1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
b'NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
2L6HA 2WQYC 2PBEA 3AECC 3AE6C 1KTMA 3AE4C 3L8IA 3C8GB 3AE5C 2KK1A 3U3FA 3O10A 1UFBA 2JPUA 1ZZPA 3AE2C 2H88C 3AEBC 2L6GA 3B71A 1O3UA 2FBWC 1WTYA 3RQFA 3U0CA 1K05A 3BRJA 3AEGC 2L6FA 3GM2A 1PV3A 2YWAA 2Q00A 2HSBA 4EBKA 2H89C 3RQEA 3TULA 1K40A 3GM3A 3SFEC 3C18A 3GM1A 3C8GD 3S9OA 1QVXA 5F28E 4YXDC 3AE3C 1KNYA 3AEDC 4YTPC 4XEFA 3L8JA 1OW8A 3AE1C 1OW6A 3MFNA 1K04A 3AE9C 3AEFC 1WWPA 3ABVC 3AE7C 3AEEC 1V4AA 1YQ4C 3SFDC 3AJMA 1JOGA 2JX0A 2LK4A 3JYYA 4EBJA 1ZP0C 4NQFA 1YQ3C 1OW7A 4XEKA 3C8GA 4XEVA 2G3AA 4R32A 3AEAC 3AE8C 1ZOYC 3K7DA 3RQGA 1WOLA 3JZ0A
chains in the Genus database with same CATH superfamily
2WQYC 3JTLO 1EDJA 4MNDA 1ZRTD 1LP1B 1Y6DA 1YYJA 4J7YA 3E70C 3H1ID 1Q0DA 4E0IA 4TT3H 1UIIA 3HD7C 2IM8A 1SR2A 3MUDC 4PFOA 3UNGC 1MNEA 3CX5I 3M1CB 1LTJB 2HS5A 3EFOB 3RBXA 3AE2C 4D4XA 2M0BA 5CCHC 2RN0A 4I7ZB 5H2FH 1M1JB 1L0ND 2Y0DA 4A7PA 3G4ZA 3EHMA 3OEOA 1N7SC 1ZHZA 4WGZA 3WHNA 4BRYA 1NU1K 3HUSC 2PP6A 3TK0A 3TSIA 5CBNA 1LVKA 4I1MA 2Q7RA 1XZPA 3L73J 2YL1A 1VL2A 1X0TA 5JLIA 4IFMA 3GHGA 1SQQE 2BCCE 3VAYA 2CW0F 3VP9A 3CCLP 5GPGB 3I56P 2M4EA 1H6GA 1ZHYA 5APWA 1PD1A 3TULA 1SP4A 3CEXA 3SZRA 2GA1A 4FAPB 1SFCD 2C03A 4H13D 3FXEA 4I3MA 5JUAA 3FXDA 2FYNB 2B88A 2OYHB 3EGDA 1EZVE 1RQVA 5TISH 4AE4A 3AE3C 2R9RB 3AEDC 3NDBB 2K88A 5CCGA 3EH2A 4U3FG 1KC8Q 3PH0A 3L72E 3VYWA 3Q7LA 1SQBD 2A45I 3VMXA 4U5CE 2P2UA 1J1DC 1V4AA 2J9BA 5E79H 2AWCA 3EHNA 3TGUE 1K8AQ 3OJAB 1IZNB 3VYIA 1NZEA 1CGNA 1T6IA 2KZIA 3MYFA 3WAQA 3JSVC 3CCMP 5CJ4A 3RK3E 1LIHA 1R5SA 1W2EA 1M6TA 5EK0A 1BCCE 1NGMB 2B87A 4WVZA 1RF1A 4J7TA 2KB7P 1HGZA 2O01H 2L5GB 1M56D 1SQVJ 3LLKA 1SFCC 4H13C 3AOUA 1BE3D 1DEBA 1BR1A 1KILB 2HUJA 3HRNA 3D71A 2NSGA 2PNOA 2KSJA 3A0BE 3G3ZA 5APUA 1GU4A 2WZ7A 3PLNA 1O3UA 2FBWC 3L37A 4YXWH 2EPLX 4BJTA 5KYXB 1NU1E 1PP9G 2WZLA 1JY3O 3SXMA 3TGUJ 2OJQA 1G4US 1S5LE 1SYQA 3N0TA 3B0PA 3MYIA 1JAFA 3BCCE 1A7VA 3TJ5A 2N1TD 4D6TE 3NYMA 3RYLA 2J8WA 2RKLA 3ECSA 3U8PA 2WZGA 4QDLA 3KHUA 1S4XA 1OR2A 3GW6A 1N73B 3SYNA 5DS5A 1OCZC 2L7AA 3H1JJ 1NFNA 4YK5A 4AL0A 2M3EA 3AQCA 3L74E 2CPBA 4I1LA 1EXJA 2KNCA 1SQXE 2WMMA 2OYIC 5B66E 2CNWA 2G3KA 1HMDA 3HTKB 2YXRB 1M56C 2C04A 2LR2A 5JT4A 4CSAC 1J1EC 1KNYA 1FZCC 2WZFA 1NTKK 2XLWA 2XS8A 2W27A 3H1KG 2I8BA 1NTME 1LTBC 2KUBA 3CCQP 2Q3IA 1ZHWA 4DOJA 5AVQB 3LNMB 4OINF 4Y99C 2A69F 1G8XA 3AJMA 4KNVA 2QLAA 2J9VA 1N1CA 2XLHA 1JTHB 2KXPB 3BCCJ 4OGQB 2OYOA 1RE4C 1YAUO 2YIUB 4NQFA 1ZW2A 3KYQA 2R7XA 1QL1A 3TQOA 3E1IA 2N1TC 4CS7A 1ZHXA 3SXYA 3LAYA 4PJMA 3DD7A 2AXTH 1AA0A 5AW2B 4LDKA 5AW0B 4PV1B 1E86A 1SQXJ 3H1HG 4YJWA 1D0ZA 1SMYF 1WN0A 3X2QC 1FS0E 1SQQD 2BCCD 2NPSA 3AE5C 1P84D 2K37A 4XLPF 3U3FA 3AGUA 3NXSA 1K9MQ 2IYOA 3KZIH 1JUNA 1NTMJ 4I7ZC 2EPMX 1Q86Q 2YLIA 3L0IA 1M1JC 2Y3DA 3LESA 5KYYB 1EZVD 1WMKA 3JCUH 1PPJE 1RKEA 4IWBA 5H2FE 2N9YB 3OWTA 3DMDA 1L0LK 2YWAA 3GM2A 5APYA 1DOVA 1KD1Q 5B3IA 3SNHA 2M5AB 2AWYA 4KHXA 3P8MC 2H7BA 2BEQD 4K35A 2FYZA 3GF7A 3HNLA 2CPSA 3EFGA 2YLDA 1GS9A 5KJ7C 2OTJP 3ATPA 3V2RA 4IL6X 4MTOA 2YKPA 3C62A 2AEFA 2HMQA 4K3AA 1KILD 2FYNC 4Q5SF 3GM1A 1KYOD 2OYHC 1S1CX 3M9HA 1TWAA 2WSSH 3RVZA 2O3JA 3GF3A 1PGQA 2ETSA 3LJBA 1URQA 2W6BA 1Y4CA 1Q0KA 1VQ6P 5TISE 4U5HA 3KL4A 3H1KD 3SXKA 5GTIH 4OIOF 1LJ2A 3S27A 4Q7CA 3AE9C 3A5TA 3L34A 1JY2N 2QSIA 2MJZA 3V6IA 1LTIC 5E3AA 5JRAA 3B5NA 1U0BB 3PJSK 1NYHA 2XL8A 3GORA 1FZEA 3TOMA 1C03A 3CX5H 5E79E 2R7QA 2I8DA 1LTSC 1GL2B 2H8PD 3F5HA 1N7LA 1NTZJ 3AGTA 3LS0A 3Q6MA 1NU1D 3AQBA 3C8GA 1RJ9B 3AEAC 3H32A 3QMKA 2Q9BA 5KAFH 1HUCA 1ZOYC 1FE6A 3K7DA 3VF0A 2A06G 4JJFA 3FWNA 3H1HD 3L4FA 3D70A 4C7NA 4HB1A 1A02J 2I1JA 5AVXB 1EXIA 2Q3EA 3LUTB 2TMVP 1KILC 5AGFA 2JO1A 4EWCA 4R4MA 2PF4E 1IFJA 1OX3A 2E5TA 5K0IA 2XM4A 3KMIA 5A6BD 3L74D 1D7MA 4N4WA 1ZR4A 1NAFA 1JMWA 1VF5D 1HJBA 2LP4A 3TYYA 1Z7Qc 3UMKA 1TFOB 1L0LE 1NTKG 4Z1MH 5GTHH 2ZYAA 2FYUE 4EHPA 1CGME 1YYCA 3AG1C 4GOFA 5L3QA 3LNRA 3CXHH 5B1BC 2FKWB 4U5GA 1AFOA 4N06A 5KLVK 2ZVNB 3NRHA 1T9KA 2VB6A 3H2VA 2X51A 1LPEA 4LLEA 4PFPA 1N73C 1VLSA 3CSKA 3WG7C 1OZHA 2IOQA 4ZKUA 2YKQA 2A45H 3DXJF 3TK1A 1ZV8A 3M0AA 2G3VA 2IX7C 1JEKA 4CPGA 3SFEC 3CI9A 2CCYA 4W7ZA 2VRSA 5T1DB 5F5FA 3R7CA 4N78E 1CGOA 3HTKC 1N7SB 5L0HA 1QVXA 5A6JA 3L35A 2N9BA 4CJGA 2IZ1A 2H43A 1D1BA 4OH8B 1JMBA 1V54C 2G8YA 4XPYA 2KJGA 5BQGA 5C39A 2VASA 1EDKA 3L71J 3R2PA 1M57D 2NUPA 3O39A 5E33A 2E75D 1O87A 3L75J 1H7IA 2PX3A 2BASA 1VQKP 1OCCC 1VF5C 3S4RA 3POVA 3M06A 2PAJA 1ZU5A 2FYUJ 3ASOC 1IFNA 2FAPB 3CCJP 1WT6A 2W45A 1JRAA 2P6VA 5CIVA 3IQCA 3EGXA 5DS6A 5KYWA 4EBJA 2KSFA 2YIUC 2GM4A 3EG9A 1H9GA 2I15A 3U5SA 1HF9A 3ABKC 3CMAP 1PPJD 4K1OA 2YNYA 1NKNA 1H89A 1FTSA 2A06D 2M64A 1HH0A 3IEEA 4OIRF 4BJ5A 5T3TA 3FOOA 3K1IA 3T4RA 2XXAB 1BDCA 2AXTE 3MP7B 3L36A 1GQAA 4J30B 2RH0A 3U9JA 3USSA 4H44D 5M1BA 3N7NA 2HJ3A 1B68A 3AE4C 2HMZA 4LLCA 1CI6B 1JMMA 2QUPA 4JCHA 4L74A 1UFBA 4NPFX 4HEAJ 3QVYA 1R5ID 2XDJA 1FZBA 1BR4A 3RGUA 3GLMA 2LXBA 3B71A 1PCXA 1WGWA 3UMIA 3HNKA 2XL6A 1M57C 4YT8A 4DVYP 1RQUA 3N4XA 1D1CA 2E75C 4WWIA 3KZIE 4X0RA 2RSEB 5B1AC 2OEXA 4G0HA 1NTKD 1ORJA 1SFCB 2WT7A 2BC5A 3OA1A 1GL2D 2RMZA 5KLVE 3B8EB 1H0TA 3PRJA 3BASA 3JCUE 4YT5A 5A6AA 4EBKA 2FXOA 1OFCX 3DJNB 4L6RA 4W8KA 1YA7O 4HKZH 4YPCA 3II6A 2NPSD 1OVRA 2WWWA 2JP3A 2YEVA 3GODA 3HE5A 2LCHA 4WY4A 4ZMDA 1L0NG 2W6AA 3GEHA 2XLDA 4M3LA 1G1JA 4CS8C 4JKVA 1VQ4P 2WITA 4JIOA 4CDAA 5KLIC 3SWYA 3EFFK 4EIYA 4H44C 4YN0B 4U5FE 3GWNA 4MVOA 1ZLLA 2H8AA 3IQ5A 5D92A 1OW8A 4BWNA 5EHHA 3IFMA 5AVTB 3P8CE 3W67A 1LTJA 2GA0A 1BDDA 2XNDH 3EFOA 2KNHA 4RESB 2YL7A 2Q7CA 5KAIH 4C7OB 5GTIE 2ZPAA 1OKKD 3N2ZB 3LLIA 2OYIB 1YYXA 3H1LG 3A7OA 3NKDA 1SQVK 4IAOA 1GL2C 3Q6NA 3P32A 4I44A 1OW7A 3CX5E 2G3AA 1LE4A 1X9VA 3EZHA 1LT9A 4NPEA 3KKBA 3FWLA 2HJMA 1X79B 3KPEA 1GGQA 4IOIH 2F22A 3AECC 5KAFE 2YO2A 1XWJA 2YVKA 3HE4B 1XZQA 5HV9A 2ZD9A 2XV5A 4OD5A 1VLTA 4IB4A 3O10A 2QJKC 4KNWA 1Z56A 3L73E 256BA 3CLQA 4WJ0A 1VB5A 5AC5A 2HODA 3AEBC 1ZW0A 2LKMA 3PDMP 4UB8H 4MQ9F 2WSCJ 4UB6H 2R7SA 1XTCC 2GWWA 3IQTA 2W83C 3BRJA 2K9JA 4BEMJ 3L70J 1U57A 3T97B 5AW9B 1T6AA 4QI2A 3DE9A 2P7JA 3CL3D 2R7TA 1BE3G 2DYRC 1PGPA 3WMM0 1D0XA 5GTHE 3CCUP 2L9JA 2FXMA 1RY3A 2H7OA 3CXHE 3I5PA 2V7QJ 1PD0A 1SQPE 3MBGA 4BG0A 2FFDB 3JC22 1EDLA 5BQIA 3SXZA 4ANJA 1HTLC 2MKVA 4GOEA 1JNMA 2KYHA 2NUTA 1MFTA 3M0DA 1L2PA 2QEXP 4K0DA 2KW3C 3UMHA 4Q4ZF 2Y3HA 2KLUA 4TLFA 4BJ6C 4DBRA 4IFDK 1FOSF 4CX9A 4G7ZF 1WASA 2QJYB 1NU9C 1RCPA 1GDTA 2IXOA 4N6HA 4O6NA 4L73A 1BSNA 4PD4D 2MWQA 2WSFJ 3CCSP 3ABVC 1UG7A 2XLOA 1SQVE 2VH3A 3JCUQ 3H1LD 1RF0A 1JOGA 3GANA 2Q5UA 3O6QB 2E43A 2LK4A 1SQXK 1SF8A 1L4AB 5L3VA 4DJ9A 2R5BA 2A0BA 1JPNA 3EWKA 3FXHA 3EH1A 4XEKA 2Y3GA 2QTVA 1SQPJ 2YO3A 1JOCA 2POHA 4U3FJ 1HW2A 5KLVD 2R44A 1ZR2A 1NTMK 3IHUA 1PP9E 1GW4A 4J32B 4KI2A 4XQ1A 1J2JB 4PR9A 2NPUA 4GIFA 3MX3A 5AVRB 4JTAB 1G5ZA 3T6JA 4MTFA 3A9CA 3W68A 2Q3TA 1KB9D 4MW3A 1BSHA 4YWQA 1KMIZ 5AW1B 1MFZA 2JWAA 5DLJA 1AVYA 4NTFA 3X1OA 3H1JE 3ZTMA 2Z5HA 4DCKA 1R4TA 1LWUC 3IN6A 5CHXA 3V5XA 1KQLA 1E85A 3TF5A 1QQ3A 1PGOA 4LGDE 3QWOC 2Q00A 2HSBA 3M4CA 1IFMA 4DXWA 1SQQG 2BCCG 2GAQA 3P8CD 3DKAA 4N6CA 2KS1A 2ZYGA 1P84I 4JJGA 3HNJA 1S05A 4ONSA 3JRMO 1HE9A 5JS5A 3RK3B 2M3BA 2B0JA 2Z5IA 1JB0J 1KN7A 2KGOA 3U8VA 1YJNP 1ZW3A 3W8IA 2LFFA 1ZXGA 4HYTB 1QVGO 1NU7D 1PGJA 1EZVG 1EZVI 1PP9J 3KPHA 3GEIA 1AVOA 1F1MA 3GHGB 2FGYA 3VM6A 1VQPP 5F28E 1YLMA 4MTGA 2WPQA 4JYCA 4GEHA 1M2VA 3L72G 4D4NA 2Q9IA 1MV8A 3G50A 2R7VA 1DD4A 1S9KD 1NTZK 2DW3A 2OGUA 3TGUG 2Z4EA 3EGDB 3ZVRA 1ZN5A 3AE7C 4WB4A 1GM5A 3DAFA 3SFDC 3I4UA 1M1KQ 1RHZB 2X0CA 3B0VC 2CYDA 1KYOI 1AJYA 2E74D 3L73D 2XKMA 5KAIE 3CCEP 4YT2A 2V3CC 3M15A 1QZXA 3E9VA 2AP3A 5CMZA 2YMYA 1ZP0C 4WY4D 1YQ3C 1T6UA 1DOWA 2Y39A 1BCCG 4G78A 3AE8C 1D0YA 3Q7GA 1YHQP 5TJHA 5CBOA 3RQGA 1WOLA 1AEPA 3PCVA 2KI7B 2P1AA 1VF5B 3VP8A 1W5CE 2W6JH 3UIAA 3CXHD 4CDVA 3I5QA 4B6IA 3RW0A 4H54A 3A3YB 3VTPC 2R25A 3O55A 1ZZPA 1NO4A 1D1AA 4GYTA 3SSUA 2L6GA 1RF1B 1QX8A 1HBWA 4G7OF 2E76D 1NU1G 2GDCA 5BU8B 3RQFA 2J7PD 3G4XA 2ZFCA 2HPCA 1ZMEC 3UGOA 3ZQVA 4UB8E 4UB6E 4C46A 1O5HA 1RE3C 2ZXPA 1L4AD 3BCCG 5COFA 1E83A 4D6TG 3QW1A 1YITP 3HNIA 3A2AA 1J8MF 4I1OB 1NBBA 3V2NA 2E74C 2IDBA 2H89C 1Q82Q 3L1MA 5APVA 4PJ0H 3F46A 3H2UA 3IF4A 1FMWA 3L74G 2R7UA 3CZ6A 2FFDC 1KQGB 1SQVD 1SQXG 1RJ9A 1JCCA 2ICWG 2E75B 1G1IA 3W8HA 1Q81Q 3S9OA 2R03A 4JVSA 4ASWA 1OIPA 2W9YA 4Y28J 4YXDC 3QH9A 1I5NA 2FYUK 1VYKA 5BUOA 3L72D 2UUHA 2MHRA 1GW3A 4XEFA 1NTMG 1BZ4A 2QJYC 1NTZE 1HY5A 3B9QA 3ZWIA 2KNCB 4PJJA 3TGUD 2CK3H 3B4SA 4MVMA 2KQ9A 1NWQA 1OCRC 2O01N 1YQ4C 2QVAA 1MMDA 4JURI 1GTWA 3RL0D 3ITFA 1QEXA 4MVRA 3PTZA 2PFXA 3KDPB 1L4AC 1T3UA 2AU5A 4MS2A 3ITKA 2SPZA 4I2LC 5KLIB 4H44B 3RK3D 3GWLA 3S0XA 5KKZC 3Q5RA 2WSCH 1HWTC 4RBNA 4GDOA 1BCCD 3HD7A 5EFWB 3FMSA 4JC7A 1USEA 3MUDA 3VMYA 3SWKA 3CAXA 2J46A 3ZDLA 1C02A 3MTUE 2L6HA 3U1AA 2FY8A 3ASNC 4CS9C 1EQ1A 5CCHA 2B0HA 3ABLC 3RF3A 2YQYA 4PJNA 4AQRD 1KV4A 3L8IA 1N7SA 1L3PA 2V7QH 3HUSA 3SP1A 5KTBA 3B0UX 2XLVA 5FZTA 1FFTC 2XU6A 1PPJG 1OMIA 2IFNA 1N86A 2NPSB 1YJ9P 4IL6H 3NTNA 1ZHTA 2PP4A 3KH2A 2QA4P 5CCGD 2IBZE 2OTKE 3WODF 1E84A 5L0IA 2Y0CA 3BCCD 1ZU4A 4D6TD 2ZXEB 3V7OA 4KJMA 2WB7A 3HJCA 2ZJSE 2QJKB 1DD3A 3RVYA 5JVEA 3CWBE 3L71E 3RK3C 2UWJE 3V4WA 2WSFH 2FFHA 4O6YA 3L75E 1SQXD 1RKEB 3FOPA 4UDVA 2AXCA 2AEJA 3TNUA 5HSWA 2ITAA 3GHGC 1VQMP 2XM0A 2QNLA 2FXPA 3T6BA 1NTMD 5L8RJ 4U5BE 1CI6A 1GK6A 2C0WA 4EKWA 1NJIQ 5EGYA 1KZUB 4OIPF 3Q1MA 2KC3A 4RD9A 1FOSE 1CPQA 2KZJA 3V2PA 5CCGC 3JYYA 1VOMA 1SFCA 3QTHA 1AUEA 5B3SC 3CWBJ 3FAPB 3SWFA 2KK7A 3RIPA 3B5NB 2IYPA 4MVQA 3FHDA 5BU5A 1BGYE 2LQGA 4XTKA 4ZLDA 1HMOA 2JWDA 4FESA 3W4YA 2ASRA 3JT1A 1VQLP 4XWJA 5KYUA 1OQCA 2H7VC 3GMAA 1ZRTE 1P84H 3C8GB 4MN4C 3H1IE 1MZ9A 1U7MA 2QIWA 1RF1C 2CNWD 2H88C 2OQQA 3T9OA 4PJLA 1BR2A 2K3RA 1WTYA 5AVUB 1YA9A 2ZXXA 3TOLA 1JY2P 1K05A 4JTDB 1L0LG 2IFMA 3N24A 4C7NB 1FAVA 2FYUG 1IK9A 2ZT9B 1L7CA 4XPWA 2JDIH 1TKNA 2C9LY 1JY3N 2QM7A 2EPOA 1DIPA 2OG2A 2Q6QA 4GQHA 2J45A 1NTZD 1QVFO 2OYIA 2HKVA 1VMAA 1IFIA 3G71P 2PGDA 3K1HA 1VTMP 3QVZA 1MMGA 1T6QA 1YVIA 4W80A 3F47A 4CSAA 2LSEA 1Q7YQ 1FZCA 1NH4A 1BGYJ 4PJ0E 1LKXA 2HV7A 3H6PA 1Q0GA 1KYOH 1LWUB 5JSLA 1PIXA 1OXBA 4JPZB 2DYSC 2EILC 2Y9ZA 2ZXOA 1OWAA 1NOHA 1IFDA 3Q5SA 3OW2O 1OXZA 3H1IJ 5L0CA 1OR3A 2OKUA 1QL2A 2QM8A 1IO4A 1LTAC 4H0LD 1RE4A 2N1TA 1ZYRF 1SQPK 4LERA 2A6HF 3G9RA 4E0HA 1IC2A 1SQBE 1L0NJ 1G2CA 3H25A 1A0BA 3LEOA 4XFJA 1A41A 3M91A 4IGGA 4U5EE 3T97A 1LP1A 1YJGA 4MVZA 3S28A 4P9TA 1T2KD 2O9XA 5AVYB 1DX7A 1FFHA 2IBZD 4JZAA 4O9BA 3JZ0A 3K66A 1LTTC 2YHSA 4PD4I 3ZG1A 3Q3DA 3EGXB 2PBEA 5KYWB 3EG9B 3L70E 2ZYDA 2J58A 1M1JA 3LS1A 1M8OB 1FBMA 3L71D 3LIDA 2L81A 3PHF2 2XSEA 2HV6A 2J5UA 3V2QA 3L75D 4PACA 4C3EA 1NSGB 2O1JA 1M90Q 3S90A 2B9BA 4E7SA 1L0LD 2Y3BA 4RO0A 4JQ0D 2FYUD 1TWCA 1URQD 3CMEP 2NPSC 4NCQA 2QE7H 1SQBJ 5KLVG 5KJ7A 2RD9A 4CBEA 1NFOA 1T5OA 1GD2E 1Z23A 5K5GB 3BRTB 4IL6E 1Z63A 3LW5J 3RK2B 1BDJB 2IPPA 2OYHA 3A0HH 1MUUA 2ZXWC 5CCHD 4RKUJ 1KORA 2XLEA 3B5ND 3ZTZA 5E3CA 1Q90D 4GKGA 4HE8D 1T2KC 1KB9I 2P1JA 4N78D 2WT7B 3GM3A 3ABMC 2BL2A 5CJ0A 1H0TB 4XLNF 1JY3P 3U59A 1SVFA 2YZSA 3C8GD 1VQOP 4ZKPA 1W2WA 1H8AA 3EJNA 4E17A 1BE3J 5AW7B 2E74B 1IZMA 2BEZF 2NRGA 1FC2C 1U6HA 2C9NY 3CCRP 2A6EF 4WY4B 3MD0A 2ZT9D 1JY2O 1NVOA 2A68F 2HSQA 4U3FE 2J9UA 2CDQA 2WSEH 2GFHA 4DZOA 1GU5A 1URQC 1LT1A 4CDYA 2JJLA 4CIPA 3RH3A 2KLVA 2HLOA 3NKEA 2P58A 1JR8A 1GK4A 1UIXA 3V5BA 2GUSA 1KILA 2Y0EA 4OVNF 1OVVA 1VDFA 3B5NC 1LS4A 3VRCA 4U7JA 2WPSA 5DQZA 2P67A 4WBAA 2E76B 5L0FA 1LM3B 5DJTB 1FU1A 3AE6C 5KYXA 2NZ2A 2QRXA 3LIEA 3BVHA 4EDFA 4JBZA 4N3YB 3L73G 1N8RQ 1ZVZA 2XLMA 2BE5F 4AUWA 2OEVA 4LDQA 1A7DA 1LT9B 2JPUA 2WVQA 2K9YA 2OQMA 1TWGA 5KKZB 3JSZA 1P84E 2XZRA 2HR3A 1VQ5P 3F89A 3C8VA 4XE5B 1APCA 2XRHA 3H65A 2ZT9C 1N73A 3ZIBA 2WL8A 4NY3A 1S2EA 3CPWO 5APQA 4DOZA 4KT0J 2HODB 3CXHI 2QJPB 1C17M 3HTKA 3S29A 1SQPG 4EI2A 4QMAA 2DGJA 4WGYA 1YZCA 2Y69C 2LFDA 1YTZI 2K9JB 1Q0MA 2KIKA 2A45G 2YRFA 3NYLA 4YL1A 5T3WA 1V74B 5A6BA 1QKRA 2Q9AA 3C18A 2CGEA 4IARA 3KQGA 1DH3A 3WU2H 3FDQA 2HYNA 5F5HA 1KILE 1KYOE 2EPKX 3TD7A 1QGKB 2KP8A 3RL0B 5AVWB 1ORSC 1SQQJ 2BCCJ 2KOGA 1FZGA 4KC9A 3L8JA 3PMRA 1JTHA 1HE1A 2JD3A 3HKKA 2W4MA 5JP7A 1OW6A 1R5LA 3L70D 5AVSB 4BRYB 2NUTB 5AW8B 1Z6AA 3H1KE 1SQVG 4C3DA 1VYIA 4EBBA 3RK2D 2QG4A 1M7LA 3I5CA 3CX5D 5L0GA 3LEVA 2YMKA 3B29A 1YDIA 1X22A 1OXKA 1EKYA 3L72J 3W2VA 2PX0A 2O1KA 3VOPA 5AW4B 3M4BA 5TJ5E 3NMKA 4AE4B 2YKZA 2R3CA 1G4WR 1WATA 4QI0A 2VC9A 1KTMA 2R5DA 3H1HE 5KYYA 1LTGC 4DBQA 1CW5A 4XPXA 4WABA 1EDIA 3E1RA 1YI2P 3M9BA 2R7RA 1TFKB 4O79A 1MNDA 5B5EH 5L0JA 1CPRA 3H1JG 3EQ2A 4AL1A 4W8PA 3U2MA 2M5AA 4BJ5C 3K1IC 2D2CD 2MYSA 3V4QA 4U9EA 1BCCJ 1Y8AA 4EIJA 3JYHA 3VMAA 3D6YA 5AVZB 3H1KJ 1LI5A 4H4KC 1VPCA 3AG3C 3NMDA 1ST6A 4AK9A 4P9FA 4BEJA 2JEEA 1VQ8P 3G6EP 3FAJA 2XS1A 3RK2C 2Q1KA 4JTCB 4Z9JA 2QE9A 1SQPD 3NMJA 4CS8A 2KYVA 4BJ1A 3OAKA 4U3FD 2B87B 3NG1A 1LNQA 1RXQA 3A0HE 1FAPB 1SS1A 1NU1J 1YBKA 4GODA 3IR9A 1S3JA 2YL3A 1FZAA 4HFFB 2KS1B 3AG2C 2UUIA 3H1HJ 3OA7A 2WTYA 1TQGA 3C9IA 4D6TJ 4LLHA 2V26A 1PZQA 4JYBA 2EIJC 3DE8A 4A4AA 2IXNA 2LIGA 5BQHA 5COMA 5KJ7D 4YTPC 4LDRA 3MHVA 2VCBA 4WY4C 4E7ZA 1GL2A 5APSA 5CI8A 1T3JA 3L74J 3M9QA 4PD4H 5AW3B 3MFNA 2D2CC 1AVOB 4Z9IA 2WPVB 3PHLA 3K5BA 1FDOA 2HFED 2ZAEB 1AV1A 1M2VB 1Y9BA 2OTLP 2Q4FA 3WUUA 2P0NA 2R3SA 4OWFA 2DB4A 1LTJC 3FGAD 4ASVA 4LC1A 2R05A 3QZCA 3GG2A 4Z9HA 2D5RB 4JRZA 1PP9D 1NAYA 2R32A 2E76C 1QSPA 2EINC 1BBHA 3S1KA 1X8YA 4EOTA 3DM9B 4N6JA 3GEEA 1QPUA 2E42A 3V5ZA 2A06E 3LW5H 3E7KA 4HJGH 3EPVA 3MLGA 2HZ8A 1N2DC 4NTBA 3IAOA 2P10A 3U3BA 2W4BA 4IAQA 3M79A 4JW1A 1M2OA 1LT9C 4C7RA 1OKKA 3H1JD 1TR2A 2XNXA 1KB9H 3T6GB 5DVWA 1FR0A 3RBZA 3PP5A 1S72P 4PK4A 2VCAA 1VQ9P 3IPMO 2Y9YA 2EIMC 3CC4P 2YL0A 2YKOA 2WSEJ 4RJTA 3VMZA 1NTKE 3DM5A 2QJPC 3RKOF 4ZNCA 1EI7A 2W90A 3R4YA 4P6IC 2B89A 2E5YA 5APXA 3C1LA 2HPCB 5AW6B 3C63A 3DWWA 1SLQA 3RQEA 3MIWA 1E79H 3U2LA 4BJ6A 5KYNA 3WUTA 1JCDA 1Q0FA 1FDIA 3CC7P 4H0LB 2HFIA 2IBFA 2P7VA 3U1CA 4EUKB 5A69A 2I1KA 2XL4A 1H9TA 4AYCA 1KFNA 5CI9A 3RL0C 2WVRA 4FWVA 3O8ZA 1L0NK 1NTZG 3WU2E 1FDMA 4JE9A 5AVVB 2WVOA 4K7BA 2R02A 1PFIA 3BATA 1K04A 3AEFC 1FJKA 3M0DC 2L91A 3US6A 5A6KA 3I55P 4O6MA 3KYJA 1Y47A 5AC4A 1TU3F 1NTKJ 2XXAA 1MKMA 2YXQB 5DQTA 3AG4C 1QLED 3CD6P 3KYIA 1KQSO 4NPDA 4XEVA 1ORYA 1MMNA 4AX2A 4JF7A 1YARO 2IZ0A 1RF0C 5FCLA 4HFKB 2OU6A 4EYYQ 5BVZA 4OGQD 1E2XA 1JPJA 4ULWA 1AQ5A 1URQB 1HVVA 2R7WA 1OCOC 2AEMA 1LWUA 2LD6A 1SZIA 1SQBK 1RKCA 3HD7B 3FX0A 1V55C 1GZLA 5E2QA 4MW8A 3C7JA 1W2BO 1YIJP 4RDAA 2NSFA 3ZC4A 4PV1D 4L75A 2M8RA 2IBZG 5B5EE 2IBZI 1EA8A 4IFFA 4F4BA 2V4HA 3K6BA 2JKVA 2L6FA 2P61A 1IW7F 2O01J 3HUSB 1VQNP 4L76A 1PV3A 1RMVA 2PFDA 1GMJA 1A7EA 3CWBG 1EQ7A 3L71G 1NKZB 3NMIA 3H32B 3BEHA 4MVSA 3ZSUA 2DI3A 4OD4A 3L75G 1QLEC 3KXDA 1Z5ZA 3P7KA 2Q9CA 5D91A 4OIQF 3UGPA 1IFPA 3C8ZA 2WPRA 2A1DD 1L0LJ 3D6ZA 4IJJA 4DJGA 4CIHA 2Z15A 1FZFA 3RFYA 3EZIA 1HJ0A 4C7OA 5DS4A 1L0NE 4OGQC 4U5DE 4JCZA 3WUVA 3RL0g 1AQTA 3JSEO 3W2WA 1CSBA 3Q2YA 2NG1A 1LI7A 1MMAA 3SEOA 2R7OA 2LXCB 1YTZT 3AE1C 3TNUB 3U9MA 5L0DA 5DJUB 1T8ZA 1S5LX 4ZLCA 4G7HF 4HH2A 4U9DA 3G4SP 1DEEG 4PV1C 2PRRA 1J1DB 1WWPA 3AEEC 4DRJB 4ULVA 1NLXA 4PD4E 4JEBA 1YZAA 4LACB 3HLZA 2JX0A 4XA4A 1VK5A 4MVUA 1PL5A 3JRTA 4B86A 1FNTc 1U89A 3H1LE 1LS1A 3HE4A 1VQ7P 4NC3A 1Q2NA 4R32A 1BGYG 3MZWB 3UR3C 3FVYA 4DT0A 5COGA 3DJUB 1CZQA 2J9WA 3CQZA 4W7YA 1J8YF 1LE2A 1EC5A 1IJDB 2J59M 4H13B 3A0BH 3O6XA 4YL0A 2VCCA 1WRGA 3H1IG 2W8ZA 3TDKA 1NHLA 3A11A 3V5YA 1JO5A 3IQ6A 2KK1A 2NUPB 1RE3A 2JR8A 4I6MC 4JEAA 2J0WA 1KQFB 3EQLF 3K33A 1FMVA 3DAGA 4BXLA 1I4ZA 2K1AA 3U0CA 1KB9E 1S5LH 3AEGC 2AVKA 2OOCA 1RH5B 5KYUB 3S84A 3QW0A 4E18A 2IXPA 2FFDA 1USDA 3ZDMA 2D4UA 1H88A 1HGVA 4IRUA 1TWHA 4DRHB 3CWBD 3NYJA 3H1LJ 4A2NB 2OARA 1BE3E 2ZVOB 1LGHB 4GT1A 1A02F 4BPMA 2KSEA 3DI5A 2ZXRA 4YL3A 1KFMA 2GUVA 1SQQK 3CCVP 1U7JA 5B66H 4NTAA 1K40A 4H0LC 4O7GA 3TJ6A 1OVUA 2OJED 4ER9A 2IXMA 3HD7D 5KLVJ 2G62A 1JM0A 5AW5B 1K73Q 2OCCC 2J7PA 1T01A 4YT4A 2IYLD 4M63A 1R8EA 1J1EB 4CJOA 1FZCB 2H7HA 3O6QA 4C3BA 1L4AA 2EIKC 3J06A 3NFQA 4R4LA 3BRVB 4DRIB 4DVZA 1SQBG 1N7SD 1Z3IX 4FX5A 1I4YA 3VN0A 4Y99B 1S9KE 5APTA 3MGNA 2QY9A 1KU2A 1IK7A 2E87A 2C0XA 3CC2P 1HW1A 4CS9A 2HG5D 1YJWP 3Q5PA 1E5WA 2J0XA 1XTGB 1FJPA 2WVNA 2EPNA 1MQVA 5IY5C 1BGYD 2N1TB 2YLGA 3ZQYA 3DZAA 3HE5B 4KBLA 1S7ZA 1NG1A 1G2CB 2A0UA 3L70G 2D2CB
chains in the Genus database with same CATH topology
2L6HA 1VF5B 2WQYC 4PV1B 3Q3DA 2PBEA 3AECC 4OGQD 4H13C 4H13B 3D70A 3AE6C 2NZ2A 1EXIA 1KTMA 4H44D 2JO1A 3GMAA 5M1BA 3IAOA 2P10A 1ZRTE 3AE4C 4TT3H 3L8IA 3C8GB 3AE5C 4R4MA 3D71A 2J5UA 2KK1A 3U3FA 3O10A 1UFBA 2QJKC 2JPUA 1ZZPA 2K9YA 2QIWA 3AE2C 2H88C 3AEBC 3GLMA 3B71A 2OQQA 1KQFB 2L6GA 2D2CD 2E76D 1KMIZ 1VF5D 2FBWC 2WSCJ 4PV1D 1O3UA 3C8VA 1WTYA 3RQFA 1K05A 3U0CA 4I7ZC 3D6YA 4I7ZB 1ZMEC 1RQUA 2E75C 3BRJA 2ZT9C 1OMIA 2ZT9B 3AEGC 1WMKA 3IN6A 1U57A 3T97B 4Z1MH 2L6FA 2O01J 2WSEJ 4KT0J 3GM2A 1PV3A 1DIPA 2Q00A 2HSBA 2YWAA 3LW5J 2QJPC 1GMJA 2E74C 4EBKA 2BEQD 1VL2A 3R4YA 2IDBA 2H89C 4RKUJ 1DD3A 1KORA 3GF7A 2V7QJ 1Q90D 3RQEA 1KQGB 3TULA 2JP3A 1JB0J 4IL6X 1K40A 3GM3A 2D2CB 4H13D 4H0LC 1FDIA 4H0LB 3SFEC 2E75B 3D6ZA 2MKVA 1EXJA 2FYNC 3C18A 3GM1A 3C8GD 3S9OA 1PIXA 1S1CX 1QVXA 1HJ0A 4OGQC 1RQVA 5F28E 1KILE 4Y28J 3RL0g 3GF3A 4YXDC 5KLIC 3Q5SA 3AE3C 3Q2YA 2G8YA 2FXPA 4H44C 1R8EA 1KNYA 2E74B 3AEDC 2BEZF 3O6QA 4YTPC 4XEFA 5L8RJ 3L8JA 1OW8A 2QJYC 3AE1C 4H0LD 2E75D 1OW6A 2ZT9D 4R4LA 1S5LX 1DD4A 3MFNA 1K04A 2D2CC 3AE9C 3AEFC 1VF5C 4PV1C 2QSIA 2WSFJ 1WWPA 3ABVC 3AE7C 2WPVB 3AEEC 3G9RA 3Q1MA 1V4AA 1YQ4C 3SFDC 3AJMA 3H25A 1IK7A 1FDOA 4XFJA 2E74D 1AJYA 1NYHA 1TU3F 1Y9BA 1JOGA 2JX0A 2LK4A 3JYYA 1MKMA 4OGQB 1PL5A 3Q5PA 4EBJA 2YIUC 1ZP0C 2YMKA 4NQFA 1YQ3C 1UIXA 4H44B 3FGAD 5KKZC 3EWKA 3Q5RA 1OW7A 4XEKA 4GDOA 3C8GA 4XEVA 2G3AA 1HF9A 4R32A 3AEAC 3AE8C 3RK3E 1ZOYC 4U7JA 1NGMB 3K7DA 1WOLA 3RQGA 3JZ0A 2E76C 2E76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6H A;  2WQY C;  2PBE A;  3AEC C;  3AE6 C;  1KTM A;  3AE4 C;  3L8I A;  3C8G B;  3AE5 C;  2KK1 A;  3U3F A;  3O10 A;  1UFB A;  2JPU A;  1ZZP A;  3AE2 C;  2H88 C;  3AEB C;  2L6G A;  3B71 A;  1O3U A;  2FBW C;  1WTY A;  3RQF A;  3U0C A;  1K05 A;  3BRJ A;  3AEG C;  2L6F A;  3GM2 A;  1PV3 A;  2YWA A;  2Q00 A;  2HSB A;  4EBK A;  2H89 C;  3RQE A;  3TUL A;  1K40 A;  3GM3 A;  3SFE C;  3C18 A;  3GM1 A;  3C8G D;  3S9O A;  1QVX A;  5F28 E;  4YXD C;  3AE3 C;  1KNY A;  3AED C;  4YTP C;  4XEF A;  3L8J A;  1OW8 A;  3AE1 C;  1OW6 A;  3MFN A;  1K04 A;  3AE9 C;  3AEF C;  1WWP A;  3ABV C;  3AE7 C;  3AEE C;  1V4A A;  1YQ4 C;  3SFD C;  3AJM A;  1JOG A;  2JX0 A;  2LK4 A;  3JYY A;  4EBJ A;  1ZP0 C;  4NQF A;  1YQ3 C;  1OW7 A;  4XEK A;  3C8G A;  4XEV A;  2G3A A;  4R32 A;  3AEA C;  3AE8 C;  1ZOY C;  3K7D A;  3RQG A;  1WOL A;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 2WQY C;  3JTL O;  1EDJ A;  4MND A;  1ZRT D;  1LP1 B;  1Y6D A;  1YYJ A;  4J7Y A;  3E70 C;  3H1I D;  1Q0D A;  4E0I A;  4TT3 H;  1UII A;  3HD7 C;  2IM8 A;  1SR2 A;  3MUD C;  4PFO A;  3UNG C;  1MNE A;  3CX5 I;  3M1C B;  1LTJ B;  2HS5 A;  3EFO B;  3RBX A;  3AE2 C;  4D4X A;  2M0B A;  5CCH C;  2RN0 A;  4I7Z B;  5H2F H;  1M1J B;  1L0N D;  2Y0D A;  4A7P A;  3G4Z A;  3EHM A;  3OEO A;  1N7S C;  1ZHZ A;  4WGZ A;  3WHN A;  4BRY A;  1NU1 K;  3HUS C;  2PP6 A;  3TK0 A;  3TSI A;  5CBN A;  1LVK A;  4I1M A;  2Q7R A;  1XZP A;  3L73 J;  2YL1 A;  1VL2 A;  1X0T A;  5JLI A;  4IFM A;  3GHG A;  1SQQ E;  2BCC E;  3VAY A;  2CW0 F;  3VP9 A;  3CCL P;  5GPG B;  3I56 P;  2M4E A;  1H6G A;  1ZHY A;  5APW A;  1PD1 A;  3TUL A;  1SP4 A;  3CEX A;  3SZR A;  2GA1 A;  4FAP B;  1SFC D;  2C03 A;  4H13 D;  3FXE A;  4I3M A;  5JUA A;  3FXD A;  2FYN B;  2B88 A;  2OYH B;  3EGD A;  1EZV E;  1RQV A;  5TIS H;  4AE4 A;  3AE3 C;  2R9R B;  3AED C;  3NDB B;  2K88 A;  5CCG A;  3EH2 A;  4U3F G;  1KC8 Q;  3PH0 A;  3L72 E;  3VYW A;  3Q7L A;  1SQB D;  2A45 I;  3VMX A;  4U5C E;  2P2U A;  1J1D C;  1V4A A;  2J9B A;  5E79 H;  2AWC A;  3EHN A;  3TGU E;  1K8A Q;  3OJA B;  1IZN B;  3VYI A;  1NZE A;  1CGN A;  1T6I A;  2KZI A;  3MYF A;  3WAQ A;  3JSV C;  3CCM P;  5CJ4 A;  3RK3 E;  1LIH A;  1R5S A;  1W2E A;  1M6T A;  5EK0 A;  1BCC E;  1NGM B;  2B87 A;  4WVZ A;  1RF1 A;  4J7T A;  2KB7 P;  1HGZ A;  2O01 H;  2L5G B;  1M56 D;  1SQV J;  3LLK A;  1SFC C;  4H13 C;  3AOU A;  1BE3 D;  1DEB A;  1BR1 A;  1KIL B;  2HUJ A;  3HRN A;  3D71 A;  2NSG A;  2PNO A;  2KSJ A;  3A0B E;  3G3Z A;  5APU A;  1GU4 A;  2WZ7 A;  3PLN A;  1O3U A;  2FBW C;  3L37 A;  4YXW H;  2EPL X;  4BJT A;  5KYX B;  1NU1 E;  1PP9 G;  2WZL A;  1JY3 O;  3SXM A;  3TGU J;  2OJQ A;  1G4U S;  1S5L E;  1SYQ A;  3N0T A;  3B0P A;  3MYI A;  1JAF A;  3BCC E;  1A7V A;  3TJ5 A;  2N1T D;  4D6T E;  3NYM A;  3RYL A;  2J8W A;  2RKL A;  3ECS A;  3U8P A;  2WZG A;  4QDL A;  3KHU A;  1S4X A;  1OR2 A;  3GW6 A;  1N73 B;  3SYN A;  5DS5 A;  1OCZ C;  2L7A A;  3H1J J;  1NFN A;  4YK5 A;  4AL0 A;  2M3E A;  3AQC A;  3L74 E;  2CPB A;  4I1L A;  1EXJ A;  2KNC A;  1SQX E;  2WMM A;  2OYI C;  5B66 E;  2CNW A;  2G3K A;  1HMD A;  3HTK B;  2YXR B;  1M56 C;  2C04 A;  2LR2 A;  5JT4 A;  4CSA C;  1J1E C;  1KNY A;  1FZC C;  2WZF A;  1NTK K;  2XLW A;  2XS8 A;  2W27 A;  3H1K G;  2I8B A;  1NTM E;  1LTB C;  2KUB A;  3CCQ P;  2Q3I A;  1ZHW A;  4DOJ A;  5AVQ B;  3LNM B;  4OIN F;  4Y99 C;  2A69 F;  1G8X A;  3AJM A;  4KNV A;  2QLA A;  2J9V A;  1N1C A;  2XLH A;  1JTH B;  2KXP B;  3BCC J;  4OGQ B;  2OYO A;  1RE4 C;  1YAU O;  2YIU B;  4NQF A;  1ZW2 A;  3KYQ A;  2R7X A;  1QL1 A;  3TQO A;  3E1I A;  2N1T C;  4CS7 A;  1ZHX A;  3SXY A;  3LAY A;  4PJM A;  3DD7 A;  2AXT H;  1AA0 A;  5AW2 B;  4LDK A;  5AW0 B;  4PV1 B;  1E86 A;  1SQX J;  3H1H G;  4YJW A;  1D0Z A;  1SMY F;  1WN0 A;  3X2Q C;  1FS0 E;  1SQQ D;  2BCC D;  2NPS A;  3AE5 C;  1P84 D;  2K37 A;  4XLP F;  3U3F A;  3AGU A;  3NXS A;  1K9M Q;  2IYO A;  3KZI H;  1JUN A;  1NTM J;  4I7Z C;  2EPM X;  1Q86 Q;  2YLI A;  3L0I A;  1M1J C;  2Y3D A;  3LES A;  5KYY B;  1EZV D;  1WMK A;  3JCU H;  1PPJ E;  1RKE A;  4IWB A;  5H2F E;  2N9Y B;  3OWT A;  3DMD A;  1L0L K;  2YWA A;  3GM2 A;  5APY A;  1DOV A;  1KD1 Q;  5B3I A;  3SNH A;  2M5A B;  2AWY A;  4KHX A;  3P8M C;  2H7B A;  2BEQ D;  4K35 A;  2FYZ A;  3GF7 A;  3HNL A;  2CPS A;  3EFG A;  2YLD A;  1GS9 A;  5KJ7 C;  2OTJ P;  3ATP A;  3V2R A;  4IL6 X;  4MTO A;  2YKP A;  3C62 A;  2AEF A;  2HMQ A;  4K3A A;  1KIL D;  2FYN C;  4Q5S F;  3GM1 A;  1KYO D;  2OYH C;  1S1C X;  3M9H A;  1TWA A;  2WSS H;  3RVZ A;  2O3J A;  3GF3 A;  1PGQ A;  2ETS A;  3LJB A;  1URQ A;  2W6B A;  1Y4C A;  1Q0K A;  1VQ6 P;  5TIS E;  4U5H A;  3KL4 A;  3H1K D;  3SXK A;  5GTI H;  4OIO F;  1LJ2 A;  3S27 A;  4Q7C A;  3AE9 C;  3A5T A;  3L34 A;  1JY2 N;  2QSI A;  2MJZ A;  3V6I A;  1LTI C;  5E3A A;  5JRA A;  3B5N A;  1U0B B;  3PJS K;  1NYH A;  2XL8 A;  3GOR A;  1FZE A;  3TOM A;  1C03 A;  3CX5 H;  5E79 E;  2R7Q A;  2I8D A;  1LTS C;  1GL2 B;  2H8P D;  3F5H A;  1N7L A;  1NTZ J;  3AGT A;  3LS0 A;  3Q6M A;  1NU1 D;  3AQB A;  3C8G A;  1RJ9 B;  3AEA C;  3H32 A;  3QMK A;  2Q9B A;  5KAF H;  1HUC A;  1ZOY C;  1FE6 A;  3K7D A;  3VF0 A;  2A06 G;  4JJF A;  3FWN A;  3H1H D;  3L4F A;  3D70 A;  4C7N A;  4HB1 A;  1A02 J;  2I1J A;  5AVX B;  1EXI A;  2Q3E A;  3LUT B;  2TMV P;  1KIL C;  5AGF A;  2JO1 A;  4EWC A;  4R4M A;  2PF4 E;  1IFJ A;  1OX3 A;  2E5T A;  5K0I A;  2XM4 A;  3KMI A;  5A6B D;  3L74 D;  1D7M A;  4N4W A;  1ZR4 A;  1NAF A;  1JMW A;  1VF5 D;  1HJB A;  2LP4 A;  3TYY A;  1Z7Q c;  3UMK A;  1TFO B;  1L0L E;  1NTK G;  4Z1M H;  5GTH H;  2ZYA A;  2FYU E;  4EHP A;  1CGM E;  1YYC A;  3AG1 C;  4GOF A;  5L3Q A;  3LNR A;  3CXH H;  5B1B C;  2FKW B;  4U5G A;  1AFO A;  4N06 A;  5KLV K;  2ZVN B;  3NRH A;  1T9K A;  2VB6 A;  3H2V A;  2X51 A;  1LPE A;  4LLE A;  4PFP A;  1N73 C;  1VLS A;  3CSK A;  3WG7 C;  1OZH A;  2IOQ A;  4ZKU A;  2YKQ A;  2A45 H;  3DXJ F;  3TK1 A;  1ZV8 A;  3M0A A;  2G3V A;  2IX7 C;  1JEK A;  4CPG A;  3SFE C;  3CI9 A;  2CCY A;  4W7Z A;  2VRS A;  5T1D B;  5F5F A;  3R7C A;  4N78 E;  1CGO A;  3HTK C;  1N7S B;  5L0H A;  1QVX A;  5A6J A;  3L35 A;  2N9B A;  4CJG A;  2IZ1 A;  2H43 A;  1D1B A;  4OH8 B;  1JMB A;  1V54 C;  2G8Y A;  4XPY A;  2KJG A;  5BQG A;  5C39 A;  2VAS A;  1EDK A;  3L71 J;  3R2P A;  1M57 D;  2NUP A;  3O39 A;  5E33 A;  2E75 D;  1O87 A;  3L75 J;  1H7I A;  2PX3 A;  2BAS A;  1VQK P;  1OCC C;  1VF5 C;  3S4R A;  3POV A;  3M06 A;  2PAJ A;  1ZU5 A;  2FYU J;  3ASO C;  1IFN A;  2FAP B;  3CCJ P;  1WT6 A;  2W45 A;  1JRA A;  2P6V A;  5CIV A;  3IQC A;  3EGX A;  5DS6 A;  5KYW A;  4EBJ A;  2KSF A;  2YIU C;  2GM4 A;  3EG9 A;  1H9G A;  2I15 A;  3U5S A;  1HF9 A;  3ABK C;  3CMA P;  1PPJ D;  4K1O A;  2YNY A;  1NKN A;  1H89 A;  1FTS A;  2A06 D;  2M64 A;  1HH0 A;  3IEE A;  4OIR F;  4BJ5 A;  5T3T A;  3FOO A;  3K1I A;  3T4R A;  2XXA B;  1BDC A;  2AXT E;  3MP7 B;  3L36 A;  1GQA A;  4J30 B;  2RH0 A;  3U9J A;  3USS A;  4H44 D;  5M1B A;  3N7N A;  2HJ3 A;  1B68 A;  3AE4 C;  2HMZ A;  4LLC A;  1CI6 B;  1JMM A;  2QUP A;  4JCH A;  4L74 A;  1UFB A;  4NPF X;  4HEA J;  3QVY A;  1R5I D;  2XDJ A;  1FZB A;  1BR4 A;  3RGU A;  3GLM A;  2LXB A;  3B71 A;  1PCX A;  1WGW A;  3UMI A;  3HNK A;  2XL6 A;  1M57 C;  4YT8 A;  4DVY P;  1RQU A;  3N4X A;  1D1C A;  2E75 C;  4WWI A;  3KZI E;  4X0R A;  2RSE B;  5B1A C;  2OEX A;  4G0H A;  1NTK D;  1ORJ A;  1SFC B;  2WT7 A;  2BC5 A;  3OA1 A;  1GL2 D;  2RMZ A;  5KLV E;  3B8E B;  1H0T A;  3PRJ A;  3BAS A;  3JCU E;  4YT5 A;  5A6A A;  4EBK A;  2FXO A;  1OFC X;  3DJN B;  4L6R A;  4W8K A;  1YA7 O;  4HKZ H;  4YPC A;  3II6 A;  2NPS D;  1OVR A;  2WWW A;  2JP3 A;  2YEV A;  3GOD A;  3HE5 A;  2LCH A;  4WY4 A;  4ZMD A;  1L0N G;  2W6A A;  3GEH A;  2XLD A;  4M3L A;  1G1J A;  4CS8 C;  4JKV A;  1VQ4 P;  2WIT A;  4JIO A;  4CDA A;  5KLI C;  3SWY A;  3EFF K;  4EIY A;  4H44 C;  4YN0 B;  4U5F E;  3GWN A;  4MVO A;  1ZLL A;  2H8A A;  3IQ5 A;  5D92 A;  1OW8 A;  4BWN A;  5EHH A;  3IFM A;  5AVT B;  3P8C E;  3W67 A;  1LTJ A;  2GA0 A;  1BDD A;  2XND H;  3EFO A;  2KNH A;  4RES B;  2YL7 A;  2Q7C A;  5KAI H;  4C7O B;  5GTI E;  2ZPA A;  1OKK D;  3N2Z B;  3LLI A;  2OYI B;  1YYX A;  3H1L G;  3A7O A;  3NKD A;  1SQV K;  4IAO A;  1GL2 C;  3Q6N A;  3P32 A;  4I44 A;  1OW7 A;  3CX5 E;  2G3A A;  1LE4 A;  1X9V A;  3EZH A;  1LT9 A;  4NPE A;  3KKB A;  3FWL A;  2HJM A;  1X79 B;  3KPE A;  1GGQ A;  4IOI H;  2F22 A;  3AEC C;  5KAF E;  2YO2 A;  1XWJ A;  2YVK A;  3HE4 B;  1XZQ A;  5HV9 A;  2ZD9 A;  2XV5 A;  4OD5 A;  1VLT A;  4IB4 A;  3O10 A;  2QJK C;  4KNW A;  1Z56 A;  3L73 E;  256B A;  3CLQ A;  4WJ0 A;  1VB5 A;  5AC5 A;  2HOD A;  3AEB C;  1ZW0 A;  2LKM A;  3PDM P;  4UB8 H;  4MQ9 F;  2WSC J;  4UB6 H;  2R7S A;  1XTC C;  2GWW A;  3IQT A;  2W83 C;  3BRJ A;  2K9J A;  4BEM J;  3L70 J;  1U57 A;  3T97 B;  5AW9 B;  1T6A A;  4QI2 A;  3DE9 A;  2P7J A;  3CL3 D;  2R7T A;  1BE3 G;  2DYR C;  1PGP A;  3WMM 0;  1D0X A;  5GTH E;  3CCU P;  2L9J A;  2FXM A;  1RY3 A;  2H7O A;  3CXH E;  3I5P A;  2V7Q J;  1PD0 A;  1SQP E;  3MBG A;  4BG0 A;  2FFD B;  3JC2 2;  1EDL A;  5BQI A;  3SXZ A;  4ANJ A;  1HTL C;  2MKV A;  4GOE A;  1JNM A;  2KYH A;  2NUT A;  1MFT A;  3M0D A;  1L2P A;  2QEX P;  4K0D A;  2KW3 C;  3UMH A;  4Q4Z F;  2Y3H A;  2KLU A;  4TLF A;  4BJ6 C;  4DBR A;  4IFD K;  1FOS F;  4CX9 A;  4G7Z F;  1WAS A;  2QJY B;  1NU9 C;  1RCP A;  1GDT A;  2IXO A;  4N6H A;  4O6N A;  4L73 A;  1BSN A;  4PD4 D;  2MWQ A;  2WSF J;  3CCS P;  3ABV C;  1UG7 A;  2XLO A;  1SQV E;  2VH3 A;  3JCU Q;  3H1L D;  1RF0 A;  1JOG A;  3GAN A;  2Q5U A;  3O6Q B;  2E43 A;  2LK4 A;  1SQX K;  1SF8 A;  1L4A B;  5L3V A;  4DJ9 A;  2R5B A;  2A0B A;  1JPN A;  3EWK A;  3FXH A;  3EH1 A;  4XEK A;  2Y3G A;  2QTV A;  1SQP J;  2YO3 A;  1JOC A;  2POH A;  4U3F J;  1HW2 A;  5KLV D;  2R44 A;  1ZR2 A;  1NTM K;  3IHU A;  1PP9 E;  1GW4 A;  4J32 B;  4KI2 A;  4XQ1 A;  1J2J B;  4PR9 A;  2NPU A;  4GIF A;  3MX3 A;  5AVR B;  4JTA B;  1G5Z A;  3T6J A;  4MTF A;  3A9C A;  3W68 A;  2Q3T A;  1KB9 D;  4MW3 A;  1BSH A;  4YWQ A;  1KMI Z;  5AW1 B;  1MFZ A;  2JWA A;  5DLJ A;  1AVY A;  4NTF A;  3X1O A;  3H1J E;  3ZTM A;  2Z5H A;  4DCK A;  1R4T A;  1LWU C;  3IN6 A;  5CHX A;  3V5X A;  1KQL A;  1E85 A;  3TF5 A;  1QQ3 A;  1PGO A;  4LGD E;  3QWO C;  2Q00 A;  2HSB A;  3M4C A;  1IFM A;  4DXW A;  1SQQ G;  2BCC G;  2GAQ A;  3P8C D;  3DKA A;  4N6C A;  2KS1 A;  2ZYG A;  1P84 I;  4JJG A;  3HNJ A;  1S05 A;  4ONS A;  3JRM O;  1HE9 A;  5JS5 A;  3RK3 B;  2M3B A;  2B0J A;  2Z5I A;  1JB0 J;  1KN7 A;  2KGO A;  3U8V A;  1YJN P;  1ZW3 A;  3W8I A;  2LFF A;  1ZXG A;  4HYT B;  1QVG O;  1NU7 D;  1PGJ A;  1EZV G;  1EZV I;  1PP9 J;  3KPH A;  3GEI A;  1AVO A;  1F1M A;  3GHG B;  2FGY A;  3VM6 A;  1VQP P;  5F28 E;  1YLM A;  4MTG A;  2WPQ A;  4JYC A;  4GEH A;  1M2V A;  3L72 G;  4D4N A;  2Q9I A;  1MV8 A;  3G50 A;  2R7V A;  1DD4 A;  1S9K D;  1NTZ K;  2DW3 A;  2OGU A;  3TGU G;  2Z4E A;  3EGD B;  3ZVR A;  1ZN5 A;  3AE7 C;  4WB4 A;  1GM5 A;  3DAF A;  3SFD C;  3I4U A;  1M1K Q;  1RHZ B;  2X0C A;  3B0V C;  2CYD A;  1KYO I;  1AJY A;  2E74 D;  3L73 D;  2XKM A;  5KAI E;  3CCE P;  4YT2 A;  2V3C C;  3M15 A;  1QZX A;  3E9V A;  2AP3 A;  5CMZ A;  2YMY A;  1ZP0 C;  4WY4 D;  1YQ3 C;  1T6U A;  1DOW A;  2Y39 A;  1BCC G;  4G78 A;  3AE8 C;  1D0Y A;  3Q7G A;  1YHQ P;  5TJH A;  5CBO A;  3RQG A;  1WOL A;  1AEP A;  3PCV A;  2KI7 B;  2P1A A;  1VF5 B;  3VP8 A;  1W5C E;  2W6J H;  3UIA A;  3CXH D;  4CDV A;  3I5Q A;  4B6I A;  3RW0 A;  4H54 A;  3A3Y B;  3VTP C;  2R25 A;  3O55 A;  1ZZP A;  1NO4 A;  1D1A A;  4GYT A;  3SSU A;  2L6G A;  1RF1 B;  1QX8 A;  1HBW A;  4G7O F;  2E76 D;  1NU1 G;  2GDC A;  5BU8 B;  3RQF A;  2J7P D;  3G4X A;  2ZFC A;  2HPC A;  1ZME C;  3UGO A;  3ZQV A;  4UB8 E;  4UB6 E;  4C46 A;  1O5H A;  1RE3 C;  2ZXP A;  1L4A D;  3BCC G;  5COF A;  1E83 A;  4D6T G;  3QW1 A;  1YIT P;  3HNI A;  3A2A A;  1J8M F;  4I1O B;  1NBB A;  3V2N A;  2E74 C;  2IDB A;  2H89 C;  1Q82 Q;  3L1M A;  5APV A;  4PJ0 H;  3F46 A;  3H2U A;  3IF4 A;  1FMW A;  3L74 G;  2R7U A;  3CZ6 A;  2FFD C;  1KQG B;  1SQV D;  1SQX G;  1RJ9 A;  1JCC A;  2ICW G;  2E75 B;  1G1I A;  3W8H A;  1Q81 Q;  3S9O A;  2R03 A;  4JVS A;  4ASW A;  1OIP A;  2W9Y A;  4Y28 J;  4YXD C;  3QH9 A;  1I5N A;  2FYU K;  1VYK A;  5BUO A;  3L72 D;  2UUH A;  2MHR A;  1GW3 A;  4XEF A;  1NTM G;  1BZ4 A;  2QJY C;  1NTZ E;  1HY5 A;  3B9Q A;  3ZWI A;  2KNC B;  4PJJ A;  3TGU D;  2CK3 H;  3B4S A;  4MVM A;  2KQ9 A;  1NWQ A;  1OCR C;  2O01 N;  1YQ4 C;  2QVA A;  1MMD A;  4JUR I;  1GTW A;  3RL0 D;  3ITF A;  1QEX A;  4MVR A;  3PTZ A;  2PFX A;  3KDP B;  1L4A C;  1T3U A;  2AU5 A;  4MS2 A;  3ITK A;  2SPZ A;  4I2L C;  5KLI B;  4H44 B;  3RK3 D;  3GWL A;  3S0X A;  5KKZ C;  3Q5R A;  2WSC H;  1HWT C;  4RBN A;  4GDO A;  1BCC D;  3HD7 A;  5EFW B;  3FMS A;  4JC7 A;  1USE A;  3MUD A;  3VMY A;  3SWK A;  3CAX A;  2J46 A;  3ZDL A;  1C02 A;  3MTU E;  2L6H A;  3U1A A;  2FY8 A;  3ASN C;  4CS9 C;  1EQ1 A;  5CCH A;  2B0H A;  3ABL C;  3RF3 A;  2YQY A;  4PJN A;  4AQR D;  1KV4 A;  3L8I A;  1N7S A;  1L3P A;  2V7Q H;  3HUS A;  3SP1 A;  5KTB A;  3B0U X;  2XLV A;  5FZT A;  1FFT C;  2XU6 A;  1PPJ G;  1OMI A;  2IFN A;  1N86 A;  2NPS B;  1YJ9 P;  4IL6 H;  3NTN A;  1ZHT A;  2PP4 A;  3KH2 A;  2QA4 P;  5CCG D;  2IBZ E;  2OTK E;  3WOD F;  1E84 A;  5L0I A;  2Y0C A;  3BCC D;  1ZU4 A;  4D6T D;  2ZXE B;  3V7O A;  4KJM A;  2WB7 A;  3HJC A;  2ZJS E;  2QJK B;  1DD3 A;  3RVY A;  5JVE A;  3CWB E;  3L71 E;  3RK3 C;  2UWJ E;  3V4W A;  2WSF H;  2FFH A;  4O6Y A;  3L75 E;  1SQX D;  1RKE B;  3FOP A;  4UDV A;  2AXC A;  2AEJ A;  3TNU A;  5HSW A;  2ITA A;  3GHG C;  1VQM P;  2XM0 A;  2QNL A;  2FXP A;  3T6B A;  1NTM D;  5L8R J;  4U5B E;  1CI6 A;  1GK6 A;  2C0W A;  4EKW A;  1NJI Q;  5EGY A;  1KZU B;  4OIP F;  3Q1M A;  2KC3 A;  4RD9 A;  1FOS E;  1CPQ A;  2KZJ A;  3V2P A;  5CCG C;  3JYY A;  1VOM A;  1SFC A;  3QTH A;  1AUE A;  5B3S C;  3CWB J;  3FAP B;  3SWF A;  2KK7 A;  3RIP A;  3B5N B;  2IYP A;  4MVQ A;  3FHD A;  5BU5 A;  1BGY E;  2LQG A;  4XTK A;  4ZLD A;  1HMO A;  2JWD A;  4FES A;  3W4Y A;  2ASR A;  3JT1 A;  1VQL P;  4XWJ A;  5KYU A;  1OQC A;  2H7V C;  3GMA A;  1ZRT E;  1P84 H;  3C8G B;  4MN4 C;  3H1I E;  1MZ9 A;  1U7M A;  2QIW A;  1RF1 C;  2CNW D;  2H88 C;  2OQQ A;  3T9O A;  4PJL A;  1BR2 A;  2K3R A;  1WTY A;  5AVU B;  1YA9 A;  2ZXX A;  3TOL A;  1JY2 P;  1K05 A;  4JTD B;  1L0L G;  2IFM A;  3N24 A;  4C7N B;  1FAV A;  2FYU G;  1IK9 A;  2ZT9 B;  1L7C A;  4XPW A;  2JDI H;  1TKN A;  2C9L Y;  1JY3 N;  2QM7 A;  2EPO A;  1DIP A;  2OG2 A;  2Q6Q A;  4GQH A;  2J45 A;  1NTZ D;  1QVF O;  2OYI A;  2HKV A;  1VMA A;  1IFI A;  3G71 P;  2PGD A;  3K1H A;  1VTM P;  3QVZ A;  1MMG A;  1T6Q A;  1YVI A;  4W80 A;  3F47 A;  4CSA A;  2LSE A;  1Q7Y Q;  1FZC A;  1NH4 A;  1BGY J;  4PJ0 E;  1LKX A;  2HV7 A;  3H6P A;  1Q0G A;  1KYO H;  1LWU B;  5JSL A;  1PIX A;  1OXB A;  4JPZ B;  2DYS C;  2EIL C;  2Y9Z A;  2ZXO A;  1OWA A;  1NOH A;  1IFD A;  3Q5S A;  3OW2 O;  1OXZ A;  3H1I J;  5L0C A;  1OR3 A;  2OKU A;  1QL2 A;  2QM8 A;  1IO4 A;  1LTA C;  4H0L D;  1RE4 A;  2N1T A;  1ZYR F;  1SQP K;  4LER A;  2A6H F;  3G9R A;  4E0H A;  1IC2 A;  1SQB E;  1L0N J;  1G2C A;  3H25 A;  1A0B A;  3LEO A;  4XFJ A;  1A41 A;  3M91 A;  4IGG A;  4U5E E;  3T97 A;  1LP1 A;  1YJG A;  4MVZ A;  3S28 A;  4P9T A;  1T2K D;  2O9X A;  5AVY B;  1DX7 A;  1FFH A;  2IBZ D;  4JZA A;  4O9B A;  3JZ0 A;  3K66 A;  1LTT C;  2YHS A;  4PD4 I;  3ZG1 A;  3Q3D A;  3EGX B;  2PBE A;  5KYW B;  3EG9 B;  3L70 E;  2ZYD A;  2J58 A;  1M1J A;  3LS1 A;  1M8O B;  1FBM A;  3L71 D;  3LID A;  2L81 A;  3PHF 2;  2XSE A;  2HV6 A;  2J5U A;  3V2Q A;  3L75 D;  4PAC A;  4C3E A;  1NSG B;  2O1J A;  1M90 Q;  3S90 A;  2B9B A;  4E7S A;  1L0L D;  2Y3B A;  4RO0 A;  4JQ0 D;  2FYU D;  1TWC A;  1URQ D;  3CME P;  2NPS C;  4NCQ A;  2QE7 H;  1SQB J;  5KLV G;  5KJ7 A;  2RD9 A;  4CBE A;  1NFO A;  1T5O A;  1GD2 E;  1Z23 A;  5K5G B;  3BRT B;  4IL6 E;  1Z63 A;  3LW5 J;  3RK2 B;  1BDJ B;  2IPP A;  2OYH A;  3A0H H;  1MUU A;  2ZXW C;  5CCH D;  4RKU J;  1KOR A;  2XLE A;  3B5N D;  3ZTZ A;  5E3C A;  1Q90 D;  4GKG A;  4HE8 D;  1T2K C;  1KB9 I;  2P1J A;  4N78 D;  2WT7 B;  3GM3 A;  3ABM C;  2BL2 A;  5CJ0 A;  1H0T B;  4XLN F;  1JY3 P;  3U59 A;  1SVF A;  2YZS A;  3C8G D;  1VQO P;  4ZKP A;  1W2W A;  1H8A A;  3EJN A;  4E17 A;  1BE3 J;  5AW7 B;  2E74 B;  1IZM A;  2BEZ F;  2NRG A;  1FC2 C;  1U6H A;  2C9N Y;  3CCR P;  2A6E F;  4WY4 B;  3MD0 A;  2ZT9 D;  1JY2 O;  1NVO A;  2A68 F;  2HSQ A;  4U3F E;  2J9U A;  2CDQ A;  2WSE H;  2GFH A;  4DZO A;  1GU5 A;  1URQ C;  1LT1 A;  4CDY A;  2JJL A;  4CIP A;  3RH3 A;  2KLV A;  2HLO A;  3NKE A;  2P58 A;  1JR8 A;  1GK4 A;  1UIX A;  3V5B A;  2GUS A;  1KIL A;  2Y0E A;  4OVN F;  1OVV A;  1VDF A;  3B5N C;  1LS4 A;  3VRC A;  4U7J A;  2WPS A;  5DQZ A;  2P67 A;  4WBA A;  2E76 B;  5L0F A;  1LM3 B;  5DJT B;  1FU1 A;  3AE6 C;  5KYX A;  2NZ2 A;  2QRX A;  3LIE A;  3BVH A;  4EDF A;  4JBZ A;  4N3Y B;  3L73 G;  1N8R Q;  1ZVZ A;  2XLM A;  2BE5 F;  4AUW A;  2OEV A;  4LDQ A;  1A7D A;  1LT9 B;  2JPU A;  2WVQ A;  2K9Y A;  2OQM A;  1TWG A;  5KKZ B;  3JSZ A;  1P84 E;  2XZR A;  2HR3 A;  1VQ5 P;  3F89 A;  3C8V A;  4XE5 B;  1APC A;  2XRH A;  3H65 A;  2ZT9 C;  1N73 A;  3ZIB A;  2WL8 A;  4NY3 A;  1S2E A;  3CPW O;  5APQ A;  4DOZ A;  4KT0 J;  2HOD B;  3CXH I;  2QJP B;  1C17 M;  3HTK A;  3S29 A;  1SQP G;  4EI2 A;  4QMA A;  2DGJ A;  4WGY A;  1YZC A;  2Y69 C;  2LFD A;  1YTZ I;  2K9J B;  1Q0M A;  2KIK A;  2A45 G;  2YRF A;  3NYL A;  4YL1 A;  5T3W A;  1V74 B;  5A6B A;  1QKR A;  2Q9A A;  3C18 A;  2CGE A;  4IAR A;  3KQG A;  1DH3 A;  3WU2 H;  3FDQ A;  2HYN A;  5F5H A;  1KIL E;  1KYO E;  2EPK X;  3TD7 A;  1QGK B;  2KP8 A;  3RL0 B;  5AVW B;  1ORS C;  1SQQ J;  2BCC J;  2KOG A;  1FZG A;  4KC9 A;  3L8J A;  3PMR A;  1JTH A;  1HE1 A;  2JD3 A;  3HKK A;  2W4M A;  5JP7 A;  1OW6 A;  1R5L A;  3L70 D;  5AVS B;  4BRY B;  2NUT B;  5AW8 B;  1Z6A A;  3H1K E;  1SQV G;  4C3D A;  1VYI A;  4EBB A;  3RK2 D;  2QG4 A;  1M7L A;  3I5C A;  3CX5 D;  5L0G A;  3LEV A;  2YMK A;  3B29 A;  1YDI A;  1X22 A;  1OXK A;  1EKY A;  3L72 J;  3W2V A;  2PX0 A;  2O1K A;  3VOP A;  5AW4 B;  3M4B A;  5TJ5 E;  3NMK A;  4AE4 B;  2YKZ A;  2R3C A;  1G4W R;  1WAT A;  4QI0 A;  2VC9 A;  1KTM A;  2R5D A;  3H1H E;  5KYY A;  1LTG C;  4DBQ A;  1CW5 A;  4XPX A;  4WAB A;  1EDI A;  3E1R A;  1YI2 P;  3M9B A;  2R7R A;  1TFK B;  4O79 A;  1MND A;  5B5E H;  5L0J A;  1CPR A;  3H1J G;  3EQ2 A;  4AL1 A;  4W8P A;  3U2M A;  2M5A A;  4BJ5 C;  3K1I C;  2D2C D;  2MYS A;  3V4Q A;  4U9E A;  1BCC J;  1Y8A A;  4EIJ A;  3JYH A;  3VMA A;  3D6Y A;  5AVZ B;  3H1K J;  1LI5 A;  4H4K C;  1VPC A;  3AG3 C;  3NMD A;  1ST6 A;  4AK9 A;  4P9F A;  4BEJ A;  2JEE A;  1VQ8 P;  3G6E P;  3FAJ A;  2XS1 A;  3RK2 C;  2Q1K A;  4JTC B;  4Z9J A;  2QE9 A;  1SQP D;  3NMJ A;  4CS8 A;  2KYV A;  4BJ1 A;  3OAK A;  4U3F D;  2B87 B;  3NG1 A;  1LNQ A;  1RXQ A;  3A0H E;  1FAP B;  1SS1 A;  1NU1 J;  1YBK A;  4GOD A;  3IR9 A;  1S3J A;  2YL3 A;  1FZA A;  4HFF B;  2KS1 B;  3AG2 C;  2UUI A;  3H1H J;  3OA7 A;  2WTY A;  1TQG A;  3C9I A;  4D6T J;  4LLH A;  2V26 A;  1PZQ A;  4JYB A;  2EIJ C;  3DE8 A;  4A4A A;  2IXN A;  2LIG A;  5BQH A;  5COM A;  5KJ7 D;  4YTP C;  4LDR A;  3MHV A;  2VCB A;  4WY4 C;  4E7Z A;  1GL2 A;  5APS A;  5CI8 A;  1T3J A;  3L74 J;  3M9Q A;  4PD4 H;  5AW3 B;  3MFN A;  2D2C C;  1AVO B;  4Z9I A;  2WPV B;  3PHL A;  3K5B A;  1FDO A;  2HFE D;  2ZAE B;  1AV1 A;  1M2V B;  1Y9B A;  2OTL P;  2Q4F A;  3WUU A;  2P0N A;  2R3S A;  4OWF A;  2DB4 A;  1LTJ C;  3FGA D;  4ASV A;  4LC1 A;  2R05 A;  3QZC A;  3GG2 A;  4Z9H A;  2D5R B;  4JRZ A;  1PP9 D;  1NAY A;  2R32 A;  2E76 C;  1QSP A;  2EIN C;  1BBH A;  3S1K A;  1X8Y A;  4EOT A;  3DM9 B;  4N6J A;  3GEE A;  1QPU A;  2E42 A;  3V5Z A;  2A06 E;  3LW5 H;  3E7K A;  4HJG H;  3EPV A;  3MLG A;  2HZ8 A;  1N2D C;  4NTB A;  3IAO A;  2P10 A;  3U3B A;  2W4B A;  4IAQ A;  3M79 A;  4JW1 A;  1M2O A;  1LT9 C;  4C7R A;  1OKK A;  3H1J D;  1TR2 A;  2XNX A;  1KB9 H;  3T6G B;  5DVW A;  1FR0 A;  3RBZ A;  3PP5 A;  1S72 P;  4PK4 A;  2VCA A;  1VQ9 P;  3IPM O;  2Y9Y A;  2EIM C;  3CC4 P;  2YL0 A;  2YKO A;  2WSE J;  4RJT A;  3VMZ A;  1NTK E;  3DM5 A;  2QJP C;  3RKO F;  4ZNC A;  1EI7 A;  2W90 A;  3R4Y A;  4P6I C;  2B89 A;  2E5Y A;  5APX A;  3C1L A;  2HPC B;  5AW6 B;  3C63 A;  3DWW A;  1SLQ A;  3RQE A;  3MIW A;  1E79 H;  3U2L A;  4BJ6 A;  5KYN A;  3WUT A;  1JCD A;  1Q0F A;  1FDI A;  3CC7 P;  4H0L B;  2HFI A;  2IBF A;  2P7V A;  3U1C A;  4EUK B;  5A69 A;  2I1K A;  2XL4 A;  1H9T A;  4AYC A;  1KFN A;  5CI9 A;  3RL0 C;  2WVR A;  4FWV A;  3O8Z A;  1L0N K;  1NTZ G;  3WU2 E;  1FDM A;  4JE9 A;  5AVV B;  2WVO A;  4K7B A;  2R02 A;  1PFI A;  3BAT A;  1K04 A;  3AEF C;  1FJK A;  3M0D C;  2L91 A;  3US6 A;  5A6K A;  3I55 P;  4O6M A;  3KYJ A;  1Y47 A;  5AC4 A;  1TU3 F;  1NTK J;  2XXA A;  1MKM A;  2YXQ B;  5DQT A;  3AG4 C;  1QLE D;  3CD6 P;  3KYI A;  1KQS O;  4NPD A;  4XEV A;  1ORY A;  1MMN A;  4AX2 A;  4JF7 A;  1YAR O;  2IZ0 A;  1RF0 C;  5FCL A;  4HFK B;  2OU6 A;  4EYY Q;  5BVZ A;  4OGQ D;  1E2X A;  1JPJ A;  4ULW A;  1AQ5 A;  1URQ B;  1HVV A;  2R7W A;  1OCO C;  2AEM A;  1LWU A;  2LD6 A;  1SZI A;  1SQB K;  1RKC A;  3HD7 B;  3FX0 A;  1V55 C;  1GZL A;  5E2Q A;  4MW8 A;  3C7J A;  1W2B O;  1YIJ P;  4RDA A;  2NSF A;  3ZC4 A;  4PV1 D;  4L75 A;  2M8R A;  2IBZ G;  5B5E E;  2IBZ I;  1EA8 A;  4IFF A;  4F4B A;  2V4H A;  3K6B A;  2JKV A;  2L6F A;  2P61 A;  1IW7 F;  2O01 J;  3HUS B;  1VQN P;  4L76 A;  1PV3 A;  1RMV A;  2PFD A;  1GMJ A;  1A7E A;  3CWB G;  1EQ7 A;  3L71 G;  1NKZ B;  3NMI A;  3H32 B;  3BEH A;  4MVS A;  3ZSU A;  2DI3 A;  4OD4 A;  3L75 G;  1QLE C;  3KXD A;  1Z5Z A;  3P7K A;  2Q9C A;  5D91 A;  4OIQ F;  3UGP A;  1IFP A;  3C8Z A;  2WPR A;  2A1D D;  1L0L J;  3D6Z A;  4IJJ A;  4DJG A;  4CIH A;  2Z15 A;  1FZF A;  3RFY A;  3EZI A;  1HJ0 A;  4C7O A;  5DS4 A;  1L0N E;  4OGQ C;  4U5D E;  4JCZ A;  3WUV A;  3RL0 g;  1AQT A;  3JSE O;  3W2W A;  1CSB A;  3Q2Y A;  2NG1 A;  1LI7 A;  1MMA A;  3SEO A;  2R7O A;  2LXC B;  1YTZ T;  3AE1 C;  3TNU B;  3U9M A;  5L0D A;  5DJU B;  1T8Z A;  1S5L X;  4ZLC A;  4G7H F;  4HH2 A;  4U9D A;  3G4S P;  1DEE G;  4PV1 C;  2PRR A;  1J1D B;  1WWP A;  3AEE C;  4DRJ B;  4ULV A;  1NLX A;  4PD4 E;  4JEB A;  1YZA A;  4LAC B;  3HLZ A;  2JX0 A;  4XA4 A;  1VK5 A;  4MVU A;  1PL5 A;  3JRT A;  4B86 A;  1FNT c;  1U89 A;  3H1L E;  1LS1 A;  3HE4 A;  1VQ7 P;  4NC3 A;  1Q2N A;  4R32 A;  1BGY G;  3MZW B;  3UR3 C;  3FVY A;  4DT0 A;  5COG A;  3DJU B;  1CZQ A;  2J9W A;  3CQZ A;  4W7Y A;  1J8Y F;  1LE2 A;  1EC5 A;  1IJD B;  2J59 M;  4H13 B;  3A0B H;  3O6X A;  4YL0 A;  2VCC A;  1WRG A;  3H1I G;  2W8Z A;  3TDK A;  1NHL A;  3A11 A;  3V5Y A;  1JO5 A;  3IQ6 A;  2KK1 A;  2NUP B;  1RE3 A;  2JR8 A;  4I6M C;  4JEA A;  2J0W A;  1KQF B;  3EQL F;  3K33 A;  1FMV A;  3DAG A;  4BXL A;  1I4Z A;  2K1A A;  3U0C A;  1KB9 E;  1S5L H;  3AEG C;  2AVK A;  2OOC A;  1RH5 B;  5KYU B;  3S84 A;  3QW0 A;  4E18 A;  2IXP A;  2FFD A;  1USD A;  3ZDM A;  2D4U A;  1H88 A;  1HGV A;  4IRU A;  1TWH A;  4DRH B;  3CWB D;  3NYJ A;  3H1L J;  4A2N B;  2OAR A;  1BE3 E;  2ZVO B;  1LGH B;  4GT1 A;  1A02 F;  4BPM A;  2KSE A;  3DI5 A;  2ZXR A;  4YL3 A;  1KFM A;  2GUV A;  1SQQ K;  3CCV P;  1U7J A;  5B66 H;  4NTA A;  1K40 A;  4H0L C;  4O7G A;  3TJ6 A;  1OVU A;  2OJE D;  4ER9 A;  2IXM A;  3HD7 D;  5KLV J;  2G62 A;  1JM0 A;  5AW5 B;  1K73 Q;  2OCC C;  2J7P A;  1T01 A;  4YT4 A;  2IYL D;  4M63 A;  1R8E A;  1J1E B;  4CJO A;  1FZC B;  2H7H A;  3O6Q A;  4C3B A;  1L4A A;  2EIK C;  3J06 A;  3NFQ A;  4R4L A;  3BRV B;  4DRI B;  4DVZ A;  1SQB G;  1N7S D;  1Z3I X;  4FX5 A;  1I4Y A;  3VN0 A;  4Y99 B;  1S9K E;  5APT A;  3MGN A;  2QY9 A;  1KU2 A;  1IK7 A;  2E87 A;  2C0X A;  3CC2 P;  1HW1 A;  4CS9 A;  2HG5 D;  1YJW P;  3Q5P A;  1E5W A;  2J0X A;  1XTG B;  1FJP A;  2WVN A;  2EPN A;  1MQV A;  5IY5 C;  1BGY D;  2N1T B;  2YLG A;  3ZQY A;  3DZA A;  3HE5 B;  4KBL A;  1S7Z A;  1NG1 A;  1G2C B;  2A0U A;  3L70 G;  2D2C B; 
#chains in the Genus database with same CATH homology
 2L6H A;  1VF5 B;  2WQY C;  4PV1 B;  3Q3D A;  2PBE A;  3AEC C;  4OGQ D;  4H13 C;  4H13 B;  3D70 A;  3AE6 C;  2NZ2 A;  1EXI A;  1KTM A;  4H44 D;  2JO1 A;  3GMA A;  5M1B A;  3IAO A;  2P10 A;  1ZRT E;  3AE4 C;  4TT3 H;  3L8I A;  3C8G B;  3AE5 C;  4R4M A;  3D71 A;  2J5U A;  2KK1 A;  3U3F A;  3O10 A;  1UFB A;  2QJK C;  2JPU A;  1ZZP A;  2K9Y A;  2QIW A;  3AE2 C;  2H88 C;  3AEB C;  3GLM A;  3B71 A;  2OQQ A;  1KQF B;  2L6G A;  2D2C D;  2E76 D;  1KMI Z;  1VF5 D;  2FBW C;  2WSC J;  4PV1 D;  1O3U A;  3C8V A;  1WTY A;  3RQF A;  1K05 A;  3U0C A;  4I7Z C;  3D6Y A;  4I7Z B;  1ZME C;  1RQU A;  2E75 C;  3BRJ A;  2ZT9 C;  1OMI A;  2ZT9 B;  3AEG C;  1WMK A;  3IN6 A;  1U57 A;  3T97 B;  4Z1M H;  2L6F A;  2O01 J;  2WSE J;  4KT0 J;  3GM2 A;  1PV3 A;  1DIP A;  2Q00 A;  2HSB A;  2YWA A;  3LW5 J;  2QJP C;  1GMJ A;  2E74 C;  4EBK A;  2BEQ D;  1VL2 A;  3R4Y A;  2IDB A;  2H89 C;  4RKU J;  1DD3 A;  1KOR A;  3GF7 A;  2V7Q J;  1Q90 D;  3RQE A;  1KQG B;  3TUL A;  2JP3 A;  1JB0 J;  4IL6 X;  1K40 A;  3GM3 A;  2D2C B;  4H13 D;  4H0L C;  1FDI A;  4H0L B;  3SFE C;  2E75 B;  3D6Z A;  2MKV A;  1EXJ A;  2FYN C;  3C18 A;  3GM1 A;  3C8G D;  3S9O A;  1PIX A;  1S1C X;  1QVX A;  1HJ0 A;  4OGQ C;  1RQV A;  5F28 E;  1KIL E;  4Y28 J;  3RL0 g;  3GF3 A;  4YXD C;  5KLI C;  3Q5S A;  3AE3 C;  3Q2Y A;  2G8Y A;  2FXP A;  4H44 C;  1R8E A;  1KNY A;  2E74 B;  3AED C;  2BEZ F;  3O6Q A;  4YTP C;  4XEF A;  5L8R J;  3L8J A;  1OW8 A;  2QJY C;  3AE1 C;  4H0L D;  2E75 D;  1OW6 A;  2ZT9 D;  4R4L A;  1S5L X;  1DD4 A;  3MFN A;  1K04 A;  2D2C C;  3AE9 C;  3AEF C;  1VF5 C;  4PV1 C;  2QSI A;  2WSF J;  1WWP A;  3ABV C;  3AE7 C;  2WPV B;  3AEE C;  3G9R A;  3Q1M A;  1V4A A;  1YQ4 C;  3SFD C;  3AJM A;  3H25 A;  1IK7 A;  1FDO A;  4XFJ A;  2E74 D;  1AJY A;  1NYH A;  1TU3 F;  1Y9B A;  1JOG A;  2JX0 A;  2LK4 A;  3JYY A;  1MKM A;  4OGQ B;  1PL5 A;  3Q5P A;  4EBJ A;  2YIU C;  1ZP0 C;  2YMK A;  4NQF A;  1YQ3 C;  1UIX A;  4H44 B;  3FGA D;  5KKZ C;  3EWK A;  3Q5R A;  1OW7 A;  4XEK A;  4GDO A;  3C8G A;  4XEV A;  2G3A A;  1HF9 A;  4R32 A;  3AEA C;  3AE8 C;  3RK3 E;  1ZOY C;  4U7J A;  1NGM B;  3K7D A;  1WOL A;  3RQG A;  3JZ0 A;  2E76 C;  2E76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...