1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
3B71A 1JOGA 4YXDC 2Q00A 2HSBA 3RQGA 3GM2A 1ZP0C 2L6HA 3C8GB 4XEKA 3AJMA 5F28E 3AEBC 2PBEA 3AE2C 1KTMA 1WTYA 2H89C 1ZOYC 2JX0A 1WOLA 3S9OA 3GM3A 2G3AA 4R32A 1K05A 3GM1A 4EBKA 3L8IA 1KNYA 3MFNA 3U3FA 4EBJA 1OW7A 3L8JA 3ABVC 3JZ0A 3JYYA 1OW8A 3AEGC 3C18A 2L6GA 1YQ4C 1ZZPA 3AEDC 1UFBA 2JPUA 3C8GD 3TULA 4XEVA 1WWPA 1V4AA 3SFEC 3O10A 2YWAA 1K40A 3AE6C 3AE4C 3BRJA 4NQFA 3C8GA 4YTPC 1K04A 3AE9C 3RQEA 2KK1A 3SFDC 3RQFA 3AEEC 1OW6A 1YQ3C 2L6FA 3AE3C 4XEFA 3K7DA 3AE1C 1QVXA 3U0CA 2H88C 3AEFC 3AECC 3AE7C 3AE8C 1O3UA 2WQYC 2FBWC 2LK4A 3AE5C 3AEAC 1PV3A
chains in the Genus database with same CATH superfamily
4B86A 5CJ0A 3OEOA 2Q00A 2WSSH 3C62A 5GTIH 4KC9A 3QW1A 5AW9B 5CCHD 3H1IG 3VYIA 2OYOA 3BCCG 5AW1B 3ASNC 5APXA 3NMJA 2B89A 2JEEA 1JUNA 1F1MA 4U5GA 3RK3D 3DKAA 1D7MA 2HFED 4BJ5C 3G71P 4PACA 4YL1A 3BASA 3A9CA 4LERA 4ASWA 4O79A 1YJ9P 2ZJSE 1RHZB 1SFCB 2XL6A 1KILA 1NWQA 1FZFA 2HR3A 3TOMA 2EPNA 1LWUB 2YO3A 1DOWA 3A3YB 3OW2O 3W2WA 3Q5SA 1RF1C 4XA4A 4YT2A 3JCUH 4PV1B 3UIAA 2KQ9A 1YIJP 4AE4A 2K37A 4JTCB 4MVZA 3KDPB 1I4ZA 1BR2A 5B3SC 1PCXA 3VMYA 2GDCA 1T01A 4D4NA 3NFQA 1PP9D 4PJJA 3CC2P 5BVZA 3GWLA 1SQBJ 2QTVA 4RJTA 2IYLD 2Y69C 3P8CD 1SQVG 1LTTC 4C7NA 1MMGA 3DJNB 4IARA 2Q3IA 4IB4A 1EDKA 3IAOA 1WT6A 3A7OA 2V3CC 2RMZA 4DOZA 3U2MA 1YQ3C 1D1CA 1T8ZA 2L6FA 1J1EC 2O01H 2YMKA 2AWCA 2Q7CA 5CHXA 3TJ5A 1L2PA 1T5OA 3EFGA 5A6BA 1VQ8P 3H65A 2NSGA 1GL2A 1R5LA 3KQGA 3TGUG 1R5ID 3B0PA 3H25A 4CDYA 5AC4A 1N73A 1VLSA 1QL1A 3H1KG 4U9DA 4U5CE 1QVFO 1BE3E 3LNMB 3M4CA 3RQGA 5E3CA 1QEXA 3BCCD 3Q5PA 1RF0C 2IZ0A 1VB5A 4H54A 4E17A 1IW7F 5KLVE 1FNTc 1WRGA 5KKZB 2ZAEB 3KYJA 3PHF2 1N86A 1T9KA 2W27A 1VF5C 3DZAA 3MX3A 1SR2A 2M64A 3H2UA 4U5EE 2H8PD 1U7JA 1YITP 4Q5SF 2YRFA 2D2CD 2PF4E 1VTMP 1JCCA 1DD4A 1L0NK 2FXPA 3H1JG 1B68A 5AW3B 2E76B 1JRAA 3CCJP 2J9BA 3O8ZA 1SMYF 1EI7A 4OINF 4LLHA 2OG2A 2DYSC 2WVRA 4U3FG 1OW8A 4E7ZA 1EQ1A 4JJFA 1ZZPA 3B5NB 1L0LE 1NTKK 2I8DA 2CK3H 3TULA 3TK1A 3SXKA 4ONSA 3OA7A 1S1CX 4BWNA 1FDMA 2EPLX 3L34A 3R4YA 3HJCA 2EPMX 1LP1B 5AVWB 1L7CA 1AJYA 1NTKG 1DX7A 5KJ7C 3AQCA 2LR2A 1ZRTD 3H6PA 3TNUB 1NBBA 5KYNA 1CW5A 4K0DA 5KAFH 4RDAA 3H32A 1YBKA 4Y99C 1O5HA 3R7CA 3S90A 1BGYJ 3CMEP 2Q9IA 4OIQF 2DW3A 2MYSA 1GW3A 1MNDA 2PP4A 4E0IA 2OYIB 2FYUE 3ZVRA 1E2XA 4OVNF 1OXKA 3GWNA 1JPJA 1N7SB 1GMJA 5B1AC 1YTZT 3TGUD 2QJYB 1HE1A 3H1KD 1AVOA 4OIRF 3SXZA 3H1LG 2I15A 4O6YA 1EQ7A 1VQLP 1VQKP 4LDKA 4YT5A 5DS6A 2C9NY 1IO4A 3EGDB 5KYYA 3MP7B 1BCCG 2AWYA 3CXHD 2OJQA 3V6IA 5DLJA 1GGQA 4U5BE 3KH2A 3ITFA 2XLHA 3DM5A 4CS9C 3DI5A 1LI7A 5KAIE 2Z5HA 2WVQA 4B6IA 1JTHB 5T1DB 2C9LY 3QTHA 5AVTB 3HUSA 1CGOA 3AGTA 3DJUB 4NCQA 1N8RQ 5KYUB 5GTHE 2FGYA 1FZBA 2XRHA 2IBZE 2WT7B 1WGWA 3H1JD 2JWAA 4QI2A 3E1RA 4JYBA 4U7JA 3GM3A 2GA1A 2PP6A 1UIIA 2M3EA 4F4BA 4EBKA 2QRXA 1VQNP 4GOFA 2SPZA 5CCHA 1FZCB 4U3FD 1KNYA 1MV8A 4JQ0D 4H4KC 2G3VA 1U7MA 2BASA 5AC5A 2HODB 1JB0J 3B29A 2OYHA 3CC7P 3I4UA 3NG1A 3A0BE 1NFNA 5BUOA 1TWCA 5D92A 2O01N 4IL6H 4CDVA 1FAPB 3AEDC 1AQTA 2JPUA 1USDA 2QIWA 4DOJA 2FAPB 3CCMP 1NTKD 3M1CB 3F46A 1Q82Q 1YYCA 4CS7A 4O9BA 4JCZA 3K5BA 4UDVA 4I7ZB 1M56D 2IOQA 2A06E 1X0TA 2M8RA 2IBZI 2E75B 4XLPF 4TT3H 4D6TG 2XSEA 2YKZA 1YA7O 3MIWA 3T6BA 1NSGB 3K6BA 2P67A 4L75A 3GHGC 1KC8Q 2XM0A 2WZGA 3E9VA 4I1OB 2Q3EA 1SQBE 2I1KA 5AVZB 1M2VA 3W8HA 4N6JA 4JYCA 5L0JA 3USSA 1OWAA 3AG3C 2KW3C 3HE4B 3H1LD 2J58A 4MNDA 3S29A 3G3ZA 3CEXA 1Y6DA 3MYIA 2ETSA 1BCCD 1S05A 3IEEA 4WWIA 4W7YA 2WSEH 2ZXWC 2HV7A 1OCZC 1QVXA 2P7VA 1NTMJ 1C02A 3L70G 3T4RA 1P84E 3VN0A 4CPGA 3JSVC 3L36A 5E3AA 2WQYC 3LW5J 3TQOA 2P58A 1PD0A 3TYYA 4Z9HA 2J5UA 3LS1A 4PD4E 2QLAA 1NYHA 4RBNA 5L0HA 3CWBG 1H9TA 3RL0D 4DXWA 3L1MA 2R7WA 3Q1MA 2PRRA 1OIPA 1FFHA 2P2UA 5CCGC 2EPKX 2IM8A 2H8AA 2WL8A 4XLNF 4DBQA 1NJIQ 4P9TA 2R05A 1OXBA 1MUUA 1HW1A 3M9HA 2F22A 1K05A 1HWTC 3E1IA 5GPGB 3CLQA 1LKXA 5TJ5E 2KOGA 1LS4A 5TISH 2C04A 3UGOA 4Q4ZF 3VF0A 4E18A 3L8JA 4OGQB 2R3CA 2H43A 1EDLA 2YLGA 3FOPA 3UNGC 4GODA 3KYIA 1GU4A 2WTYA 2YEVA 3SXYA 1TFOB 2L6GA 5AW0B 2OJED 1P84I 2BCCG 4PJLA 2JDIH 1LTAC 1SQQG 1Z5ZA 4IL6X 5K0IA 1FR0A 2A0BA 2A45G 4C3BA 1JPNA 3NTNA 4PD4I 4BPMA 2J0XA 2YVKA 4D6TD 3SFEC 2FFDA 2N1TD 1Q0FA 2YL7A 4ZKPA 3BVHA 2OQMA 2HMZA 1PZQA 4NQFA 1SQPJ 2EIKC 2NUTA 1Q0GA 1LTSC 3VMZA 4XPWA 4PJNA 3CI9A 4M63A 1KYOE 2AVKA 2K9JA 3M79A 1HVVA 5CI8A 1OVRA 2IX7C 3CCLP 1DIPA 3RQFA 2J7PD 3IFMA 3WUTA 4MW3A 1BGYE 1VF5D 2NPSB 1L4AB 3AG1C 1A7EA 1EZVE 3L70D 3AE3C 4L74A 2OKUA 3O6QA 2W83C 1U6HA 3K1IA 1JOCA 2O1JA 3HE5B 3QVZA 4C3DA 3CWBD 1SVFA 3LEVA 1FC2C 2HFIA 1SQXJ 3AEAC 3ZDLA 2QJKB 3HKKA 5CI9A 1CZQA 1NLXA 3EHNA 1AFOA 1KQLA 3FAPB 1SFCC 1NO4A 3BRVB 4PJMA 3HNLA 3RVYA 2XXAB 3F5HA 2O01J 5AVXB 1FOSF 1KYOI 1LWUC 1TWAA 1PP9J 2CGEA 5KJ7D 1WASA 3ZWIA 3PJSK 4MS2A 4PV1C 4QDLA 5APSA 3NYJA 1RJ9A 4JIOA 1O87A 1EZVI 2BCCD 1VQOP 3QW0A 4JE9A 1JR8A 3JZ0A 1SQQD 2DYRC 3TOLA 4ASVA 1OCRC 1URQB 1ORSC 4H44B 5B66H 3G4XA 3C8VA 2UWJE 1UFBA 3GODA 3Q7LA 4AX2A 1PIXA 1VDFA 1NU1K 4XEVA 5JLIA 4WB4A 2G3KA 1VPCA 2AEFA 3O10A 3EG9B 2I8BA 4C7OA 1T6IA 1JMWA 3AE6C 2QSIA 1Z3IX 3V5ZA 1W2BO 2KSJA 1FMWA 1U0BB 3NYMA 1V74B 1DEBA 1ORYA 4IWBA 4ULWA 2WPVB 1LE2A 1R8EA 2FYNB 2LCHA 2GA0A 2A45H 5BU8B 2ITAA 3L4FA 3BCCJ 5L0IA 2N9YB 1OMIA 1H89A 1JO5A 1KB9E 3CQZA 1LNQA 5KKZC 4XEFA 4IFMA 1HGZA 3M0AA 5KYWB 1IFDA 2VCBA 4BEJA 3ZC4A 4P6IC 4N78D 4FX5A 3A0HH 1H9GA 2NG1A 1NTME 5F5HA 2P7JA 3DWWA 2J46A 3EGXB 2LFDA 3I5CA 1G4US 1W2WA 4BJ5A 2YLDA 1FAVA 2E76C 4WY4B 2ASRA 3I5QA 4KI2A 4LGDE 2YZSA 2GUVA 2ZVNB 1BE3G 3M06A 1ZR2A 3EFOA 1WTYA 4NTFA 4OWFA 3Q2YA 1GK6A 3V2RA 1RKEA 1IFPA 3B5NC 1CGME 5KLVG 2XM4A 3KMIA 3C7JA 2P1JA 1QPUA 4BJ1A 2OGUA 1RF1A 4R32A 2XLOA 2XL4A 3M0DC 1KB9I 5AVQB 1ZV8A 2KSEA 5TJHA 3GMAA 3T97A 3CX5D 3MFNA 5H2FH 1JAFA 4XWJA 3FHDA 4DRHB 3SWYA 2FY8A 3ABLC 3MYFA 5L0CA 1TFKB 1NTZJ 2YKOA 4IFFA 5B1BC 1ZMEC 2E87A 3VMAA 5CIVA 4FAPB 1S2EA 3C8GD 4YXWH 2O3JA 5GTIE 4KJMA 5L0GA 2W45A 2P1AA 1NU1D 2OYIC 1A7VA 5AVSB 2YWAA 2W4BA 4QI0A 2KYHA 3POVA 4CSAC 1HY5A 4MVMA 2OOCA 1TQGA 1N7SC 3PH0A 4CIHA 3CX5H 3HRNA 2QJYC 3SP1A 1D1BA 1HW2A 1DOVA 1KZUB 3CCVP 4U5FE 2A68F 4TLFA 1SQPE 2N1TA 1LT1A 2YL3A 4MVUA 2R7XA 2KXPB 2XU6A 4GKGA 2NSFA 3WHNA 2W6JH 3HD7B 5CCGD 1GW4A 3S0XA 1ZU5A 2N9BA 2NUPA 3O55A 1SQVK 3HTKC 2AXTH 1SS1A 1XWJA 2XLVA 4R4LA 1OVUA 1RF0A 1LVKA 3JCUE 1ZYRF 4EOTA 2FYUG 3C8ZA 3K7DA 2KI7B 2WMMA 2AU5A 2KS1B 1G1JA 1NAYA 4U3FJ 2J7PA 2NZ2A 1GDTA 1L0NJ 2H7OA 4IRUA 4IAOA 5T3TA 4I44A 5A6JA 2JWDA 3C1LA 1SQXE 1FZCC 1JOGA 2FXOA 4IJJA 4LDRA 3VRCA 1R5SA 2ZXOA 2EINC 2QM7A 3L72G 5F28E 3IR9A 1NTKJ 3AOUA 1JY2P 1NAFA 2J59M 1Q7YQ 4EHPA 1M8OB 2K88A 3DD7A 5AVRB 3WMM0 2WSEJ 4GIFA 2L81A 1YTZI 2IBZG 3H1ID 1PP9E 3E7KA 2KNCB 4I7ZC 2QE9A 4MTFA 1OR2A 1VLTA 4EBBA 3ABVC 3TDKA 3MZWB 1BZ4A 1D1AA 2E75C 5KJ7A 1KFNA 2XS8A 4DJGA 3DAGA 4WGZA 3U8PA 2DGJA 4U9EA 2B87A 3H1LJ 3OWTA 3V5XA 3QZCA 4C7RA 1VQ7P 1G2CB 256BA 3D70A 3V5YA 4IOIH 1GK4A 1OQCA 1CI6B 3N4XA 3RL0g 4AQRD 4HE8D 3ZQVA 1XZQA 4D4XA 2ZT9C 3AE4C 4EIJA 1BDCA 1AEPA 1IJDB 4OD5A 1X79B 2WITA 1FE6A 2VCCA 2LD6A 4L76A 4LDQA 1PPJG 5KTBA 2K1AA 1RCPA 2M5AA 2KJGA 2YHSA 3BCCE 3H2VA 3GEIA 2EIMC 2FYUD 1YJGA 1LTJB 4CS9A 4MVQA 1SQVD 1SQBG 4YT4A 2ZYDA 3H1HJ 2D4UA 4PV1D 3TD7A 3B0VC 1ZVZA 5EK0A 2O1KA 3KZIE 3N0TA 1Z56A 3JCUQ 4W8PA 4CIPA 4W8KA 3P8MC 1BDJB 2YKQA 2Y9ZA 3LNRA 3ABMC 2H88C 3RBXA 2KLVA 5FCLA 3A5TA 2BEZF 4JW1A 3S84A 1EXJA 1O3UA 4UB6H 4AL1A 1LT9B 3L72D 5DVWA 2QE7H 3VP9A 1A41A 1ZLLA 1Y4CA 4OIPF 3B71A 4W80A 4RO0A 5APYA 2WVNA 4YXDC 5F5FA 2WSFJ 3U1AA 3TF5A 3LJBA 3JSEO 4J7TA 5KAFE 4OGQC 1HE9A 1OZHA 1IC2A 3C9IA 3X2QC 3EWKA 3AE2C 1G8XA 4HYTB 2AP3A 4CJOA 1NVOA 1M1JA 2E43A 5T3WA 3L73J 1SF8A 2RSEB 1C17M 4JZAA 3DE8A 4O6NA 3MGNA 2XL8A 1AUEA 3L8IA 2Y3HA 2Y3BA 3HTKB 1JEKA 2POHA 3EFFK 3B8EB 2Z5IA 1PGQA 3MLGA 3U3FA 3NMDA 3T6GB 3S4RA 3GF3A 1ZU4A 5AVUB 1QVGO 2IPPA 2KP8A 2WSCH 2M0BA 4EDFA 1XTCC 1GTWA 3GHGA 4BRYA 3U59A 1NTZE 2OEXA 2R7SA 1RQUA 2A6EF 3ITKA 1A02F 1LM3B 2OTJP 1Q0MA 3CXHH 3RFYA 2RN0A 3L75J 2NPSC 1L4AC 5DQTA 3CWBJ 1S7ZA 3GLMA 1Y9BA 4NC3A 1PPJD 1YA9A 3C8GA 3IN6A 5APTA 1T6QA 2HPCA 1U89A 1ORJA 2HKVA 1K04A 3AE9C 2E76D 1A0BA 3OA1A 3A0BH 3ZSUA 1KU2A 2ZYGA 1WATA 2QJKC 1QLEC 4I6MC 4H13B 1OXZA 1OR3A 3GEEA 1T6AA 3LUTB 4L73A 4JTAB 1KILB 3W4YA 2IFMA 3B5ND 1K73Q 1AV1A 2AEMA 2W6AA 4H0LB 3RK2B 4IL6E 1ZW3A 2D5RB 4BXLA 3GG2A 1J8YF 1GQAA 5AW4B 4C3EA 1Z23A 1VOMA 1BGYG 1TWGA 4LC1A 3VP8A 5CCGA 4KBLA 5L0DA 4AE4B 4LLCA 1EZVG 3IQ5A 1P84D 3II6A 3NMKA 1FDIA 4U3FE 1UG7A 1L0NE 4PD4D 1GD2E 1K8AQ 2L6HA 1Q86Q 2XV5A 4N4WA 3FGAD 4XEKA 1EDIA 2ZT9B 3AJMA 2R3SA 3QH9A 3UR3C 3L37A 4C7NB 1URQC 1N1CA 1I5NA 3PRJA 4U5DE 1FZGA 4H44C 3U8VA 2J45A 1DEEG 1NTKE 1HMDA 1N7SD 3WU2H 2PNOA 3K33A 4EYYQ 4IAQA 2Q5UA 1R4TA 2CYDA 2V7QH 1S5LH 4MVRA 1T6UA 1P84H 1YYXA 2BE5F 2CCYA 1H88A 1OW7A 4PD4H 5COGA 2WZLA 2J9WA 3E70C 5KYXB 2E74B 1GL2B 3AEGC 3O6XA 3CSKA 4CDAA 2FYNC 1H0TA 4CX9A 3IQCA 2E5YA 1N73B 4CS8C 3JT1A 4N6CA 3EQLF 4BG0A 3NDBB 2Y9YA 2Y0DA 1V4AA 3EPVA 3T6JA 3H1LE 1RE4C 3CCRP 3VAYA 1LTBC 5AVVB 3NKEA 2RKLA 1SQQK 2JKVA 1V54C 4UB8H 1YI2P 1OKKD 1Z63A 2QVAA 5CJ4A 3D6ZA 4ULVA 2BL2A 5DJTB 2UUHA 1LIHA 3S28A 3SSUA 4JBZA 3L74J 2KK1A 2Q9BA 4Y28J 1IFIA 1M57C 3LAYA 2XZRA 2KIKA 4EKWA 2NPUA 2C0WA 1XZPA 1BGYD 5D91A 3CPWO 4I2LC 1NG1A 4IGGA 1J2JB 1RQVA 5L8RJ 4WY4C 1KQGB 5AW7B 3LIDA 2Y3GA 1JY2O 3HNKA 1VQ5P 5B5EH 1RMVA 5E2QA 2KK7A 1IFNA 2Z15A 1AA0A 1SFCA 4WVZA 1OX3A 2KNHA 3B9QA 2OEVA 3CCUP 4YL3A 3H1HE 1Z7Qc 4HFFB 1X22A 1LWUA 2QJPB 1YJWP 3HLZA 1S9KE 1Y47A 5COMA 2Y39A 1NZEA 2R9RB 1KFMA 2E75D 5APWA 1FZEA 3G6EP 2XLMA 5BU5A 4MVSA 3SXMA 2KZIA 3EH1A 1IK9A 2XLDA 4DJ9A 1YARO 4G0HA 2J9UA 5E79H 1M6TA 3OAKA 1VL2A 3FWNA 3VM6A 4WBAA 2H7HA 3H32B 1Q2NA 1NTMG 1YYJA 1NU1J 4ER9A 1KILE 3CZ6A 3IQTA 2EIJC 1FOSE 1Z6AA 1NHLA 1M90Q 4GDOA 2ICWG 2YIUC 2K3RA 3KPHA 2BEQD 4BEMJ 1E86A 5AW8B 1S5LX 3L73E 1LJ2A 3SNHA 5L0FA 3L71G 5KLIB 1D0ZA 1VK5A 1PGPA 1ZHXA 1AVOB 1RE3C 1LI5A 2QUPA 5KYYB 4YT8A 4JEAA 2HLOA 3CCSP 3UMKA 4J32B 2ZXEB 4Z9JA 2XNXA 2O9XA 2KGOA 5EGYA 2NRGA 3HD7C 2IXNA 2ZPAA 4XQ1A 3HUSB 2ZD9A 4O6MA 2WB7A 2JD3A 2OTLP 1NU7D 3LS0A 1FU1A 1YJNP 4XPXA 1FFTC 1E5WA 3L75E 1J8MF 3CWBE 1USEA 1S72P 1IFMA 2GFHA 3MUDC 1SQPK 3FXHA 2YXRB 1LPEA 1VQMP 3FX0A 4FESA 4OGQD 3U5SA 4ZNCA 2PGDA 2QA4P 4KNVA 2KLUA 1PL5A 3M4BA 1SQPG 1KB9D 2OYHB 2PFDA 1JY3P 3UMIA 4ZMDA 1MMNA 1CPQA 3RK3B 1H7IA 2HJ3A 4KHXA 3M9QA 3WODF 5M1BA 2C03A 3N24A 4PR9A 4I1MA 3H1IJ 2JR8A 2IXPA 4NY3A 3TJ6A 3WG7C 2HS5A 4C46A 1EA8A 2ZVOB 3KYQA 3SYNA 1J1DB 1JNMA 1HJBA 2LK4A 4YPCA 1NH4A 3B5NA 3GORA 1SQXK 5IY5C 4IFDK 1LTGC 3M0DA 3WUVA 2VC9A 1GM5A 2ZYAA 5EHHA 3X1OA 1LP1A 4GEHA 2P0NA 2WPRA 3ZTZA 1T2KC 2VCAA 1SQXG 3U2LA 2LKMA 2H89C 2NPSD 3Q7GA 1L4AD 5FZTA 3TNUA 1M2VB 4MVOA 1JY3N 3L71D 3JTLO 4ZLDA 2R7UA 3RF3A 3WAQA 1HUCA 1QX8A 1NKZB 2ZFCA 1VYIA 3BATA 3D6YA 5AVYB 2IBFA 3PCVA 2IFNA 4O7GA 2OYIA 1E84A 5KLVK 1JM0A 4CSAA 4MN4C 1N7SA 2CNWD 4WGYA 5HSWA 3A0HE 1G5ZA 5AW6B 2UUIA 3CL3D 2HG5D 3JSZA 1HMOA 1SQVJ 1W5CE 4PJ0H 1N2DC 3EGDA 1BDDA 4XPYA 2JO1A 1OCOC 1G1IA 4MTOA 4HKZH 4MTGA 2A45I 2XKMA 1LTJC 1SYQA 4GYTA 3G9RA 3U9MA 1L3PA 3MTUE 1JTHA 1EXIA 4G7OF 3L72J 4I1LA 3GF7A 1HTLC 5KYUA 5APQA 2FFHA 2Q9AA 2WPSA 2E5TA 3VYWA 1L0LK 4N78E 2WT7A 1SQPD 2XDJA 3SFDC 1C03A 3RGUA 2YIUB 1LT9C 5AW2B 3LLIA 1URQD 3TGUJ 2WSCJ 3L74E 3H1KJ 4H44D 3W67A 1OKKA 1PD1A 2R7TA 2WZFA 2KSFA 1L0LG 1FZCA 2W6BA 2CPBA 1EDJA 2D2CB 1APCA 2ZXRA 5A6AA 2VASA 2YXQB 3U0CA 1ZW0A 2HODA 2IYPA 4JVSA 3M15A 3AEFC 2YNYA 3NYLA 4GQHA 2FFDB 2Z4EA 2KUBA 5JS5A 4EWCA 2A1DD 3RIPA 2FYUK 3CX5E 1BR4A 1IK7A 2R5DA 3GM2A 1SQXD 2KB7P 1NOHA 1ZP0C 4GT1A 2NUTB 4BJ6C 2DB4A 1RH5B 3H1JJ 3L35A 2GWWA 2XLEA 3G4ZA 3NRHA 4P9FA 2KZJA 3AEBC 3UGPA 2Y0EA 3P32A 2K9JB 4NPFX 3NKDA 1KTMA 3RL0C 1CPRA 5DJUB 2BC5A 1WOLA 3J06A 3RK3E 1YVIA 2AXTE 1NU1E 3S27A 1MQVA 3PP5A 1WN0A 1BE3D 1JMBA 3NMIA 3OJAB 2RH0A 3O6QB 2ZXXA 4Z9IA 1GZLA 4ZKUA 3HE4A 1Q90D 3EQ2A 3SZRA 1M57D 3JYYA 3BRTB 1DD3A 5KLVD 3V4QA 3V2NA 1VYKA 4YL0A 2Q1KA 3K66A 4CBEA 3MBGA 4DZOA 3MD0A 4WY4D 2MJZA 1NTZK 4HJGH 3CX5I 4PFOA 5APUA 2YLIA 2AEJA 1KD1Q 4H13C 3VOPA 1K40A 1KILC 2HJMA 2V7QJ 2QY9A 2R02A 1T3JA 4H0LC 3RK2C 1NTZG 3T9OA 3W8IA 3V2PA 2XNDH 2N1TC 3P8CE 3PDMP 4YTPC 2JP3A 1NU9C 5KYXA 3QWOC 2Q4FA 4EUKB 5CBNA 2L7AA 3CMAP 4K3AA 1L0LD 1RJ9B 3CAXA 4PFPA 5B3IA 1BCCJ 4LACB 1WMKA 3DMDA 1JY2N 1OFCX 1SP4A 1HGVA 1M7LA 2R44A 4N3YB 1LGHB 3EZHA 3I5PA 2VH3A 3US6A 1MKMA 1VQPP 3FXEA 5BQIA 4K1OA 1QQ3A 2QM8A 4J7YA 4JF7A 3ASOC 3FVYA 4JC7A 1SQBK 2LSEA 2A06G 3H1IE 1SFCD 3V4WA 3NXSA 4C7OB 4WABA 1FDOA 2HMQA 1SZIA 4QMAA 3HD7D 1ZHYA 4HFKB 3ZQYA 2PBEA 2E74C 1GL2C 1L0NG 2WPQA 1E85A 4YK5A 1ZOYC 2JX0A 1N73C 1KORA 3KZIH 4JPZB 3S9OA 3R2PA 3DM9B 5DQZA 4ZLCA 5DS4A 2IXOA 2L5GB 4A7PA 1G4WR 1RKCA 5JSLA 2FKWB 1FJPA 2XS1A 2YMYA 3VMXA 1MNEA 4W7ZA 5JP7A 2RD9A 1NGMB 2Q3TA 2NPSA 1L4AA 4G7HF 4EI2A 4EIYA 3CCQP 4K35A 4UB6E 1IFJA 2YKPA 1YZCA 1OVVA 2IBZD 4D6TJ 1K9MQ 2OQQA 3HE5A 1YZAA 4HEAJ 1PFIA 2K9YA 5COFA 3U3BA 1NTZD 5L3QA 2J8WA 3N7NA 3DXJF 4JURI 3A11A 2Q6QA 2VB6A 1SQVE 2Q9CA 2CNWA 3TK0A 1JY3O 2H7VC 3DE9A 2HSQA 1MFTA 1ZR4A 5APVA 4NTBA 3EFOB 1ZRTE 3SWFA 3ATPA 1XTGB 5KAIH 3FAJA 2W9YA 4LLEA 1RKEB 3FDQA 4YJWA 3RL0B 3VTPC 3D71A 5GTHH 1RF1B 3L72E 2B88A 2XXAA 2QJPC 1VQ9P 2OARA 5JT4A 3L70J 3AEEC 3JC22 4XFJA 3T97B 2EILC 1T2KD 2L91A 1H6GA 5CBOA 4DVZA 5L3VA 2G8YA 1FJKA 3K1HA 2HZ8A 3TGUE 2E42A 1OCCC 2A06D 3H1KE 3PLNA 3F47A 3P7KA 2JJLA 3SWKA 2LXCB 2R7QA 1TR2A 2M3BA 3AECC 1URQA 2GAQA 4K7BA 4PK4A 1YAUO 2HYNA 3CXHE 2X51A 5EFWB 1Y8AA 1QGKB 3AE5C 1SQBD 1HF9A 2V26A 2PX3A 3QMKA 2W8ZA 3LIEA 3LEOA 4G7ZF 3BEHA 3H1HG 1L0ND 4G78A 1J1EB 3CD6P 5KLIC 5DS5A 2ZXPA 1RXQA 3EG9A 1E83A 2MKVA 1M1JC 4Z1MH 2N1TB 5JRAA 3ZIBA 2DI3A 4FWVA 2IDBA 3H1JE 1Q81Q 1ZW2A 3IPMO 2G62A 3ZTMA 1ZHZA 4U5HA 3UMHA 1HBWA 2NUPB 2XLWA 2BCCJ 2Q7RA 4CS8A 1BSHA 2TMVP 1JMMA 2G3AA 3GANA 1SQQJ 3GM1A 1EC5A 1BSNA 2IZ1A 3U9JA 3Q6NA 3HUSC 4CJGA 1RE4A 2HUJA 5E33A 1PPJE 4EBJA 5JVEA 2R7RA 2KYVA 1TWHA 1I4YA 1VF5B 4HH2A 3EJNA 3L73G 3CXHI 1D0XA 4BJTA 4XTKA 5CCHC 2PFXA 5KYWA 4DT0A 1KQFB 2B9BA 1KMIZ 2LFFA 4A4AA 1M1KQ 2P10A 3V5BA 2YO2A 2FYZA 3G4SP 2OYHC 1QL2A 2YL0A 3EGXA 3RK3C 4JJGA 3IF4A 3WU2E 3KPEA 4WY4A 1ZN5A 1HH0A 1S5LE 1RY3A 3I56P 1S4XA 3AG2C 1J1DC 1Q0KA 3PMRA 3L75G 4R4MA 4WJ0A 4DVYP 1BBHA 4I3MA 3GEHA 1YDIA 4RD9A 1BCCE 3G50A 3L71J 1ZXGA 1GS9A 2B87B 3B4SA 2GM4A 1TKNA 4Y99B 3QVYA 3AE7C 3AQBA 3H1HD 5BQHA 2J0WA 2GUSA 1KYOD 2FBWC 1VMAA 1CSBA 4OD4A 5TISE 4ANJA 1S9KD 1AQ5A 3DAFA 5BQGA 3RYLA 4UB8E 3PTZA 5A6KA 1IZMA 2HSBA 2WWWA 3LLKA 1ZHWA 4KNWA 2AXCA 1EZVD 3A2AA 3W68A 4DRJB 2VRSA 4RESB 1RE3A 1V55C 2FXMA 4H13D 2LP4A 2M5AB 3S1KA 2Y3DA 3M9BA 1KILD 1QSPA 1NKNA 5HV9A 2OU6A 2PX0A 3RK2D 4H0LD 3Q3DA 3JRMO 1GU5A 3W2VA 4AYCA 1NTMK 4DBRA 3KL4A 1KYOH 1T3UA 4HB1A 5B5EE 2A0UA 3EZIA 3HD7A 1Q0DA 2WZ7A 3L73D 1YLMA 2L9JA 3Q6MA 1AVYA 4OH8B 3JRTA 3C18A 5JUAA 1H8AA 2WSFH 2KS1A 3MUDA 2ZT9D 1QZXA 4D6TE 5E79E 2QEXP 2EPOA 3FXDA 1S3JA 1KQSO 1JCDA 4MQ9F 1MZ9A 4JKVA 1W2EA 1EKYA 3BRJA 3I55P 3CC4P 2D2CC 2I1JA 1X8YA 1DH3A 1M1JB 3L75D 2OCCC 1M2OA 2X0CA 2R7VA 1SLQA 2WVOA 3FOOA 2FFDC 1ST6A 1D0YA 2LXBA 5A6BD 1U57A 2IXMA 2E74D 1GL2D 1X9VA 2A6HF 3L0IA 1FS0E 4DRIB 3V7OA 2PAJA 4GOEA 4JTDB 4AL0A 2V4HA 3L70E 1PGJA 2QG4A 2KNCA 1KV4A 4N06A 3TSIA 2P6VA 3KHUA 2YL1A 4MW8A 3L74G 1MFZA 3KXDA 3GHGB 2R32A 4BRYB 4RKUJ 2LQGA 2MHRA 1BE3J 4NTAA 5AGFA 3ABKC 2HV6A 3AE8C 3RBZA 5C39A 4JRZA 2B0HA 1PV3A 5KLVJ 2C0XA 3U1CA 1VQ4P 1BR1A 1G2CA 4J30B 4E0HA 1QKRA 1UIXA 4OIOF 3N2ZB 4M3LA 3C8GB 2J9VA 1FZAA 1MMDA 3K1IC 5B66E 3ECSA 1CI6A 2R7OA 2HPCB 1LS1A 4Q7CA 3ZDMA 1KN7A 4L6RA 1N7LA 4N6HA 4X0RA 3V2QA 4DCKA 1FBMA 3RKOF 3FWLA 1FMVA 3KKBA 1NTMD 3HNIA 2BCCE 2YQYA 2Y0CA 4XE5B 1SQQE 4NPEA 1NU1G 1L0LJ 2MWQA 1MMAA 2W4MA 1LTJA 3AG4C 3AGUA 1PGOA 2IYOA 2M4EA 1KB9H 5AW5B 2OTKE 2H7BA 1YQ4C 1VQ6P 4E7SA 5K5GB 3HNJA 3PHLA 1A7DA 1WWPA 1E79H 1HJ0A 4AUWA 1LT9A 4YN0B 3JYHA 1ZHTA 2KC3A 3ZG1A 4YWQA 4NPDA 2W90A 2QNLA 3IQ6A 3GW6A 3LW5H 1TU3F 4JEBA 3MHVA 1QLED 2R25A 4KT0J 3IHUA 1PP9G 3EHMA 1IZNB 5CMZA 3RH3A 2FYUJ 1CGNA 3RVZA 3RQEA 1YHQP 1A02J 2P61A 2A69F 1OW6A 3B0UX 3SEOA 4A2NB 1LE4A 3Q5RA 1FTSA 3L74D 3LESA 2B0JA 2R5BA 3HTKA 1H0TB 2CW0F 4BJ6A 5A69A 4PJ0E 3AE1C 2LIGA 2R03A 3F89A 1LTIC 3L71E 3RW0A 3C63A 3O39A 3CCEP 1M56C 3EH2A 2CDQA 2CPSA 3M91A 4JCHA 4AK9A 1NFOA 5H2FE 3WUUA 3FMSA
chains in the Genus database with same CATH topology
2J5UA 3B71A 1NYHA 1JOGA 1IK7A 4YXDC 1UIXA 2WSFJ 2HSBA 2Q00A 3GM2A 3RQGA 1ZP0C 3Q5PA 2L6HA 2E76C 1FDOA 3FGAD 5KLIC 3Q1MA 3C8GB 4XEKA 2ZT9B 3AJMA 1VL2A 5F28E 4OGQC 3AEBC 3EWKA 2MKVA 2PBEA 3AE2C 4Z1MH 2E74C 2O01J 1KTMA 1WTYA 2IDBA 1VF5C 1KILE 2H89C 4H13D 4H44C 3Q2YA 1ZOYC 2JX0A 1WOLA 1KORA 3S9OA 3RK3E 4GDOA 4U7JA 2WSEJ 4H0LD 3Q3DA 3GM3A 2YIUC 2D2CD 4PV1C 2G3AA 4R32A 1K05A 3GM1A 4EBKA 2BEQD 3D6YA 1DD4A 2FXPA 3L8IA 1S5LX 1KNYA 3GMAA 3MFNA 4I7ZC 2E76B 3U3FA 1HF9A 4EBJA 1OW7A 1NGMB 3L8JA 4OGQB 1Q90D 3ABVC 3JZ0A 1JB0J 3GF3A 1DD3A 3JYYA 2E75C 2E74B 1OW8A 3AEGC 3C18A 2L6GA 1VF5B 1YQ4C 4H44B 2FYNC 1ZMEC 1ZZPA 3C8VA 3AEDC 1UFBA 2OQQA 3Q5SA 2JPUA 2QIWA 3C8GD 3TULA 1PIXA 4IL6X 2ZT9D 4PV1B 3D70A 4XEVA 1WWPA 2K9YA 1S1CX 1KQFB 1V4AA 1RQUA 3R4YA 1HJ0A 1KMIZ 3SFEC 2JO1A 3O10A 2YWAA 2P10A 4I7ZB 4H13C 1K40A 3RL0g 3GLMA 2V7QJ 3AE6C 2QSIA 1AJYA 3G9RA 2ZT9C 3AE4C 1Y9BA 4H0LC 3BRJA 4NQFA 2E75B 1EXIA 1ZRTE 2D2CC 4TT3H 2QJYC 3C8GA 3GF7A 3IN6A 3D6ZA 2WPVB 1TU3F 4YTPC 1R8EA 4KT0J 2JP3A 1K04A 3AE9C 3D71A 2E76D 3RQEA 2KK1A 2QJPC 3SFDC 4OGQD 4Y28J 3IAOA 1DIPA 3RQFA 3AEEC 1U57A 4XFJA 1WMKA 1OW6A 1OMIA 3T97B 4R4MA 2E74D 1PL5A 2QJKC 2WSCJ 1YQ3C 3Q5RA 1VF5D 4H13B 4H44D 2G8YA 2L6FA 1RQVA 5L8RJ 1GMJA 4R4LA 4H0LB 1KQGB 3AE3C 2YMKA 4PV1D 2D2CB 5KKZC 1MKMA 3O6QA 4XEFA 5M1BA 3K7DA 3AE1C 1QVXA 3U0CA 2H88C 2NZ2A 4RKUJ 3AEFC 3AECC 2BEZF 3AE7C 3AE8C 1EXJA 1O3UA 2WQYC 2FBWC 3LW5J 3H25A 2LK4A 1FDIA 3AE5C 2E75D 3AEAC 1PV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  1JOG A;  4YXD C;  2Q00 A;  2HSB A;  3RQG A;  3GM2 A;  1ZP0 C;  2L6H A;  3C8G B;  4XEK A;  3AJM A;  5F28 E;  3AEB C;  2PBE A;  3AE2 C;  1KTM A;  1WTY A;  2H89 C;  1ZOY C;  2JX0 A;  1WOL A;  3S9O A;  3GM3 A;  2G3A A;  4R32 A;  1K05 A;  3GM1 A;  4EBK A;  3L8I A;  1KNY A;  3MFN A;  3U3F A;  4EBJ A;  1OW7 A;  3L8J A;  3ABV C;  3JZ0 A;  3JYY A;  1OW8 A;  3AEG C;  3C18 A;  2L6G A;  1YQ4 C;  1ZZP A;  3AED C;  1UFB A;  2JPU A;  3C8G D;  3TUL A;  4XEV A;  1WWP A;  1V4A A;  3SFE C;  3O10 A;  2YWA A;  1K40 A;  3AE6 C;  3AE4 C;  3BRJ A;  4NQF A;  3C8G A;  4YTP C;  1K04 A;  3AE9 C;  3RQE A;  2KK1 A;  3SFD C;  3RQF A;  3AEE C;  1OW6 A;  1YQ3 C;  2L6F A;  3AE3 C;  4XEF A;  3K7D A;  3AE1 C;  1QVX A;  3U0C A;  2H88 C;  3AEF C;  3AEC C;  3AE7 C;  3AE8 C;  1O3U A;  2WQY C;  2FBW C;  2LK4 A;  3AE5 C;  3AEA C;  1PV3 A; 
#chains in the Genus database with same CATH topology
 4B86 A;  5CJ0 A;  3OEO A;  2Q00 A;  2WSS H;  3C62 A;  5GTI H;  4KC9 A;  3QW1 A;  5AW9 B;  5CCH D;  3H1I G;  3VYI A;  2OYO A;  3BCC G;  5AW1 B;  3ASN C;  5APX A;  3NMJ A;  2B89 A;  2JEE A;  1JUN A;  1F1M A;  4U5G A;  3RK3 D;  3DKA A;  1D7M A;  2HFE D;  4BJ5 C;  3G71 P;  4PAC A;  4YL1 A;  3BAS A;  3A9C A;  4LER A;  4ASW A;  4O79 A;  1YJ9 P;  2ZJS E;  1RHZ B;  1SFC B;  2XL6 A;  1KIL A;  1NWQ A;  1FZF A;  2HR3 A;  3TOM A;  2EPN A;  1LWU B;  2YO3 A;  1DOW A;  3A3Y B;  3OW2 O;  3W2W A;  3Q5S A;  1RF1 C;  4XA4 A;  4YT2 A;  3JCU H;  4PV1 B;  3UIA A;  2KQ9 A;  1YIJ P;  4AE4 A;  2K37 A;  4JTC B;  4MVZ A;  3KDP B;  1I4Z A;  1BR2 A;  5B3S C;  1PCX A;  3VMY A;  2GDC A;  1T01 A;  4D4N A;  3NFQ A;  1PP9 D;  4PJJ A;  3CC2 P;  5BVZ A;  3GWL A;  1SQB J;  2QTV A;  4RJT A;  2IYL D;  2Y69 C;  3P8C D;  1SQV G;  1LTT C;  4C7N A;  1MMG A;  3DJN B;  4IAR A;  2Q3I A;  4IB4 A;  1EDK A;  3IAO A;  1WT6 A;  3A7O A;  2V3C C;  2RMZ A;  4DOZ A;  3U2M A;  1YQ3 C;  1D1C A;  1T8Z A;  2L6F A;  1J1E C;  2O01 H;  2YMK A;  2AWC A;  2Q7C A;  5CHX A;  3TJ5 A;  1L2P A;  1T5O A;  3EFG A;  5A6B A;  1VQ8 P;  3H65 A;  2NSG A;  1GL2 A;  1R5L A;  3KQG A;  3TGU G;  1R5I D;  3B0P A;  3H25 A;  4CDY A;  5AC4 A;  1N73 A;  1VLS A;  1QL1 A;  3H1K G;  4U9D A;  4U5C E;  1QVF O;  1BE3 E;  3LNM B;  3M4C A;  3RQG A;  5E3C A;  1QEX A;  3BCC D;  3Q5P A;  1RF0 C;  2IZ0 A;  1VB5 A;  4H54 A;  4E17 A;  1IW7 F;  5KLV E;  1FNT c;  1WRG A;  5KKZ B;  2ZAE B;  3KYJ A;  3PHF 2;  1N86 A;  1T9K A;  2W27 A;  1VF5 C;  3DZA A;  3MX3 A;  1SR2 A;  2M64 A;  3H2U A;  4U5E E;  2H8P D;  1U7J A;  1YIT P;  4Q5S F;  2YRF A;  2D2C D;  2PF4 E;  1VTM P;  1JCC A;  1DD4 A;  1L0N K;  2FXP A;  3H1J G;  1B68 A;  5AW3 B;  2E76 B;  1JRA A;  3CCJ P;  2J9B A;  3O8Z A;  1SMY F;  1EI7 A;  4OIN F;  4LLH A;  2OG2 A;  2DYS C;  2WVR A;  4U3F G;  1OW8 A;  4E7Z A;  1EQ1 A;  4JJF A;  1ZZP A;  3B5N B;  1L0L E;  1NTK K;  2I8D A;  2CK3 H;  3TUL A;  3TK1 A;  3SXK A;  4ONS A;  3OA7 A;  1S1C X;  4BWN A;  1FDM A;  2EPL X;  3L34 A;  3R4Y A;  3HJC A;  2EPM X;  1LP1 B;  5AVW B;  1L7C A;  1AJY A;  1NTK G;  1DX7 A;  5KJ7 C;  3AQC A;  2LR2 A;  1ZRT D;  3H6P A;  3TNU B;  1NBB A;  5KYN A;  1CW5 A;  4K0D A;  5KAF H;  4RDA A;  3H32 A;  1YBK A;  4Y99 C;  1O5H A;  3R7C A;  3S90 A;  1BGY J;  3CME P;  2Q9I A;  4OIQ F;  2DW3 A;  2MYS A;  1GW3 A;  1MND A;  2PP4 A;  4E0I A;  2OYI B;  2FYU E;  3ZVR A;  1E2X A;  4OVN F;  1OXK A;  3GWN A;  1JPJ A;  1N7S B;  1GMJ A;  5B1A C;  1YTZ T;  3TGU D;  2QJY B;  1HE1 A;  3H1K D;  1AVO A;  4OIR F;  3SXZ A;  3H1L G;  2I15 A;  4O6Y A;  1EQ7 A;  1VQL P;  1VQK P;  4LDK A;  4YT5 A;  5DS6 A;  2C9N Y;  1IO4 A;  3EGD B;  5KYY A;  3MP7 B;  1BCC G;  2AWY A;  3CXH D;  2OJQ A;  3V6I A;  5DLJ A;  1GGQ A;  4U5B E;  3KH2 A;  3ITF A;  2XLH A;  3DM5 A;  4CS9 C;  3DI5 A;  1LI7 A;  5KAI E;  2Z5H A;  2WVQ A;  4B6I A;  1JTH B;  5T1D B;  2C9L Y;  3QTH A;  5AVT B;  3HUS A;  1CGO A;  3AGT A;  3DJU B;  4NCQ A;  1N8R Q;  5KYU B;  5GTH E;  2FGY A;  1FZB A;  2XRH A;  2IBZ E;  2WT7 B;  1WGW A;  3H1J D;  2JWA A;  4QI2 A;  3E1R A;  4JYB A;  4U7J A;  3GM3 A;  2GA1 A;  2PP6 A;  1UII A;  2M3E A;  4F4B A;  4EBK A;  2QRX A;  1VQN P;  4GOF A;  2SPZ A;  5CCH A;  1FZC B;  4U3F D;  1KNY A;  1MV8 A;  4JQ0 D;  4H4K C;  2G3V A;  1U7M A;  2BAS A;  5AC5 A;  2HOD B;  1JB0 J;  3B29 A;  2OYH A;  3CC7 P;  3I4U A;  3NG1 A;  3A0B E;  1NFN A;  5BUO A;  1TWC A;  5D92 A;  2O01 N;  4IL6 H;  4CDV A;  1FAP B;  3AED C;  1AQT A;  2JPU A;  1USD A;  2QIW A;  4DOJ A;  2FAP B;  3CCM P;  1NTK D;  3M1C B;  3F46 A;  1Q82 Q;  1YYC A;  4CS7 A;  4O9B A;  4JCZ A;  3K5B A;  4UDV A;  4I7Z B;  1M56 D;  2IOQ A;  2A06 E;  1X0T A;  2M8R A;  2IBZ I;  2E75 B;  4XLP F;  4TT3 H;  4D6T G;  2XSE A;  2YKZ A;  1YA7 O;  3MIW A;  3T6B A;  1NSG B;  3K6B A;  2P67 A;  4L75 A;  3GHG C;  1KC8 Q;  2XM0 A;  2WZG A;  3E9V A;  4I1O B;  2Q3E A;  1SQB E;  2I1K A;  5AVZ B;  1M2V A;  3W8H A;  4N6J A;  4JYC A;  5L0J A;  3USS A;  1OWA A;  3AG3 C;  2KW3 C;  3HE4 B;  3H1L D;  2J58 A;  4MND A;  3S29 A;  3G3Z A;  3CEX A;  1Y6D A;  3MYI A;  2ETS A;  1BCC D;  1S05 A;  3IEE A;  4WWI A;  4W7Y A;  2WSE H;  2ZXW C;  2HV7 A;  1OCZ C;  1QVX A;  2P7V A;  1NTM J;  1C02 A;  3L70 G;  3T4R A;  1P84 E;  3VN0 A;  4CPG A;  3JSV C;  3L36 A;  5E3A A;  2WQY C;  3LW5 J;  3TQO A;  2P58 A;  1PD0 A;  3TYY A;  4Z9H A;  2J5U A;  3LS1 A;  4PD4 E;  2QLA A;  1NYH A;  4RBN A;  5L0H A;  3CWB G;  1H9T A;  3RL0 D;  4DXW A;  3L1M A;  2R7W A;  3Q1M A;  2PRR A;  1OIP A;  1FFH A;  2P2U A;  5CCG C;  2EPK X;  2IM8 A;  2H8A A;  2WL8 A;  4XLN F;  4DBQ A;  1NJI Q;  4P9T A;  2R05 A;  1OXB A;  1MUU A;  1HW1 A;  3M9H A;  2F22 A;  1K05 A;  1HWT C;  3E1I A;  5GPG B;  3CLQ A;  1LKX A;  5TJ5 E;  2KOG A;  1LS4 A;  5TIS H;  2C04 A;  3UGO A;  4Q4Z F;  3VF0 A;  4E18 A;  3L8J A;  4OGQ B;  2R3C A;  2H43 A;  1EDL A;  2YLG A;  3FOP A;  3UNG C;  4GOD A;  3KYI A;  1GU4 A;  2WTY A;  2YEV A;  3SXY A;  1TFO B;  2L6G A;  5AW0 B;  2OJE D;  1P84 I;  2BCC G;  4PJL A;  2JDI H;  1LTA C;  1SQQ G;  1Z5Z A;  4IL6 X;  5K0I A;  1FR0 A;  2A0B A;  2A45 G;  4C3B A;  1JPN A;  3NTN A;  4PD4 I;  4BPM A;  2J0X A;  2YVK A;  4D6T D;  3SFE C;  2FFD A;  2N1T D;  1Q0F A;  2YL7 A;  4ZKP A;  3BVH A;  2OQM A;  2HMZ A;  1PZQ A;  4NQF A;  1SQP J;  2EIK C;  2NUT A;  1Q0G A;  1LTS C;  3VMZ A;  4XPW A;  4PJN A;  3CI9 A;  4M63 A;  1KYO E;  2AVK A;  2K9J A;  3M79 A;  1HVV A;  5CI8 A;  1OVR A;  2IX7 C;  3CCL P;  1DIP A;  3RQF A;  2J7P D;  3IFM A;  3WUT A;  4MW3 A;  1BGY E;  1VF5 D;  2NPS B;  1L4A B;  3AG1 C;  1A7E A;  1EZV E;  3L70 D;  3AE3 C;  4L74 A;  2OKU A;  3O6Q A;  2W83 C;  1U6H A;  3K1I A;  1JOC A;  2O1J A;  3HE5 B;  3QVZ A;  4C3D A;  3CWB D;  1SVF A;  3LEV A;  1FC2 C;  2HFI A;  1SQX J;  3AEA C;  3ZDL A;  2QJK B;  3HKK A;  5CI9 A;  1CZQ A;  1NLX A;  3EHN A;  1AFO A;  1KQL A;  3FAP B;  1SFC C;  1NO4 A;  3BRV B;  4PJM A;  3HNL A;  3RVY A;  2XXA B;  3F5H A;  2O01 J;  5AVX B;  1FOS F;  1KYO I;  1LWU C;  1TWA A;  1PP9 J;  2CGE A;  5KJ7 D;  1WAS A;  3ZWI A;  3PJS K;  4MS2 A;  4PV1 C;  4QDL A;  5APS A;  3NYJ A;  1RJ9 A;  4JIO A;  1O87 A;  1EZV I;  2BCC D;  1VQO P;  3QW0 A;  4JE9 A;  1JR8 A;  3JZ0 A;  1SQQ D;  2DYR C;  3TOL A;  4ASV A;  1OCR C;  1URQ B;  1ORS C;  4H44 B;  5B66 H;  3G4X A;  3C8V A;  2UWJ E;  1UFB A;  3GOD A;  3Q7L A;  4AX2 A;  1PIX A;  1VDF A;  1NU1 K;  4XEV A;  5JLI A;  4WB4 A;  2G3K A;  1VPC A;  2AEF A;  3O10 A;  3EG9 B;  2I8B A;  4C7O A;  1T6I A;  1JMW A;  3AE6 C;  2QSI A;  1Z3I X;  3V5Z A;  1W2B O;  2KSJ A;  1FMW A;  1U0B B;  3NYM A;  1V74 B;  1DEB A;  1ORY A;  4IWB A;  4ULW A;  2WPV B;  1LE2 A;  1R8E A;  2FYN B;  2LCH A;  2GA0 A;  2A45 H;  5BU8 B;  2ITA A;  3L4F A;  3BCC J;  5L0I A;  2N9Y B;  1OMI A;  1H89 A;  1JO5 A;  1KB9 E;  3CQZ A;  1LNQ A;  5KKZ C;  4XEF A;  4IFM A;  1HGZ A;  3M0A A;  5KYW B;  1IFD A;  2VCB A;  4BEJ A;  3ZC4 A;  4P6I C;  4N78 D;  4FX5 A;  3A0H H;  1H9G A;  2NG1 A;  1NTM E;  5F5H A;  2P7J A;  3DWW A;  2J46 A;  3EGX B;  2LFD A;  3I5C A;  1G4U S;  1W2W A;  4BJ5 A;  2YLD A;  1FAV A;  2E76 C;  4WY4 B;  2ASR A;  3I5Q A;  4KI2 A;  4LGD E;  2YZS A;  2GUV A;  2ZVN B;  1BE3 G;  3M06 A;  1ZR2 A;  3EFO A;  1WTY A;  4NTF A;  4OWF A;  3Q2Y A;  1GK6 A;  3V2R A;  1RKE A;  1IFP A;  3B5N C;  1CGM E;  5KLV G;  2XM4 A;  3KMI A;  3C7J A;  2P1J A;  1QPU A;  4BJ1 A;  2OGU A;  1RF1 A;  4R32 A;  2XLO A;  2XL4 A;  3M0D C;  1KB9 I;  5AVQ B;  1ZV8 A;  2KSE A;  5TJH A;  3GMA A;  3T97 A;  3CX5 D;  3MFN A;  5H2F H;  1JAF A;  4XWJ A;  3FHD A;  4DRH B;  3SWY A;  2FY8 A;  3ABL C;  3MYF A;  5L0C A;  1TFK B;  1NTZ J;  2YKO A;  4IFF A;  5B1B C;  1ZME C;  2E87 A;  3VMA A;  5CIV A;  4FAP B;  1S2E A;  3C8G D;  4YXW H;  2O3J A;  5GTI E;  4KJM A;  5L0G A;  2W45 A;  2P1A A;  1NU1 D;  2OYI C;  1A7V A;  5AVS B;  2YWA A;  2W4B A;  4QI0 A;  2KYH A;  3POV A;  4CSA C;  1HY5 A;  4MVM A;  2OOC A;  1TQG A;  1N7S C;  3PH0 A;  4CIH A;  3CX5 H;  3HRN A;  2QJY C;  3SP1 A;  1D1B A;  1HW2 A;  1DOV A;  1KZU B;  3CCV P;  4U5F E;  2A68 F;  4TLF A;  1SQP E;  2N1T A;  1LT1 A;  2YL3 A;  4MVU A;  2R7X A;  2KXP B;  2XU6 A;  4GKG A;  2NSF A;  3WHN A;  2W6J H;  3HD7 B;  5CCG D;  1GW4 A;  3S0X A;  1ZU5 A;  2N9B A;  2NUP A;  3O55 A;  1SQV K;  3HTK C;  2AXT H;  1SS1 A;  1XWJ A;  2XLV A;  4R4L A;  1OVU A;  1RF0 A;  1LVK A;  3JCU E;  1ZYR F;  4EOT A;  2FYU G;  3C8Z A;  3K7D A;  2KI7 B;  2WMM A;  2AU5 A;  2KS1 B;  1G1J A;  1NAY A;  4U3F J;  2J7P A;  2NZ2 A;  1GDT A;  1L0N J;  2H7O A;  4IRU A;  4IAO A;  5T3T A;  4I44 A;  5A6J A;  2JWD A;  3C1L A;  1SQX E;  1FZC C;  1JOG A;  2FXO A;  4IJJ A;  4LDR A;  3VRC A;  1R5S A;  2ZXO A;  2EIN C;  2QM7 A;  3L72 G;  5F28 E;  3IR9 A;  1NTK J;  3AOU A;  1JY2 P;  1NAF A;  2J59 M;  1Q7Y Q;  4EHP A;  1M8O B;  2K88 A;  3DD7 A;  5AVR B;  3WMM 0;  2WSE J;  4GIF A;  2L81 A;  1YTZ I;  2IBZ G;  3H1I D;  1PP9 E;  3E7K A;  2KNC B;  4I7Z C;  2QE9 A;  4MTF A;  1OR2 A;  1VLT A;  4EBB A;  3ABV C;  3TDK A;  3MZW B;  1BZ4 A;  1D1A A;  2E75 C;  5KJ7 A;  1KFN A;  2XS8 A;  4DJG A;  3DAG A;  4WGZ A;  3U8P A;  2DGJ A;  4U9E A;  2B87 A;  3H1L J;  3OWT A;  3V5X A;  3QZC A;  4C7R A;  1VQ7 P;  1G2C B;  256B A;  3D70 A;  3V5Y A;  4IOI H;  1GK4 A;  1OQC A;  1CI6 B;  3N4X A;  3RL0 g;  4AQR D;  4HE8 D;  3ZQV A;  1XZQ A;  4D4X A;  2ZT9 C;  3AE4 C;  4EIJ A;  1BDC A;  1AEP A;  1IJD B;  4OD5 A;  1X79 B;  2WIT A;  1FE6 A;  2VCC A;  2LD6 A;  4L76 A;  4LDQ A;  1PPJ G;  5KTB A;  2K1A A;  1RCP A;  2M5A A;  2KJG A;  2YHS A;  3BCC E;  3H2V A;  3GEI A;  2EIM C;  2FYU D;  1YJG A;  1LTJ B;  4CS9 A;  4MVQ A;  1SQV D;  1SQB G;  4YT4 A;  2ZYD A;  3H1H J;  2D4U A;  4PV1 D;  3TD7 A;  3B0V C;  1ZVZ A;  5EK0 A;  2O1K A;  3KZI E;  3N0T A;  1Z56 A;  3JCU Q;  4W8P A;  4CIP A;  4W8K A;  3P8M C;  1BDJ B;  2YKQ A;  2Y9Z A;  3LNR A;  3ABM C;  2H88 C;  3RBX A;  2KLV A;  5FCL A;  3A5T A;  2BEZ F;  4JW1 A;  3S84 A;  1EXJ A;  1O3U A;  4UB6 H;  4AL1 A;  1LT9 B;  3L72 D;  5DVW A;  2QE7 H;  3VP9 A;  1A41 A;  1ZLL A;  1Y4C A;  4OIP F;  3B71 A;  4W80 A;  4RO0 A;  5APY A;  2WVN A;  4YXD C;  5F5F A;  2WSF J;  3U1A A;  3TF5 A;  3LJB A;  3JSE O;  4J7T A;  5KAF E;  4OGQ C;  1HE9 A;  1OZH A;  1IC2 A;  3C9I A;  3X2Q C;  3EWK A;  3AE2 C;  1G8X A;  4HYT B;  2AP3 A;  4CJO A;  1NVO A;  1M1J A;  2E43 A;  5T3W A;  3L73 J;  1SF8 A;  2RSE B;  1C17 M;  4JZA A;  3DE8 A;  4O6N A;  3MGN A;  2XL8 A;  1AUE A;  3L8I A;  2Y3H A;  2Y3B A;  3HTK B;  1JEK A;  2POH A;  3EFF K;  3B8E B;  2Z5I A;  1PGQ A;  3MLG A;  3U3F A;  3NMD A;  3T6G B;  3S4R A;  3GF3 A;  1ZU4 A;  5AVU B;  1QVG O;  2IPP A;  2KP8 A;  2WSC H;  2M0B A;  4EDF A;  1XTC C;  1GTW A;  3GHG A;  4BRY A;  3U59 A;  1NTZ E;  2OEX A;  2R7S A;  1RQU A;  2A6E F;  3ITK A;  1A02 F;  1LM3 B;  2OTJ P;  1Q0M A;  3CXH H;  3RFY A;  2RN0 A;  3L75 J;  2NPS C;  1L4A C;  5DQT A;  3CWB J;  1S7Z A;  3GLM A;  1Y9B A;  4NC3 A;  1PPJ D;  1YA9 A;  3C8G A;  3IN6 A;  5APT A;  1T6Q A;  2HPC A;  1U89 A;  1ORJ A;  2HKV A;  1K04 A;  3AE9 C;  2E76 D;  1A0B A;  3OA1 A;  3A0B H;  3ZSU A;  1KU2 A;  2ZYG A;  1WAT A;  2QJK C;  1QLE C;  4I6M C;  4H13 B;  1OXZ A;  1OR3 A;  3GEE A;  1T6A A;  3LUT B;  4L73 A;  4JTA B;  1KIL B;  3W4Y A;  2IFM A;  3B5N D;  1K73 Q;  1AV1 A;  2AEM A;  2W6A A;  4H0L B;  3RK2 B;  4IL6 E;  1ZW3 A;  2D5R B;  4BXL A;  3GG2 A;  1J8Y F;  1GQA A;  5AW4 B;  4C3E A;  1Z23 A;  1VOM A;  1BGY G;  1TWG A;  4LC1 A;  3VP8 A;  5CCG A;  4KBL A;  5L0D A;  4AE4 B;  4LLC A;  1EZV G;  3IQ5 A;  1P84 D;  3II6 A;  3NMK A;  1FDI A;  4U3F E;  1UG7 A;  1L0N E;  4PD4 D;  1GD2 E;  1K8A Q;  2L6H A;  1Q86 Q;  2XV5 A;  4N4W A;  3FGA D;  4XEK A;  1EDI A;  2ZT9 B;  3AJM A;  2R3S A;  3QH9 A;  3UR3 C;  3L37 A;  4C7N B;  1URQ C;  1N1C A;  1I5N A;  3PRJ A;  4U5D E;  1FZG A;  4H44 C;  3U8V A;  2J45 A;  1DEE G;  1NTK E;  1HMD A;  1N7S D;  3WU2 H;  2PNO A;  3K33 A;  4EYY Q;  4IAQ A;  2Q5U A;  1R4T A;  2CYD A;  2V7Q H;  1S5L H;  4MVR A;  1T6U A;  1P84 H;  1YYX A;  2BE5 F;  2CCY A;  1H88 A;  1OW7 A;  4PD4 H;  5COG A;  2WZL A;  2J9W A;  3E70 C;  5KYX B;  2E74 B;  1GL2 B;  3AEG C;  3O6X A;  3CSK A;  4CDA A;  2FYN C;  1H0T A;  4CX9 A;  3IQC A;  2E5Y A;  1N73 B;  4CS8 C;  3JT1 A;  4N6C A;  3EQL F;  4BG0 A;  3NDB B;  2Y9Y A;  2Y0D A;  1V4A A;  3EPV A;  3T6J A;  3H1L E;  1RE4 C;  3CCR P;  3VAY A;  1LTB C;  5AVV B;  3NKE A;  2RKL A;  1SQQ K;  2JKV A;  1V54 C;  4UB8 H;  1YI2 P;  1OKK D;  1Z63 A;  2QVA A;  5CJ4 A;  3D6Z A;  4ULV A;  2BL2 A;  5DJT B;  2UUH A;  1LIH A;  3S28 A;  3SSU A;  4JBZ A;  3L74 J;  2KK1 A;  2Q9B A;  4Y28 J;  1IFI A;  1M57 C;  3LAY A;  2XZR A;  2KIK A;  4EKW A;  2NPU A;  2C0W A;  1XZP A;  1BGY D;  5D91 A;  3CPW O;  4I2L C;  1NG1 A;  4IGG A;  1J2J B;  1RQV A;  5L8R J;  4WY4 C;  1KQG B;  5AW7 B;  3LID A;  2Y3G A;  1JY2 O;  3HNK A;  1VQ5 P;  5B5E H;  1RMV A;  5E2Q A;  2KK7 A;  1IFN A;  2Z15 A;  1AA0 A;  1SFC A;  4WVZ A;  1OX3 A;  2KNH A;  3B9Q A;  2OEV A;  3CCU P;  4YL3 A;  3H1H E;  1Z7Q c;  4HFF B;  1X22 A;  1LWU A;  2QJP B;  1YJW P;  3HLZ A;  1S9K E;  1Y47 A;  5COM A;  2Y39 A;  1NZE A;  2R9R B;  1KFM A;  2E75 D;  5APW A;  1FZE A;  3G6E P;  2XLM A;  5BU5 A;  4MVS A;  3SXM A;  2KZI A;  3EH1 A;  1IK9 A;  2XLD A;  4DJ9 A;  1YAR O;  4G0H A;  2J9U A;  5E79 H;  1M6T A;  3OAK A;  1VL2 A;  3FWN A;  3VM6 A;  4WBA A;  2H7H A;  3H32 B;  1Q2N A;  1NTM G;  1YYJ A;  1NU1 J;  4ER9 A;  1KIL E;  3CZ6 A;  3IQT A;  2EIJ C;  1FOS E;  1Z6A A;  1NHL A;  1M90 Q;  4GDO A;  2ICW G;  2YIU C;  2K3R A;  3KPH A;  2BEQ D;  4BEM J;  1E86 A;  5AW8 B;  1S5L X;  3L73 E;  1LJ2 A;  3SNH A;  5L0F A;  3L71 G;  5KLI B;  1D0Z A;  1VK5 A;  1PGP A;  1ZHX A;  1AVO B;  1RE3 C;  1LI5 A;  2QUP A;  5KYY B;  4YT8 A;  4JEA A;  2HLO A;  3CCS P;  3UMK A;  4J32 B;  2ZXE B;  4Z9J A;  2XNX A;  2O9X A;  2KGO A;  5EGY A;  2NRG A;  3HD7 C;  2IXN A;  2ZPA A;  4XQ1 A;  3HUS B;  2ZD9 A;  4O6M A;  2WB7 A;  2JD3 A;  2OTL P;  1NU7 D;  3LS0 A;  1FU1 A;  1YJN P;  4XPX A;  1FFT C;  1E5W A;  3L75 E;  1J8M F;  3CWB E;  1USE A;  1S72 P;  1IFM A;  2GFH A;  3MUD C;  1SQP K;  3FXH A;  2YXR B;  1LPE A;  1VQM P;  3FX0 A;  4FES A;  4OGQ D;  3U5S A;  4ZNC A;  2PGD A;  2QA4 P;  4KNV A;  2KLU A;  1PL5 A;  3M4B A;  1SQP G;  1KB9 D;  2OYH B;  2PFD A;  1JY3 P;  3UMI A;  4ZMD A;  1MMN A;  1CPQ A;  3RK3 B;  1H7I A;  2HJ3 A;  4KHX A;  3M9Q A;  3WOD F;  5M1B A;  2C03 A;  3N24 A;  4PR9 A;  4I1M A;  3H1I J;  2JR8 A;  2IXP A;  4NY3 A;  3TJ6 A;  3WG7 C;  2HS5 A;  4C46 A;  1EA8 A;  2ZVO B;  3KYQ A;  3SYN A;  1J1D B;  1JNM A;  1HJB A;  2LK4 A;  4YPC A;  1NH4 A;  3B5N A;  3GOR A;  1SQX K;  5IY5 C;  4IFD K;  1LTG C;  3M0D A;  3WUV A;  2VC9 A;  1GM5 A;  2ZYA A;  5EHH A;  3X1O A;  1LP1 A;  4GEH A;  2P0N A;  2WPR A;  3ZTZ A;  1T2K C;  2VCA A;  1SQX G;  3U2L A;  2LKM A;  2H89 C;  2NPS D;  3Q7G A;  1L4A D;  5FZT A;  3TNU A;  1M2V B;  4MVO A;  1JY3 N;  3L71 D;  3JTL O;  4ZLD A;  2R7U A;  3RF3 A;  3WAQ A;  1HUC A;  1QX8 A;  1NKZ B;  2ZFC A;  1VYI A;  3BAT A;  3D6Y A;  5AVY B;  2IBF A;  3PCV A;  2IFN A;  4O7G A;  2OYI A;  1E84 A;  5KLV K;  1JM0 A;  4CSA A;  4MN4 C;  1N7S A;  2CNW D;  4WGY A;  5HSW A;  3A0H E;  1G5Z A;  5AW6 B;  2UUI A;  3CL3 D;  2HG5 D;  3JSZ A;  1HMO A;  1SQV J;  1W5C E;  4PJ0 H;  1N2D C;  3EGD A;  1BDD A;  4XPY A;  2JO1 A;  1OCO C;  1G1I A;  4MTO A;  4HKZ H;  4MTG A;  2A45 I;  2XKM A;  1LTJ C;  1SYQ A;  4GYT A;  3G9R A;  3U9M A;  1L3P A;  3MTU E;  1JTH A;  1EXI A;  4G7O F;  3L72 J;  4I1L A;  3GF7 A;  1HTL C;  5KYU A;  5APQ A;  2FFH A;  2Q9A A;  2WPS A;  2E5T A;  3VYW A;  1L0L K;  4N78 E;  2WT7 A;  1SQP D;  2XDJ A;  3SFD C;  1C03 A;  3RGU A;  2YIU B;  1LT9 C;  5AW2 B;  3LLI A;  1URQ D;  3TGU J;  2WSC J;  3L74 E;  3H1K J;  4H44 D;  3W67 A;  1OKK A;  1PD1 A;  2R7T A;  2WZF A;  2KSF A;  1L0L G;  1FZC A;  2W6B A;  2CPB A;  1EDJ A;  2D2C B;  1APC A;  2ZXR A;  5A6A A;  2VAS A;  2YXQ B;  3U0C A;  1ZW0 A;  2HOD A;  2IYP A;  4JVS A;  3M15 A;  3AEF C;  2YNY A;  3NYL A;  4GQH A;  2FFD B;  2Z4E A;  2KUB A;  5JS5 A;  4EWC A;  2A1D D;  3RIP A;  2FYU K;  3CX5 E;  1BR4 A;  1IK7 A;  2R5D A;  3GM2 A;  1SQX D;  2KB7 P;  1NOH A;  1ZP0 C;  4GT1 A;  2NUT B;  4BJ6 C;  2DB4 A;  1RH5 B;  3H1J J;  3L35 A;  2GWW A;  2XLE A;  3G4Z A;  3NRH A;  4P9F A;  2KZJ A;  3AEB C;  3UGP A;  2Y0E A;  3P32 A;  2K9J B;  4NPF X;  3NKD A;  1KTM A;  3RL0 C;  1CPR A;  5DJU B;  2BC5 A;  1WOL A;  3J06 A;  3RK3 E;  1YVI A;  2AXT E;  1NU1 E;  3S27 A;  1MQV A;  3PP5 A;  1WN0 A;  1BE3 D;  1JMB A;  3NMI A;  3OJA B;  2RH0 A;  3O6Q B;  2ZXX A;  4Z9I A;  1GZL A;  4ZKU A;  3HE4 A;  1Q90 D;  3EQ2 A;  3SZR A;  1M57 D;  3JYY A;  3BRT B;  1DD3 A;  5KLV D;  3V4Q A;  3V2N A;  1VYK A;  4YL0 A;  2Q1K A;  3K66 A;  4CBE A;  3MBG A;  4DZO A;  3MD0 A;  4WY4 D;  2MJZ A;  1NTZ K;  4HJG H;  3CX5 I;  4PFO A;  5APU A;  2YLI A;  2AEJ A;  1KD1 Q;  4H13 C;  3VOP A;  1K40 A;  1KIL C;  2HJM A;  2V7Q J;  2QY9 A;  2R02 A;  1T3J A;  4H0L C;  3RK2 C;  1NTZ G;  3T9O A;  3W8I A;  3V2P A;  2XND H;  2N1T C;  3P8C E;  3PDM P;  4YTP C;  2JP3 A;  1NU9 C;  5KYX A;  3QWO C;  2Q4F A;  4EUK B;  5CBN A;  2L7A A;  3CMA P;  4K3A A;  1L0L D;  1RJ9 B;  3CAX A;  4PFP A;  5B3I A;  1BCC J;  4LAC B;  1WMK A;  3DMD A;  1JY2 N;  1OFC X;  1SP4 A;  1HGV A;  1M7L A;  2R44 A;  4N3Y B;  1LGH B;  3EZH A;  3I5P A;  2VH3 A;  3US6 A;  1MKM A;  1VQP P;  3FXE A;  5BQI A;  4K1O A;  1QQ3 A;  2QM8 A;  4J7Y A;  4JF7 A;  3ASO C;  3FVY A;  4JC7 A;  1SQB K;  2LSE A;  2A06 G;  3H1I E;  1SFC D;  3V4W A;  3NXS A;  4C7O B;  4WAB A;  1FDO A;  2HMQ A;  1SZI A;  4QMA A;  3HD7 D;  1ZHY A;  4HFK B;  3ZQY A;  2PBE A;  2E74 C;  1GL2 C;  1L0N G;  2WPQ A;  1E85 A;  4YK5 A;  1ZOY C;  2JX0 A;  1N73 C;  1KOR A;  3KZI H;  4JPZ B;  3S9O A;  3R2P A;  3DM9 B;  5DQZ A;  4ZLC A;  5DS4 A;  2IXO A;  2L5G B;  4A7P A;  1G4W R;  1RKC A;  5JSL A;  2FKW B;  1FJP A;  2XS1 A;  2YMY A;  3VMX A;  1MNE A;  4W7Z A;  5JP7 A;  2RD9 A;  1NGM B;  2Q3T A;  2NPS A;  1L4A A;  4G7H F;  4EI2 A;  4EIY A;  3CCQ P;  4K35 A;  4UB6 E;  1IFJ A;  2YKP A;  1YZC A;  1OVV A;  2IBZ D;  4D6T J;  1K9M Q;  2OQQ A;  3HE5 A;  1YZA A;  4HEA J;  1PFI A;  2K9Y A;  5COF A;  3U3B A;  1NTZ D;  5L3Q A;  2J8W A;  3N7N A;  3DXJ F;  4JUR I;  3A11 A;  2Q6Q A;  2VB6 A;  1SQV E;  2Q9C A;  2CNW A;  3TK0 A;  1JY3 O;  2H7V C;  3DE9 A;  2HSQ A;  1MFT A;  1ZR4 A;  5APV A;  4NTB A;  3EFO B;  1ZRT E;  3SWF A;  3ATP A;  1XTG B;  5KAI H;  3FAJ A;  2W9Y A;  4LLE A;  1RKE B;  3FDQ A;  4YJW A;  3RL0 B;  3VTP C;  3D71 A;  5GTH H;  1RF1 B;  3L72 E;  2B88 A;  2XXA A;  2QJP C;  1VQ9 P;  2OAR A;  5JT4 A;  3L70 J;  3AEE C;  3JC2 2;  4XFJ A;  3T97 B;  2EIL C;  1T2K D;  2L91 A;  1H6G A;  5CBO A;  4DVZ A;  5L3V A;  2G8Y A;  1FJK A;  3K1H A;  2HZ8 A;  3TGU E;  2E42 A;  1OCC C;  2A06 D;  3H1K E;  3PLN A;  3F47 A;  3P7K A;  2JJL A;  3SWK A;  2LXC B;  2R7Q A;  1TR2 A;  2M3B A;  3AEC C;  1URQ A;  2GAQ A;  4K7B A;  4PK4 A;  1YAU O;  2HYN A;  3CXH E;  2X51 A;  5EFW B;  1Y8A A;  1QGK B;  3AE5 C;  1SQB D;  1HF9 A;  2V26 A;  2PX3 A;  3QMK A;  2W8Z A;  3LIE A;  3LEO A;  4G7Z F;  3BEH A;  3H1H G;  1L0N D;  4G78 A;  1J1E B;  3CD6 P;  5KLI C;  5DS5 A;  2ZXP A;  1RXQ A;  3EG9 A;  1E83 A;  2MKV A;  1M1J C;  4Z1M H;  2N1T B;  5JRA A;  3ZIB A;  2DI3 A;  4FWV A;  2IDB A;  3H1J E;  1Q81 Q;  1ZW2 A;  3IPM O;  2G62 A;  3ZTM A;  1ZHZ A;  4U5H A;  3UMH A;  1HBW A;  2NUP B;  2XLW A;  2BCC J;  2Q7R A;  4CS8 A;  1BSH A;  2TMV P;  1JMM A;  2G3A A;  3GAN A;  1SQQ J;  3GM1 A;  1EC5 A;  1BSN A;  2IZ1 A;  3U9J A;  3Q6N A;  3HUS C;  4CJG A;  1RE4 A;  2HUJ A;  5E33 A;  1PPJ E;  4EBJ A;  5JVE A;  2R7R A;  2KYV A;  1TWH A;  1I4Y A;  1VF5 B;  4HH2 A;  3EJN A;  3L73 G;  3CXH I;  1D0X A;  4BJT A;  4XTK A;  5CCH C;  2PFX A;  5KYW A;  4DT0 A;  1KQF B;  2B9B A;  1KMI Z;  2LFF A;  4A4A A;  1M1K Q;  2P10 A;  3V5B A;  2YO2 A;  2FYZ A;  3G4S P;  2OYH C;  1QL2 A;  2YL0 A;  3EGX A;  3RK3 C;  4JJG A;  3IF4 A;  3WU2 E;  3KPE A;  4WY4 A;  1ZN5 A;  1HH0 A;  1S5L E;  1RY3 A;  3I56 P;  1S4X A;  3AG2 C;  1J1D C;  1Q0K A;  3PMR A;  3L75 G;  4R4M A;  4WJ0 A;  4DVY P;  1BBH A;  4I3M A;  3GEH A;  1YDI A;  4RD9 A;  1BCC E;  3G50 A;  3L71 J;  1ZXG A;  1GS9 A;  2B87 B;  3B4S A;  2GM4 A;  1TKN A;  4Y99 B;  3QVY A;  3AE7 C;  3AQB A;  3H1H D;  5BQH A;  2J0W A;  2GUS A;  1KYO D;  2FBW C;  1VMA A;  1CSB A;  4OD4 A;  5TIS E;  4ANJ A;  1S9K D;  1AQ5 A;  3DAF A;  5BQG A;  3RYL A;  4UB8 E;  3PTZ A;  5A6K A;  1IZM A;  2HSB A;  2WWW A;  3LLK A;  1ZHW A;  4KNW A;  2AXC A;  1EZV D;  3A2A A;  3W68 A;  4DRJ B;  2VRS A;  4RES B;  1RE3 A;  1V55 C;  2FXM A;  4H13 D;  2LP4 A;  2M5A B;  3S1K A;  2Y3D A;  3M9B A;  1KIL D;  1QSP A;  1NKN A;  5HV9 A;  2OU6 A;  2PX0 A;  3RK2 D;  4H0L D;  3Q3D A;  3JRM O;  1GU5 A;  3W2V A;  4AYC A;  1NTM K;  4DBR A;  3KL4 A;  1KYO H;  1T3U A;  4HB1 A;  5B5E E;  2A0U A;  3EZI A;  3HD7 A;  1Q0D A;  2WZ7 A;  3L73 D;  1YLM A;  2L9J A;  3Q6M A;  1AVY A;  4OH8 B;  3JRT A;  3C18 A;  5JUA A;  1H8A A;  2WSF H;  2KS1 A;  3MUD A;  2ZT9 D;  1QZX A;  4D6T E;  5E79 E;  2QEX P;  2EPO A;  3FXD A;  1S3J A;  1KQS O;  1JCD A;  4MQ9 F;  1MZ9 A;  4JKV A;  1W2E A;  1EKY A;  3BRJ A;  3I55 P;  3CC4 P;  2D2C C;  2I1J A;  1X8Y A;  1DH3 A;  1M1J B;  3L75 D;  2OCC C;  1M2O A;  2X0C A;  2R7V A;  1SLQ A;  2WVO A;  3FOO A;  2FFD C;  1ST6 A;  1D0Y A;  2LXB A;  5A6B D;  1U57 A;  2IXM A;  2E74 D;  1GL2 D;  1X9V A;  2A6H F;  3L0I A;  1FS0 E;  4DRI B;  3V7O A;  2PAJ A;  4GOE A;  4JTD B;  4AL0 A;  2V4H A;  3L70 E;  1PGJ A;  2QG4 A;  2KNC A;  1KV4 A;  4N06 A;  3TSI A;  2P6V A;  3KHU A;  2YL1 A;  4MW8 A;  3L74 G;  1MFZ A;  3KXD A;  3GHG B;  2R32 A;  4BRY B;  4RKU J;  2LQG A;  2MHR A;  1BE3 J;  4NTA A;  5AGF A;  3ABK C;  2HV6 A;  3AE8 C;  3RBZ A;  5C39 A;  4JRZ A;  2B0H A;  1PV3 A;  5KLV J;  2C0X A;  3U1C A;  1VQ4 P;  1BR1 A;  1G2C A;  4J30 B;  4E0H A;  1QKR A;  1UIX A;  4OIO F;  3N2Z B;  4M3L A;  3C8G B;  2J9V A;  1FZA A;  1MMD A;  3K1I C;  5B66 E;  3ECS A;  1CI6 A;  2R7O A;  2HPC B;  1LS1 A;  4Q7C A;  3ZDM A;  1KN7 A;  4L6R A;  1N7L A;  4N6H A;  4X0R A;  3V2Q A;  4DCK A;  1FBM A;  3RKO F;  3FWL A;  1FMV A;  3KKB A;  1NTM D;  3HNI A;  2BCC E;  2YQY A;  2Y0C A;  4XE5 B;  1SQQ E;  4NPE A;  1NU1 G;  1L0L J;  2MWQ A;  1MMA A;  2W4M A;  1LTJ A;  3AG4 C;  3AGU A;  1PGO A;  2IYO A;  2M4E A;  1KB9 H;  5AW5 B;  2OTK E;  2H7B A;  1YQ4 C;  1VQ6 P;  4E7S A;  5K5G B;  3HNJ A;  3PHL A;  1A7D A;  1WWP A;  1E79 H;  1HJ0 A;  4AUW A;  1LT9 A;  4YN0 B;  3JYH A;  1ZHT A;  2KC3 A;  3ZG1 A;  4YWQ A;  4NPD A;  2W90 A;  2QNL A;  3IQ6 A;  3GW6 A;  3LW5 H;  1TU3 F;  4JEB A;  3MHV A;  1QLE D;  2R25 A;  4KT0 J;  3IHU A;  1PP9 G;  3EHM A;  1IZN B;  5CMZ A;  3RH3 A;  2FYU J;  1CGN A;  3RVZ A;  3RQE A;  1YHQ P;  1A02 J;  2P61 A;  2A69 F;  1OW6 A;  3B0U X;  3SEO A;  4A2N B;  1LE4 A;  3Q5R A;  1FTS A;  3L74 D;  3LES A;  2B0J A;  2R5B A;  3HTK A;  1H0T B;  2CW0 F;  4BJ6 A;  5A69 A;  4PJ0 E;  3AE1 C;  2LIG A;  2R03 A;  3F89 A;  1LTI C;  3L71 E;  3RW0 A;  3C63 A;  3O39 A;  3CCE P;  1M56 C;  3EH2 A;  2CDQ A;  2CPS A;  3M91 A;  4JCH A;  4AK9 A;  1NFO A;  5H2F E;  3WUU A;  3FMS A; 
#chains in the Genus database with same CATH homology
 2J5U A;  3B71 A;  1NYH A;  1JOG A;  1IK7 A;  4YXD C;  1UIX A;  2WSF J;  2HSB A;  2Q00 A;  3GM2 A;  3RQG A;  1ZP0 C;  3Q5P A;  2L6H A;  2E76 C;  1FDO A;  3FGA D;  5KLI C;  3Q1M A;  3C8G B;  4XEK A;  2ZT9 B;  3AJM A;  1VL2 A;  5F28 E;  4OGQ C;  3AEB C;  3EWK A;  2MKV A;  2PBE A;  3AE2 C;  4Z1M H;  2E74 C;  2O01 J;  1KTM A;  1WTY A;  2IDB A;  1VF5 C;  1KIL E;  2H89 C;  4H13 D;  4H44 C;  3Q2Y A;  1ZOY C;  2JX0 A;  1WOL A;  1KOR A;  3S9O A;  3RK3 E;  4GDO A;  4U7J A;  2WSE J;  4H0L D;  3Q3D A;  3GM3 A;  2YIU C;  2D2C D;  4PV1 C;  2G3A A;  4R32 A;  1K05 A;  3GM1 A;  4EBK A;  2BEQ D;  3D6Y A;  1DD4 A;  2FXP A;  3L8I A;  1S5L X;  1KNY A;  3GMA A;  3MFN A;  4I7Z C;  2E76 B;  3U3F A;  1HF9 A;  4EBJ A;  1OW7 A;  1NGM B;  3L8J A;  4OGQ B;  1Q90 D;  3ABV C;  3JZ0 A;  1JB0 J;  3GF3 A;  1DD3 A;  3JYY A;  2E75 C;  2E74 B;  1OW8 A;  3AEG C;  3C18 A;  2L6G A;  1VF5 B;  1YQ4 C;  4H44 B;  2FYN C;  1ZME C;  1ZZP A;  3C8V A;  3AED C;  1UFB A;  2OQQ A;  3Q5S A;  2JPU A;  2QIW A;  3C8G D;  3TUL A;  1PIX A;  4IL6 X;  2ZT9 D;  4PV1 B;  3D70 A;  4XEV A;  1WWP A;  2K9Y A;  1S1C X;  1KQF B;  1V4A A;  1RQU A;  3R4Y A;  1HJ0 A;  1KMI Z;  3SFE C;  2JO1 A;  3O10 A;  2YWA A;  2P10 A;  4I7Z B;  4H13 C;  1K40 A;  3RL0 g;  3GLM A;  2V7Q J;  3AE6 C;  2QSI A;  1AJY A;  3G9R A;  2ZT9 C;  3AE4 C;  1Y9B A;  4H0L C;  3BRJ A;  4NQF A;  2E75 B;  1EXI A;  1ZRT E;  2D2C C;  4TT3 H;  2QJY C;  3C8G A;  3GF7 A;  3IN6 A;  3D6Z A;  2WPV B;  1TU3 F;  4YTP C;  1R8E A;  4KT0 J;  2JP3 A;  1K04 A;  3AE9 C;  3D71 A;  2E76 D;  3RQE A;  2KK1 A;  2QJP C;  3SFD C;  4OGQ D;  4Y28 J;  3IAO A;  1DIP A;  3RQF A;  3AEE C;  1U57 A;  4XFJ A;  1WMK A;  1OW6 A;  1OMI A;  3T97 B;  4R4M A;  2E74 D;  1PL5 A;  2QJK C;  2WSC J;  1YQ3 C;  3Q5R A;  1VF5 D;  4H13 B;  4H44 D;  2G8Y A;  2L6F A;  1RQV A;  5L8R J;  1GMJ A;  4R4L A;  4H0L B;  1KQG B;  3AE3 C;  2YMK A;  4PV1 D;  2D2C B;  5KKZ C;  1MKM A;  3O6Q A;  4XEF A;  5M1B A;  3K7D A;  3AE1 C;  1QVX A;  3U0C A;  2H88 C;  2NZ2 A;  4RKU J;  3AEF C;  3AEC C;  2BEZ F;  3AE7 C;  3AE8 C;  1EXJ A;  1O3U A;  2WQY C;  2FBW C;  3LW5 J;  3H25 A;  2LK4 A;  1FDI A;  3AE5 C;  2E75 D;  3AEA C;  1PV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...