1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
3C18A 3L8JA 1YQ4C 3U0CA 2Q00A 1K04A 1ZOYC 3AE3C 3U3FA 1ZZPA 3SFDC 4XEVA 1K05A 1K40A 4YXDC 3RQGA 2L6GA 3L8IA 3AEFC 1WTYA 3B71A 1OW7A 3S9OA 2JPUA 3AE8C 4EBKA 2PBEA 3K7DA 4R32A 1ZP0C 1YQ3C 2FBWC 1OW6A 3SFEC 3AE1C 3GM3A 3RQFA 3AECC 2L6FA 3GM2A 3AE5C 2HSBA 2KK1A 3TULA 2L6HA 1PV3A 2H88C 3ABVC 1UFBA 3C8GA 3GM1A 4XEKA 3AEDC 2YWAA 3AE9C 1JOGA 3C8GD 4YTPC 1KTMA 1OW8A 2JX0A 1WWPA 3JYYA 3AEEC 2LK4A 4EBJA 4XEFA 5F28E 3AE2C 3O10A 1V4AA 1QVXA 2H89C 3AEAC 2G3AA 3MFNA 3AE4C 3AEGC 2WQYC 3AJMA 3C8GB 3AE7C 3AEBC 1KNYA 3JZ0A 1WOLA 3AE6C 4NQFA 3RQEA 1O3UA 3BRJA
chains in the Genus database with same CATH superfamily
4LLHA 2A06G 5APWA 5GTHE 3MP7B 1BDDA 4ZKPA 3L8JA 1ZR2A 1IFJA 1BSHA 3GORA 5DS6A 3W2VA 3ZIBA 5HV9A 4DVYP 2F22A 1N7SB 3CC7P 1SQXD 3H1KE 4PV1B 4DBQA 2I1JA 1M56D 2KZJA 1SR2A 5GTIE 3NMKA 4EWCA 1FDIA 4GKGA 3KXDA 1H7IA 2W4BA 1SFCC 4DRIB 1GTWA 1JMWA 1OR2A 1XTCC 1L0ND 3T6JA 4XA4A 3E7KA 2CW0F 2O1JA 2WVRA 2YLIA 1M6TA 3VAYA 4E18A 3M0DC 3AOUA 3PTZA 2XL4A 1NWQA 1S7ZA 4LERA 4DRJB 3Q1MA 3DJNB 3UR3C 5DQZA 3IHUA 1OXBA 1YTZI 3JYHA 1N7SA 4A4AA 1JO5A 2ZXOA 5T1DB 3IPMO 2PRRA 3TJ6A 2Q4FA 3R7CA 4PJNA 1ZW0A 2FXPA 4XLPF 4XPWA 3GM2A 5JT4A 4G0HA 4XLNF 3DE9A 4K7BA 1RHZB 4R4LA 4CJOA 3KYIA 1FDOA 4GT1A 5AW6B 1HWTC 3N7NA 3CAXA 1NTKE 3MZWB 3RGUA 1H89A 4YTPC 2D4UA 4U9DA 1A02F 2EPNA 4JE9A 1ZHTA 5DVWA 2WZFA 4IL6H 2X0CA 2CNWA 2Q5UA 5BUOA 1AJYA 1VYIA 4XEFA 5KLVD 3Q5RA 3L74E 2YQYA 3TGUE 3FOOA 3FWNA 1SQVG 1E79H 3RK2D 2I8BA 1L0NJ 2DB4A 4Z9IA 4DXWA 4JEBA 4M3LA 1USEA 4BJ6A 5IY5C 3CCQP 3EFOA 2NZ2A 2R7UA 2YL7A 4P9TA 1NU1E 5CJ4A 3M79A 4JBZA 2Q3IA 2Z5HA 4MW3A 2WPSA 1A41A 1T3UA 1YYCA 2LIGA 1OXZA 2XKMA 1VQNP 2OKUA 3E9VA 1SQBK 5CCHC 3N0TA 1S2EA 2XLWA 3C18A 1VLTA 1EDJA 1LGHB 4CPGA 2KQ9A 1SZIA 2K3RA 1PD1A 1ZOYC 3T6GB 2Y0EA 1R8EA 1SQVD 3FHDA 4ER9A 1K05A 1CGOA 2OARA 3JCUH 2KJGA 1LI7A 1P84D 1FJKA 1GS9A 3L8IA 2QE7H 3H6PA 3RIPA 1KILA 5M1BA 4RD9A 3S29A 4ANJA 1JRAA 1SQXK 2I15A 2KUBA 2ZVOB 1B68A 1M57D 4OINF 4U5DE 3T9OA 3E1IA 4JPZB 4W7YA 1BBHA 4JF7A 4DOZA 2FYNC 2XXAA 1M2OA 2XM0A 4YXWH 2Y9ZA 1V55C 3D71A 2NG1A 1QL1A 1EDLA 3EHMA 3X1OA 3CX5E 1DX7A 2DGJA 4KJMA 1JEKA 1LE4A 2HJ3A 4BJ1A 2OYIA 3TULA 4ZLDA 1SQQK 2R02A 4AK9A 4WY4C 4G7HF 1VDFA 1G1IA 2JD3A 2WTYA 1L4AB 4XEKA 1E2XA 2LXCB 1RE3A 3AEDC 4BPMA 3TJ5A 4WY4A 1SS1A 2HPCB 2IFNA 1JOGA 3C8GD 2BASA 1FU1A 2KS1A 4O6YA 1URQA 1OQCA 4EI2A 2JJLA 1S9KD 4OIQF 2IXPA 3L74D 2MYSA 2HS5A 1MMDA 3LNRA 4CIHA 2XS8A 2CK3H 3HD7C 1YYJA 3M0AA 2EILC 3RVZA 4OWFA 3MYFA 1NU1J 3FOPA 1PGOA 1SQPE 3H32A 1L0LE 1SFCA 5BQHA 1LTJB 3AGUA 3SXZA 3Q6MA 3VTPC 3WUTA 2M64A 2AXTH 4U9EA 4I1MA 2BEZF 3FAPB 3K33A 3QVYA 4G7OF 3DM5A 2KSEA 3SXKA 1FFTC 2ZJSE 3V5YA 3AE6C 3LIEA 3G50A 2QJPC 1VQ6P 3EGXB 4L76A 3KPHA 1G4WR 3CCSP 2PX0A 2YKZA 3EPVA 1YAUO 3RK3E 3B5NC 4I7ZC 2YVKA 3U0CA 3Q6NA 1U57A 1VLSA 5DS4A 1YJNP 3C63A 2DYSC 2Y0CA 5CJ0A 2RMZA 4PD4H 3H1IG 2H8AA 1VL2A 3L71J 1FJPA 2FGYA 1KN7A 4YXDC 2UWJE 1L7CA 1TFKB 5A6BA 1TWAA 3N4XA 1QVGO 2LCHA 1IFDA 3AG2C 4H13C 1PP9E 2YIUB 5FCLA 1NTKD 4ZMDA 1LNQA 1PPJD 2FFDC 1PFIA 2PBEA 1J1DC 4EBKA 1OCRC 1YQ3C 1BR2A 3S84A 1P84E 3LLKA 1OZHA 4OIRF 4RBNA 1I4ZA 3UMHA 3GF3A 4ZNCA 1WATA 3UMKA 3OA1A 1NTMG 3V5XA 1SQBG 4N06A 2WSCJ 1RY3A 2ZXRA 4DBRA 4DRHB 3RL0g 3RK3B 2ZYAA 3A11A 3NXSA 2B88A 2PF4E 4D4NA 2WPVB 2HSBA 3H1JE 2J9BA 3DM9B 1IFMA 4EBBA 2EPOA 1HJ0A 2YKOA 1ZMEC 1JY3N 5AW4B 4ONSA 4RESB 1E5WA 4ZKUA 5AVTB 3H1JG 1GW3A 2HV6A 3U2LA 3VP9A 2OQQA 3CC4P 4IARA 2HODB 3CCRP 5DJTB 3IQTA 1M2VB 2K88A 3A0BE 3TNUA 4G78A 1LI5A 1T9KA 2NPSC 3K5BA 2XLMA 3PJSK 3PDMP 4CDVA 1OKKA 3AEAC 2YRFA 2H43A 2R7XA 2YL1A 3BRVB 1QX8A 3FDQA 4KNWA 1KU2A 1YLMA 5E2QA 1LWUC 4C3DA 1VTMP 4JEAA 2M0BA 3AG4C 2H8PD 1RKCA 5KLIB 3KYJA 3ATPA 4YL0A 3KDPB 1FTSA 3K1IC 1KMIZ 1SQPJ 3H32B 2OQMA 1AQTA 3JTLO 4ZLCA 1NG1A 3KZIE 3C7JA 1RE4A 2YNYA 2Q00A 3AG3C 4MQ9F 2OCCC 3PP5A 1ZLLA 3WAQA 2MKVA 3AQBA 4E17A 1KB9I 3N2ZB 1SQVE 1URQB 3RBZA 3PH0A 1BDJB 3RK3C 1VQLP 5KYWA 1L4AA 3GG2A 2PFXA 2HMZA 1CI6A 2OTLP 3CCMP 1NTZK 5BU8B 1SP4A 1QEXA 3BCCE 1IC2A 3RH3A 3Q7LA 4LDRA 2ZXPA 3L74G 2W9YA 2AWCA 5TJ5E 3H65A 3RQFA 1NTKK 2BCCE 3EQ2A 1H6GA 2WSEJ 4U5CE 3RW0A 1HMDA 3W8IA 3L75D 3OEOA 2L6FA 4MVOA 4Y28J 3FMSA 2QLAA 3U9MA 1L0NG 3H1HD 3Q5SA 1J1DB 2P2UA 1VQ8P 3UNGC 2Y0DA 1VQPP 4IOIH 4NY3A 3GM1A 2BE5F 4XWJA 1A02J 2BC5A 1KD1Q 2ZYGA 1YJGA 2GFHA 3JSVC 3DAFA 1L0NK 4EOTA 1DOVA 4N6HA 5CMZA 2YO2A 4IWBA 4L73A 4EHPA 2NPSA 4UB6E 3NKEA 1NYHA 1MFZA 2XLOA 1K8AQ 5C39A 2CPBA 4AL0A 2D2CD 1NTMK 2J7PA 1TU3F 5COFA 2RD9A 3H1HE 1Q0DA 1YARO 3V4QA 5CCHD 1SFCD 1KQGB 3GWNA 2WQYC 4W8PA 2Z4EA 4GEHA 1EDIA 2XLDA 1N73B 2IXMA 3K1IA 3CMEP 2XLHA 3M1CB 1OR3A 2KGOA 1EDKA 2KNHA 5D91A 3WHNA 1CI6B 3LEVA 1VB5A 1HY5A 2XSEA 4FWVA 4MVMA 1BGYE 1OVVA 3L73J 5KYWB 1S72P 2A69F 2BL2A 3AE3C 1QLED 1BE3E 3W8HA 2QVAA 4Q4ZF 3EJNA 3A0HH 2P10A 2XS1A 2HFED 1FAPB 4GODA 1SMYF 2Q7CA 2W4MA 3CCLP 1ZRTE 1SQXJ 1AUEA 3NMIA 1LS1A 3L1MA 2E87A 1Z63A 4KT0J 1WTYA 3EH2A 1JMMA 2NSGA 1Y9BA 3KHUA 4IFFA 2CCYA 5CI9A 3SNHA 2V3CC 2A45H 2XL8A 5AVQB 4ASVA 5A6JA 3VRCA 3L0IA 1OW6A 1Q2NA 3SFEC 2JR8A 1RXQA 1MMGA 4R4MA 4U5FE 3DAGA 1X0TA 5JLIA 2PFDA 4GOFA 3S4RA 4GYTA 2P0NA 2NPSD 1JAFA 4K0DA 1MUUA 3AE5C 2L5GB 1KILD 1NTKJ 2QTVA 4U5GA 4N6JA 3C8ZA 4U7JA 4GIFA 1M2VA 4JTAB 3P8CD 2CGEA 3E70C 4BJ5A 4JJGA 4WWIA 3SWFA 3L35A 4L75A 5A69A 2KYHA 4PV1D 4XFJA 3UIAA 3A3YB 1OX3A 3H1KD 4D6TG 3O10A 2IBZG 2W90A 1VPCA 1GZLA 3ZSUA 3G3ZA 1ORSC 3BATA 4PD4D 3RBXA 1Z23A 3H1ID 2P1AA 4YK5A 4JRZA 2E75D 1WN0A 2O9XA 3RVYA 1PGJA 2Q9CA 2ZT9D 4B86A 4CBEA 1FFHA 2FFDB 3AE7C 3RYLA 1IO4A 2IYPA 2O3JA 1LT9B 1N7LA 1GM5A 1ZW3A 3H1KJ 4C46A 1T8ZA 3PHLA 1JNMA 4NPEA 1YQ4C 3EG9A 3L71G 1XWJA 1PIXA 3VM6A 1J1EB 1MFTA 5L8RJ 4JW1A 5DLJA 3EQLF 5A6AA 2J9WA 4LC1A 1SQBD 1VQ4P 2GUVA 3OJAB 4UB8E 3AQCA 4OGQD 2R44A 4NTAA 2IBFA 1IZNB 1FZEA 1RF0A 3AEFC 1TKNA 3QTHA 2R7QA 4Q5SF 1W2EA 1FMWA 2IYLD 2KC3A 3SWKA 1FZCA 4MN4C 2HLOA 4RDAA 5CCGC 2VASA 1S5LH 1HBWA 4E0IA 4CDYA 1N7SD 1PZQA 3U8VA 4EUKB 4XTKA 4OD5A 3EFGA 4DOJA 1SFCB 4PR9A 2FYUE 1I5NA 4UB6H 1D0ZA 2Q9AA 3QWOC 3TYYA 1N7SC 4QDLA 1NAYA 3L36A 1QSPA 3ABLC 1LTTC 4Z9JA 4HJGH 1W2BO 3ABVC 1Z5ZA 1UFBA 1VMAA 3V6IA 3L37A 3L75E 1FS0E 3C8GA 5CIVA 2XZRA 1VF5C 4NC3A 2HPCA 4WY4B 4C7OA 1NTMD 1NTMJ 1L3PA 4LACB 4OGQC 1SQPG 2A45I 5AW2B 5AVXB 3B5NA 3AE2C 3IAOA 5AW3B 1FZCC 3W4YA 5AVYB 2M8RA 1SQQE 4C7RA 3MD0A 1H9GA 256BA 3CCJP 5KYYA 3E1RA 4JIOA 3EFFK 1MKMA 3VYIA 3AJMA 2PP6A 3KKBA 3BASA 5B3IA 4IRUA 1M1JC 4CJGA 2O01J 2J8WA 2LXBA 4RO0A 1H0TA 3RK2B 1HW1A 5AW5B 3QW0A 2RKLA 2OG2A 4KI2A 2WPQA 1VK5A 1P84I 1NVOA 4A2NB 5AW7B 1GL2D 4GQHA 3DI5A 1KILB 4U3FJ 2LKMA 2ZXEB 2IX7C 3FGAD 1KQLA 4HEAJ 4IL6E 1NH4A 1PL5A 3ZC4A 1NTZE 4JQ0D 1GQAA 3QZCA 1ZHZA 3LNMB 1NGMB 3DMDA 3JRMO 2V7QJ 3EHNA 4CSAA 1LE2A 1RF0C 3DD7A 2YXRB 1BSNA 4I44A 2B89A 3H1HG 3O6QA 3G71P 4F4BA 3B71A 1Y47A 2ZD9A 3FXDA 4W80A 3ABKC 3L70G 4AE4A 1SQQD 3F5HA 3C62A 4K35A 1U7MA 2A06D 5APSA 2EIKC 4C7NB 2UUIA 2G8YA 2EPMX 1VQ5P 4MVUA 3H1KG 4D6TD 3GLMA 2ZT9B 3HNIA 3ZWIA 3NYJA 1C17M 4XPXA 2HSQA 3AECC 5KAIE 2KNCA 1L0NE 3CLQA 1C02A 2A0BA 3S27A 4LGDE 3LW5J 4ULWA 2PX3A 2EPLX 4OIOF 5KKZB 3IQ6A 3CMAP 4PFOA 1TQGA 3MTUE 3HE4B 2J0XA 3II6A 1YA7O 2Z15A 2O01H 2WITA 5KYUB 1CPQA 2OYIC 5L3VA 2HG5D 3D70A 1N2DC 2AEFA 2IZ0A 1H88A 2NUTB 3T97A 1GDTA 3GODA 2GDCA 2LK4A 4I1LA 2J58A 3A7OA 2YKQA 1FZAA 3CQZA 5AVUB 1ZHWA 4YL1A 3MLGA 1JM0A 1M7LA 3PLNA 3A0BH 1KFNA 1FDMA 4CS7A 2E42A 2OYOA 2DI3A 2Q1KA 2WL8A 1JPNA 3DE8A 3JC22 1LJ2A 1AVYA 1L0LJ 4CX9A 4BRYB 1JR8A 3RQEA 1TWCA 1E86A 3V2QA 2G3KA 4BG0A 1NTKG 4JTDB 1Q82Q 1ORYA 2J45A 4PK4A 1FZFA 4WABA 3JRTA 2M4EA 2IFMA 3HTKA 2KB7P 3U3FA 1M56C 2H7VC 3ZVRA 2XLEA 5KAFH 1FOSE 4HYTB 2WVQA 4RJTA 2XNDH 2K1AA 5KLVK 1LM3B 4CS9C 3S0XA 3HE5A 2ZFCA 3TD7A 2M5AA 2XRHA 1PCXA 3DWWA 2WT7B 1VQKP 4NPDA 1R4TA 2QSIA 4EIJA 3H1LE 5DS5A 1FZGA 1Z3IX 2GAQA 3PRJA 2C9NY 2NUTA 3U2MA 1GK6A 3KQGA 5KLIC 3GM3A 3MYIA 3L70E 2QIWA 3UGOA 2HV7A 3SSUA 1E84A 1YJWP 1G1JA 2ICWG 2YL3A 2QUPA 1KYOE 1BCCJ 4M63A 3SYNA 1AEPA 4KHXA 5COMA 5JP7A 1G2CB 2G62A 3DXJF 2KNCB 4YJWA 5KKZC 1M1JA 4N78E 5APUA 2WWWA 2A06E 2FYZA 1NFOA 2KZIA 3U59A 2FKWB 1JY2N 1VQ9P 2QJYB 3CXHD 4QI2A 1DEBA 4C7NA 4H44C 2WVNA 4YT5A 5L0CA 3RK3D 2P1JA 4YN0B 1NTZG 3JYYA 1URQD 3AEEC 3CCEP 4LLEA 2JEEA 1Q0GA 5AVZB 4PFPA 1JB0J 1SQBE 3GF7A 3OA7A 3P8MC 5AW1B 3O6XA 1HH0A 4MS2A 1TFOB 3SWYA 1KYOD 3AE4C 3AEGC 1WASA 3VP8A 1LP1B 2B0JA 5EHHA 2EIMC 1LTGC 1M90Q 1E83A 3BRJA 3A0HE 1YZCA 2KSFA 4U3FE 2C9LY 1S05A 1GL2C 1LS4A 2AEJA 3TK0A 1K04A 3BEHA 2DYRC 4NTBA 2QEXP 5JVEA 1CSBA 2KK7A 3GHGB 4FX5A 4LDKA 3SFDC 2ZVNB 2B87A 1LWUB 1NAFA 3POVA 3IR9A 1L0LG 1KB9H 2NUPB 3ZQYA 2AWYA 2P7VA 3A2AA 3NKDA 5A6BD 4IL6X 4MTGA 2WB7A 3RQGA 5KYYB 2XV5A 1T5OA 1LTBC 2E5TA 3L75G 4JYBA 2Q9IA 2B0HA 3GEEA 1KYOH 5JUAA 3CX5D 4H13D 3A9CA 4MW8A 3G9RA 2ZXWC 1J2JB 1IFNA 2XM4A 3B5NB 2OJED 1BR1A 4FESA 4Y99C 2KSJA 3H2VA 2QJPB 4CDAA 1CZQA 2PNOA 1ZU5A 4OD4A 2NUPA 2B87B 1DEEG 4GDOA 1Z56A 4Q7CA 2Z5IA 2POHA 3GHGA 3EZIA 2G3VA 4O6MA 3EGDA 1VF5D 2FAPB 2QE9A 1N86A 3IQ5A 4NPFX 4J7TA 5APXA 1T01A 2N9BA 2W6AA 2YO3A 4EDFA 3RFYA 3GANA 2L81A 1LP1A 2VH3A 4D4XA 2HR3A 1KB9E 2R7WA 4O9BA 1JPJA 3RL0C 2D5RB 4WGZA 2P6VA 2OTKE 1APCA 2QRXA 3AG1C 5K0IA 5CCGD 3MGNA 4U5HA 4H44D 1Z6AA 1NOHA 3LUTB 5AVVB 1N1CA 4JURI 1NU7D 2H89C 3T6BA 3B5ND 3W68A 2RN0A 1EQ7A 1WT6A 3GW6A 3V2PA 1S1CX 2YLGA 1YYXA 2R3CA 1BCCG 1X9VA 1HMOA 3HNKA 3SXMA 1NTZJ 1ZV8A 2OJQA 3U5SA 1KNYA 1G2CA 3BCCD 1OCOC 1NU1D 3NG1A 2GUSA 2AVKA 3H1JD 1RJ9B 2I1KA 3TF5A 1KC8Q 1OXKA 3LS0A 1VYKA 4IFDK 4QMAA 1HF9A 1LT9A 1YDIA 2Q6QA 1J8MF 1VOMA 3H1IE 4PJJA 2Q7RA 2IXNA 2FFHA 2BCCG 2NPUA 1NU1K 2J59M 2FFDA 4MTOA 3VF0A 2L9JA 4XPYA 5CBNA 4EKWA 2L91A 5E3CA 5GTIH 3CSKA 2CDQA 3USSA 3WODF 2ZT9C 4A7PA 2P61A 1KQFB 4JCHA 5AGFA 2KYVA 2M5AB 1RF1A 2KW3C 3TOLA 1KORA 4TT3H 3HE5B 5KLVJ 1FBMA 3AE8C 2J46A 1Q0KA 1ZW2A 3K7DA 1YJ9P 3B8EB 3RKOF 3ZG1A 5DQTA 1NU1G 1YVIA 1Q81Q 3UGPA 4PV1C 1XTGB 1HGVA 3IQCA 4MVSA 3ZTZA 5E79H 5E3AA 1BZ4A 2JKVA 1SQVJ 3HTKB 1HW2A 2E75B 3W67A 3KYQA 4MTFA 5JS5A 4I6MC 1W5CE 3L73D 1R5ID 2VCCA 4B6IA 2FY8A 4MVQA 2IBZD 3HD7A 4BRYA 1L0LK 1NU9C 1V54C 1OCCC 2E76B 1KILC 4N78D 3HKKA 3L72J 2AEMA 2IYOA 2J9UA 2R7VA 4OVNF 2OU6A 5E33A 2CNWD 1N8RQ 3IFMA 2R7OA 1KTMA 4Z9HA 2CYDA 1UG7A 1CW5A 2R25A 1EZVI 3LW5H 2C0XA 4P6IC 1M1KQ 2H7HA 1ZRTD 1LTSC 5COGA 1CPRA 1S9KE 1Q0FA 2IXOA 1MV8A 3IEEA 1FR0A 4J7YA 2N1TC 3MFNA 4L74A 4JTCB 4QI0A 5H2FE 3HLZA 3HE4A 2YLDA 3I4UA 5KYXB 2E74B 3U1AA 2N1TA 3JZ0A 1QKRA 1LTJC 3QH9A 1X22A 1O3UA 2H7BA 2K9JB 2PAJA 1QLEC 1ZYRF 3CL3D 1WRGA 3DZAA 3LESA 1K73Q 1U0BB 5B1BC 1ZZPA 3VMZA 2EINC 2XU6A 5KJ7A 4LDQA 5CI8A 1NHLA 2AXTE 1S5LE 4I2LC 5B66E 1N73A 4BJ6C 3M4CA 2LFFA 2HYNA 4DJ9A 1SQPK 3H25A 1MQVA 3A5TA 1T6AA 3GWLA 3CXHE 3ABMC 1LTAC 2QNLA 4X0RA 5AC5A 3P32A 2IPPA 2LR2A 3H1LG 1FAVA 1LPEA 2N1TD 1T6UA 1XZPA 1WGWA 1OW7A 1LVKA 2WSFJ 3FX0A 3L70J 2HMQA 1G8XA 4R32A 1ZP0C 4Z1MH 3HUSA 1NFNA 4FAPB 3WUVA 2C04A 3H1LJ 2YZSA 3CXHH 1JMBA 2KI7B 3WU2H 1OIPA 2ZYDA 1KQSO 1Y4CA 3S90A 3R2PA 2JDIH 4P9FA 4CS8A 2OTJP 5CCGA 2ZAEB 1H0TB 2LSEA 1W2WA 2W6JH 2M3EA 2QJKB 1OWAA 2Y3BA 3G4SP 4HFFB 2OYHB 1MMNA 4YWQA 3BCCG 3CD6P 1TR2A 1EI7A 1GU5A 1CGNA 3C8VA 1YA9A 1SQQJ 5B1AC 1DH3A 2JX0A 3QW1A 1BE3G 3U8PA 3O8ZA 1SF8A 5T3TA 2DW3A 1PGQA 5TISH 3F47A 1GMJA 4H0LB 2AXCA 3V5BA 5JSLA 5L0HA 1DD4A 2JO1A 3FXHA 2K37A 2K9JA 2WPRA 3H2UA 4C7OB 3V4WA 1ZHXA 1A7EA 5TJHA 1YIJP 3K6BA 1SQBJ 1V74B 3FWLA 5CBOA 3KMIA 3CEXA 1HTLC 1D7MA 3C8GB 4N4WA 1AVOA 1BGYG 3B4SA 2Y39A 4CS9A 2JWDA 4E7ZA 3JT1A 3M0DA 4IAQA 3M9HA 1RMVA 2YEVA 4U5EE 1IFIA 1GL2A 1JTHB 1JY3O 4WBAA 2OEXA 1Q90D 3L70D 4DZOA 2AU5A 2HZ8A 2QJKC 3Q3DA 4GOEA 2HJMA 2R05A 2OYHC 4PD4I 3OWTA 5HSWA 4XEVA 2XL6A 4KBLA 5TISE 4WJ0A 1K40A 2XLVA 3PMRA 2A68F 2J9VA 1USDA 3V5ZA 4AQRD 1M8OB 3L72E 2OGUA 2O01N 1FZCB 2JPUA 1AV1A 3D6YA 5F5HA 1L2PA 4ULVA 3TNUB 4H0LD 2I8DA 3KPEA 1J8YF 2FBWC 1PP9G 4W7ZA 3G4XA 2A1DD 2IBZE 1KV4A 3V2NA 4D6TE 3JCUQ 3L71D 3W2WA 1D1BA 2PGDA 3RL0B 3G4ZA 2J0WA 1RE4C 2Y3GA 4K1OA 3CX5H 4U3FD 5B66H 1NTME 2FXOA 1D1AA 2KK1A 1CGME 3CI9A 1RKEB 1PV3A 1KZUB 3H1JJ 3ITKA 1VF5B 5L0GA 1NZEA 2BCCJ 1VQOP 1YI2P 4MVZA 4MVRA 4IGGA 3HRNA 4E0HA 1GGQA 3M91A 2E74C 4CSAC 4PJLA 3K1HA 1PP9D 1RKEA 2FYUJ 5AW9B 3BRTB 1DIPA 2ITAA 1V4AA 3IF4A 3VMYA 4BWNA 3NRHA 2QY9A 4W8KA 1RJ9A 4Y99B 3L74J 4IFMA 3P8CE 2J7PD 5BVZA 2VC9A 4H13B 1HE9A 1OMIA 2OOCA 3NTNA 3FVYA 2K9YA 2NSFA 1AFOA 1WOLA 1EQ1A 4OH8B 1T3JA 1YZAA 5KLVG 4PJ0H 2KP8A 2E5YA 1LT9C 5AVSB 1Q86Q 1XZQA 1VQ7P 2QG4A 2W6BA 1BE3J 3M15A 2E76C 2VB6A 1Q7YQ 1BR4A 4PJ0E 1D0XA 3L4FA 2IM8A 1GK4A 3I56P 4AL1A 1NKZB 1LTJA 2L6GA 3HTKC 2R7TA 1ST6A 2A6EF 3M9QA 2FXMA 5KTBA 4BEJA 1JTHA 1GL2B 2YXQB 1RF1C 1MNDA 5EK0A 2A45G 4XE5B 3L72G 2E43A 2R03A 1Z7Qc 1SQVK 2B9BA 2HUJA 1IW7F 1AVOB 3SZRA 2QM8A 4E7SA 2E75C 1URQC 3EGDB 3D6ZA 5E79E 3WU2E 2GM4A 4XQ1A 3CCUP 4RKUJ 1PPJE 1FZBA 2VRSA 2ZXXA 4LLCA 4C3BA 1NJIQ 1EXIA 3TK1A 2IZ1A 5APYA 4NCQA 4AYCA 2Q3TA 1T6IA 3HUSC 1YBKA 2MHRA 3R4YA 4MNDA 2KXPB 5APVA 3CC2P 1T6QA 1HJBA 1YITP 2D2CC 2XXAB 4TLFA 2QJYC 2R9RB 2OYHA 2R32A 4CS8C 4O7GA 2L7AA 1EZVG 2YMYA 1RH5B 2NPSB 5F28E 2P7JA 4YL3A 1M57C 5FZTA 4HKZH 1Q0MA 4BJTA 1G5ZA 5AC4A 2AP3A 2V7QH 1SQXG 1OKKD 4DVZA 3TGUG 1L0LD 4UDVA 1FMVA 1OCZC 5BU5A 3NYLA 4KNVA 1TWHA 4UB8H 3HUSB 1OVRA 3H1LD 3B0PA 2ETSA 3U3BA 1UIXA 3ZDMA 2EPKX 1ZHYA 1QL2A 2QA4P 1KYOI 1UIIA 4J32B 1T2KD 1HVVA 1IFPA 1N73C 2V26A 3CWBG 2HFIA 4BEMJ 5DJUB 3L73E 3MUDA 2J5UA 4U3FG 2BEQD 3V2RA 1Y6DA 5KJ7D 2JP3A 1IZMA 1DD3A 1MMAA 2YL0A 3GMAA 3TGUD 4YPCA 5APTA 3EFOB 5AW0B 2H7OA 3BVHA 3OAKA 5L0IA 1U6HA 3B9QA 3X2QC 5L3QA 2WSCH 2X51A 3US6A 3CPWO 2N1TB 1R5SA 5KYXA 3Q7GA 5F5FA 4D6TJ 3AE1C 1FOSF 3TDKA 3M4BA 1NLXA 3S1KA 1ZU4A 1T2KC 3T4RA 1EZVE 3CWBD 1ZXGA 2LQGA 1A0BA 4G7ZF 2V4HA 4EIYA 3SP1A 3B0UX 3MBGA 3RF3A 2YKPA 5B5EE 5BQIA 1NBBA 1JCDA 1NKNA 1ZVZA 3QMKA 3VOPA 3TOMA 2IOQA 2WT7A 5GPGB 3TSIA 1PPJG 5T3WA 3J06A 2H88C 1H8AA 4JVSA 2R5DA 4PD4E 2W45A 1SYQA 4KC9A 2N9YB 3GHGC 5EGYA 1BCCE 3EZHA 1I4YA 1BGYJ 2D2CB 2UUHA 1BGYD 2RH0A 2A6HF 2LP4A 2R7SA 4O6NA 1X79B 3M9BA 3VMAA 5KJ7C 2XNXA 3U1CA 3HD7B 3VN0A 5CHXA 1LT1A 3LAYA 3PHF2 1RE3C 2HODA 1OFCX 3P7KA 2XDJA 5CCHA 4J30B 4C3EA 2ZPAA 1BDCA 5BQGA 3L34A 1K9MQ 2GA0A 2YMKA 2HKVA 4EYYQ 2P67A 4BJ5C 1GD2E 3MUDC 5A6KA 5AVWB 1DOWA 3K66A 5APQA 2LD6A 3L72D 1SQQG 4H44B 4NQFA 1IK9A 3KL4A 5KLVE 3F89A 4HH2A 3AGTA 4H54A 3M06A 3LIDA 1RF1B 4I1OB 1NTZD 2A0UA 1SLQA 3UMIA 2KIKA 4JYCA 3GEHA 4IB4A 3I55P 3T97B 2ASRA 3DKAA 3O39A 4L6RA 3H1IJ 5KYUA 1D0YA 1HGZA 2EIJC 1JOCA 5AW8B 3L73G 4IJJA 3ZDLA 3EH1A 1PP9J 1U89A 4YT4A 3ECSA 1EC5A 1TWGA 3FAJA 2WMMA 5L0DA 3JSZA 2CPSA 4PJMA 2BCCD 3MIWA 4JZAA 4AX2A 4HB1A 4AUWA 2RSEB 1JY2O 1P84H 2FYUG 1S4XA 2GA1A 2Q3EA 4ASWA 1SQXE 1OVUA 1QQ3A 1L4AD 3S28A 1JCCA 3EGXA 4AE4B 3I5QA 3Q5PA 2R3SA 2WZLA 3ASOC 2W83C 3JCUE 1JUNA 2L6HA 3RL0D 3I5PA 3DJUB 3O6QB 3WUUA 4WB4A 1Y8AA 2Y69C 3Q2YA 2LFDA 1LKXA 2YWAA 3NMDA 5D92A 4HFKB 1S5LX 3AE9C 5KAFE 2FYUK 1NO4A 1PGPA 2W27A 3LLIA 5EFWB 3NMJA 1FC2C 1WWPA 3HD7D 1HE1A 3U9JA 4JCZA 1IK7A 5AVRB 2E76D 3FXEA 1RCPA 1EXJA 2MWQA 1AA0A 3QVZA 4N6CA 1A7DA 2YIUC 3I5CA 1SVFA 1FNTc 5L0JA 1QGKB 2FYUD 3H1HJ 1R5LA 2G3AA 5K5GB 1MZ9A 4BXLA 2Y3HA 2KS1B 4IAOA 1X8YA 4CIPA 2KLUA 4DJGA 3HJCA 1PD0A 5B3SC 4WY4D 2C03A 3KZIH 3V7OA 2KOGA 1YTZT 2OYIB 4OIPF 2Y9YA 1RQUA 3CX5I 2R5BA 4K3AA 1LTIC 3L71E 4DT0A 3OW2O 1J1EC 3VYWA 3C9IA 1S3JA 2GWWA 3LEOA 1VQMP 2TMVP 3SEOA 5L0FA 1LWUA 3NYMA 1ZN5A 4I7ZB 2PP4A 1ORJA 2E74D 2MJZA 4HE8D 4I3MA 4WGYA 3HNJA 5KAIH 3S9OA 1JY3P 2O1KA 1BCCD 2KLVA 3C1LA 1NSGB 3ASNC 3F46A 2QM7A 1A7VA 3GEIA 2C0WA 1JY2P 1KFMA 1SQPD 3LJBA 1O87A 3BCCJ 4YT2A 2R7RA 1GW4A 4PACA 2WSEH 1QVFO 1FE6A 1D1CA 2NRGA 1BE3D 1IJDB 1G4US 1C03A 3HNLA 1EKYA 3G6EP 1EZVD 3CWBE 3MHVA 4U5BE 3B0VC 5B5EH 4JC7A 1YHQP 1ZR4A 2YHSA 2W8ZA 4JKVA 5KYNA 5H2FH 3NDBB 1GU4A 4H0LC 2VCBA 3L75J 3VMXA 4WVZA 2Y3DA 2WSFH 3CWBJ 4NTFA 4DCKA 1O5HA 2M3BA 1L4AC 2Q9BA 5GTHH 3KH2A 3WMM0 2FYNB 1HUCA 1KILE 1AQ5A 1LIHA 3CZ6A 2WSSH 3CCVP 4O79A 4YT8A 3MX3A 3O55A 3WG7C 2IBZI 1OW8A 3CXHI 1M1JB 3RK2C 3EWKA 3JSEO 4EBJA 3LS1A 2P58A 4N3YB 1RQVA 1KB9D 3TGUJ 2VCAA 3EG9B 3PCVA 1WMKA 3IN6A 1QVXA 1E85A 1EA8A 1F1MA 2WVOA 3N24A 2WZGA 1U7JA 1QPUA 3ZQVA 1H9TA 3SXYA 1QZXA 2WZ7A 4H4KC 3ITFA 2SPZA 2IDBA 2JWAA 3NFQA 3TQOA 3ZTMA 5JRAA 3AEBC 4OGQB 1MNEA 2OEVA 3B29A 4JJFA
chains in the Genus database with same CATH topology
3C18A 3RK3E 4I7ZC 1Q90D 1YQ4C 3L8JA 3U0CA 2Q00A 1U57A 1K04A 1PIXA 1ZOYC 3FGAD 3AE3C 2QJKC 2MKVA 1PL5A 5L8RJ 1HF9A 1ZZPA 3U3FA 3SFDC 3Q3DA 2P10A 1R8EA 3T97B 2E76C 2J5UA 4XEVA 1K05A 1VL2A 2BEQD 4PV1B 3H25A 1K40A 4IL6X 2JP3A 1ZRTE 4I7ZB 4YXDC 3RQGA 2E74D 4OGQD 1NGMB 1DD3A 1FDIA 2V7QJ 2L6GA 3GMAA 3L8IA 2ZT9C 4H13D 1KQFB 3AEFC 4H13C 3O6QA 4KT0J 1WTYA 5M1BA 3B71A 1KORA 1OW7A 3G9RA 4TT3H 3S9OA 2JPUA 1Y9BA 2WSFJ 3AE8C 4EBKA 2PBEA 3K7DA 3D6YA 4R32A 2QSIA 1ZP0C 4Z1MH 1YQ3C 4H0LD 3Q1MA 2FBWC 1OW6A 2E75C 4PV1C 3GF3A 3SFEC 3AE1C 2FYNC 3D6ZA 4R4MA 5KLIC 4GDOA 2G8YA 3GM3A 3RQFA 2WSCJ 3GLMA 2WSEJ 2QIWA 2ZT9B 4RKUJ 3RL0g 2E75B 1VF5D 3D71A 3AECC 2FXPA 2L6FA 4Y28J 3AE5C 3GM2A 2WPVB 3Q5SA 1EXIA 2HSBA 2KK1A 3Q5PA 3LW5J 3TULA 4H0LC 4R4LA 2L6HA 1PV3A 1FDOA 4U7JA 2H88C 1VF5B 3ABVC 1HJ0A 2E76B 3R4YA 5KKZC 1ZMEC 1UFBA 3C8GA 3GM1A 3Q2YA 4XEKA 3AEDC 2YWAA 1S5LX 1VF5C 3AE9C 1KILE 1JOGA 3C8VA 3C8GD 4YTPC 2D2CC 2D2CB 4H44C 3D70A 2QJYC 1KTMA 2OQQA 1OW8A 2E74C 4OGQC 2JX0A 1WWPA 3JYYA 3AEEC 3EWKA 4PV1D 1AJYA 2LK4A 1IK7A 4XFJA 4XEFA 3Q5RA 4EBJA 2E76D 1EXJA 5F28E 1RQVA 1GMJA 1NYHA 2YIUC 1JB0J 3AE2C 3IAOA 4H0LB 1DIPA 3O10A 1V4AA 1WMKA 3GF7A 3IN6A 4H44D 1QVXA 2D2CD 2NZ2A 1DD4A 2JO1A 2H89C 3AEAC 2G3AA 1TU3F 3MFNA 2E75D 3AE4C 3AEGC 4H13B 2ZT9D 1KQGB 1MKMA 1S1CX 2WQYC 1OMIA 2BEZF 2YMKA 3AJMA 3C8GB 3AE7C 2IDBA 2K9YA 2E74B 3AEBC 4OGQB 1KNYA 3JZ0A 1WOLA 2O01J 3AE6C 1KMIZ 4H44B 4NQFA 3RQEA 1O3UA 1UIXA 2QJPC 1RQUA 3BRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  3L8J A;  1YQ4 C;  3U0C A;  2Q00 A;  1K04 A;  1ZOY C;  3AE3 C;  3U3F A;  1ZZP A;  3SFD C;  4XEV A;  1K05 A;  1K40 A;  4YXD C;  3RQG A;  2L6G A;  3L8I A;  3AEF C;  1WTY A;  3B71 A;  1OW7 A;  3S9O A;  2JPU A;  3AE8 C;  4EBK A;  2PBE A;  3K7D A;  4R32 A;  1ZP0 C;  1YQ3 C;  2FBW C;  1OW6 A;  3SFE C;  3AE1 C;  3GM3 A;  3RQF A;  3AEC C;  2L6F A;  3GM2 A;  3AE5 C;  2HSB A;  2KK1 A;  3TUL A;  2L6H A;  1PV3 A;  2H88 C;  3ABV C;  1UFB A;  3C8G A;  3GM1 A;  4XEK A;  3AED C;  2YWA A;  3AE9 C;  1JOG A;  3C8G D;  4YTP C;  1KTM A;  1OW8 A;  2JX0 A;  1WWP A;  3JYY A;  3AEE C;  2LK4 A;  4EBJ A;  4XEF A;  5F28 E;  3AE2 C;  3O10 A;  1V4A A;  1QVX A;  2H89 C;  3AEA C;  2G3A A;  3MFN A;  3AE4 C;  3AEG C;  2WQY C;  3AJM A;  3C8G B;  3AE7 C;  3AEB C;  1KNY A;  3JZ0 A;  1WOL A;  3AE6 C;  4NQF A;  3RQE A;  1O3U A;  3BRJ A; 
#chains in the Genus database with same CATH topology
 4LLH A;  2A06 G;  5APW A;  5GTH E;  3MP7 B;  1BDD A;  4ZKP A;  3L8J A;  1ZR2 A;  1IFJ A;  1BSH A;  3GOR A;  5DS6 A;  3W2V A;  3ZIB A;  5HV9 A;  4DVY P;  2F22 A;  1N7S B;  3CC7 P;  1SQX D;  3H1K E;  4PV1 B;  4DBQ A;  2I1J A;  1M56 D;  2KZJ A;  1SR2 A;  5GTI E;  3NMK A;  4EWC A;  1FDI A;  4GKG A;  3KXD A;  1H7I A;  2W4B A;  1SFC C;  4DRI B;  1GTW A;  1JMW A;  1OR2 A;  1XTC C;  1L0N D;  3T6J A;  4XA4 A;  3E7K A;  2CW0 F;  2O1J A;  2WVR A;  2YLI A;  1M6T A;  3VAY A;  4E18 A;  3M0D C;  3AOU A;  3PTZ A;  2XL4 A;  1NWQ A;  1S7Z A;  4LER A;  4DRJ B;  3Q1M A;  3DJN B;  3UR3 C;  5DQZ A;  3IHU A;  1OXB A;  1YTZ I;  3JYH A;  1N7S A;  4A4A A;  1JO5 A;  2ZXO A;  5T1D B;  3IPM O;  2PRR A;  3TJ6 A;  2Q4F A;  3R7C A;  4PJN A;  1ZW0 A;  2FXP A;  4XLP F;  4XPW A;  3GM2 A;  5JT4 A;  4G0H A;  4XLN F;  3DE9 A;  4K7B A;  1RHZ B;  4R4L A;  4CJO A;  3KYI A;  1FDO A;  4GT1 A;  5AW6 B;  1HWT C;  3N7N A;  3CAX A;  1NTK E;  3MZW B;  3RGU A;  1H89 A;  4YTP C;  2D4U A;  4U9D A;  1A02 F;  2EPN A;  4JE9 A;  1ZHT A;  5DVW A;  2WZF A;  4IL6 H;  2X0C A;  2CNW A;  2Q5U A;  5BUO A;  1AJY A;  1VYI A;  4XEF A;  5KLV D;  3Q5R A;  3L74 E;  2YQY A;  3TGU E;  3FOO A;  3FWN A;  1SQV G;  1E79 H;  3RK2 D;  2I8B A;  1L0N J;  2DB4 A;  4Z9I A;  4DXW A;  4JEB A;  4M3L A;  1USE A;  4BJ6 A;  5IY5 C;  3CCQ P;  3EFO A;  2NZ2 A;  2R7U A;  2YL7 A;  4P9T A;  1NU1 E;  5CJ4 A;  3M79 A;  4JBZ A;  2Q3I A;  2Z5H A;  4MW3 A;  2WPS A;  1A41 A;  1T3U A;  1YYC A;  2LIG A;  1OXZ A;  2XKM A;  1VQN P;  2OKU A;  3E9V A;  1SQB K;  5CCH C;  3N0T A;  1S2E A;  2XLW A;  3C18 A;  1VLT A;  1EDJ A;  1LGH B;  4CPG A;  2KQ9 A;  1SZI A;  2K3R A;  1PD1 A;  1ZOY C;  3T6G B;  2Y0E A;  1R8E A;  1SQV D;  3FHD A;  4ER9 A;  1K05 A;  1CGO A;  2OAR A;  3JCU H;  2KJG A;  1LI7 A;  1P84 D;  1FJK A;  1GS9 A;  3L8I A;  2QE7 H;  3H6P A;  3RIP A;  1KIL A;  5M1B A;  4RD9 A;  3S29 A;  4ANJ A;  1JRA A;  1SQX K;  2I15 A;  2KUB A;  2ZVO B;  1B68 A;  1M57 D;  4OIN F;  4U5D E;  3T9O A;  3E1I A;  4JPZ B;  4W7Y A;  1BBH A;  4JF7 A;  4DOZ A;  2FYN C;  2XXA A;  1M2O A;  2XM0 A;  4YXW H;  2Y9Z A;  1V55 C;  3D71 A;  2NG1 A;  1QL1 A;  1EDL A;  3EHM A;  3X1O A;  3CX5 E;  1DX7 A;  2DGJ A;  4KJM A;  1JEK A;  1LE4 A;  2HJ3 A;  4BJ1 A;  2OYI A;  3TUL A;  4ZLD A;  1SQQ K;  2R02 A;  4AK9 A;  4WY4 C;  4G7H F;  1VDF A;  1G1I A;  2JD3 A;  2WTY A;  1L4A B;  4XEK A;  1E2X A;  2LXC B;  1RE3 A;  3AED C;  4BPM A;  3TJ5 A;  4WY4 A;  1SS1 A;  2HPC B;  2IFN A;  1JOG A;  3C8G D;  2BAS A;  1FU1 A;  2KS1 A;  4O6Y A;  1URQ A;  1OQC A;  4EI2 A;  2JJL A;  1S9K D;  4OIQ F;  2IXP A;  3L74 D;  2MYS A;  2HS5 A;  1MMD A;  3LNR A;  4CIH A;  2XS8 A;  2CK3 H;  3HD7 C;  1YYJ A;  3M0A A;  2EIL C;  3RVZ A;  4OWF A;  3MYF A;  1NU1 J;  3FOP A;  1PGO A;  1SQP E;  3H32 A;  1L0L E;  1SFC A;  5BQH A;  1LTJ B;  3AGU A;  3SXZ A;  3Q6M A;  3VTP C;  3WUT A;  2M64 A;  2AXT H;  4U9E A;  4I1M A;  2BEZ F;  3FAP B;  3K33 A;  3QVY A;  4G7O F;  3DM5 A;  2KSE A;  3SXK A;  1FFT C;  2ZJS E;  3V5Y A;  3AE6 C;  3LIE A;  3G50 A;  2QJP C;  1VQ6 P;  3EGX B;  4L76 A;  3KPH A;  1G4W R;  3CCS P;  2PX0 A;  2YKZ A;  3EPV A;  1YAU O;  3RK3 E;  3B5N C;  4I7Z C;  2YVK A;  3U0C A;  3Q6N A;  1U57 A;  1VLS A;  5DS4 A;  1YJN P;  3C63 A;  2DYS C;  2Y0C A;  5CJ0 A;  2RMZ A;  4PD4 H;  3H1I G;  2H8A A;  1VL2 A;  3L71 J;  1FJP A;  2FGY A;  1KN7 A;  4YXD C;  2UWJ E;  1L7C A;  1TFK B;  5A6B A;  1TWA A;  3N4X A;  1QVG O;  2LCH A;  1IFD A;  3AG2 C;  4H13 C;  1PP9 E;  2YIU B;  5FCL A;  1NTK D;  4ZMD A;  1LNQ A;  1PPJ D;  2FFD C;  1PFI A;  2PBE A;  1J1D C;  4EBK A;  1OCR C;  1YQ3 C;  1BR2 A;  3S84 A;  1P84 E;  3LLK A;  1OZH A;  4OIR F;  4RBN A;  1I4Z A;  3UMH A;  3GF3 A;  4ZNC A;  1WAT A;  3UMK A;  3OA1 A;  1NTM G;  3V5X A;  1SQB G;  4N06 A;  2WSC J;  1RY3 A;  2ZXR A;  4DBR A;  4DRH B;  3RL0 g;  3RK3 B;  2ZYA A;  3A11 A;  3NXS A;  2B88 A;  2PF4 E;  4D4N A;  2WPV B;  2HSB A;  3H1J E;  2J9B A;  3DM9 B;  1IFM A;  4EBB A;  2EPO A;  1HJ0 A;  2YKO A;  1ZME C;  1JY3 N;  5AW4 B;  4ONS A;  4RES B;  1E5W A;  4ZKU A;  5AVT B;  3H1J G;  1GW3 A;  2HV6 A;  3U2L A;  3VP9 A;  2OQQ A;  3CC4 P;  4IAR A;  2HOD B;  3CCR P;  5DJT B;  3IQT A;  1M2V B;  2K88 A;  3A0B E;  3TNU A;  4G78 A;  1LI5 A;  1T9K A;  2NPS C;  3K5B A;  2XLM A;  3PJS K;  3PDM P;  4CDV A;  1OKK A;  3AEA C;  2YRF A;  2H43 A;  2R7X A;  2YL1 A;  3BRV B;  1QX8 A;  3FDQ A;  4KNW A;  1KU2 A;  1YLM A;  5E2Q A;  1LWU C;  4C3D A;  1VTM P;  4JEA A;  2M0B A;  3AG4 C;  2H8P D;  1RKC A;  5KLI B;  3KYJ A;  3ATP A;  4YL0 A;  3KDP B;  1FTS A;  3K1I C;  1KMI Z;  1SQP J;  3H32 B;  2OQM A;  1AQT A;  3JTL O;  4ZLC A;  1NG1 A;  3KZI E;  3C7J A;  1RE4 A;  2YNY A;  2Q00 A;  3AG3 C;  4MQ9 F;  2OCC C;  3PP5 A;  1ZLL A;  3WAQ A;  2MKV A;  3AQB A;  4E17 A;  1KB9 I;  3N2Z B;  1SQV E;  1URQ B;  3RBZ A;  3PH0 A;  1BDJ B;  3RK3 C;  1VQL P;  5KYW A;  1L4A A;  3GG2 A;  2PFX A;  2HMZ A;  1CI6 A;  2OTL P;  3CCM P;  1NTZ K;  5BU8 B;  1SP4 A;  1QEX A;  3BCC E;  1IC2 A;  3RH3 A;  3Q7L A;  4LDR A;  2ZXP A;  3L74 G;  2W9Y A;  2AWC A;  5TJ5 E;  3H65 A;  3RQF A;  1NTK K;  2BCC E;  3EQ2 A;  1H6G A;  2WSE J;  4U5C E;  3RW0 A;  1HMD A;  3W8I A;  3L75 D;  3OEO A;  2L6F A;  4MVO A;  4Y28 J;  3FMS A;  2QLA A;  3U9M A;  1L0N G;  3H1H D;  3Q5S A;  1J1D B;  2P2U A;  1VQ8 P;  3UNG C;  2Y0D A;  1VQP P;  4IOI H;  4NY3 A;  3GM1 A;  2BE5 F;  4XWJ A;  1A02 J;  2BC5 A;  1KD1 Q;  2ZYG A;  1YJG A;  2GFH A;  3JSV C;  3DAF A;  1L0N K;  4EOT A;  1DOV A;  4N6H A;  5CMZ A;  2YO2 A;  4IWB A;  4L73 A;  4EHP A;  2NPS A;  4UB6 E;  3NKE A;  1NYH A;  1MFZ A;  2XLO A;  1K8A Q;  5C39 A;  2CPB A;  4AL0 A;  2D2C D;  1NTM K;  2J7P A;  1TU3 F;  5COF A;  2RD9 A;  3H1H E;  1Q0D A;  1YAR O;  3V4Q A;  5CCH D;  1SFC D;  1KQG B;  3GWN A;  2WQY C;  4W8P A;  2Z4E A;  4GEH A;  1EDI A;  2XLD A;  1N73 B;  2IXM A;  3K1I A;  3CME P;  2XLH A;  3M1C B;  1OR3 A;  2KGO A;  1EDK A;  2KNH A;  5D91 A;  3WHN A;  1CI6 B;  3LEV A;  1VB5 A;  1HY5 A;  2XSE A;  4FWV A;  4MVM A;  1BGY E;  1OVV A;  3L73 J;  5KYW B;  1S72 P;  2A69 F;  2BL2 A;  3AE3 C;  1QLE D;  1BE3 E;  3W8H A;  2QVA A;  4Q4Z F;  3EJN A;  3A0H H;  2P10 A;  2XS1 A;  2HFE D;  1FAP B;  4GOD A;  1SMY F;  2Q7C A;  2W4M A;  3CCL P;  1ZRT E;  1SQX J;  1AUE A;  3NMI A;  1LS1 A;  3L1M A;  2E87 A;  1Z63 A;  4KT0 J;  1WTY A;  3EH2 A;  1JMM A;  2NSG A;  1Y9B A;  3KHU A;  4IFF A;  2CCY A;  5CI9 A;  3SNH A;  2V3C C;  2A45 H;  2XL8 A;  5AVQ B;  4ASV A;  5A6J A;  3VRC A;  3L0I A;  1OW6 A;  1Q2N A;  3SFE C;  2JR8 A;  1RXQ A;  1MMG A;  4R4M A;  4U5F E;  3DAG A;  1X0T A;  5JLI A;  2PFD A;  4GOF A;  3S4R A;  4GYT A;  2P0N A;  2NPS D;  1JAF A;  4K0D A;  1MUU A;  3AE5 C;  2L5G B;  1KIL D;  1NTK J;  2QTV A;  4U5G A;  4N6J A;  3C8Z A;  4U7J A;  4GIF A;  1M2V A;  4JTA B;  3P8C D;  2CGE A;  3E70 C;  4BJ5 A;  4JJG A;  4WWI A;  3SWF A;  3L35 A;  4L75 A;  5A69 A;  2KYH A;  4PV1 D;  4XFJ A;  3UIA A;  3A3Y B;  1OX3 A;  3H1K D;  4D6T G;  3O10 A;  2IBZ G;  2W90 A;  1VPC A;  1GZL A;  3ZSU A;  3G3Z A;  1ORS C;  3BAT A;  4PD4 D;  3RBX A;  1Z23 A;  3H1I D;  2P1A A;  4YK5 A;  4JRZ A;  2E75 D;  1WN0 A;  2O9X A;  3RVY A;  1PGJ A;  2Q9C A;  2ZT9 D;  4B86 A;  4CBE A;  1FFH A;  2FFD B;  3AE7 C;  3RYL A;  1IO4 A;  2IYP A;  2O3J A;  1LT9 B;  1N7L A;  1GM5 A;  1ZW3 A;  3H1K J;  4C46 A;  1T8Z A;  3PHL A;  1JNM A;  4NPE A;  1YQ4 C;  3EG9 A;  3L71 G;  1XWJ A;  1PIX A;  3VM6 A;  1J1E B;  1MFT A;  5L8R J;  4JW1 A;  5DLJ A;  3EQL F;  5A6A A;  2J9W A;  4LC1 A;  1SQB D;  1VQ4 P;  2GUV A;  3OJA B;  4UB8 E;  3AQC A;  4OGQ D;  2R44 A;  4NTA A;  2IBF A;  1IZN B;  1FZE A;  1RF0 A;  3AEF C;  1TKN A;  3QTH A;  2R7Q A;  4Q5S F;  1W2E A;  1FMW A;  2IYL D;  2KC3 A;  3SWK A;  1FZC A;  4MN4 C;  2HLO A;  4RDA A;  5CCG C;  2VAS A;  1S5L H;  1HBW A;  4E0I A;  4CDY A;  1N7S D;  1PZQ A;  3U8V A;  4EUK B;  4XTK A;  4OD5 A;  3EFG A;  4DOJ A;  1SFC B;  4PR9 A;  2FYU E;  1I5N A;  4UB6 H;  1D0Z A;  2Q9A A;  3QWO C;  3TYY A;  1N7S C;  4QDL A;  1NAY A;  3L36 A;  1QSP A;  3ABL C;  1LTT C;  4Z9J A;  4HJG H;  1W2B O;  3ABV C;  1Z5Z A;  1UFB A;  1VMA A;  3V6I A;  3L37 A;  3L75 E;  1FS0 E;  3C8G A;  5CIV A;  2XZR A;  1VF5 C;  4NC3 A;  2HPC A;  4WY4 B;  4C7O A;  1NTM D;  1NTM J;  1L3P A;  4LAC B;  4OGQ C;  1SQP G;  2A45 I;  5AW2 B;  5AVX B;  3B5N A;  3AE2 C;  3IAO A;  5AW3 B;  1FZC C;  3W4Y A;  5AVY B;  2M8R A;  1SQQ E;  4C7R A;  3MD0 A;  1H9G A;  256B A;  3CCJ P;  5KYY A;  3E1R A;  4JIO A;  3EFF K;  1MKM A;  3VYI A;  3AJM A;  2PP6 A;  3KKB A;  3BAS A;  5B3I A;  4IRU A;  1M1J C;  4CJG A;  2O01 J;  2J8W A;  2LXB A;  4RO0 A;  1H0T A;  3RK2 B;  1HW1 A;  5AW5 B;  3QW0 A;  2RKL A;  2OG2 A;  4KI2 A;  2WPQ A;  1VK5 A;  1P84 I;  1NVO A;  4A2N B;  5AW7 B;  1GL2 D;  4GQH A;  3DI5 A;  1KIL B;  4U3F J;  2LKM A;  2ZXE B;  2IX7 C;  3FGA D;  1KQL A;  4HEA J;  4IL6 E;  1NH4 A;  1PL5 A;  3ZC4 A;  1NTZ E;  4JQ0 D;  1GQA A;  3QZC A;  1ZHZ A;  3LNM B;  1NGM B;  3DMD A;  3JRM O;  2V7Q J;  3EHN A;  4CSA A;  1LE2 A;  1RF0 C;  3DD7 A;  2YXR B;  1BSN A;  4I44 A;  2B89 A;  3H1H G;  3O6Q A;  3G71 P;  4F4B A;  3B71 A;  1Y47 A;  2ZD9 A;  3FXD A;  4W80 A;  3ABK C;  3L70 G;  4AE4 A;  1SQQ D;  3F5H A;  3C62 A;  4K35 A;  1U7M A;  2A06 D;  5APS A;  2EIK C;  4C7N B;  2UUI A;  2G8Y A;  2EPM X;  1VQ5 P;  4MVU A;  3H1K G;  4D6T D;  3GLM A;  2ZT9 B;  3HNI A;  3ZWI A;  3NYJ A;  1C17 M;  4XPX A;  2HSQ A;  3AEC C;  5KAI E;  2KNC A;  1L0N E;  3CLQ A;  1C02 A;  2A0B A;  3S27 A;  4LGD E;  3LW5 J;  4ULW A;  2PX3 A;  2EPL X;  4OIO F;  5KKZ B;  3IQ6 A;  3CMA P;  4PFO A;  1TQG A;  3MTU E;  3HE4 B;  2J0X A;  3II6 A;  1YA7 O;  2Z15 A;  2O01 H;  2WIT A;  5KYU B;  1CPQ A;  2OYI C;  5L3V A;  2HG5 D;  3D70 A;  1N2D C;  2AEF A;  2IZ0 A;  1H88 A;  2NUT B;  3T97 A;  1GDT A;  3GOD A;  2GDC A;  2LK4 A;  4I1L A;  2J58 A;  3A7O A;  2YKQ A;  1FZA A;  3CQZ A;  5AVU B;  1ZHW A;  4YL1 A;  3MLG A;  1JM0 A;  1M7L A;  3PLN A;  3A0B H;  1KFN A;  1FDM A;  4CS7 A;  2E42 A;  2OYO A;  2DI3 A;  2Q1K A;  2WL8 A;  1JPN A;  3DE8 A;  3JC2 2;  1LJ2 A;  1AVY A;  1L0L J;  4CX9 A;  4BRY B;  1JR8 A;  3RQE A;  1TWC A;  1E86 A;  3V2Q A;  2G3K A;  4BG0 A;  1NTK G;  4JTD B;  1Q82 Q;  1ORY A;  2J45 A;  4PK4 A;  1FZF A;  4WAB A;  3JRT A;  2M4E A;  2IFM A;  3HTK A;  2KB7 P;  3U3F A;  1M56 C;  2H7V C;  3ZVR A;  2XLE A;  5KAF H;  1FOS E;  4HYT B;  2WVQ A;  4RJT A;  2XND H;  2K1A A;  5KLV K;  1LM3 B;  4CS9 C;  3S0X A;  3HE5 A;  2ZFC A;  3TD7 A;  2M5A A;  2XRH A;  1PCX A;  3DWW A;  2WT7 B;  1VQK P;  4NPD A;  1R4T A;  2QSI A;  4EIJ A;  3H1L E;  5DS5 A;  1FZG A;  1Z3I X;  2GAQ A;  3PRJ A;  2C9N Y;  2NUT A;  3U2M A;  1GK6 A;  3KQG A;  5KLI C;  3GM3 A;  3MYI A;  3L70 E;  2QIW A;  3UGO A;  2HV7 A;  3SSU A;  1E84 A;  1YJW P;  1G1J A;  2ICW G;  2YL3 A;  2QUP A;  1KYO E;  1BCC J;  4M63 A;  3SYN A;  1AEP A;  4KHX A;  5COM A;  5JP7 A;  1G2C B;  2G62 A;  3DXJ F;  2KNC B;  4YJW A;  5KKZ C;  1M1J A;  4N78 E;  5APU A;  2WWW A;  2A06 E;  2FYZ A;  1NFO A;  2KZI A;  3U59 A;  2FKW B;  1JY2 N;  1VQ9 P;  2QJY B;  3CXH D;  4QI2 A;  1DEB A;  4C7N A;  4H44 C;  2WVN A;  4YT5 A;  5L0C A;  3RK3 D;  2P1J A;  4YN0 B;  1NTZ G;  3JYY A;  1URQ D;  3AEE C;  3CCE P;  4LLE A;  2JEE A;  1Q0G A;  5AVZ B;  4PFP A;  1JB0 J;  1SQB E;  3GF7 A;  3OA7 A;  3P8M C;  5AW1 B;  3O6X A;  1HH0 A;  4MS2 A;  1TFO B;  3SWY A;  1KYO D;  3AE4 C;  3AEG C;  1WAS A;  3VP8 A;  1LP1 B;  2B0J A;  5EHH A;  2EIM C;  1LTG C;  1M90 Q;  1E83 A;  3BRJ A;  3A0H E;  1YZC A;  2KSF A;  4U3F E;  2C9L Y;  1S05 A;  1GL2 C;  1LS4 A;  2AEJ A;  3TK0 A;  1K04 A;  3BEH A;  2DYR C;  4NTB A;  2QEX P;  5JVE A;  1CSB A;  2KK7 A;  3GHG B;  4FX5 A;  4LDK A;  3SFD C;  2ZVN B;  2B87 A;  1LWU B;  1NAF A;  3POV A;  3IR9 A;  1L0L G;  1KB9 H;  2NUP B;  3ZQY A;  2AWY A;  2P7V A;  3A2A A;  3NKD A;  5A6B D;  4IL6 X;  4MTG A;  2WB7 A;  3RQG A;  5KYY B;  2XV5 A;  1T5O A;  1LTB C;  2E5T A;  3L75 G;  4JYB A;  2Q9I A;  2B0H A;  3GEE A;  1KYO H;  5JUA A;  3CX5 D;  4H13 D;  3A9C A;  4MW8 A;  3G9R A;  2ZXW C;  1J2J B;  1IFN A;  2XM4 A;  3B5N B;  2OJE D;  1BR1 A;  4FES A;  4Y99 C;  2KSJ A;  3H2V A;  2QJP B;  4CDA A;  1CZQ A;  2PNO A;  1ZU5 A;  4OD4 A;  2NUP A;  2B87 B;  1DEE G;  4GDO A;  1Z56 A;  4Q7C A;  2Z5I A;  2POH A;  3GHG A;  3EZI A;  2G3V A;  4O6M A;  3EGD A;  1VF5 D;  2FAP B;  2QE9 A;  1N86 A;  3IQ5 A;  4NPF X;  4J7T A;  5APX A;  1T01 A;  2N9B A;  2W6A A;  2YO3 A;  4EDF A;  3RFY A;  3GAN A;  2L81 A;  1LP1 A;  2VH3 A;  4D4X A;  2HR3 A;  1KB9 E;  2R7W A;  4O9B A;  1JPJ A;  3RL0 C;  2D5R B;  4WGZ A;  2P6V A;  2OTK E;  1APC A;  2QRX A;  3AG1 C;  5K0I A;  5CCG D;  3MGN A;  4U5H A;  4H44 D;  1Z6A A;  1NOH A;  3LUT B;  5AVV B;  1N1C A;  4JUR I;  1NU7 D;  2H89 C;  3T6B A;  3B5N D;  3W68 A;  2RN0 A;  1EQ7 A;  1WT6 A;  3GW6 A;  3V2P A;  1S1C X;  2YLG A;  1YYX A;  2R3C A;  1BCC G;  1X9V A;  1HMO A;  3HNK A;  3SXM A;  1NTZ J;  1ZV8 A;  2OJQ A;  3U5S A;  1KNY A;  1G2C A;  3BCC D;  1OCO C;  1NU1 D;  3NG1 A;  2GUS A;  2AVK A;  3H1J D;  1RJ9 B;  2I1K A;  3TF5 A;  1KC8 Q;  1OXK A;  3LS0 A;  1VYK A;  4IFD K;  4QMA A;  1HF9 A;  1LT9 A;  1YDI A;  2Q6Q A;  1J8M F;  1VOM A;  3H1I E;  4PJJ A;  2Q7R A;  2IXN A;  2FFH A;  2BCC G;  2NPU A;  1NU1 K;  2J59 M;  2FFD A;  4MTO A;  3VF0 A;  2L9J A;  4XPY A;  5CBN A;  4EKW A;  2L91 A;  5E3C A;  5GTI H;  3CSK A;  2CDQ A;  3USS A;  3WOD F;  2ZT9 C;  4A7P A;  2P61 A;  1KQF B;  4JCH A;  5AGF A;  2KYV A;  2M5A B;  1RF1 A;  2KW3 C;  3TOL A;  1KOR A;  4TT3 H;  3HE5 B;  5KLV J;  1FBM A;  3AE8 C;  2J46 A;  1Q0K A;  1ZW2 A;  3K7D A;  1YJ9 P;  3B8E B;  3RKO F;  3ZG1 A;  5DQT A;  1NU1 G;  1YVI A;  1Q81 Q;  3UGP A;  4PV1 C;  1XTG B;  1HGV A;  3IQC A;  4MVS A;  3ZTZ A;  5E79 H;  5E3A A;  1BZ4 A;  2JKV A;  1SQV J;  3HTK B;  1HW2 A;  2E75 B;  3W67 A;  3KYQ A;  4MTF A;  5JS5 A;  4I6M C;  1W5C E;  3L73 D;  1R5I D;  2VCC A;  4B6I A;  2FY8 A;  4MVQ A;  2IBZ D;  3HD7 A;  4BRY A;  1L0L K;  1NU9 C;  1V54 C;  1OCC C;  2E76 B;  1KIL C;  4N78 D;  3HKK A;  3L72 J;  2AEM A;  2IYO A;  2J9U A;  2R7V A;  4OVN F;  2OU6 A;  5E33 A;  2CNW D;  1N8R Q;  3IFM A;  2R7O A;  1KTM A;  4Z9H A;  2CYD A;  1UG7 A;  1CW5 A;  2R25 A;  1EZV I;  3LW5 H;  2C0X A;  4P6I C;  1M1K Q;  2H7H A;  1ZRT D;  1LTS C;  5COG A;  1CPR A;  1S9K E;  1Q0F A;  2IXO A;  1MV8 A;  3IEE A;  1FR0 A;  4J7Y A;  2N1T C;  3MFN A;  4L74 A;  4JTC B;  4QI0 A;  5H2F E;  3HLZ A;  3HE4 A;  2YLD A;  3I4U A;  5KYX B;  2E74 B;  3U1A A;  2N1T A;  3JZ0 A;  1QKR A;  1LTJ C;  3QH9 A;  1X22 A;  1O3U A;  2H7B A;  2K9J B;  2PAJ A;  1QLE C;  1ZYR F;  3CL3 D;  1WRG A;  3DZA A;  3LES A;  1K73 Q;  1U0B B;  5B1B C;  1ZZP A;  3VMZ A;  2EIN C;  2XU6 A;  5KJ7 A;  4LDQ A;  5CI8 A;  1NHL A;  2AXT E;  1S5L E;  4I2L C;  5B66 E;  1N73 A;  4BJ6 C;  3M4C A;  2LFF A;  2HYN A;  4DJ9 A;  1SQP K;  3H25 A;  1MQV A;  3A5T A;  1T6A A;  3GWL A;  3CXH E;  3ABM C;  1LTA C;  2QNL A;  4X0R A;  5AC5 A;  3P32 A;  2IPP A;  2LR2 A;  3H1L G;  1FAV A;  1LPE A;  2N1T D;  1T6U A;  1XZP A;  1WGW A;  1OW7 A;  1LVK A;  2WSF J;  3FX0 A;  3L70 J;  2HMQ A;  1G8X A;  4R32 A;  1ZP0 C;  4Z1M H;  3HUS A;  1NFN A;  4FAP B;  3WUV A;  2C04 A;  3H1L J;  2YZS A;  3CXH H;  1JMB A;  2KI7 B;  3WU2 H;  1OIP A;  2ZYD A;  1KQS O;  1Y4C A;  3S90 A;  3R2P A;  2JDI H;  4P9F A;  4CS8 A;  2OTJ P;  5CCG A;  2ZAE B;  1H0T B;  2LSE A;  1W2W A;  2W6J H;  2M3E A;  2QJK B;  1OWA A;  2Y3B A;  3G4S P;  4HFF B;  2OYH B;  1MMN A;  4YWQ A;  3BCC G;  3CD6 P;  1TR2 A;  1EI7 A;  1GU5 A;  1CGN A;  3C8V A;  1YA9 A;  1SQQ J;  5B1A C;  1DH3 A;  2JX0 A;  3QW1 A;  1BE3 G;  3U8P A;  3O8Z A;  1SF8 A;  5T3T A;  2DW3 A;  1PGQ A;  5TIS H;  3F47 A;  1GMJ A;  4H0L B;  2AXC A;  3V5B A;  5JSL A;  5L0H A;  1DD4 A;  2JO1 A;  3FXH A;  2K37 A;  2K9J A;  2WPR A;  3H2U A;  4C7O B;  3V4W A;  1ZHX A;  1A7E A;  5TJH A;  1YIJ P;  3K6B A;  1SQB J;  1V74 B;  3FWL A;  5CBO A;  3KMI A;  3CEX A;  1HTL C;  1D7M A;  3C8G B;  4N4W A;  1AVO A;  1BGY G;  3B4S A;  2Y39 A;  4CS9 A;  2JWD A;  4E7Z A;  3JT1 A;  3M0D A;  4IAQ A;  3M9H A;  1RMV A;  2YEV A;  4U5E E;  1IFI A;  1GL2 A;  1JTH B;  1JY3 O;  4WBA A;  2OEX A;  1Q90 D;  3L70 D;  4DZO A;  2AU5 A;  2HZ8 A;  2QJK C;  3Q3D A;  4GOE A;  2HJM A;  2R05 A;  2OYH C;  4PD4 I;  3OWT A;  5HSW A;  4XEV A;  2XL6 A;  4KBL A;  5TIS E;  4WJ0 A;  1K40 A;  2XLV A;  3PMR A;  2A68 F;  2J9V A;  1USD A;  3V5Z A;  4AQR D;  1M8O B;  3L72 E;  2OGU A;  2O01 N;  1FZC B;  2JPU A;  1AV1 A;  3D6Y A;  5F5H A;  1L2P A;  4ULV A;  3TNU B;  4H0L D;  2I8D A;  3KPE A;  1J8Y F;  2FBW C;  1PP9 G;  4W7Z A;  3G4X A;  2A1D D;  2IBZ E;  1KV4 A;  3V2N A;  4D6T E;  3JCU Q;  3L71 D;  3W2W A;  1D1B A;  2PGD A;  3RL0 B;  3G4Z A;  2J0W A;  1RE4 C;  2Y3G A;  4K1O A;  3CX5 H;  4U3F D;  5B66 H;  1NTM E;  2FXO A;  1D1A A;  2KK1 A;  1CGM E;  3CI9 A;  1RKE B;  1PV3 A;  1KZU B;  3H1J J;  3ITK A;  1VF5 B;  5L0G A;  1NZE A;  2BCC J;  1VQO P;  1YI2 P;  4MVZ A;  4MVR A;  4IGG A;  3HRN A;  4E0H A;  1GGQ A;  3M91 A;  2E74 C;  4CSA C;  4PJL A;  3K1H A;  1PP9 D;  1RKE A;  2FYU J;  5AW9 B;  3BRT B;  1DIP A;  2ITA A;  1V4A A;  3IF4 A;  3VMY A;  4BWN A;  3NRH A;  2QY9 A;  4W8K A;  1RJ9 A;  4Y99 B;  3L74 J;  4IFM A;  3P8C E;  2J7P D;  5BVZ A;  2VC9 A;  4H13 B;  1HE9 A;  1OMI A;  2OOC A;  3NTN A;  3FVY A;  2K9Y A;  2NSF A;  1AFO A;  1WOL A;  1EQ1 A;  4OH8 B;  1T3J A;  1YZA A;  5KLV G;  4PJ0 H;  2KP8 A;  2E5Y A;  1LT9 C;  5AVS B;  1Q86 Q;  1XZQ A;  1VQ7 P;  2QG4 A;  2W6B A;  1BE3 J;  3M15 A;  2E76 C;  2VB6 A;  1Q7Y Q;  1BR4 A;  4PJ0 E;  1D0X A;  3L4F A;  2IM8 A;  1GK4 A;  3I56 P;  4AL1 A;  1NKZ B;  1LTJ A;  2L6G A;  3HTK C;  2R7T A;  1ST6 A;  2A6E F;  3M9Q A;  2FXM A;  5KTB A;  4BEJ A;  1JTH A;  1GL2 B;  2YXQ B;  1RF1 C;  1MND A;  5EK0 A;  2A45 G;  4XE5 B;  3L72 G;  2E43 A;  2R03 A;  1Z7Q c;  1SQV K;  2B9B A;  2HUJ A;  1IW7 F;  1AVO B;  3SZR A;  2QM8 A;  4E7S A;  2E75 C;  1URQ C;  3EGD B;  3D6Z A;  5E79 E;  3WU2 E;  2GM4 A;  4XQ1 A;  3CCU P;  4RKU J;  1PPJ E;  1FZB A;  2VRS A;  2ZXX A;  4LLC A;  4C3B A;  1NJI Q;  1EXI A;  3TK1 A;  2IZ1 A;  5APY A;  4NCQ A;  4AYC A;  2Q3T A;  1T6I A;  3HUS C;  1YBK A;  2MHR A;  3R4Y A;  4MND A;  2KXP B;  5APV A;  3CC2 P;  1T6Q A;  1HJB A;  1YIT P;  2D2C C;  2XXA B;  4TLF A;  2QJY C;  2R9R B;  2OYH A;  2R32 A;  4CS8 C;  4O7G A;  2L7A A;  1EZV G;  2YMY A;  1RH5 B;  2NPS B;  5F28 E;  2P7J A;  4YL3 A;  1M57 C;  5FZT A;  4HKZ H;  1Q0M A;  4BJT A;  1G5Z A;  5AC4 A;  2AP3 A;  2V7Q H;  1SQX G;  1OKK D;  4DVZ A;  3TGU G;  1L0L D;  4UDV A;  1FMV A;  1OCZ C;  5BU5 A;  3NYL A;  4KNV A;  1TWH A;  4UB8 H;  3HUS B;  1OVR A;  3H1L D;  3B0P A;  2ETS A;  3U3B A;  1UIX A;  3ZDM A;  2EPK X;  1ZHY A;  1QL2 A;  2QA4 P;  1KYO I;  1UII A;  4J32 B;  1T2K D;  1HVV A;  1IFP A;  1N73 C;  2V26 A;  3CWB G;  2HFI A;  4BEM J;  5DJU B;  3L73 E;  3MUD A;  2J5U A;  4U3F G;  2BEQ D;  3V2R A;  1Y6D A;  5KJ7 D;  2JP3 A;  1IZM A;  1DD3 A;  1MMA A;  2YL0 A;  3GMA A;  3TGU D;  4YPC A;  5APT A;  3EFO B;  5AW0 B;  2H7O A;  3BVH A;  3OAK A;  5L0I A;  1U6H A;  3B9Q A;  3X2Q C;  5L3Q A;  2WSC H;  2X51 A;  3US6 A;  3CPW O;  2N1T B;  1R5S A;  5KYX A;  3Q7G A;  5F5F A;  4D6T J;  3AE1 C;  1FOS F;  3TDK A;  3M4B A;  1NLX A;  3S1K A;  1ZU4 A;  1T2K C;  3T4R A;  1EZV E;  3CWB D;  1ZXG A;  2LQG A;  1A0B A;  4G7Z F;  2V4H A;  4EIY A;  3SP1 A;  3B0U X;  3MBG A;  3RF3 A;  2YKP A;  5B5E E;  5BQI A;  1NBB A;  1JCD A;  1NKN A;  1ZVZ A;  3QMK A;  3VOP A;  3TOM A;  2IOQ A;  2WT7 A;  5GPG B;  3TSI A;  1PPJ G;  5T3W A;  3J06 A;  2H88 C;  1H8A A;  4JVS A;  2R5D A;  4PD4 E;  2W45 A;  1SYQ A;  4KC9 A;  2N9Y B;  3GHG C;  5EGY A;  1BCC E;  3EZH A;  1I4Y A;  1BGY J;  2D2C B;  2UUH A;  1BGY D;  2RH0 A;  2A6H F;  2LP4 A;  2R7S A;  4O6N A;  1X79 B;  3M9B A;  3VMA A;  5KJ7 C;  2XNX A;  3U1C A;  3HD7 B;  3VN0 A;  5CHX A;  1LT1 A;  3LAY A;  3PHF 2;  1RE3 C;  2HOD A;  1OFC X;  3P7K A;  2XDJ A;  5CCH A;  4J30 B;  4C3E A;  2ZPA A;  1BDC A;  5BQG A;  3L34 A;  1K9M Q;  2GA0 A;  2YMK A;  2HKV A;  4EYY Q;  2P67 A;  4BJ5 C;  1GD2 E;  3MUD C;  5A6K A;  5AVW B;  1DOW A;  3K66 A;  5APQ A;  2LD6 A;  3L72 D;  1SQQ G;  4H44 B;  4NQF A;  1IK9 A;  3KL4 A;  5KLV E;  3F89 A;  4HH2 A;  3AGT A;  4H54 A;  3M06 A;  3LID A;  1RF1 B;  4I1O B;  1NTZ D;  2A0U A;  1SLQ A;  3UMI A;  2KIK A;  4JYC A;  3GEH A;  4IB4 A;  3I55 P;  3T97 B;  2ASR A;  3DKA A;  3O39 A;  4L6R A;  3H1I J;  5KYU A;  1D0Y A;  1HGZ A;  2EIJ C;  1JOC A;  5AW8 B;  3L73 G;  4IJJ A;  3ZDL A;  3EH1 A;  1PP9 J;  1U89 A;  4YT4 A;  3ECS A;  1EC5 A;  1TWG A;  3FAJ A;  2WMM A;  5L0D A;  3JSZ A;  2CPS A;  4PJM A;  2BCC D;  3MIW A;  4JZA A;  4AX2 A;  4HB1 A;  4AUW A;  2RSE B;  1JY2 O;  1P84 H;  2FYU G;  1S4X A;  2GA1 A;  2Q3E A;  4ASW A;  1SQX E;  1OVU A;  1QQ3 A;  1L4A D;  3S28 A;  1JCC A;  3EGX A;  4AE4 B;  3I5Q A;  3Q5P A;  2R3S A;  2WZL A;  3ASO C;  2W83 C;  3JCU E;  1JUN A;  2L6H A;  3RL0 D;  3I5P A;  3DJU B;  3O6Q B;  3WUU A;  4WB4 A;  1Y8A A;  2Y69 C;  3Q2Y A;  2LFD A;  1LKX A;  2YWA A;  3NMD A;  5D92 A;  4HFK B;  1S5L X;  3AE9 C;  5KAF E;  2FYU K;  1NO4 A;  1PGP A;  2W27 A;  3LLI A;  5EFW B;  3NMJ A;  1FC2 C;  1WWP A;  3HD7 D;  1HE1 A;  3U9J A;  4JCZ A;  1IK7 A;  5AVR B;  2E76 D;  3FXE A;  1RCP A;  1EXJ A;  2MWQ A;  1AA0 A;  3QVZ A;  4N6C A;  1A7D A;  2YIU C;  3I5C A;  1SVF A;  1FNT c;  5L0J A;  1QGK B;  2FYU D;  3H1H J;  1R5L A;  2G3A A;  5K5G B;  1MZ9 A;  4BXL A;  2Y3H A;  2KS1 B;  4IAO A;  1X8Y A;  4CIP A;  2KLU A;  4DJG A;  3HJC A;  1PD0 A;  5B3S C;  4WY4 D;  2C03 A;  3KZI H;  3V7O A;  2KOG A;  1YTZ T;  2OYI B;  4OIP F;  2Y9Y A;  1RQU A;  3CX5 I;  2R5B A;  4K3A A;  1LTI C;  3L71 E;  4DT0 A;  3OW2 O;  1J1E C;  3VYW A;  3C9I A;  1S3J A;  2GWW A;  3LEO A;  1VQM P;  2TMV P;  3SEO A;  5L0F A;  1LWU A;  3NYM A;  1ZN5 A;  4I7Z B;  2PP4 A;  1ORJ A;  2E74 D;  2MJZ A;  4HE8 D;  4I3M A;  4WGY A;  3HNJ A;  5KAI H;  3S9O A;  1JY3 P;  2O1K A;  1BCC D;  2KLV A;  3C1L A;  1NSG B;  3ASN C;  3F46 A;  2QM7 A;  1A7V A;  3GEI A;  2C0W A;  1JY2 P;  1KFM A;  1SQP D;  3LJB A;  1O87 A;  3BCC J;  4YT2 A;  2R7R A;  1GW4 A;  4PAC A;  2WSE H;  1QVF O;  1FE6 A;  1D1C A;  2NRG A;  1BE3 D;  1IJD B;  1G4U S;  1C03 A;  3HNL A;  1EKY A;  3G6E P;  1EZV D;  3CWB E;  3MHV A;  4U5B E;  3B0V C;  5B5E H;  4JC7 A;  1YHQ P;  1ZR4 A;  2YHS A;  2W8Z A;  4JKV A;  5KYN A;  5H2F H;  3NDB B;  1GU4 A;  4H0L C;  2VCB A;  3L75 J;  3VMX A;  4WVZ A;  2Y3D A;  2WSF H;  3CWB J;  4NTF A;  4DCK A;  1O5H A;  2M3B A;  1L4A C;  2Q9B A;  5GTH H;  3KH2 A;  3WMM 0;  2FYN B;  1HUC A;  1KIL E;  1AQ5 A;  1LIH A;  3CZ6 A;  2WSS H;  3CCV P;  4O79 A;  4YT8 A;  3MX3 A;  3O55 A;  3WG7 C;  2IBZ I;  1OW8 A;  3CXH I;  1M1J B;  3RK2 C;  3EWK A;  3JSE O;  4EBJ A;  3LS1 A;  2P58 A;  4N3Y B;  1RQV A;  1KB9 D;  3TGU J;  2VCA A;  3EG9 B;  3PCV A;  1WMK A;  3IN6 A;  1QVX A;  1E85 A;  1EA8 A;  1F1M A;  2WVO A;  3N24 A;  2WZG A;  1U7J A;  1QPU A;  3ZQV A;  1H9T A;  3SXY A;  1QZX A;  2WZ7 A;  4H4K C;  3ITF A;  2SPZ A;  2IDB A;  2JWA A;  3NFQ A;  3TQO A;  3ZTM A;  5JRA A;  3AEB C;  4OGQ B;  1MNE A;  2OEV A;  3B29 A;  4JJF A; 
#chains in the Genus database with same CATH homology
 3C18 A;  3RK3 E;  4I7Z C;  1Q90 D;  1YQ4 C;  3L8J A;  3U0C A;  2Q00 A;  1U57 A;  1K04 A;  1PIX A;  1ZOY C;  3FGA D;  3AE3 C;  2QJK C;  2MKV A;  1PL5 A;  5L8R J;  1HF9 A;  1ZZP A;  3U3F A;  3SFD C;  3Q3D A;  2P10 A;  1R8E A;  3T97 B;  2E76 C;  2J5U A;  4XEV A;  1K05 A;  1VL2 A;  2BEQ D;  4PV1 B;  3H25 A;  1K40 A;  4IL6 X;  2JP3 A;  1ZRT E;  4I7Z B;  4YXD C;  3RQG A;  2E74 D;  4OGQ D;  1NGM B;  1DD3 A;  1FDI A;  2V7Q J;  2L6G A;  3GMA A;  3L8I A;  2ZT9 C;  4H13 D;  1KQF B;  3AEF C;  4H13 C;  3O6Q A;  4KT0 J;  1WTY A;  5M1B A;  3B71 A;  1KOR A;  1OW7 A;  3G9R A;  4TT3 H;  3S9O A;  2JPU A;  1Y9B A;  2WSF J;  3AE8 C;  4EBK A;  2PBE A;  3K7D A;  3D6Y A;  4R32 A;  2QSI A;  1ZP0 C;  4Z1M H;  1YQ3 C;  4H0L D;  3Q1M A;  2FBW C;  1OW6 A;  2E75 C;  4PV1 C;  3GF3 A;  3SFE C;  3AE1 C;  2FYN C;  3D6Z A;  4R4M A;  5KLI C;  4GDO A;  2G8Y A;  3GM3 A;  3RQF A;  2WSC J;  3GLM A;  2WSE J;  2QIW A;  2ZT9 B;  4RKU J;  3RL0 g;  2E75 B;  1VF5 D;  3D71 A;  3AEC C;  2FXP A;  2L6F A;  4Y28 J;  3AE5 C;  3GM2 A;  2WPV B;  3Q5S A;  1EXI A;  2HSB A;  2KK1 A;  3Q5P A;  3LW5 J;  3TUL A;  4H0L C;  4R4L A;  2L6H A;  1PV3 A;  1FDO A;  4U7J A;  2H88 C;  1VF5 B;  3ABV C;  1HJ0 A;  2E76 B;  3R4Y A;  5KKZ C;  1ZME C;  1UFB A;  3C8G A;  3GM1 A;  3Q2Y A;  4XEK A;  3AED C;  2YWA A;  1S5L X;  1VF5 C;  3AE9 C;  1KIL E;  1JOG A;  3C8V A;  3C8G D;  4YTP C;  2D2C C;  2D2C B;  4H44 C;  3D70 A;  2QJY C;  1KTM A;  2OQQ A;  1OW8 A;  2E74 C;  4OGQ C;  2JX0 A;  1WWP A;  3JYY A;  3AEE C;  3EWK A;  4PV1 D;  1AJY A;  2LK4 A;  1IK7 A;  4XFJ A;  4XEF A;  3Q5R A;  4EBJ A;  2E76 D;  1EXJ A;  5F28 E;  1RQV A;  1GMJ A;  1NYH A;  2YIU C;  1JB0 J;  3AE2 C;  3IAO A;  4H0L B;  1DIP A;  3O10 A;  1V4A A;  1WMK A;  3GF7 A;  3IN6 A;  4H44 D;  1QVX A;  2D2C D;  2NZ2 A;  1DD4 A;  2JO1 A;  2H89 C;  3AEA C;  2G3A A;  1TU3 F;  3MFN A;  2E75 D;  3AE4 C;  3AEG C;  4H13 B;  2ZT9 D;  1KQG B;  1MKM A;  1S1C X;  2WQY C;  1OMI A;  2BEZ F;  2YMK A;  3AJM A;  3C8G B;  3AE7 C;  2IDB A;  2K9Y A;  2E74 B;  3AEB C;  4OGQ B;  1KNY A;  3JZ0 A;  1WOL A;  2O01 J;  3AE6 C;  1KMI Z;  4H44 B;  4NQF A;  3RQE A;  1O3U A;  1UIX A;  2QJP C;  1RQU A;  3BRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...