4NY3 A;  3LW5 J;  3W8H A;  4XA4 A;  1ZYR F;  1OXZ A;  1OZH A;  1FJK A;  3RQE A;  1M1J C;  2FFD C;  1RKE A;  2OKU A;  3LEV A;  2HZ8 A;  1G8X A;  4L74 A;  2R7V A;  5AW5 B;  2JD3 A;  4BWN A;  3MYF A;  1CGN A;  2W8Z A;  1UFB A;  1NFO A;  1KYO H;  1PCX A;  2JWA A;  3ABV C;  2UUI A;  3LS1 A;  3P8C D;  2CPS A;  5D91 A;  3H1J E;  1WTY A;  1U7M A;  2WIT A;  1CGM E;  3CC4 P;  4PK4 A;  2W4M A;  5T3W A;  3L0I A;  1YTZ I;  2DI3 A;  1ZHX A;  3H1L D;  1D7M A;  1JCC A;  1BR2 A;  4YJW A;  3KZI E;  1RF1 C;  2YXR B;  5AW2 B;  5GTH E;  1SFC B;  3TGU E;  1ZN5 A;  2FYU K;  4M3L A;  3DMD A;  5AW9 B;  1PD0 A;  1J8M F;  4FWV A;  1E86 A;  1JMW A;  5APU A;  4AUW A;  2Q5U A;  1MFT A;  1SQQ K;  3LLI A;  4JRZ A;  1LT9 A;  2XDJ A;  3RL0 D;  2Q00 A;  5DS6 A;  5M1B A;  3BEH A;  4FX5 A;  3A5T A;  1IK7 A;  3L35 A;  2IFN A;  2IZ0 A;  1AVY A;  2Q3E A;  2KYH A;  4N6J A;  1ZU5 A;  2ZJS E;  2PF4 E;  3GG2 A;  3B5N C;  1NFN A;  2IFM A;  1SVF A;  2PAJ A;  4JJF A;  5L3Q A;  4EBJ A;  3L74 J;  5AVQ B;  2IXM A;  2W45 A;  4ZLC A;  1QX8 A;  5AVU B;  5L0C A;  2XLH A;  3RK3 E;  1UG7 A;  2ZD9 A;  1GL2 D;  2C0X A;  1T2K D;  4WWI A;  2R7Q A;  1KD1 Q;  4BRY A;  4JCH A;  5L8R J;  4LER A;  2Q3T A;  1WN0 A; 
#chains in the Genus database with same CATH homology
 1K04 A;  3GMA A;  4H44 C;  3BRJ A;  1NYH A;  3AE4 C;  2YMK A;  3C8V A;  2JPU A;  2JP3 A;  5KLI C;  4RKU J;  3AEB C;  1VL2 A;  1PV3 A;  2E75 B;  3FGA D;  4NQF A;  3GF3 A;  1PIX A;  2ZT9 C;  2L6G A;  1DD3 A;  2E75 C;  3U0C A;  4PV1 C;  3AE3 C;  2G8Y A;  3EWK A;  3Q1M A;  2E76 C;  3Q2Y A;  3Q3D A;  1JB0 J;  3T97 B;  3GLM A;  1O3U A;  4H0L C;  4R32 A;  3D6Z A;  1DIP A;  3RQG A;  3GM3 A;  4XFJ A;  2YWA A;  2D2C D;  1U57 A;  1HF9 A;  2P10 A;  3LW5 J;  4OGQ D;  4XEK A;  2QJP C;  3AEA C;  3JZ0 A;  1WMK A;  1MKM A;  1ZZP A;  1ZOY C;  3RQF A;  3RQE A;  4H44 B;  1FDO A;  4R4M A;  2FBW C;  3AE9 C;  3SFD C;  3RL0 g;  4H13 D;  3TUL A;  2FYN C;  3AE7 C;  3O6Q A;  3H25 A;  1OW7 A;  2BEZ F;  3AEC C;  1S1C X;  2ZT9 B;  3C8G B;  2QJY C;  3K7D A;  2MKV A;  1UFB A;  1GMJ A;  4Y28 J;  3GM1 A;  4PV1 B;  1WOL A;  2L6H A;  2E76 B;  1VF5 C;  2OQQ A;  4H0L B;  4H44 D;  1KMI Z;  3ABV C;  4XEV A;  5F28 E;  1DD4 A;  1WTY A;  1S5L X;  1R8E A;  2WPV B;  4TT3 H;  3GM2 A;  3C8G D;  2ZT9 D;  2NZ2 A;  3G9R A;  1AJY A;  1JOG A;  1KNY A;  1KIL E;  3D70 A;  2E75 D;  1UIX A;  1PL5 A;  2YIU C;  1ZRT E;  2JO1 A;  4PV1 D;  2K9Y A;  2E76 D;  1YQ4 C;  2L6F A;  4I7Z B;  2O01 J;  1K40 A;  3O10 A;  2QIW A;  1Y9B A;  2KK1 A;  1ZME C;  4I7Z C;  3D6Y A;  2FXP A;  1EXI A;  3R4Y A;  1VF5 B;  2V7Q J;  3L8J A;  4KT0 J;  3JYY A;  1RQV A;  2PBE A;  2H88 C;  3U3F A;  1WWP A;  1V4A A;  1FDI A;  1KOR A;  3C18 A;  2E74 C;  1EXJ A;  1RQU A;  2WSC J;  3C8G A;  3GF7 A;  3B71 A;  1VF5 D;  4GDO A;  5KKZ C;  1OW6 A;  1YQ3 C;  3Q5R A;  3Q5S A;  2IDB A;  4IL6 X;  4R4L A;  1NGM B;  1QVX A;  2G3A A;  1Q90 D;  4H0L D;  2H89 C;  2BEQ D;  3AE5 C;  2HSB A;  2Q00 A;  2WSE J;  5M1B A;  3IN6 A;  1OW8 A;  1IK7 A;  3D71 A;  2D2C B;  1KTM A;  2LK4 A;  4OGQ B;  4YTP C;  2QSI A;  3Q5P A;  3MFN A;  1KQG B;  2WQY C;  2D2C C;  3AE2 C;  2WSF J;  4OGQ C;  3S9O A;  2E74 B;  3AEF C;  4H13 B;  1TU3 F;  4EBJ A;  4EBK A;  1KQF B;  4U7J A;  3AE8 C;  1OMI A;  3AED C;  4H13 C;  4Z1M H;  3AJM A;  3AE6 C;  3AEE C;  3L8I A;  4YXD C;  3AE1 C;  4XEF A;  3SFE C;  1HJ0 A;  3RK3 E;  3IAO A;  2JX0 A;  2QJK C;  1K05 A;  1ZP0 C;  3AEG C;  2E74 D;  5L8R J;  2J5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...