1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
3AEDC 2G3AA 3AEGC 1K40A 1ZZPA 3RQEA 4XEVA 2Q00A 4EBKA 1WOLA 3AE4C 3AE3C 3GM1A 4NQFA 3C8GD 3SFDC 1PV3A 2L6FA 1OW7A 5F28E 3AE9C 3K7DA 3RQFA 3C18A 2HSBA 2YWAA 1UFBA 3AEAC 3RQGA 3AE5C 3AEEC 3AEBC 3AE8C 3GM3A 3B71A 1KTMA 3MFNA 2H88C 4EBJA 4YTPC 4XEKA 1OW6A 3AE1C 1ZOYC 3AE6C 3AE7C 3TULA 3JZ0A 3U3FA 2L6HA 3AE2C 3ABVC 1OW8A 2L6GA 2FBWC 3C8GB 2WQYC 3U0CA 2LK4A 1QVXA 3L8JA 1ZP0C 3S9OA 1WWPA 3AJMA 2PBEA 1WTYA 1V4AA 2H89C 3AECC 3L8IA 3O10A 2JPUA 1JOGA 3C8GA 3SFEC 1K04A 3JYYA 3GM2A 1YQ3C 1O3UA 4XEFA 3BRJA 3AEFC 2JX0A 2KK1A 4YXDC 4R32A 1KNYA 1YQ4C 1K05A
chains in the Genus database with same CATH superfamily
2D2CD 3EHMA 2BCCG 2VRSA 5BQHA 2HSQA 1FFHA 4G7OF 5B66E 4Y99C 2AEMA 4I3MA 4EBKA 3SXMA 2FY8A 2YXQB 3GM1A 4NQFA 1GL2A 3H1HJ 2YL7A 4BJTA 4FAPB 2NZ2A 2P2UA 1LI5A 3S84A 3RL0B 3CL3D 3FXEA 2HFED 2WZLA 2QJPC 1VQ6P 3W2VA 1IFDA 2OGUA 5E2QA 1SFCD 4WY4B 1HVVA 3A7OA 1KB9D 1ZW3A 2B87B 4D6TG 4CJOA 3FX0A 4HJGH 1I5NA 3BCCD 2XL6A 1DD3A 1JM0A 4Y99B 2OTKE 4JIOA 5AC5A 5DS6A 2VCBA 4I44A 1XZQA 4EBJA 3TNUB 3PHF2 4JCHA 1N73A 2ZYGA 3U8VA 3L70G 4HFKB 4YJWA 5COMA 2XZRA 3W2WA 4WGYA 1L0ND 4W7ZA 5HSWA 4AK9A 2AXTH 1HE9A 1HW2A 2Q3IA 3UIAA 2GFHA 2HJMA 2Z15A 4J30B 1NU1D 4H13C 2XM4A 3CX5E 5FCLA 3GODA 3AE2C 4U5HA 4P9FA 3RVZA 4U9EA 3CCJP 3IEEA 2ZXWC 1KQFB 3L74D 3VAYA 1KILD 5AW3B 3H1HG 4MN4C 5KLVG 1PGOA 1NKNA 2G3VA 3NRHA 4AE4B 1N1CA 4H4KC 2QNLA 4MVRA 4BJ5A 1N73C 1LTJA 1SYQA 4YXWH 2AWYA 2VASA 4CDVA 3MZWB 3P7KA 4N6HA 1S5LX 3P8MC 3CCRP 1KILB 3HE5A 2YMYA 1VQKP 3CWBG 1HW1A 1G1JA 1G8XA 1VK5A 2R7TA 5A6BD 1A0BA 1BBHA 5F5HA 2E43A 5COGA 2Y3HA 3EFOA 1VQNP 1NTMD 1D0ZA 1SQXE 2Y0DA 2WPSA 1KZUB 1K04A 3I4UA 1XWJA 1BGYD 1YITP 4JBZA 3V2RA 1MQVA 4XE5B 2LP4A 1JAFA 1YQ4C 3CC2P 3HNJA 4OINF 3DJNB 1KFMA 2H7BA 2J7PA 2KB7P 3UGOA 3C63A 3KYIA 2A06G 3Q1MA 3T6BA 1I4ZA 2Q00A 2QM7A 3OJAB 3AE3C 1AA0A 1X8YA 2KUBA 1V54C 1JMBA 3NMKA 4ANJA 1GL2C 5KYUA 3V5YA 2RD9A 4G7ZF 2ETSA 3G9RA 3IFMA 1JPJA 5GTHE 1RH5B 1YI2P 3TSIA 2R7VA 1JO5A 4LLCA 5KYNA 1IFNA 2KXPB 1APCA 1YTZT 1Z56A 1L0LG 4WY4C 4OIQF 3JSVC 2HUJA 3MUDC 3SXYA 1AV1A 2D2CB 3EHNA 4PJMA 1USEA 3CCUP 1E85A 1LS4A 1N8RQ 2IM8A 3SZRA 1KYOI 5GTIH 1FE6A 3CCMP 1WGWA 5AVRB 2W6JH 3U3FA 2FFDC 1D0XA 5C39A 1KC8Q 3W4YA 2UUIA 3RFYA 1S3JA 2DGJA 3PRJA 1T6UA 3H1KD 1LWUC 3U0CA 3M9QA 2P61A 3QVYA 4QI0A 3OEOA 3RIPA 1SR2A 2NUTB 3D6ZA 2Q9BA 3L8JA 4KJMA 2WT7A 1MZ9A 3RBZA 1J1EB 3CX5I 3TK1A 1LP1A 1GM5A 3WU2H 1LIHA 3TJ6A 2N9BA 1G1IA 4GT1A 4EUKB 2E42A 1S7ZA 1AQ5A 4D4NA 1LWUB 1LWUA 4OIPF 3PTZA 1OR2A 4JE9A 5K0IA 2H7HA 4YT2A 2J59M 1T8ZA 2IX7C 2LFFA 5H2FE 1ZW2A 1IK7A 3K66A 3OAKA 4C7NA 3NYJA 3IPMO 4GYTA 2A6HF 2K1AA 5AW4B 3U9MA 1BR2A 4JEBA 4KHXA 2D5RB 3A0BH 2E74C 1B68A 2WTYA 1M6TA 3S1KA 4AQRD 4K0DA 2BCCE 3M4CA 1M1JB 5AGFA 4DZOA 2JD3A 3JT1A 3S0XA 2AVKA 4E7ZA 2AWCA 2YXRB 1NJIQ 4AX2A 1PP9E 2KNCA 3RBXA 3L70D 4EIJA 3GF3A 3HD7A 1Z6AA 3AE5C 2JEEA 2OYHB 1X22A 4H0LB 3B71A 1MFTA 1QX8A 3ZIBA 4MQ9F 1U7JA 2X0CA 4BG0A 4YTPC 2YRFA 1NGMB 2WSFH 1JTHB 4GIFA 5CCHA 3HD7D 2W83C 1DIPA 4IFMA 1WMKA 2W6AA 3IAOA 1XZPA 2O01H 5TISH 1GS9A 2L6HA 2XS1A 2L91A 5CCHD 5DS4A 3M91A 2XRHA 1J2JB 1FTSA 3G3ZA 4N78D 3CXHH 3C8VA 4HE8D 2Q4FA 4OIRF 2WITA 4E17A 2CW0F 4JJGA 2Y9YA 3NMJA 3II6A 2YLIA 1GW4A 1JY2O 4Q5SF 4BJ5C 1H7IA 3OA7A 1BGYG 1NTZE 2H89C 2RH0A 4LDRA 1DD4A 1IW7F 2I8DA 4N4WA 1NU1J 2Y69C 1VLSA 3NFQA 3HRNA 1X9VA 1VQ7P 2IBZG 2A06E 1PD0A 4PD4H 1SVFA 2C03A 3RK2B 1RJ9B 4HH2A 1ZVZA 1VTMP 1FNTc 1M1JA 4IFFA 1K9MQ 2P6VA 4I6MC 5KJ7D 3T6JA 3KYJA 2PP4A 2QJYC 4MVMA 1KU2A 1OCCC 3AEGC 3WHNA 3LS1A 4CDYA 3RK2D 3RVYA 1LI7A 3IQCA 3O55A 5E79E 3AGUA 3H2VA 1BE3D 2A45H 4I1MA 1L4AA 2OEVA 2M5AB 1CZQA 3L75J 4YL0A 1Z7Qc 5A69A 1URQC 2HFIA 2YL3A 1QLEC 3KKBA 2P10A 1QSPA 3LEOA 1OWAA 3CCSP 1FDOA 1EZVD 1T3UA 3EH2A 1VF5C 2XL4A 3PCVA 1VPCA 4AL0A 1TWGA 2WSSH 3GM3A 1KTMA 2IZ0A 5L0CA 3OW2O 1V55C 4W8PA 1JB0J 3R2PA 4BRYA 1SQQG 1OW6A 1QL2A 1URQA 5T3TA 3UMKA 4RDAA 1PIXA 1LTAC 2KNHA 2PNOA 2L81A 4EWCA 2HODA 3FOPA 3V2QA 5KAFE 2Y9ZA 2R9RB 3GW6A 3L70J 2O1KA 2H43A 1YZAA 1OW8A 1L4AD 3U2MA 1BDCA 1DEBA 1NFOA 4XPXA 4I2LC 4NPDA 1H8AA 4LLEA 3GHGB 1KB9E 5KLVJ 2HG5D 3DMDA 3DWWA 2J9BA 3V5BA 3H32B 3CCQP 2CNWA 2OU6A 2Q7CA 1SMYF 3RK2C 5EGYA 2ZFCA 3VM6A 3V2NA 2KIKA 4E0IA 4BXLA 2W4BA 1VQ8P 2NPSB 2N1TC 1WN0A 1J1DC 1VQOP 5E33A 1SQVK 1BR1A 1OVUA 5L0FA 3ZVRA 4M63A 5APQA 1G5ZA 4C7OB 4A7PA 1QQ3A 2C9NY 4RESB 1SQPJ 3I56P 4PJ0H 2YO3A 5CCGC 2GUSA 4DOJA 1JY3N 1NTKG 1ZHZA 1SZIA 2ZXRA 3NXSA 1SQVJ 5AW0B 1NAFA 2DW3A 1RXQA 2O9XA 2A06D 1LM3B 1LT1A 1EXJA 2L6FA 2KYVA 4XQ1A 2ZXXA 3LESA 3EGDB 4YT8A 4JQ0D 1JUNA 5E79H 2HMZA 1RF0C 4GODA 1BCCG 4L75A 1Q86Q 3T97B 2KJGA 2C04A 1GTWA 5CJ0A 1TWAA 1S5LH 3A5TA 5FZTA 5GTIE 5A6AA 2KZJA 5TJHA 3P32A 2W8ZA 5JLIA 3HD7C 2V26A 3K5BA 3USSA 4ZKPA 3V2PA 2AXTE 1H0TA 2SPZA 2FFHA 2X51A 1YYXA 4U5BE 4H44B 3EH1A 1JY3P 1FZGA 3GORA 5AW6B 1NTZK 4J7TA 5TJ5E 3H1JJ 3OWTA 5GPGB 2AU5A 3VMYA 4PJ0E 1Q0GA 2IYOA 2V4HA 3FGAD 2LSEA 1M57C 1ZN5A 3DAGA 2YNYA 3L71J 3KPHA 1MV8A 2QUPA 1M8OB 4OIOF 1RMVA 1H6GA 1NVOA 4PD4E 1L0NK 4ASWA 2YZSA 1ZR2A 1UG7A 2C9LY 3SSUA 1SQBG 1NWQA 1VDFA 1OKKA 1L7CA 3UNGC 1D7MA 3HTKA 4I1LA 4IL6X 3DJUB 4CX9A 1JOGA 4CS8C 3NMDA 3EFOB 1NYHA 1W2WA 3P8CD 1EI7A 5BVZA 2N1TA 3TDKA 3UMIA 1N7LA 5K5GB 2C0WA 5JT4A 1YQ3C 1SLQA 5APXA 3A0BE 3GMAA 2KK1A 4LACB 2BCCD 4MVSA 2Q9CA 3IF4A 4CSAA 1Z63A 1WRGA 1KQGB 3EQ2A 1ZHWA 5CBNA 3LUTB 2LQGA 1NKZB 2LR2A 3MYIA 2OG2A 3H25A 1QEXA 4GDOA 3L71E 3RYLA 1EC5A 2XLDA 5KLIB 4MW3A 1UIIA 1Q2NA 3U1AA 5KYXB 3GEEA 4C7OA 3RGUA 4MS2A 3W67A 3QMKA 1RE3A 4U3FD 1ZHTA 3CCEP 4ZMDA 4MTFA 3AEAC 3FWLA 5EK0A 2YVKA 3HE4B 3BCCJ 3VMAA 1Q0KA 3RQGA 1T6QA 1EKYA 1SQPE 3CX5H 1LKXA 1NTMJ 1R4TA 2KSEA 3M4BA 3H1LD 1L2PA 3SXKA 2IBZE 1GU4A 4XFJA 1NTMK 5A6JA 3AE1C 3KDPB 1EDJA 3L75G 2W6BA 5KJ7C 3MLGA 3CD6P 1NTME 4MTOA 1SQXD 1PD1A 1U0BB 3L75D 1HBWA 1HJ0A 1OR3A 5JUAA 5B5EE 4L73A 1BGYE 4C3EA 2R5DA 3L37A 2EINC 4C3BA 4DVZA 1HWTC 1IZMA 2R32A 1OQCA 3ZQVA 4AYCA 3DXJF 3S28A 2M3EA 1FJPA 2FFDB 2D2CC 1S1CX 3AGTA 3CC7P 1SQVE 2FYUE 1BCCJ 1H88A 2BE5F 3M0DC 3E1IA 3EWKA 2K9JA 1L0NE 1H0TB 1BSNA 2Q1KA 4UB6H 2PP6A 4JVSA 2K9YA 2R7OA 2WT7B 4WY4D 3S9OA 3WUVA 1JRAA 2EIKC 1LT9B 2G62A 3CX5D 4YPCA 3U2LA 5DS5A 4JTAB 1ZMEC 1JMWA 3Q6NA 2B89A 2QJKC 5AVZB 2RSEB 5CHXA 3AG2C 2HR3A 3F46A 3L74E 2ZT9B 4WBAA 1WATA 1NTKJ 3FWNA 4PACA 4L6RA 2R03A 3WODF 2C0XA 2XDJA 1KYOE 3VRCA 1FC2C 3B5ND 2WVQA 1E86A 1Q0MA 2GUVA 2QA4P 1NTKE 3PP5A 3UR3C 1PP9J 4ZNCA 5KLIC 1RKCA 4CS9A 1ORJA 1KNYA 256BA 3Q5SA 1K40A 1SF8A 5KLVK 2JKVA 1SS1A 3P8CE 3KZIE 3DZAA 1NZEA 1V74B 3S90A 2WVNA 1OMIA 2ITAA 1TQGA 1IFJA 2R3SA 3C8GD 4OH8B 1BCCE 3SFDC 1Q0FA 4ZLCA 4IFDK 2A6EF 2B9BA 2CPBA 4IJJA 1NTZD 1PGPA 1RJ9A 5F28E 4JW1A 3C18A 2RMZA 1VL2A 3FVYA 1OVVA 4HEAJ 3VP8A 4XLNF 2J8WA 1M90Q 2I1KA 4CPGA 3M1CB 4EKWA 3LS0A 1JTHA 2NRGA 1FZAA 4DT0A 2GA1A 1M1KQ 2XLMA 1ZOYC 2G8YA 1GL2D 3TULA 3EGXB 5KJ7A 3G4XA 4EOTA 1NU9C 4PD4I 2PGDA 3KHUA 3RKOF 3TK0A 1H9TA 1A7DA 2WSCJ 4ZKUA 1DH3A 1SQBE 1YDIA 2FBWC 1HJBA 2WQYC 3C8GB 3M0DA 1VQMP 3GWLA 1EZVI 2NG1A 1N86A 3S29A 4KNVA 1FAPB 3GG2A 1ZHYA 3QW1A 1ZP0C 3NMIA 4LGDE 5KTBA 1GK4A 1WTYA 3V4QA 5B1AC 4CJGA 5AVYB 4KI2A 1V4AA 3D71A 1CPRA 3CEXA 5BQIA 3HKKA 2P0NA 2J9UA 1ZRTD 3JRMO 3LEVA 3V5ZA 2E87A 1QVGO 2JPUA 4JRZA 1P84E 2OYOA 4Q7CA 2POHA 3NG1A 2JP3A 4DXWA 2FKWB 2KW3C 5KYYA 5KAFH 4AUWA 2WSEJ 3H1JG 2VB6A 2WSCH 4IB4A 4MVUA 5IY5C 3T4RA 3AEFC 3VF0A 1RF1C 4U5CE 4R32A 1HY5A 2XNDH 1IO4A 2WB7A 1PL5A 3ZTZA 5DQTA 5AVSB 2O3JA 3Q5PA 1USDA 3RQEA 2PAJA 1S4XA 2MWQA 3H1HE 2OYHA 2E76D 4PV1C 1NTKD 2Y0CA 3ZDMA 1PV3A 4LERA 2KP8A 2QY9A 4YWQA 2WVRA 4ZLDA 3KXDA 5BU5A 3RQFA 4FX5A 4WGZA 1R5SA 3SP1A 1RF1B 3SNHA 4M3LA 2J0XA 3ZG1A 3G50A 1RF1A 3J06A 2OQMA 2LXCB 3TGUE 1RE3C 4N6JA 5L0HA 3JYHA 4G0HA 5HV9A 1NOHA 3AEEC 1F1MA 2DB4A 1VQ5P 2YMKA 3V4WA 5F5FA 4PV1B 3B29A 2E75C 1Q0DA 1HF9A 3ASNC 4Z1MH 4IAOA 3W8HA 2H8PD 4BRYB 4G7HF 3AE7C 3K1IA 4PD4D 1OCOC 1TFOB 2UWJE 2HJ3A 1K8AQ 1VB5A 3OA1A 3X2QC 5AW2B 3I5QA 4LC1A 3ABMC 4CBEA 3F5HA 3JC22 3H65A 1BE3J 2A0UA 1OFCX 2V7QJ 3UGPA 1QLED 2L6GA 1NTMG 2YKPA 3JCUE 1A02F 1M56D 4EBBA 1YJNP 5KAIH 1RQUA 4QMAA 2FXOA 5DQZA 1HTLC 3B5NB 4ONSA 1FZBA 2P67A 1W2EA 2Q5UA 3QZCA 3U8PA 2J46A 5A6KA 4IRUA 3K6BA 3U9JA 1O87A 1MFZA 1N7SB 1MNDA 3DM5A 5KKZC 3HNKA 3CXHE 2QE9A 2ZD9A 3DI5A 3FAJA 3O6QB 2HV7A 3O6XA 5BU8B 1N7SC 3SWYA 1JY2P 4MW8A 3EFGA 2YQYA 2DYRC 5KYXA 5APSA 1OX3A 2WVOA 1RCPA 2ZJSE 2J58A 3L4FA 1YYCA 4YK5A 3A11A 4YXDC 1JOCA 2KLVA 3JCUH 1H89A 1CGOA 4U3FE 1FR0A 3I55P 4A4AA 5A6BA 2VCAA 3B9QA 4XEVA 4JURI 3CZ6A 1G2CB 4RO0A 2R25A 5L3QA 1M1JC 3VMZA 3DM9B 3CWBE 4UB6E 3NTNA 2H7OA 3Q3DA 3FDQA 1KN7A 1Y9BA 4LDQA 2M0BA 4H0LD 5B1BC 3IQ6A 1PPJG 3HJCA 3ZSUA 3H1IG 5APWA 4XWJA 4H44D 4WY4A 3Q7LA 3AG3C 3LW5J 2OJQA 2CCYA 1RKEB 2E74B 4XPYA 1LTIC 3H1KG 2I8BA 1AVOA 3JTLO 1SQVD 1R5ID 3CC4P 3TGUJ 2QRXA 3N24A 3NKDA 2ZXPA 3CXHD 2L5GB 3DE8A 2TMVP 5H2FH 3B5NA 1BDDA 3MTUE 5B66H 4OGQD 1VLTA 2LXBA 1T2KD 1FS0E 3CQZA 1L0NJ 4H44C 1NU1G 4XLPF 2ZAEB 2J0WA 3IQ5A 4C3DA 4NTBA 3ZTMA 3L72G 5KLVD 4U5FE 2E76B 3L72D 1AFOA 1YVIA 5AVVB 3T6GB 3I5CA 1P84I 1HUCA 1GU5A 3I5PA 3L73G 4OWFA 4ASVA 1SQPK 2QG4A 3TQOA 3B5NC 2NUPB 2QJYB 3UMHA 4BJ6C 3A0HH 1YHQP 1LTTC 2FAPB 3Q7GA 5CI8A 3QH9A 2KK7A 4RKUJ 4UB8H 5D92A 2HPCB 4KT0J 1JCCA 1NHLA 2FYNC 3N7NA 4IWBA 4DJ9A 5KYYB 2IPPA 2KQ9A 4OGQB 2CNWD 1RHZB 4CS7A 2IXMA 3FHDA 2H8AA 2QTVA 3JYYA 1D1BA 3ITFA 2QM8A 3BCCE 4OGQC 1YA7O 2AEFA 2N1TD 3EGDA 3HUSA 1ZV8A 1LP1B 2IXNA 1CI6B 1JR8A 5CMZA 3AEDC 1TKNA 3CXHI 2OKUA 3H1KJ 4KBLA 1DOWA 2FYNB 2OYIC 2R05A 2YIUC 3TGUG 4K3AA 2M5AA 1L4AB 3LW5H 1KYOH 3RL0C 2DYSC 1R5LA 1Y8AA 3MIWA 1SQQK 1CSBA 1A41A 3EG9A 1NSGB 4K35A 2Q3TA 3EG9B 3SWFA 4J7YA 2IXOA 3MD0A 5DJTB 3JRTA 1YA9A 1FDIA 2LKMA 1CPQA 4MTGA 2YL1A 2AXCA 3ABKC 1G4US 3WG7C 3IR9A 3PJSK 4H0LC 4O9BA 3VOPA 4XEKA 3FAPB 4ULVA 1FMWA 5DJUB 5T1DB 3B0VC 2YKQA 1URQB 1LTBC 3FXHA 1NBBA 4WABA 1ZHXA 3ZDLA 1T3JA 1JMMA 3LLKA 2EPNA 1VF5B 3M06A 4TLFA 1FZEA 3G4ZA 3LLIA 4B6IA 1N7SD 4DRHB 2P58A 1YLMA 1SQQD 3TOLA 2PFDA 2IBFA 2I1JA 3W8IA 3MP7B 2ZT9D 3HNLA 3WAQA 1N73B 1NTKK 2NUTA 4U9DA 3E7KA 3L70E 1A7EA 2JWAA 1SQXK 2PX3A 2WWWA 4PJLA 1D1AA 4DRJB 3AJMA 2NPSD 5L0DA 1M7LA 3ITKA 1SQXJ 3AECC 2L9JA 4JYBA 4PJNA 2V7QH 1KQLA 4HKZH 3TJ5A 1BE3G 2NPSA 4IGGA 3EQLF 4CIHA 1GQAA 1IFMA 3R4YA 2WPRA 3PLNA 1A02J 4XTKA 1L0LE 4PR9A 1O3UA 5CCGA 3AQBA 3GF7A 1Q81Q 3IHUA 1EQ1A 4EI2A 1KILA 3HE5B 1BR4A 1K73Q 4CS8A 3U59A 3CWBJ 3HTKB 1QKRA 1VQPP 3F89A 2A45G 1Y47A 4IAQA 1JY2N 4U7JA 3GLMA 4DCKA 1AEPA 3C8ZA 2W9YA 3FMSA 3KMIA 4N6CA 2XKMA 3MGNA 5L8RJ 3L75E 4NCQA 4YN0B 2AEJA 3H1IE 1IFIA 1FDMA 4U3FJ 1KV4A 1SQQE 1ZXGA 2OARA 4YT5A 5L3VA 1ZRTE 4NC3A 2LIGA 2KS1A 1NFNA 3H1KE 1SQVG 1OZHA 1E2XA 1VYIA 2OEXA 4EDFA 2JO1A 1AQTA 2PRRA 5BQGA 2HMQA 2YKOA 1L0NG 3BASA 2HV6A 2CK3H 1NU7D 5CIVA 2WPQA 1ZLLA 2ZYAA 3MYFA 3HD7B 2XV5A 1R8EA 2BC5A 2DI3A 4E18A 2R7QA 1I4YA 5M1BA 1PGQA 5CJ4A 3AE8C 4DOZA 4OVNF 3U1CA 1FFTC 5KYUB 5CCGD 3E9VA 1S9KE 5APVA 1EQ7A 4CDAA 4EYYQ 5DLJA 1LGHB 2M64A 3M79A 3KZIH 1NTZJ 1Q90D 3RK3E 1E5WA 3ASOC 1T2KC 4G78A 5L0GA 1G4WR 3GHGC 3AG4C 4NPFX 1KMIZ 4W7YA 2PF4E 1SFCB 2GAQA 4GKGA 2BEZF 4O6YA 3ABVC 3C1LA 3LIDA 1LPEA 3CSKA 3RW0A 1U57A 1X0TA 2IDBA 4NY3A 3RL0D 4JKVA 1OIPA 2JWDA 2K3RA 3L35A 3ZWIA 2A45I 1SP4A 3H1IJ 1T5OA 3TYYA 2WMMA 2VC9A 1LTJB 4MVZA 2QVAA 1E84A 1WWPA 1HGVA 5GTHH 1HGZA 4BEMJ 3D6YA 3U5SA 3HNIA 1OCZC 4O6MA 3TD7A 2YKZA 2MYSA 2HPCA 2R7RA 3N4XA 1MMNA 1PP9D 2KGOA 3F47A 2EIMC 2K9JB 5EHHA 1GDTA 2NPSC 1PP9G 1YIJP 1LT9C 5JRAA 1J8MF 1GL2B 3G71P 5D91A 4D4XA 2KS1B 2PFXA 4BPMA 3KQGA 3C7JA 1KILC 2ZPAA 2BL2A 1BZ4A 2KNCB 3T9OA 2IYPA 2B87A 1ORYA 1ZW0A 1OKKD 2QJPB 1LTGC 2KYHA 1KYOD 2CYDA 4JZAA 1WT6A 2K37A 3AE4C 4N06A 1NH4A 1L0LD 1EXIA 1OW7A 3ABLC 1ZYRF 1MNEA 3O8ZA 1ZR4A 2GWWA 2M4EA 1N2DC 1LJ2A 1AUEA 2L7AA 1YJ9P 5B3IA 4JC7A 2XU6A 1EZVG 2NSGA 1PPJD 4IL6E 2OQQA 1VQ4P 2GDCA 3H1ID 2W45A 5AW5B 1DX7A 4DVYP 2O01J 2ASRA 3C62A 3CAXA 4EIYA 3BCCG 3MUDA 1LTSC 2ZYDA 1P84D 4RJTA 2YLGA 3QTHA 1CGNA 5KYWA 2J45A 4U5DE 2XNXA 2Y0EA 1ZU4A 4DBQA 1HMDA 4XPWA 3BRTB 4QI2A 3EJNA 3S4RA 1ST6A 2XXAA 2R7WA 2M3BA 2KLUA 2FFDA 1TU3F 1AVOB 4I7ZC 2B0JA 2WZ7A 4O7GA 5AVUB 1M2VB 3ECSA 1XTGB 2IOQA 4PFOA 2MKVA 3H1HD 1DOVA 4A2NB 2Y3DA 1OXZA 4DJGA 1BE3E 2E74D 4Z9JA 2H7VC 1KD1Q 3A2AA 2Q9AA 3L73D 3CMAP 1TWHA 2IZ1A 3O10A 2K88A 3BRVB 1JEKA 1L0LJ 2FXMA 1QGKB 5APUA 2XLVA 4GOEA 5TISE 3RL0g 3C8GA 3NYLA 4I7ZB 2FGYA 2QEXP 4LLHA 2A69F 4NTFA 1JPNA 1S5LE 4HFFB 3RH3A 1VOMA 3M15A 4CSAC 2FYZA 2G3KA 4Y28J 1FOSF 1FOSE 5KLVE 2QJKB 5JSLA 1SQPG 2XS8A 2ZXOA 3E70C 2XL8A 3KL4A 1SQPD 2KOGA 2J9VA 2NPUA 3RF3A 2P7VA 3SEOA 1YZCA 3KYQA 2W4MA 3PMRA 4B86A 2QLAA 1YARO 5KYWB 2P7JA 3HUSB 3LJBA 2XLEA 3LNRA 3U3BA 2UUHA 1T6IA 3E1RA 4MNDA 2Y3BA 2XLHA 4IL6H 1KB9I 1EA8A 1QL1A 3SWKA 1KFNA 5APYA 3VMXA 2WL8A 1U6HA 3ZQYA 4JJFA 2E75B 3A3YB 4K1OA 3WU2E 4C7RA 2Y39A 2AP3A 2H88C 2HZ8A 1U7MA 1QZXA 5E3CA 4JPZB 4LDKA 4K7BA 1LNQA 3GEIA 1FBMA 1IFPA 1OXKA 3L71D 2Q9IA 2QIWA 1HMOA 1FZFA 1ZU5A 2A68F 2EPOA 3L0IA 3SYNA 1YJWP 4EHPA 3L34A 5E3AA 3NYMA 1BGYJ 3V6IA 1QVFO 2LK4A 2Z5HA 2E76C 4PV1D 1S05A 3CMEP 1JCDA 2NUPA 3H1LE 3RK3B 2V3CC 1J1EC 5AW7B 4YL1A 5KKZB 2XXAB 5B3SC 2YO2A 1G2CA 2QSIA 4JTCB 1IK9A 1LS1A 3DE9A 3GEHA 4H54A 3H2UA 2VCCA 3GM2A 3BRJA 2J7PD 2Z5IA 1C17M 3DD7A 4RBNA 1LT9A 2FYUG 2QE7H 5EFWB 3WUUA 1CW5A 3LAYA 3QWOC 2HLOA 1PZQA 2FYUD 3B0UX 1RE4A 2WZFA 1ZZPA 2CPSA 1N7SA 3H1JD 1FU1A 1AJYA 1GD2E 1Z5ZA 2XM0A 4ER9A 3O6QA 2P1JA 4MVQA 2KSJA 4GOFA 1S72P 1P84H 2EIJC 1GMJA 3G6EP 2J9WA 4Z9HA 2EPLX 4JYCA 1NLXA 1L4AC 3JSEO 1KILE 3L72E 1PGJA 3R7CA 5AW8B 5CCHC 4YL3A 5JVEA 1RE4C 4H13D 3TF5A 1LE4A 3MBGA 2EILC 4CIPA 1JNMA 3Q5RA 3A0HE 3PHLA 2IBZI 3PH0A 3MX3A 1CGME 3GWNA 3L36A 5DVWA 1IZNB 4PK4A 4N78E 2O01N 1FMVA 3NDBB 1PCXA 4P6IC 1RQVA 2KZIA 5AVQB 3JZ0A 2IFNA 1VMAA 5AVXB 3Q2YA 2EPKX 2LD6A 4Q4ZF 3CPWO 4J32B 2BCCJ 5L0JA 2N9YB 5AVWB 1Y4CA 1BCCD 1MKMA 5JP7A 4H13B 3AOUA 3L72J 3H6PA 3POVA 2Q3EA 1GK6A 5CI9A 1Y6DA 2I15A 3V5XA 3H1JE 1PFIA 3B8EB 2R44A 2FYUJ 4W8KA 1RY3A 3G4SP 1D0YA 2XLWA 4AL1A 3KH2A 2YHSA 2HKVA 3H32A 1MMAA 3K1HA 2PBEA 1CI6A 1M56C 3MHVA 2FYUK 1FZCC 4JF7A 4R4LA 1HE1A 1C03A 4IARA 1TWCA 4FESA 1IC2A 1GW3A 1W2BO 3A9CA 4NPEA 3QW0A 4O6NA 4KNWA 4U5EE 3KPEA 1WASA 2WSFJ 2RN0A 2MJZA 3H1LJ 4E0HA 2R7SA 2CGEA 5L0IA 4BJ6A 3S27A 1DEEG 2IBZD 2ICWG 4BWNA 4C7NB 1SQQJ 1HH0A 1ORSC 1BDJB 3JCUQ 1FZCA 2GA0A 2D4UA 3QVZA 1EZVE 1GZLA 2A0BA 1FAVA 2BASA 2W90A 3Q6MA 4XA4A 3L73J 4U5GA 4PJJA 2Y3GA 3B0PA 1OVRA 4Z9IA 4I1OB 3EZIA 2WZGA 4UDVA 1JY3O 1NU1K 1NTZG 3HUSC 1T6AA 2J5UA 4OD5A 2R7XA 5AC4A 2CDQA 1UIXA 3US6A 3CLQA 4UB8E 2VH3A 4E7SA 1D1CA 2YWAA 2E75D 3V7OA 4CS9C 2R02A 3ZC4A 2OYIB 2GM4A 4DRIB 1BSHA 1T01A 2LCHA 4O79A 2RKLA 1LE2A 1RKEA 3AEBC 1RF0A 3L71G 4WWIA 2W27A 3TNUA 3CI9A 2HYNA 3WUTA 1X79B 2OCCC 3GANA 3TOMA 3AE6C 4D6TE 4WB4A 1IJDB 4U3FG 4WVZA 1YAUO 2A1DD 2LFDA 1Q82Q 3B4SA 3L1MA 2ZXEB 1A7VA 4KC9A 2KC3A 4MVOA 3H1LG 1L3PA 4AE4A 3EFFK 1VYKA 3W68A 4X0RA 3M9BA 2FXPA 2YLDA 5CBOA 1PPJE 1YBKA 2YL0A 1SQXG 2PX0A 5AW1B 3X1OA 4R4MA 3EPVA 1NO4A 5BUOA 3N0TA 3LNMB 2ZT9C 1LVKA 5AW9B 1FZCB 4OD4A 5AVTB 2Q6QA 2IFMA 1YYJA 4IOIH 1Z3IX 2NSFA 3HTKC 2P1AA 2YIUB 2N1TB 1T9KA 3VTPC 1EDLA 2ZVNB 1S2EA 1O5HA 3M0AA 3FXDA 3CWBD 4F4BA 1QPUA 1E83A 1C02A 3FOOA 1YJGA 3PDMP 4L76A 2OYIA 2OOCA 1EDIA 2G3AA 5JS5A 4BJ1A 4BEJA 4D6TD 3T97A 4FWVA 1YTZI 1E79H 2R5BA 2OTLP 4GEHA 4GQHA 3CCLP 3JSZA 1WOLA 1AVYA 1SQBJ 2B0HA 1VF5D 2JDIH 3L73E 3AE9C 3K7DA 4TT3H 2OJED 3AG1C 4P9TA 2IYLD 2HS5A 5APTA 2HSBA 3EGXA 3CCVP 1UFBA 5T3WA 1VQ9P 1URQD 2Q7RA 2WSEH 3HE4A 4JEAA 1NU1E 1XTCC 3WMM0 4W80A 1EDKA 2MHRA 1OCRC 1SQBK 3L74G 1NAYA 4DBRA 2IXPA 3BATA 2OYHC 1GGQA 1KORA 3HLZA 1VQLP 3IN6A 3MFNA 2M8RA 3VYIA 3C9IA 5COFA 1NG1A 3VP9A 3BVHA 3VYWA 1M57D 1MMDA 1M2OA 2WPVB 2R7UA 2HODB 2Z4EA 3AQCA 4WJ0A 3O39A 2BEQD 2KI7B 1SFCC 1OXBA 3VN0A 2XSEA 3DKAA 1FJKA 2E5YA 2O1JA 1J1DB 4C46A 4NTAA 1S9KD 1J8YF 3NKEA 1TFKB 5KAIE 1L0LK 5B5EH 1MMGA 1TR2A 4ULWA 1LTJC 1QVXA 2KSFA 3N2ZB 1M2VA 3GHGA 3RK3D 2B88A 3ATPA 4RD9A 1Q7YQ 3SXZA 2EPMX 3RK3C 4YT4A 3K1IC 2JR8A 4N3YB 4D6TJ 1MUUA 3IQTA 3L8IA 1U89A 1H9GA 1SFCA 1SQBD 1W5CE 1Z23A 2YEVA 3K33A 4HYTB 2E5TA 3D70A 2ZVOB 1KQSO 4JCZA 3M9HA 3TGUD 4QDLA 2OTJP 2JJLA 2F22A 3SFEC 2XLOA 4JTDB 3L74J 3BEHA 3EZHA 4PFPA 3LIEA 4XEFA 2JX0A 4L74A 3DAFA 1KB9H 2R3CA 1K05A 4HB1A
chains in the Genus database with same CATH topology
2D2CD 3AEDC 2G3AA 3AEGC 3Q5PA 4U7JA 1K40A 3GLMA 1ZZPA 3Q1MA 1AJYA 4XEVA 3RQEA 5L8RJ 3H25A 2Q00A 3O6QA 2E74C 4GDOA 4EBKA 1OMIA 3AE4C 3AE3C 1WOLA 2E76D 4PV1C 2YIUC 3GM1A 3C8GD 4NQFA 3SFDC 1PV3A 1EXIA 1GMJA 1EXJA 1VF5D 2L6FA 1OW7A 2J5UA 2NZ2A 5F28E 3AE9C 3K7DA 3Q3DA 4TT3H 1UIXA 3RQFA 3G9RA 3C18A 1ZRTE 1Y9BA 1VL2A 2P10A 1KILE 2HSBA 2YWAA 2E75D 2QJPC 3AEAC 4H0LD 1UFBA 1FDOA 3RQGA 2JO1A 1VF5C 4H44D 4H13D 3T97B 3GF3A 3LW5J 1FDIA 1R8EA 3AE5C 3AEEC 2OQQA 3Q5RA 5M1BA 1DD3A 2D2CB 2YMKA 3AEBC 2E74B 2E75B 3AE8C 4H0LB 3B71A 3GM3A 1KTMA 1KORA 2O01J 3IN6A 4PV1B 2E75C 4H0LC 1JB0J 4XFJA 2H88C 3MFNA 4EBJA 4YTPC 1HF9A 4XEKA 4Z1MH 1NGMB 1OW6A 1RQVA 3AE1C 1DIPA 1ZOYC 2G8YA 3AE6C 3AE7C 4H44B 3TULA 3JZ0A 2WPVB 1WMKA 1Q90D 1PIXA 3Q2YA 3RK3E 4OGQD 1HJ0A 3IAOA 3U3FA 4H13C 4H44C 1VF5B 1MKMA 2BEQD 3FGAD 2L6HA 2QIWA 2WSCJ 3AE2C 1KMIZ 4H13B 2BEZF 2V7QJ 3ABVC 1OW8A 1S1CX 2D2CC 1KQFB 1TU3F 2L6GA 4I7ZC 2FBWC 3C8VA 2WQYC 3EWKA 3C8GB 1U57A 2E76B 2IDBA 3U0CA 2ZT9D 2LK4A 1QVXA 3D6ZA 2K9YA 1RQUA 3L8JA 2MKVA 2E76C 4PV1D 2FXPA 1ZP0C 3S9OA 2E74D 1WWPA 1S5LX 3AJMA 3D6YA 4R4MA 1WTYA 2PBEA 1ZMEC 1V4AA 3D71A 2H89C 3AECC 2QJKC 3L8IA 4R4LA 3O10A 2ZT9C 4IL6X 2JPUA 1JOGA 1DD4A 2ZT9B 4RKUJ 5KKZC 4KT0J 2FYNC 1NYHA 2QSIA 3D70A 3RL0g 3C8GA 2JP3A 4I7ZB 4OGQB 2WSFJ 2WSEJ 3R4YA 3SFEC 1K04A 3JYYA 3GM2A 1YQ3C 4OGQC 1O3UA 4XEFA 3BRJA 3AEFC 2JX0A 3GMAA 2KK1A 4YXDC 3GF7A 5KLIC 4R32A 1IK7A 1KNYA 1YQ4C 2QJYC 1K05A 4Y28J 1KQGB 3Q5SA 1PL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED C;  2G3A A;  3AEG C;  1K40 A;  1ZZP A;  3RQE A;  4XEV A;  2Q00 A;  4EBK A;  1WOL A;  3AE4 C;  3AE3 C;  3GM1 A;  4NQF A;  3C8G D;  3SFD C;  1PV3 A;  2L6F A;  1OW7 A;  5F28 E;  3AE9 C;  3K7D A;  3RQF A;  3C18 A;  2HSB A;  2YWA A;  1UFB A;  3AEA C;  3RQG A;  3AE5 C;  3AEE C;  3AEB C;  3AE8 C;  3GM3 A;  3B71 A;  1KTM A;  3MFN A;  2H88 C;  4EBJ A;  4YTP C;  4XEK A;  1OW6 A;  3AE1 C;  1ZOY C;  3AE6 C;  3AE7 C;  3TUL A;  3JZ0 A;  3U3F A;  2L6H A;  3AE2 C;  3ABV C;  1OW8 A;  2L6G A;  2FBW C;  3C8G B;  2WQY C;  3U0C A;  2LK4 A;  1QVX A;  3L8J A;  1ZP0 C;  3S9O A;  1WWP A;  3AJM A;  2PBE A;  1WTY A;  1V4A A;  2H89 C;  3AEC C;  3L8I A;  3O10 A;  2JPU A;  1JOG A;  3C8G A;  3SFE C;  1K04 A;  3JYY A;  3GM2 A;  1YQ3 C;  1O3U A;  4XEF A;  3BRJ A;  3AEF C;  2JX0 A;  2KK1 A;  4YXD C;  4R32 A;  1KNY A;  1YQ4 C;  1K05 A; 
#chains in the Genus database with same CATH topology
 2D2C D;  3EHM A;  2BCC G;  2VRS A;  5BQH A;  2HSQ A;  1FFH A;  4G7O F;  5B66 E;  4Y99 C;  2AEM A;  4I3M A;  4EBK A;  3SXM A;  2FY8 A;  2YXQ B;  3GM1 A;  4NQF A;  1GL2 A;  3H1H J;  2YL7 A;  4BJT A;  4FAP B;  2NZ2 A;  2P2U A;  1LI5 A;  3S84 A;  3RL0 B;  3CL3 D;  3FXE A;  2HFE D;  2WZL A;  2QJP C;  1VQ6 P;  3W2V A;  1IFD A;  2OGU A;  5E2Q A;  1SFC D;  4WY4 B;  1HVV A;  3A7O A;  1KB9 D;  1ZW3 A;  2B87 B;  4D6T G;  4CJO A;  3FX0 A;  4HJG H;  1I5N A;  3BCC D;  2XL6 A;  1DD3 A;  1JM0 A;  4Y99 B;  2OTK E;  4JIO A;  5AC5 A;  5DS6 A;  2VCB A;  4I44 A;  1XZQ A;  4EBJ A;  3TNU B;  3PHF 2;  4JCH A;  1N73 A;  2ZYG A;  3U8V A;  3L70 G;  4HFK B;  4YJW A;  5COM A;  2XZR A;  3W2W A;  4WGY A;  1L0N D;  4W7Z A;  5HSW A;  4AK9 A;  2AXT H;  1HE9 A;  1HW2 A;  2Q3I A;  3UIA A;  2GFH A;  2HJM A;  2Z15 A;  4J30 B;  1NU1 D;  4H13 C;  2XM4 A;  3CX5 E;  5FCL A;  3GOD A;  3AE2 C;  4U5H A;  4P9F A;  3RVZ A;  4U9E A;  3CCJ P;  3IEE A;  2ZXW C;  1KQF B;  3L74 D;  3VAY A;  1KIL D;  5AW3 B;  3H1H G;  4MN4 C;  5KLV G;  1PGO A;  1NKN A;  2G3V A;  3NRH A;  4AE4 B;  1N1C A;  4H4K C;  2QNL A;  4MVR A;  4BJ5 A;  1N73 C;  1LTJ A;  1SYQ A;  4YXW H;  2AWY A;  2VAS A;  4CDV A;  3MZW B;  3P7K A;  4N6H A;  1S5L X;  3P8M C;  3CCR P;  1KIL B;  3HE5 A;  2YMY A;  1VQK P;  3CWB G;  1HW1 A;  1G1J A;  1G8X A;  1VK5 A;  2R7T A;  5A6B D;  1A0B A;  1BBH A;  5F5H A;  2E43 A;  5COG A;  2Y3H A;  3EFO A;  1VQN P;  1NTM D;  1D0Z A;  1SQX E;  2Y0D A;  2WPS A;  1KZU B;  1K04 A;  3I4U A;  1XWJ A;  1BGY D;  1YIT P;  4JBZ A;  3V2R A;  1MQV A;  4XE5 B;  2LP4 A;  1JAF A;  1YQ4 C;  3CC2 P;  3HNJ A;  4OIN F;  3DJN B;  1KFM A;  2H7B A;  2J7P A;  2KB7 P;  3UGO A;  3C63 A;  3KYI A;  2A06 G;  3Q1M A;  3T6B A;  1I4Z A;  2Q00 A;  2QM7 A;  3OJA B;  3AE3 C;  1AA0 A;  1X8Y A;  2KUB A;  1V54 C;  1JMB A;  3NMK A;  4ANJ A;  1GL2 C;  5KYU A;  3V5Y A;  2RD9 A;  4G7Z F;  2ETS A;  3G9R A;  3IFM A;  1JPJ A;  5GTH E;  1RH5 B;  1YI2 P;  3TSI A;  2R7V A;  1JO5 A;  4LLC A;  5KYN A;  1IFN A;  2KXP B;  1APC A;  1YTZ T;  1Z56 A;  1L0L G;  4WY4 C;  4OIQ F;  3JSV C;  2HUJ A;  3MUD C;  3SXY A;  1AV1 A;  2D2C B;  3EHN A;  4PJM A;  1USE A;  3CCU P;  1E85 A;  1LS4 A;  1N8R Q;  2IM8 A;  3SZR A;  1KYO I;  5GTI H;  1FE6 A;  3CCM P;  1WGW A;  5AVR B;  2W6J H;  3U3F A;  2FFD C;  1D0X A;  5C39 A;  1KC8 Q;  3W4Y A;  2UUI A;  3RFY A;  1S3J A;  2DGJ A;  3PRJ A;  1T6U A;  3H1K D;  1LWU C;  3U0C A;  3M9Q A;  2P61 A;  3QVY A;  4QI0 A;  3OEO A;  3RIP A;  1SR2 A;  2NUT B;  3D6Z A;  2Q9B A;  3L8J A;  4KJM A;  2WT7 A;  1MZ9 A;  3RBZ A;  1J1E B;  3CX5 I;  3TK1 A;  1LP1 A;  1GM5 A;  3WU2 H;  1LIH A;  3TJ6 A;  2N9B A;  1G1I A;  4GT1 A;  4EUK B;  2E42 A;  1S7Z A;  1AQ5 A;  4D4N A;  1LWU B;  1LWU A;  4OIP F;  3PTZ A;  1OR2 A;  4JE9 A;  5K0I A;  2H7H A;  4YT2 A;  2J59 M;  1T8Z A;  2IX7 C;  2LFF A;  5H2F E;  1ZW2 A;  1IK7 A;  3K66 A;  3OAK A;  4C7N A;  3NYJ A;  3IPM O;  4GYT A;  2A6H F;  2K1A A;  5AW4 B;  3U9M A;  1BR2 A;  4JEB A;  4KHX A;  2D5R B;  3A0B H;  2E74 C;  1B68 A;  2WTY A;  1M6T A;  3S1K A;  4AQR D;  4K0D A;  2BCC E;  3M4C A;  1M1J B;  5AGF A;  4DZO A;  2JD3 A;  3JT1 A;  3S0X A;  2AVK A;  4E7Z A;  2AWC A;  2YXR B;  1NJI Q;  4AX2 A;  1PP9 E;  2KNC A;  3RBX A;  3L70 D;  4EIJ A;  3GF3 A;  3HD7 A;  1Z6A A;  3AE5 C;  2JEE A;  2OYH B;  1X22 A;  4H0L B;  3B71 A;  1MFT A;  1QX8 A;  3ZIB A;  4MQ9 F;  1U7J A;  2X0C A;  4BG0 A;  4YTP C;  2YRF A;  1NGM B;  2WSF H;  1JTH B;  4GIF A;  5CCH A;  3HD7 D;  2W83 C;  1DIP A;  4IFM A;  1WMK A;  2W6A A;  3IAO A;  1XZP A;  2O01 H;  5TIS H;  1GS9 A;  2L6H A;  2XS1 A;  2L91 A;  5CCH D;  5DS4 A;  3M91 A;  2XRH A;  1J2J B;  1FTS A;  3G3Z A;  4N78 D;  3CXH H;  3C8V A;  4HE8 D;  2Q4F A;  4OIR F;  2WIT A;  4E17 A;  2CW0 F;  4JJG A;  2Y9Y A;  3NMJ A;  3II6 A;  2YLI A;  1GW4 A;  1JY2 O;  4Q5S F;  4BJ5 C;  1H7I A;  3OA7 A;  1BGY G;  1NTZ E;  2H89 C;  2RH0 A;  4LDR A;  1DD4 A;  1IW7 F;  2I8D A;  4N4W A;  1NU1 J;  2Y69 C;  1VLS A;  3NFQ A;  3HRN A;  1X9V A;  1VQ7 P;  2IBZ G;  2A06 E;  1PD0 A;  4PD4 H;  1SVF A;  2C03 A;  3RK2 B;  1RJ9 B;  4HH2 A;  1ZVZ A;  1VTM P;  1FNT c;  1M1J A;  4IFF A;  1K9M Q;  2P6V A;  4I6M C;  5KJ7 D;  3T6J A;  3KYJ A;  2PP4 A;  2QJY C;  4MVM A;  1KU2 A;  1OCC C;  3AEG C;  3WHN A;  3LS1 A;  4CDY A;  3RK2 D;  3RVY A;  1LI7 A;  3IQC A;  3O55 A;  5E79 E;  3AGU A;  3H2V A;  1BE3 D;  2A45 H;  4I1M A;  1L4A A;  2OEV A;  2M5A B;  1CZQ A;  3L75 J;  4YL0 A;  1Z7Q c;  5A69 A;  1URQ C;  2HFI A;  2YL3 A;  1QLE C;  3KKB A;  2P10 A;  1QSP A;  3LEO A;  1OWA A;  3CCS P;  1FDO A;  1EZV D;  1T3U A;  3EH2 A;  1VF5 C;  2XL4 A;  3PCV A;  1VPC A;  4AL0 A;  1TWG A;  2WSS H;  3GM3 A;  1KTM A;  2IZ0 A;  5L0C A;  3OW2 O;  1V55 C;  4W8P A;  1JB0 J;  3R2P A;  4BRY A;  1SQQ G;  1OW6 A;  1QL2 A;  1URQ A;  5T3T A;  3UMK A;  4RDA A;  1PIX A;  1LTA C;  2KNH A;  2PNO A;  2L81 A;  4EWC A;  2HOD A;  3FOP A;  3V2Q A;  5KAF E;  2Y9Z A;  2R9R B;  3GW6 A;  3L70 J;  2O1K A;  2H43 A;  1YZA A;  1OW8 A;  1L4A D;  3U2M A;  1BDC A;  1DEB A;  1NFO A;  4XPX A;  4I2L C;  4NPD A;  1H8A A;  4LLE A;  3GHG B;  1KB9 E;  5KLV J;  2HG5 D;  3DMD A;  3DWW A;  2J9B A;  3V5B A;  3H32 B;  3CCQ P;  2CNW A;  2OU6 A;  2Q7C A;  1SMY F;  3RK2 C;  5EGY A;  2ZFC A;  3VM6 A;  3V2N A;  2KIK A;  4E0I A;  4BXL A;  2W4B A;  1VQ8 P;  2NPS B;  2N1T C;  1WN0 A;  1J1D C;  1VQO P;  5E33 A;  1SQV K;  1BR1 A;  1OVU A;  5L0F A;  3ZVR A;  4M63 A;  5APQ A;  1G5Z A;  4C7O B;  4A7P A;  1QQ3 A;  2C9N Y;  4RES B;  1SQP J;  3I56 P;  4PJ0 H;  2YO3 A;  5CCG C;  2GUS A;  4DOJ A;  1JY3 N;  1NTK G;  1ZHZ A;  1SZI A;  2ZXR A;  3NXS A;  1SQV J;  5AW0 B;  1NAF A;  2DW3 A;  1RXQ A;  2O9X A;  2A06 D;  1LM3 B;  1LT1 A;  1EXJ A;  2L6F A;  2KYV A;  4XQ1 A;  2ZXX A;  3LES A;  3EGD B;  4YT8 A;  4JQ0 D;  1JUN A;  5E79 H;  2HMZ A;  1RF0 C;  4GOD A;  1BCC G;  4L75 A;  1Q86 Q;  3T97 B;  2KJG A;  2C04 A;  1GTW A;  5CJ0 A;  1TWA A;  1S5L H;  3A5T A;  5FZT A;  5GTI E;  5A6A A;  2KZJ A;  5TJH A;  3P32 A;  2W8Z A;  5JLI A;  3HD7 C;  2V26 A;  3K5B A;  3USS A;  4ZKP A;  3V2P A;  2AXT E;  1H0T A;  2SPZ A;  2FFH A;  2X51 A;  1YYX A;  4U5B E;  4H44 B;  3EH1 A;  1JY3 P;  1FZG A;  3GOR A;  5AW6 B;  1NTZ K;  4J7T A;  5TJ5 E;  3H1J J;  3OWT A;  5GPG B;  2AU5 A;  3VMY A;  4PJ0 E;  1Q0G A;  2IYO A;  2V4H A;  3FGA D;  2LSE A;  1M57 C;  1ZN5 A;  3DAG A;  2YNY A;  3L71 J;  3KPH A;  1MV8 A;  2QUP A;  1M8O B;  4OIO F;  1RMV A;  1H6G A;  1NVO A;  4PD4 E;  1L0N K;  4ASW A;  2YZS A;  1ZR2 A;  1UG7 A;  2C9L Y;  3SSU A;  1SQB G;  1NWQ A;  1VDF A;  1OKK A;  1L7C A;  3UNG C;  1D7M A;  3HTK A;  4I1L A;  4IL6 X;  3DJU B;  4CX9 A;  1JOG A;  4CS8 C;  3NMD A;  3EFO B;  1NYH A;  1W2W A;  3P8C D;  1EI7 A;  5BVZ A;  2N1T A;  3TDK A;  3UMI A;  1N7L A;  5K5G B;  2C0W A;  5JT4 A;  1YQ3 C;  1SLQ A;  5APX A;  3A0B E;  3GMA A;  2KK1 A;  4LAC B;  2BCC D;  4MVS A;  2Q9C A;  3IF4 A;  4CSA A;  1Z63 A;  1WRG A;  1KQG B;  3EQ2 A;  1ZHW A;  5CBN A;  3LUT B;  2LQG A;  1NKZ B;  2LR2 A;  3MYI A;  2OG2 A;  3H25 A;  1QEX A;  4GDO A;  3L71 E;  3RYL A;  1EC5 A;  2XLD A;  5KLI B;  4MW3 A;  1UII A;  1Q2N A;  3U1A A;  5KYX B;  3GEE A;  4C7O A;  3RGU A;  4MS2 A;  3W67 A;  3QMK A;  1RE3 A;  4U3F D;  1ZHT A;  3CCE P;  4ZMD A;  4MTF A;  3AEA C;  3FWL A;  5EK0 A;  2YVK A;  3HE4 B;  3BCC J;  3VMA A;  1Q0K A;  3RQG A;  1T6Q A;  1EKY A;  1SQP E;  3CX5 H;  1LKX A;  1NTM J;  1R4T A;  2KSE A;  3M4B A;  3H1L D;  1L2P A;  3SXK A;  2IBZ E;  1GU4 A;  4XFJ A;  1NTM K;  5A6J A;  3AE1 C;  3KDP B;  1EDJ A;  3L75 G;  2W6B A;  5KJ7 C;  3MLG A;  3CD6 P;  1NTM E;  4MTO A;  1SQX D;  1PD1 A;  1U0B B;  3L75 D;  1HBW A;  1HJ0 A;  1OR3 A;  5JUA A;  5B5E E;  4L73 A;  1BGY E;  4C3E A;  2R5D A;  3L37 A;  2EIN C;  4C3B A;  4DVZ A;  1HWT C;  1IZM A;  2R32 A;  1OQC A;  3ZQV A;  4AYC A;  3DXJ F;  3S28 A;  2M3E A;  1FJP A;  2FFD B;  2D2C C;  1S1C X;  3AGT A;  3CC7 P;  1SQV E;  2FYU E;  1BCC J;  1H88 A;  2BE5 F;  3M0D C;  3E1I A;  3EWK A;  2K9J A;  1L0N E;  1H0T B;  1BSN A;  2Q1K A;  4UB6 H;  2PP6 A;  4JVS A;  2K9Y A;  2R7O A;  2WT7 B;  4WY4 D;  3S9O A;  3WUV A;  1JRA A;  2EIK C;  1LT9 B;  2G62 A;  3CX5 D;  4YPC A;  3U2L A;  5DS5 A;  4JTA B;  1ZME C;  1JMW A;  3Q6N A;  2B89 A;  2QJK C;  5AVZ B;  2RSE B;  5CHX A;  3AG2 C;  2HR3 A;  3F46 A;  3L74 E;  2ZT9 B;  4WBA A;  1WAT A;  1NTK J;  3FWN A;  4PAC A;  4L6R A;  2R03 A;  3WOD F;  2C0X A;  2XDJ A;  1KYO E;  3VRC A;  1FC2 C;  3B5N D;  2WVQ A;  1E86 A;  1Q0M A;  2GUV A;  2QA4 P;  1NTK E;  3PP5 A;  3UR3 C;  1PP9 J;  4ZNC A;  5KLI C;  1RKC A;  4CS9 A;  1ORJ A;  1KNY A;  256B A;  3Q5S A;  1K40 A;  1SF8 A;  5KLV K;  2JKV A;  1SS1 A;  3P8C E;  3KZI E;  3DZA A;  1NZE A;  1V74 B;  3S90 A;  2WVN A;  1OMI A;  2ITA A;  1TQG A;  1IFJ A;  2R3S A;  3C8G D;  4OH8 B;  1BCC E;  3SFD C;  1Q0F A;  4ZLC A;  4IFD K;  2A6E F;  2B9B A;  2CPB A;  4IJJ A;  1NTZ D;  1PGP A;  1RJ9 A;  5F28 E;  4JW1 A;  3C18 A;  2RMZ A;  1VL2 A;  3FVY A;  1OVV A;  4HEA J;  3VP8 A;  4XLN F;  2J8W A;  1M90 Q;  2I1K A;  4CPG A;  3M1C B;  4EKW A;  3LS0 A;  1JTH A;  2NRG A;  1FZA A;  4DT0 A;  2GA1 A;  1M1K Q;  2XLM A;  1ZOY C;  2G8Y A;  1GL2 D;  3TUL A;  3EGX B;  5KJ7 A;  3G4X A;  4EOT A;  1NU9 C;  4PD4 I;  2PGD A;  3KHU A;  3RKO F;  3TK0 A;  1H9T A;  1A7D A;  2WSC J;  4ZKU A;  1DH3 A;  1SQB E;  1YDI A;  2FBW C;  1HJB A;  2WQY C;  3C8G B;  3M0D A;  1VQM P;  3GWL A;  1EZV I;  2NG1 A;  1N86 A;  3S29 A;  4KNV A;  1FAP B;  3GG2 A;  1ZHY A;  3QW1 A;  1ZP0 C;  3NMI A;  4LGD E;  5KTB A;  1GK4 A;  1WTY A;  3V4Q A;  5B1A C;  4CJG A;  5AVY B;  4KI2 A;  1V4A A;  3D71 A;  1CPR A;  3CEX A;  5BQI A;  3HKK A;  2P0N A;  2J9U A;  1ZRT D;  3JRM O;  3LEV A;  3V5Z A;  2E87 A;  1QVG O;  2JPU A;  4JRZ A;  1P84 E;  2OYO A;  4Q7C A;  2POH A;  3NG1 A;  2JP3 A;  4DXW A;  2FKW B;  2KW3 C;  5KYY A;  5KAF H;  4AUW A;  2WSE J;  3H1J G;  2VB6 A;  2WSC H;  4IB4 A;  4MVU A;  5IY5 C;  3T4R A;  3AEF C;  3VF0 A;  1RF1 C;  4U5C E;  4R32 A;  1HY5 A;  2XND H;  1IO4 A;  2WB7 A;  1PL5 A;  3ZTZ A;  5DQT A;  5AVS B;  2O3J A;  3Q5P A;  1USD A;  3RQE A;  2PAJ A;  1S4X A;  2MWQ A;  3H1H E;  2OYH A;  2E76 D;  4PV1 C;  1NTK D;  2Y0C A;  3ZDM A;  1PV3 A;  4LER A;  2KP8 A;  2QY9 A;  4YWQ A;  2WVR A;  4ZLD A;  3KXD A;  5BU5 A;  3RQF A;  4FX5 A;  4WGZ A;  1R5S A;  3SP1 A;  1RF1 B;  3SNH A;  4M3L A;  2J0X A;  3ZG1 A;  3G50 A;  1RF1 A;  3J06 A;  2OQM A;  2LXC B;  3TGU E;  1RE3 C;  4N6J A;  5L0H A;  3JYH A;  4G0H A;  5HV9 A;  1NOH A;  3AEE C;  1F1M A;  2DB4 A;  1VQ5 P;  2YMK A;  3V4W A;  5F5F A;  4PV1 B;  3B29 A;  2E75 C;  1Q0D A;  1HF9 A;  3ASN C;  4Z1M H;  4IAO A;  3W8H A;  2H8P D;  4BRY B;  4G7H F;  3AE7 C;  3K1I A;  4PD4 D;  1OCO C;  1TFO B;  2UWJ E;  2HJ3 A;  1K8A Q;  1VB5 A;  3OA1 A;  3X2Q C;  5AW2 B;  3I5Q A;  4LC1 A;  3ABM C;  4CBE A;  3F5H A;  3JC2 2;  3H65 A;  1BE3 J;  2A0U A;  1OFC X;  2V7Q J;  3UGP A;  1QLE D;  2L6G A;  1NTM G;  2YKP A;  3JCU E;  1A02 F;  1M56 D;  4EBB A;  1YJN P;  5KAI H;  1RQU A;  4QMA A;  2FXO A;  5DQZ A;  1HTL C;  3B5N B;  4ONS A;  1FZB A;  2P67 A;  1W2E A;  2Q5U A;  3QZC A;  3U8P A;  2J46 A;  5A6K A;  4IRU A;  3K6B A;  3U9J A;  1O87 A;  1MFZ A;  1N7S B;  1MND A;  3DM5 A;  5KKZ C;  3HNK A;  3CXH E;  2QE9 A;  2ZD9 A;  3DI5 A;  3FAJ A;  3O6Q B;  2HV7 A;  3O6X A;  5BU8 B;  1N7S C;  3SWY A;  1JY2 P;  4MW8 A;  3EFG A;  2YQY A;  2DYR C;  5KYX A;  5APS A;  1OX3 A;  2WVO A;  1RCP A;  2ZJS E;  2J58 A;  3L4F A;  1YYC A;  4YK5 A;  3A11 A;  4YXD C;  1JOC A;  2KLV A;  3JCU H;  1H89 A;  1CGO A;  4U3F E;  1FR0 A;  3I55 P;  4A4A A;  5A6B A;  2VCA A;  3B9Q A;  4XEV A;  4JUR I;  3CZ6 A;  1G2C B;  4RO0 A;  2R25 A;  5L3Q A;  1M1J C;  3VMZ A;  3DM9 B;  3CWB E;  4UB6 E;  3NTN A;  2H7O A;  3Q3D A;  3FDQ A;  1KN7 A;  1Y9B A;  4LDQ A;  2M0B A;  4H0L D;  5B1B C;  3IQ6 A;  1PPJ G;  3HJC A;  3ZSU A;  3H1I G;  5APW A;  4XWJ A;  4H44 D;  4WY4 A;  3Q7L A;  3AG3 C;  3LW5 J;  2OJQ A;  2CCY A;  1RKE B;  2E74 B;  4XPY A;  1LTI C;  3H1K G;  2I8B A;  1AVO A;  3JTL O;  1SQV D;  1R5I D;  3CC4 P;  3TGU J;  2QRX A;  3N24 A;  3NKD A;  2ZXP A;  3CXH D;  2L5G B;  3DE8 A;  2TMV P;  5H2F H;  3B5N A;  1BDD A;  3MTU E;  5B66 H;  4OGQ D;  1VLT A;  2LXB A;  1T2K D;  1FS0 E;  3CQZ A;  1L0N J;  4H44 C;  1NU1 G;  4XLP F;  2ZAE B;  2J0W A;  3IQ5 A;  4C3D A;  4NTB A;  3ZTM A;  3L72 G;  5KLV D;  4U5F E;  2E76 B;  3L72 D;  1AFO A;  1YVI A;  5AVV B;  3T6G B;  3I5C A;  1P84 I;  1HUC A;  1GU5 A;  3I5P A;  3L73 G;  4OWF A;  4ASV A;  1SQP K;  2QG4 A;  3TQO A;  3B5N C;  2NUP B;  2QJY B;  3UMH A;  4BJ6 C;  3A0H H;  1YHQ P;  1LTT C;  2FAP B;  3Q7G A;  5CI8 A;  3QH9 A;  2KK7 A;  4RKU J;  4UB8 H;  5D92 A;  2HPC B;  4KT0 J;  1JCC A;  1NHL A;  2FYN C;  3N7N A;  4IWB A;  4DJ9 A;  5KYY B;  2IPP A;  2KQ9 A;  4OGQ B;  2CNW D;  1RHZ B;  4CS7 A;  2IXM A;  3FHD A;  2H8A A;  2QTV A;  3JYY A;  1D1B A;  3ITF A;  2QM8 A;  3BCC E;  4OGQ C;  1YA7 O;  2AEF A;  2N1T D;  3EGD A;  3HUS A;  1ZV8 A;  1LP1 B;  2IXN A;  1CI6 B;  1JR8 A;  5CMZ A;  3AED C;  1TKN A;  3CXH I;  2OKU A;  3H1K J;  4KBL A;  1DOW A;  2FYN B;  2OYI C;  2R05 A;  2YIU C;  3TGU G;  4K3A A;  2M5A A;  1L4A B;  3LW5 H;  1KYO H;  3RL0 C;  2DYS C;  1R5L A;  1Y8A A;  3MIW A;  1SQQ K;  1CSB A;  1A41 A;  3EG9 A;  1NSG B;  4K35 A;  2Q3T A;  3EG9 B;  3SWF A;  4J7Y A;  2IXO A;  3MD0 A;  5DJT B;  3JRT A;  1YA9 A;  1FDI A;  2LKM A;  1CPQ A;  4MTG A;  2YL1 A;  2AXC A;  3ABK C;  1G4U S;  3WG7 C;  3IR9 A;  3PJS K;  4H0L C;  4O9B A;  3VOP A;  4XEK A;  3FAP B;  4ULV A;  1FMW A;  5DJU B;  5T1D B;  3B0V C;  2YKQ A;  1URQ B;  1LTB C;  3FXH A;  1NBB A;  4WAB A;  1ZHX A;  3ZDL A;  1T3J A;  1JMM A;  3LLK A;  2EPN A;  1VF5 B;  3M06 A;  4TLF A;  1FZE A;  3G4Z A;  3LLI A;  4B6I A;  1N7S D;  4DRH B;  2P58 A;  1YLM A;  1SQQ D;  3TOL A;  2PFD A;  2IBF A;  2I1J A;  3W8I A;  3MP7 B;  2ZT9 D;  3HNL A;  3WAQ A;  1N73 B;  1NTK K;  2NUT A;  4U9D A;  3E7K A;  3L70 E;  1A7E A;  2JWA A;  1SQX K;  2PX3 A;  2WWW A;  4PJL A;  1D1A A;  4DRJ B;  3AJM A;  2NPS D;  5L0D A;  1M7L A;  3ITK A;  1SQX J;  3AEC C;  2L9J A;  4JYB A;  4PJN A;  2V7Q H;  1KQL A;  4HKZ H;  3TJ5 A;  1BE3 G;  2NPS A;  4IGG A;  3EQL F;  4CIH A;  1GQA A;  1IFM A;  3R4Y A;  2WPR A;  3PLN A;  1A02 J;  4XTK A;  1L0L E;  4PR9 A;  1O3U A;  5CCG A;  3AQB A;  3GF7 A;  1Q81 Q;  3IHU A;  1EQ1 A;  4EI2 A;  1KIL A;  3HE5 B;  1BR4 A;  1K73 Q;  4CS8 A;  3U59 A;  3CWB J;  3HTK B;  1QKR A;  1VQP P;  3F89 A;  2A45 G;  1Y47 A;  4IAQ A;  1JY2 N;  4U7J A;  3GLM A;  4DCK A;  1AEP A;  3C8Z A;  2W9Y A;  3FMS A;  3KMI A;  4N6C A;  2XKM A;  3MGN A;  5L8R J;  3L75 E;  4NCQ A;  4YN0 B;  2AEJ A;  3H1I E;  1IFI A;  1FDM A;  4U3F J;  1KV4 A;  1SQQ E;  1ZXG A;  2OAR A;  4YT5 A;  5L3V A;  1ZRT E;  4NC3 A;  2LIG A;  2KS1 A;  1NFN A;  3H1K E;  1SQV G;  1OZH A;  1E2X A;  1VYI A;  2OEX A;  4EDF A;  2JO1 A;  1AQT A;  2PRR A;  5BQG A;  2HMQ A;  2YKO A;  1L0N G;  3BAS A;  2HV6 A;  2CK3 H;  1NU7 D;  5CIV A;  2WPQ A;  1ZLL A;  2ZYA A;  3MYF A;  3HD7 B;  2XV5 A;  1R8E A;  2BC5 A;  2DI3 A;  4E18 A;  2R7Q A;  1I4Y A;  5M1B A;  1PGQ A;  5CJ4 A;  3AE8 C;  4DOZ A;  4OVN F;  3U1C A;  1FFT C;  5KYU B;  5CCG D;  3E9V A;  1S9K E;  5APV A;  1EQ7 A;  4CDA A;  4EYY Q;  5DLJ A;  1LGH B;  2M64 A;  3M79 A;  3KZI H;  1NTZ J;  1Q90 D;  3RK3 E;  1E5W A;  3ASO C;  1T2K C;  4G78 A;  5L0G A;  1G4W R;  3GHG C;  3AG4 C;  4NPF X;  1KMI Z;  4W7Y A;  2PF4 E;  1SFC B;  2GAQ A;  4GKG A;  2BEZ F;  4O6Y A;  3ABV C;  3C1L A;  3LID A;  1LPE A;  3CSK A;  3RW0 A;  1U57 A;  1X0T A;  2IDB A;  4NY3 A;  3RL0 D;  4JKV A;  1OIP A;  2JWD A;  2K3R A;  3L35 A;  3ZWI A;  2A45 I;  1SP4 A;  3H1I J;  1T5O A;  3TYY A;  2WMM A;  2VC9 A;  1LTJ B;  4MVZ A;  2QVA A;  1E84 A;  1WWP A;  1HGV A;  5GTH H;  1HGZ A;  4BEM J;  3D6Y A;  3U5S A;  3HNI A;  1OCZ C;  4O6M A;  3TD7 A;  2YKZ A;  2MYS A;  2HPC A;  2R7R A;  3N4X A;  1MMN A;  1PP9 D;  2KGO A;  3F47 A;  2EIM C;  2K9J B;  5EHH A;  1GDT A;  2NPS C;  1PP9 G;  1YIJ P;  1LT9 C;  5JRA A;  1J8M F;  1GL2 B;  3G71 P;  5D91 A;  4D4X A;  2KS1 B;  2PFX A;  4BPM A;  3KQG A;  3C7J A;  1KIL C;  2ZPA A;  2BL2 A;  1BZ4 A;  2KNC B;  3T9O A;  2IYP A;  2B87 A;  1ORY A;  1ZW0 A;  1OKK D;  2QJP B;  1LTG C;  2KYH A;  1KYO D;  2CYD A;  4JZA A;  1WT6 A;  2K37 A;  3AE4 C;  4N06 A;  1NH4 A;  1L0L D;  1EXI A;  1OW7 A;  3ABL C;  1ZYR F;  1MNE A;  3O8Z A;  1ZR4 A;  2GWW A;  2M4E A;  1N2D C;  1LJ2 A;  1AUE A;  2L7A A;  1YJ9 P;  5B3I A;  4JC7 A;  2XU6 A;  1EZV G;  2NSG A;  1PPJ D;  4IL6 E;  2OQQ A;  1VQ4 P;  2GDC A;  3H1I D;  2W45 A;  5AW5 B;  1DX7 A;  4DVY P;  2O01 J;  2ASR A;  3C62 A;  3CAX A;  4EIY A;  3BCC G;  3MUD A;  1LTS C;  2ZYD A;  1P84 D;  4RJT A;  2YLG A;  3QTH A;  1CGN A;  5KYW A;  2J45 A;  4U5D E;  2XNX A;  2Y0E A;  1ZU4 A;  4DBQ A;  1HMD A;  4XPW A;  3BRT B;  4QI2 A;  3EJN A;  3S4R A;  1ST6 A;  2XXA A;  2R7W A;  2M3B A;  2KLU A;  2FFD A;  1TU3 F;  1AVO B;  4I7Z C;  2B0J A;  2WZ7 A;  4O7G A;  5AVU B;  1M2V B;  3ECS A;  1XTG B;  2IOQ A;  4PFO A;  2MKV A;  3H1H D;  1DOV A;  4A2N B;  2Y3D A;  1OXZ A;  4DJG A;  1BE3 E;  2E74 D;  4Z9J A;  2H7V C;  1KD1 Q;  3A2A A;  2Q9A A;  3L73 D;  3CMA P;  1TWH A;  2IZ1 A;  3O10 A;  2K88 A;  3BRV B;  1JEK A;  1L0L J;  2FXM A;  1QGK B;  5APU A;  2XLV A;  4GOE A;  5TIS E;  3RL0 g;  3C8G A;  3NYL A;  4I7Z B;  2FGY A;  2QEX P;  4LLH A;  2A69 F;  4NTF A;  1JPN A;  1S5L E;  4HFF B;  3RH3 A;  1VOM A;  3M15 A;  4CSA C;  2FYZ A;  2G3K A;  4Y28 J;  1FOS F;  1FOS E;  5KLV E;  2QJK B;  5JSL A;  1SQP G;  2XS8 A;  2ZXO A;  3E70 C;  2XL8 A;  3KL4 A;  1SQP D;  2KOG A;  2J9V A;  2NPU A;  3RF3 A;  2P7V A;  3SEO A;  1YZC A;  3KYQ A;  2W4M A;  3PMR A;  4B86 A;  2QLA A;  1YAR O;  5KYW B;  2P7J A;  3HUS B;  3LJB A;  2XLE A;  3LNR A;  3U3B A;  2UUH A;  1T6I A;  3E1R A;  4MND A;  2Y3B A;  2XLH A;  4IL6 H;  1KB9 I;  1EA8 A;  1QL1 A;  3SWK A;  1KFN A;  5APY A;  3VMX A;  2WL8 A;  1U6H A;  3ZQY A;  4JJF A;  2E75 B;  3A3Y B;  4K1O A;  3WU2 E;  4C7R A;  2Y39 A;  2AP3 A;  2H88 C;  2HZ8 A;  1U7M A;  1QZX A;  5E3C A;  4JPZ B;  4LDK A;  4K7B A;  1LNQ A;  3GEI A;  1FBM A;  1IFP A;  1OXK A;  3L71 D;  2Q9I A;  2QIW A;  1HMO A;  1FZF A;  1ZU5 A;  2A68 F;  2EPO A;  3L0I A;  3SYN A;  1YJW P;  4EHP A;  3L34 A;  5E3A A;  3NYM A;  1BGY J;  3V6I A;  1QVF O;  2LK4 A;  2Z5H A;  2E76 C;  4PV1 D;  1S05 A;  3CME P;  1JCD A;  2NUP A;  3H1L E;  3RK3 B;  2V3C C;  1J1E C;  5AW7 B;  4YL1 A;  5KKZ B;  2XXA B;  5B3S C;  2YO2 A;  1G2C A;  2QSI A;  4JTC B;  1IK9 A;  1LS1 A;  3DE9 A;  3GEH A;  4H54 A;  3H2U A;  2VCC A;  3GM2 A;  3BRJ A;  2J7P D;  2Z5I A;  1C17 M;  3DD7 A;  4RBN A;  1LT9 A;  2FYU G;  2QE7 H;  5EFW B;  3WUU A;  1CW5 A;  3LAY A;  3QWO C;  2HLO A;  1PZQ A;  2FYU D;  3B0U X;  1RE4 A;  2WZF A;  1ZZP A;  2CPS A;  1N7S A;  3H1J D;  1FU1 A;  1AJY A;  1GD2 E;  1Z5Z A;  2XM0 A;  4ER9 A;  3O6Q A;  2P1J A;  4MVQ A;  2KSJ A;  4GOF A;  1S72 P;  1P84 H;  2EIJ C;  1GMJ A;  3G6E P;  2J9W A;  4Z9H A;  2EPL X;  4JYC A;  1NLX A;  1L4A C;  3JSE O;  1KIL E;  3L72 E;  1PGJ A;  3R7C A;  5AW8 B;  5CCH C;  4YL3 A;  5JVE A;  1RE4 C;  4H13 D;  3TF5 A;  1LE4 A;  3MBG A;  2EIL C;  4CIP A;  1JNM A;  3Q5R A;  3A0H E;  3PHL A;  2IBZ I;  3PH0 A;  3MX3 A;  1CGM E;  3GWN A;  3L36 A;  5DVW A;  1IZN B;  4PK4 A;  4N78 E;  2O01 N;  1FMV A;  3NDB B;  1PCX A;  4P6I C;  1RQV A;  2KZI A;  5AVQ B;  3JZ0 A;  2IFN A;  1VMA A;  5AVX B;  3Q2Y A;  2EPK X;  2LD6 A;  4Q4Z F;  3CPW O;  4J32 B;  2BCC J;  5L0J A;  2N9Y B;  5AVW B;  1Y4C A;  1BCC D;  1MKM A;  5JP7 A;  4H13 B;  3AOU A;  3L72 J;  3H6P A;  3POV A;  2Q3E A;  1GK6 A;  5CI9 A;  1Y6D A;  2I15 A;  3V5X A;  3H1J E;  1PFI A;  3B8E B;  2R44 A;  2FYU J;  4W8K A;  1RY3 A;  3G4S P;  1D0Y A;  2XLW A;  4AL1 A;  3KH2 A;  2YHS A;  2HKV A;  3H32 A;  1MMA A;  3K1H A;  2PBE A;  1CI6 A;  1M56 C;  3MHV A;  2FYU K;  1FZC C;  4JF7 A;  4R4L A;  1HE1 A;  1C03 A;  4IAR A;  1TWC A;  4FES A;  1IC2 A;  1GW3 A;  1W2B O;  3A9C A;  4NPE A;  3QW0 A;  4O6N A;  4KNW A;  4U5E E;  3KPE A;  1WAS A;  2WSF J;  2RN0 A;  2MJZ A;  3H1L J;  4E0H A;  2R7S A;  2CGE A;  5L0I A;  4BJ6 A;  3S27 A;  1DEE G;  2IBZ D;  2ICW G;  4BWN A;  4C7N B;  1SQQ J;  1HH0 A;  1ORS C;  1BDJ B;  3JCU Q;  1FZC A;  2GA0 A;  2D4U A;  3QVZ A;  1EZV E;  1GZL A;  2A0B A;  1FAV A;  2BAS A;  2W90 A;  3Q6M A;  4XA4 A;  3L73 J;  4U5G A;  4PJJ A;  2Y3G A;  3B0P A;  1OVR A;  4Z9I A;  4I1O B;  3EZI A;  2WZG A;  4UDV A;  1JY3 O;  1NU1 K;  1NTZ G;  3HUS C;  1T6A A;  2J5U A;  4OD5 A;  2R7X A;  5AC4 A;  2CDQ A;  1UIX A;  3US6 A;  3CLQ A;  4UB8 E;  2VH3 A;  4E7S A;  1D1C A;  2YWA A;  2E75 D;  3V7O A;  4CS9 C;  2R02 A;  3ZC4 A;  2OYI B;  2GM4 A;  4DRI B;  1BSH A;  1T01 A;  2LCH A;  4O79 A;  2RKL A;  1LE2 A;  1RKE A;  3AEB C;  1RF0 A;  3L71 G;  4WWI A;  2W27 A;  3TNU A;  3CI9 A;  2HYN A;  3WUT A;  1X79 B;  2OCC C;  3GAN A;  3TOM A;  3AE6 C;  4D6T E;  4WB4 A;  1IJD B;  4U3F G;  4WVZ A;  1YAU O;  2A1D D;  2LFD A;  1Q82 Q;  3B4S A;  3L1M A;  2ZXE B;  1A7V A;  4KC9 A;  2KC3 A;  4MVO A;  3H1L G;  1L3P A;  4AE4 A;  3EFF K;  1VYK A;  3W68 A;  4X0R A;  3M9B A;  2FXP A;  2YLD A;  5CBO A;  1PPJ E;  1YBK A;  2YL0 A;  1SQX G;  2PX0 A;  5AW1 B;  3X1O A;  4R4M A;  3EPV A;  1NO4 A;  5BUO A;  3N0T A;  3LNM B;  2ZT9 C;  1LVK A;  5AW9 B;  1FZC B;  4OD4 A;  5AVT B;  2Q6Q A;  2IFM A;  1YYJ A;  4IOI H;  1Z3I X;  2NSF A;  3HTK C;  2P1A A;  2YIU B;  2N1T B;  1T9K A;  3VTP C;  1EDL A;  2ZVN B;  1S2E A;  1O5H A;  3M0A A;  3FXD A;  3CWB D;  4F4B A;  1QPU A;  1E83 A;  1C02 A;  3FOO A;  1YJG A;  3PDM P;  4L76 A;  2OYI A;  2OOC A;  1EDI A;  2G3A A;  5JS5 A;  4BJ1 A;  4BEJ A;  4D6T D;  3T97 A;  4FWV A;  1YTZ I;  1E79 H;  2R5B A;  2OTL P;  4GEH A;  4GQH A;  3CCL P;  3JSZ A;  1WOL A;  1AVY A;  1SQB J;  2B0H A;  1VF5 D;  2JDI H;  3L73 E;  3AE9 C;  3K7D A;  4TT3 H;  2OJE D;  3AG1 C;  4P9T A;  2IYL D;  2HS5 A;  5APT A;  2HSB A;  3EGX A;  3CCV P;  1UFB A;  5T3W A;  1VQ9 P;  1URQ D;  2Q7R A;  2WSE H;  3HE4 A;  4JEA A;  1NU1 E;  1XTC C;  3WMM 0;  4W80 A;  1EDK A;  2MHR A;  1OCR C;  1SQB K;  3L74 G;  1NAY A;  4DBR A;  2IXP A;  3BAT A;  2OYH C;  1GGQ A;  1KOR A;  3HLZ A;  1VQL P;  3IN6 A;  3MFN A;  2M8R A;  3VYI A;  3C9I A;  5COF A;  1NG1 A;  3VP9 A;  3BVH A;  3VYW A;  1M57 D;  1MMD A;  1M2O A;  2WPV B;  2R7U A;  2HOD B;  2Z4E A;  3AQC A;  4WJ0 A;  3O39 A;  2BEQ D;  2KI7 B;  1SFC C;  1OXB A;  3VN0 A;  2XSE A;  3DKA A;  1FJK A;  2E5Y A;  2O1J A;  1J1D B;  4C46 A;  4NTA A;  1S9K D;  1J8Y F;  3NKE A;  1TFK B;  5KAI E;  1L0L K;  5B5E H;  1MMG A;  1TR2 A;  4ULW A;  1LTJ C;  1QVX A;  2KSF A;  3N2Z B;  1M2V A;  3GHG A;  3RK3 D;  2B88 A;  3ATP A;  4RD9 A;  1Q7Y Q;  3SXZ A;  2EPM X;  3RK3 C;  4YT4 A;  3K1I C;  2JR8 A;  4N3Y B;  4D6T J;  1MUU A;  3IQT A;  3L8I A;  1U89 A;  1H9G A;  1SFC A;  1SQB D;  1W5C E;  1Z23 A;  2YEV A;  3K33 A;  4HYT B;  2E5T A;  3D70 A;  2ZVO B;  1KQS O;  4JCZ A;  3M9H A;  3TGU D;  4QDL A;  2OTJ P;  2JJL A;  2F22 A;  3SFE C;  2XLO A;  4JTD B;  3L74 J;  3BEH A;  3EZH A;  4PFP A;  3LIE A;  4XEF A;  2JX0 A;  4L74 A;  3DAF A;  1KB9 H;  2R3C A;  1K05 A;  4HB1 A; 
#chains in the Genus database with same CATH homology
 2D2C D;  3AED C;  2G3A A;  3AEG C;  3Q5P A;  4U7J A;  1K40 A;  3GLM A;  1ZZP A;  3Q1M A;  1AJY A;  4XEV A;  3RQE A;  5L8R J;  3H25 A;  2Q00 A;  3O6Q A;  2E74 C;  4GDO A;  4EBK A;  1OMI A;  3AE4 C;  3AE3 C;  1WOL A;  2E76 D;  4PV1 C;  2YIU C;  3GM1 A;  3C8G D;  4NQF A;  3SFD C;  1PV3 A;  1EXI A;  1GMJ A;  1EXJ A;  1VF5 D;  2L6F A;  1OW7 A;  2J5U A;  2NZ2 A;  5F28 E;  3AE9 C;  3K7D A;  3Q3D A;  4TT3 H;  1UIX A;  3RQF A;  3G9R A;  3C18 A;  1ZRT E;  1Y9B A;  1VL2 A;  2P10 A;  1KIL E;  2HSB A;  2YWA A;  2E75 D;  2QJP C;  3AEA C;  4H0L D;  1UFB A;  1FDO A;  3RQG A;  2JO1 A;  1VF5 C;  4H44 D;  4H13 D;  3T97 B;  3GF3 A;  3LW5 J;  1FDI A;  1R8E A;  3AE5 C;  3AEE C;  2OQQ A;  3Q5R A;  5M1B A;  1DD3 A;  2D2C B;  2YMK A;  3AEB C;  2E74 B;  2E75 B;  3AE8 C;  4H0L B;  3B71 A;  3GM3 A;  1KTM A;  1KOR A;  2O01 J;  3IN6 A;  4PV1 B;  2E75 C;  4H0L C;  1JB0 J;  4XFJ A;  2H88 C;  3MFN A;  4EBJ A;  4YTP C;  1HF9 A;  4XEK A;  4Z1M H;  1NGM B;  1OW6 A;  1RQV A;  3AE1 C;  1DIP A;  1ZOY C;  2G8Y A;  3AE6 C;  3AE7 C;  4H44 B;  3TUL A;  3JZ0 A;  2WPV B;  1WMK A;  1Q90 D;  1PIX A;  3Q2Y A;  3RK3 E;  4OGQ D;  1HJ0 A;  3IAO A;  3U3F A;  4H13 C;  4H44 C;  1VF5 B;  1MKM A;  2BEQ D;  3FGA D;  2L6H A;  2QIW A;  2WSC J;  3AE2 C;  1KMI Z;  4H13 B;  2BEZ F;  2V7Q J;  3ABV C;  1OW8 A;  1S1C X;  2D2C C;  1KQF B;  1TU3 F;  2L6G A;  4I7Z C;  2FBW C;  3C8V A;  2WQY C;  3EWK A;  3C8G B;  1U57 A;  2E76 B;  2IDB A;  3U0C A;  2ZT9 D;  2LK4 A;  1QVX A;  3D6Z A;  2K9Y A;  1RQU A;  3L8J A;  2MKV A;  2E76 C;  4PV1 D;  2FXP A;  1ZP0 C;  3S9O A;  2E74 D;  1WWP A;  1S5L X;  3AJM A;  3D6Y A;  4R4M A;  1WTY A;  2PBE A;  1ZME C;  1V4A A;  3D71 A;  2H89 C;  3AEC C;  2QJK C;  3L8I A;  4R4L A;  3O10 A;  2ZT9 C;  4IL6 X;  2JPU A;  1JOG A;  1DD4 A;  2ZT9 B;  4RKU J;  5KKZ C;  4KT0 J;  2FYN C;  1NYH A;  2QSI A;  3D70 A;  3RL0 g;  3C8G A;  2JP3 A;  4I7Z B;  4OGQ B;  2WSF J;  2WSE J;  3R4Y A;  3SFE C;  1K04 A;  3JYY A;  3GM2 A;  1YQ3 C;  4OGQ C;  1O3U A;  4XEF A;  3BRJ A;  3AEF C;  2JX0 A;  3GMA A;  2KK1 A;  4YXD C;  3GF7 A;  5KLI C;  4R32 A;  1IK7 A;  1KNY A;  1YQ4 C;  2QJY C;  1K05 A;  4Y28 J;  1KQG B;  3Q5S A;  1PL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...