1OW7A

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 57
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow7A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow7A02
3AJMA 1KTMA 2JPUA 1K40A 3AE7C 4YTPC 2LK4A 3JZ0A 2Q00A 3O10A 3U0CA 3AEDC 3U3FA 2YWAA 3AEEC 3RQFA 4XEKA 3S9OA 3AEFC 3C18A 1ZZPA 3AEGC 3AE9C 3JYYA 1OW7A 3SFEC 3L8IA 1YQ3C 3ABVC 3RQEA 4R32A 1OW8A 1PV3A 1O3UA 4EBKA 3K7DA 2L6GA 1K04A 1V4AA 1K05A 3C8GD 3SFDC 3RQGA 3TULA 3AE6C 1YQ4C 4NQFA 1ZP0C 3AE4C 1WOLA 2FBWC 1ZOYC 3GM1A 3AECC 2PBEA 4XEFA 2JX0A 1OW6A 4XEVA 4YXDC 3AE1C 3B71A 1JOGA 2KK1A 3BRJA 1QVXA 3GM3A 2HSBA 1KNYA 3C8GA 3AE5C 5F28E 2H89C 3L8JA 1WTYA 3GM2A 3AE8C 3AEBC 2G3AA 2H88C 1WWPA 2L6FA 3AEAC 2L6HA 3AE3C 3AE2C 1UFBA 3C8GB 4EBJA 2WQYC 3MFNA
chains in the Genus database with same CATH superfamily
1ZU4A 2I15A 1MMDA 2UUHA 4IWBA 2R7VA 5COMA 3C7JA 4O6NA 4OIRF 4X0RA 1D1AA 2CNWD 2Q9AA 3GWLA 3TK0A 1RXQA 2BEZF 1YJ9P 1IZMA 1W2WA 3A0BH 4XWJA 2R7WA 1A0BA 1VQ8P 1HE9A 2HYNA 3H1JD 3FWLA 1Y6DA 4HFKB 1QKRA 2EIKC 5H2FH 1PV3A 1Q81Q 2Q1KA 3M9HA 2FAPB 2D2CB 2ZT9C 3H1LD 3WUUA 2QE9A 2KIKA 3WUTA 5DS6A 2WPQA 1X8YA 2PFXA 4U3FD 2YKPA 1X22A 2ZXXA 3VMXA 3S29A 4EUKB 1H6GA 1L0ND 2IBZI 1VF5B 3IEEA 4MVQA 4JE9A 2KC3A 2OYIB 2Y69C 3HJCA 3S0XA 4XEFA 3RVZA 1KYOD 3RGUA 3FOOA 2MWQA 1AFOA 3TD7A 1NU1E 1RF0C 3B0VC 3GM3A 1QVXA 2OJED 1BE3E 2XRHA 3H1LE 2KLVA 4N6HA 5B3IA 4CS7A 3NRHA 3L0IA 1T8ZA 1YARO 1PPJD 1SMYF 1T6IA 2HMQA 1ZLLA 1IFPA 1P84H 1YDIA 1SQPJ 2YLIA 3W8IA 5JLIA 1L0NJ 5T3TA 1Z23A 4Y99C 2BASA 1Q0FA 3EH2A 3AE3C 1VDFA 2HODB 5D92A 3B0PA 2YVKA 3H1KJ 5A6BA 1NH4A 3U9MA 4MTGA 3FGAD 2HUJA 4DVYP 1RH5B 4EHPA 1YI2P 1EXJA 2JPUA 4JCHA 2J58A 3H1LG 3B8EB 5DVWA 5AW5B 4MNDA 4J7TA 3E7KA 3HTKB 3P32A 3H32A 3RK3D 2KSJA 4NCQA 4XA4A 5GTIE 2NUTB 3M0DC 4XEKA 4HEAJ 1VK5A 2J9BA 2CW0F 5TISE 2GA0A 1ZHZA 2M4EA 3C1LA 1KFMA 3HD7A 1KORA 4D4XA 1WMKA 1SVFA 3AE9C 2NPSC 1FFHA 2H7OA 1A41A 2FYNC 4W7ZA 2Y3DA 1YIJP 1LS1A 2AXTE 1EA8A 3C8ZA 1FC2C 2G3KA 1QL2A 5DLJA 1OW8A 2VCBA 3QZCA 4BWNA 3W68A 3SZRA 1K8AQ 3HUSA 1OXBA 1TKNA 4DXWA 2A45I 1BGYJ 1AVOB 4B6IA 4DRIB 1GL2D 2E75B 3LS0A 2DYRC 3TULA 2YL3A 1YBKA 5DS4A 5L0IA 1KQSO 3K6BA 3H1IE 3GANA 1ZOYC 1SLQA 1Z6AA 1U0BB 1GU5A 3EHMA 1U57A 5CBNA 4WJ0A 4O79A 2WITA 1PP9D 3PCVA 1YJWP 2R03A 4H54A 5L0HA 1EZVI 4NPEA 5IY5C 3AG3C 2R7OA 4PD4E 2W6JH 1M57D 4MVOA 4EDFA 2XL6A 3MUDA 3V5YA 3LW5J 1IJDB 2D2CC 1PPJG 2ZT9B 4MN4C 1FMWA 3NMKA 1YYXA 3P8MC 3R4YA 1S5LX 1NTZD 4OVNF 4F4BA 3RK3E 1A02F 2G3VA 3GM2A 3HLZA 2FYUD 2GM4A 1WWPA 2OARA 1PGJA 3FWNA 1R5SA 1YYCA 1QSPA 4PJLA 3HE5B 1RKEB 4D4NA 5AVSB 1PZQA 3QW1A 4D6TD 2N1TD 2KXPB 2WQYC 3H1JG 1EDJA 3CZ6A 2WTYA 4EWCA 3UNGC 4JC7A 1KV4A 1YA7O 2L7AA 2GUSA 2L5GB 1JPNA 1JNMA 3UGOA 4KI2A 1FZBA 5KLVG 1NTKE 1S4XA 1CGME 2IXOA 5APQA 5APYA 1L0NK 2M8RA 3L73E 1D1BA 2K9YA 4I1OB 4NC3A 4RD9A 5L3VA 4H44D 3WODF 2JDIH 3C18A 3CSKA 2E74C 1A7EA 4KBLA 2H8PD 2HODA 2B89A 3A7OA 5KAFE 3L74G 3FX0A 2OTLP 3CEXA 3L35A 4W7YA 1KILE 1APCA 2QM8A 3AOUA 3W67A 4OGQB 1ORSC 2Q9IA 2EIMC 2WB7A 3UMKA 1LWUB 3K7DA 2L6GA 4FWVA 4EIYA 1TFOB 1Q0DA 4WBAA 1ZHWA 4E17A 3S27A 4A4AA 4CS9C 3KDPB 3B5ND 2HZ8A 1OVVA 2Q9CA 1LGHB 1RY3A 1E84A 2IPPA 3W4YA 2W6BA 4BRYB 1NG1A 1G5ZA 2R5DA 1QZXA 1VYIA 2W83C 3AG4C 1RF0A 2A45G 2W9YA 4LDQA 2Y39A 1H89A 2HKVA 4JPZB 4XEVA 4PD4I 1EXIA 3NMJA 3JT1A 3LEVA 5CCHA 4WB4A 2KSEA 4J32B 5KYXB 2A06G 1RKEA 3TOLA 1KNYA 4JZAA 5AW2B 5BVZA 2HG5D 4LACB 1AA0A 4O7GA 4R4MA 2R5BA 3W8HA 4HE8D 3MZWB 2R7TA 1JTHA 1FTSA 4L76A 3JSZA 1KYOI 3FAPB 3TF5A 2DGJA 1GQAA 4W80A 3GHGC 2BCCE 1GM5A 2QUPA 1S05A 3QVYA 2ICWG 2WSCH 2LFDA 2QNLA 4Q7CA 1JY3N 3ABMC 4ANJA 1SQXE 4G0HA 3HD7D 5KYWA 4G7HF 1Q0MA 1G2CB 2WMMA 3KKBA 3TOMA 3FMSA 1NTZG 1FE6A 3TJ6A 1S3JA 5KKZC 3FVYA 3CCMP 1KD1Q 1RE4A 5KAIE 1OXZA 2NRGA 3PHLA 3Q3DA 1CI6B 2K9JB 5AVVB 3GW6A 3II6A 3L70E 5DQZA 3U0CA 1NTMK 3TYYA 2WZ7A 1M1JB 3FOPA 2R02A 3SXZA 3SXKA 1YA9A 2E5TA 2Y0EA 1LTBC 2E76B 3H1JJ 2OYHB 2AEMA 3Q5RA 4PJNA 2L91A 3N7NA 1TWAA 1Y47A 3MHVA 4L73A 3L71J 3T6GB 1FFTC 4FAPB 3RQEA 2KUBA 1G4WR 1FR0A 3IHUA 4IRUA 1IK9A 2R32A 1D1CA 1VYKA 4OGQC 1GU4A 2IZ0A 5KLVD 2B87A 3RQGA 3UIAA 1M2VA 4KJMA 3JYHA 4IFMA 3CX5H 1H88A 4N78E 3POVA 2DB4A 3B5NC 1KB9I 1TWGA 4CSAC 2FYZA 3RW0A 4EYYQ 2NSFA 1OW6A 5KYWB 1VLSA 2OCCC 3KH2A 1NHLA 4N3YB 1ZHYA 3DE8A 3DM9B 3EHNA 2O9XA 4JTAB 4TT3H 5B3SC 5JVEA 3CI9A 5AW4B 2A6HF 3J06A 1VTMP 1FZGA 2I1JA 1VPCA 2YL1A 2YO2A 1K73Q 2YRFA 4JJFA 2OYHC 1T9KA 1BGYG 2G3AA 2Y9ZA 1NTKJ 3EFGA 2BCCD 1EDLA 3PMRA 1OVRA 2IXPA 5L3QA 1MNDA 3WHNA 3NG1A 4PJ0H 2KNCB 1IFJA 1I4YA 1QLEC 1GW3A 2C03A 3SXMA 3EG9B 3H2UA 4P9TA 1ZYRF 3GODA 1EDKA 4DT0A 1URQC 3L73G 5D91A 1K40A 2QG4A 3TDKA 2R7SA 1PGOA 4LGDE 3S4RA 4GEHA 3VAYA 3U3FA 1H8AA 1BDCA 4C3EA 3FAJA 1KB9D 1JCDA 1SQVG 1LWUA 2K3RA 1WN0A 2G62A 3RQFA 1NGMB 2LR2A 3X1OA 1L0NG 3BCCG 3Q6NA 3CC2P 1J8MF 1M57C 1N73B 1H0TA 4U5CE 4MTOA 1YZAA 1IFNA 5AVUB 1HF9A 3DXJF 2QA4P 4HH2A 3H1KG 3RK2B 2D2CD 5DQTA 3Q7GA 4JKVA 3CWBG 2OYIA 2A06D 5B1BC 1IC2A 1NTMJ 3DI5A 2OQMA 5FZTA 1HJBA 1I4ZA 3NKDA 4DOZA 1QL1A 4I6MC 2M3EA 5EFWB 2PFDA 1SQXK 3C8GD 1TU3F 3MX3A 1MV8A 1OMIA 3IN6A 4NQFA 1DD3A 2WSFH 3HE4B 5KYXA 1BCCG 5CBOA 2XS1A 3TNUB 1RJ9A 3L72E 1G8XA 2YL7A 2YL0A 2B0JA 1BBHA 1LPEA 4P6IC 1KFNA 1MFZA 5AVYB 1HGZA 1T01A 2WPVB 2KNCA 2CYDA 3VMAA 3K1IC 2W27A 1T2KC 2M5AB 4G78A 3WUVA 4I2LC 3AQBA 4LERA 2PX3A 5AVQB 3CCVP 2AXTH 3IAOA 1S2EA 3VN0A 3GHGA 4C7NA 4AE4A 2HMZA 1LKXA 4O6YA 3IQCA 1QEXA 4AQRD 1SQVE 2Q5UA 1SQXG 3AEBC 2JP3A 3M1CB 1E79H 5L0CA 1VQ9P 1NU1K 1DIPA 2F22A 3DMDA 3MBGA 2AU5A 2FFDB 3AEAC 3LLKA 4PJJA 3R2PA 2WZLA 3HNKA 5K0IA 3G4ZA 1Y8AA 2AEJA 3Q5SA 2XKMA 3T6BA 2R7XA 2IDBA 3H1KE 1JY2P 4CJOA 1YTZT 3CWBE 3AG2C 4IL6X 3P8CD 1SFCB 1NFOA 2M3BA 3TGUD 2P61A 2Q3IA 5AW7B 1W2BO 4GOFA 4TLFA 1SQBD 1SP4A 1NTKK 1H0TB 4JF7A 3D70A 1PPJE 2XLWA 4EIJA 1EKYA 3QTHA 1J2JB 2QIWA 4JYCA 2XLDA 1N2DC 4YT5A 3L75G 2BE5F 2VCCA 1QVFO 1P84I 3PJSK 4BJ5A 1S72P 2EPNA 3LNRA 4KNVA 1GW4A 3EQ2A 4W8KA 1AVYA 4NTBA 2E76D 4KT0J 1PFIA 1C02A 3KL4A 4XPYA 1SQQE 5BUOA 3H1IG 3CCRP 2ZYGA 2NUTA 3I5PA 3B5NA 5GPGB 3CD6P 1RQUA 1RF1B 5KKZB 3AE6C 3ITKA 2Q6QA 3A5TA 3RIPA 1XTCC 2XNXA 1GGQA 4OIQF 1NTZK 5GTHE 2P6VA 1XTGB 3MIWA 2PGDA 4U3FJ 3NMIA 3L75E 2XSEA 2NSGA 1FJKA 3I5CA 1JAFA 4XE5B 4IGGA 1ZR4A 2NZ2A 3KYJA 2WVOA 4YXDC 2VCAA 5EGYA 2XM4A 2YMYA 4IL6H 3HNJA 1YLMA 2YEVA 1FDOA 1FBMA 1EZVE 5KLVE 2KK1A 1S5LH 4CPGA 5AW8B 3RL0g 1OR3A 3BRJA 5FCLA 3U8PA 2A1DD 3A0HH 1U7MA 3VYIA 5GTIH 2A45H 1WTYA 4U5DE 2YKOA 3DJNB 5CIVA 1GK6A 2V4HA 4YJWA 4UB8E 2KZJA 3EGXB 4YL3A 5KYUA 2TMVP 4U5FE 4I3MA 1FJPA 4MVSA 1CPQA 2IM8A 4YN0B 3ZG1A 1SQQK 2Q3TA 1DH3A 4XFJA 1FS0E 3U1CA 4B86A 1ZR2A 3G4XA 4OIPF 1LWUC 1MKMA 3QH9A 1YAUO 3V6IA 5BU8B 1EZVG 4C7NB 3RK2D 2J46A 1TFKB 3OWTA 4AE4B 1S9KD 5AW9B 3B5NB 1MUUA 4D6TJ 5CCGA 1GD2E 1R8EA 4YL0A 3VTPC 2FGYA 3V5XA 1Y9BA 2B87B 4YWQA 3GMAA 1EQ7A 3V5ZA 1CPRA 2IXMA 2I8BA 3HNIA 1ZZPA 3LLIA 1D0YA 1ZW0A 2OYIC 4H0LC 1NTME 1WATA 1OXKA 4DBQA 2OEVA 2XXAB 4BEMJ 1RF1A 3JYYA 2IYOA 1VQNP 1KN7A 1BZ4A 3L8IA 1YQ3C 3HTKA 1L7CA 3M06A 1KQGB 2Y3GA 1USEA 2DI3A 4BRYA 2KLUA 4BEJA 1ST6A 4L74A 3L74J 2KZIA 3G4SP 3AGUA 4H44B 2C9NY 1VQMP 5E79E 1FAPB 3L70G 3DAGA 1IW7F 3EGXA 1JB0J 3N24A 3I55P 4OWFA 3MYFA 3RFYA 1TWCA 3VM6A 1A7DA 4ZLCA 1Q0KA 2FY8A 1YVIA 3LUTB 2XLHA 2A0UA 1URQB 1KU2A 2ZVOB 2E75C 4GIFA 3FXDA 2HR3A 2N1TA 1SFCD 1UG7A 4LLHA 3O6QA 4NPFX 2NPSD 4UB6E 2EILC 5APWA 1L0LJ 1M1KQ 5F5HA 1LP1B 2J5UA 3M4BA 4YT2A 5E79H 1SQBG 1MQVA 4WGYA 4PFOA 1FDMA 4HFFB 3LW5H 1LNQA 4MW8A 3ZDLA 2R3SA 4M63A 2NPSB 3OW2O 1U7JA 3EJNA 5M1BA 1OR2A 2QLAA 3JRMO 2WVRA 5A6JA 2LXCB 1HBWA 4MVUA 2FFDC 5CJ4A 1CGNA 2FYNB 2QRXA 2XV5A 4ZMDA 3L73D 3ASNC 3EFFK 4C46A 3CXHD 1Z63A 3AJMA 2KP8A 1VQKP 1T3UA 2WT7A 4ZLDA 1ZV8A 3EGDA 1YJGA 4U5EE 1ORJA 2EPLX 2RKLA 1E85A 5K5GB 2OYOA 4LDRA 2LK4A 3RF3A 4U7JA 1LIHA 4CS8A 4CBEA 3JCUH 2OTKE 2J8WA 5JT4A 1V54C 3ZTZA 4JJGA 3L72J 4CIHA 3G50A 4MVRA 5T1DB 4C7RA 2IZ1A 3N4XA 3ZQYA 3TNUA 3SWYA 2RSEB 3JTLO 1N7SD 1RHZB 2HV6A 1VQPP 2OKUA 3VMYA 2E74D 3QW0A 5APSA 2GWWA 1VF5D 3SFEC 4I44A 3U2LA 3M4CA 1E86A 2WSEJ 2QE7H 3A0BE 1RMVA 4RKUJ 1OVUA 1FOSF 2HFIA 3NYJA 1LJ2A 4PACA 2QJKC 3H1HE 1NSGB 4E7SA 1ZU5A 1LT9C 2QVAA 1K05A 2IFMA 2WSCJ 3KQGA 1SQXD 1LE4A 4H13B 2HJ3A 3V2QA 3ABLC 1NTKG 2XZRA 1ZP0C 4U9EA 4HKZH 1GL2A 2Z5HA 3RL0C 2VB6A 5HSWA 4CJGA 3L37A 1BSNA 4L6RA 3S28A 5TJ5E 4WY4A 4OD5A 2KYVA 4DOJA 2CPSA 3V7OA 1JOCA 4K35A 1L0LE 4ULWA 2FXPA 1KZUB 1SQXJ 1M2VB 2YQYA 3TSIA 2AWYA 4HYTB 3ZIBA 1T6QA 3CC7P 1VLTA 1SFCA 4H4KC 4WVZA 4DJ9A 2K37A 3KZIE 2YLGA 2L81A 5L8RJ 1ZRTD 5CJ0A 1FU1A 1PD1A 1NTZE 1BCCE 5L0DA 3CCSP 5CI8A 4CSAA 1KB9H 2RH0A 1EQ1A 4UDVA 2Y9YA 1LTJC 3AE2C 1JR8A 2Y0CA 3ITFA 5JS5A 3H2VA 4MTFA 3DWWA 1VQOP 1VOMA 3AE7C 2AP3A 2I1KA 4EKWA 3V4QA 2OEXA 1PCXA 1J1DB 3DJUB 1NO4A 2WZFA 1HMDA 1G2CA 3L72G 5KAIH 3PTZA 2YWAA 4Z9HA 4HB1A 1LTSC 1JY3P 1GL2B 3KZIH 3F46A 3HTKC 1NFNA 2IOQA 2J9WA 5AVRB 5AW3B 1L0LD 3GF7A 2E43A 2KB7P 4H0LB 4U5BE 2QJYC 4QI0A 1GS9A 2C9LY 1FMVA 2GAQA 2JWDA 2Q7CA 3LS1A 3HRNA 3FDQA 3L1MA 2YKQA 1URQA 3M79A 1OQCA 2J7PA 5CCGD 2ITAA 1LVKA 1GZLA 3VOPA 3NYMA 1OWAA 3L73J 2N1TB 1KILB 4RESB 4AK9A 5B5EH 1YITP 3NTNA 4JTDB 1HH0A 2ZAEB 3HKKA 2P7JA 2Y3BA 3M0DA 2PNOA 2R9RB 3GG2A 1L4AD 1N8RQ 1C17M 4NTFA 3BATA 1ZRTE 5JP7A 1FZFA 1NJIQ 2HPCB 2NPSA 1N73C 1JY3O 3BCCJ 1FZCB 2VRSA 3B9QA 5APTA 3W2WA 4BJ6A 4E18A 3Q5PA 2OGUA 3F89A 4ER9A 1N7SC 1LM3B 4LLCA 2P0NA 3AE1C 1L2PA 4U3FE 4ZNCA 4KHXA 5BU5A 1JOGA 1MMGA 2IBZG 3RBXA 3K33A 5CCHD 2FXOA 5COGA 1KQLA 1NWQA 4CIPA 5TISH 3U59A 5H2FE 4AUWA 1HW2A 3L71G 1ZN5A 1Z5ZA 3D6ZA 3Q1MA 3DE9A 1NU1J 2C04A 2YIUC 5APVA 1FZAA 3NXSA 2QTVA 4ULVA 3G9RA 1JY2N 4XLPF 5B5EE 2MKVA 1TWHA 1NU1D 4DJGA 1X79B 4J30B 1ZHXA 3S84A 1HJ0A 2H43A 2ZXRA 4JEBA 1W5CE 3JC22 1PGQA 3VRCA 1G1JA 3GEIA 1PP9G 2ZXPA 3L70J 3ZWIA 4AX2A 1EZVD 3RVYA 3USSA 1SR2A 2YZSA 3HNLA 5KJ7D 3EFOA 4J7YA 3AG1C 1ZVZA 2EPOA 2FFHA 4R4LA 4C3BA 3PLNA 3T97A 4YT8A 1GTWA 4O6MA 2MHRA 4N6JA 2W4MA 1U89A 1NKZB 4QDLA 2JJLA 3CWBD 1OZHA 1D0ZA 2J9VA 1OCRC 1J1EB 2GFHA 1YHQP 2LIGA 1PP9J 3PRJA 1WRGA 2WVQA 2KNHA 1SQQD 2C0XA 2ZFCA 4PR9A 4GDOA 2LXBA 2IYPA 5CI9A 3WG7C 4BG0A 1N7SB 5C39A 4HJGH 3M9QA 2KYHA 1DEEG 2Y0DA 4WY4B 3ZC4A 1Q82Q 5A69A 3I56P 2YIUB 3KPHA 2P2UA 4LC1A 5DJTB 4MVZA 3O39A 4E7ZA 2ZXOA 3DZAA 1JEKA 4ONSA 2QM7A 2IFNA 3LNMB 3ASOC 3AECC 3H1HG 4EOTA 4WY4D 3C63A 5COFA 2A06E 2FYUJ 1VQ5P 4K0DA 1CSBA 2PRRA 2WPSA 2WSFJ 1NLXA 1L4AA 2Z5IA 3HE4A 3CMAP 2XNDH 5GTHH 5CMZA 2M0BA 5KYUB 5A6BD 3CX5E 3PP5A 2ZYAA 3EFOB 1M6TA 2IXNA 1IFDA 5CHXA 2HSBA 4D6TE 1E2XA 3EWKA 1BCCD 3RK3B 1U6HA 4IAQA 3SP1A 3V2PA 4MQ9F 4KC9A 2M5AA 5AVTB 3JRTA 1NU1G 2WT7B 4IJJA 1QQ3A 1VF5C 4GQHA 1PGPA 5AGFA 2WZGA 1JRAA 3W2VA 3HD7C 1XZPA 1YJNP 2O1JA 3D71A 1C03A 2E5YA 1NU9C 4DRHB 4OD4A 1JMMA 3CXHH 3D6YA 1BCCJ 3O6XA 2HSQA 2X51A 1EC5A 2JEEA 2RN0A 3GHGB 2QEXP 1UIIA 1OFCX 1X0TA 2QJPB 3BCCD 3IQTA 3R7CA 3TGUJ 3KHUA 1NKNA 1BE3G 3GORA 3L72D 5B1AC 2PF4E 1J1DC 5KYYA 1IK7A 2NG1A 2VASA 2ZYDA 2OG2A 2DW3A 4YT4A 3N2ZB 1USDA 3EQLF 3Q6MA 5AC4A 3LESA 3UR3C 2R7UA 1JM0A 3ZSUA 2A0BA 5BQHA 2P1AA 2R3CA 2J0XA 3TGUE 1MFTA 3CC4P 1RE3A 1O3UA 2ETSA 4OGQD 2O01N 2HPCA 3PHF2 1M56D 3L34A 3L74E 2B9BA 2N9YB 3H1KD 4I1LA 2FKWB 4ZKUA 3SFDC 2J59M 2P67A 1NAYA 1YQ4C 1AV1A 3CX5D 1N73A 4OIOF 1M1JA 1WOLA 2YMKA 1RCPA 4CDVA 1E83A 1ZW2A 3O8ZA 4LDKA 1F1MA 2XM0A 1H9GA 3ZVRA 2EINC 4Z9JA 5KLVK 1HUCA 1LI7A 2XLOA 1EDIA 3GF3A 4RBNA 5E2QA 1H7IA 2OOCA 1FNTc 3B71A 1AJYA 3ZTMA 3WU2E 2BCCG 3VF0A 4IFDK 3KPEA 2L9JA 1VQLP 4QMAA 4I7ZC 1E5WA 2H88C 4C7OA 1VMAA 3CQZA 4Q4ZF 2HJMA 3T6JA 2O1KA 1MNEA 2QJYB 3BCCE 2R7QA 1SYQA 4BJ1A 2P10A 1SQPE 2HFED 3P8CE 1OIPA 1FZCC 4ASWA 1AQTA 3PDMP 4PJMA 3MFNA 5CCGC 2N1TC 2ZT9D 4JBZA 3SNHA 3F47A 3L70D 2KW3C 1ZMEC 3EH1A 2LSEA 2H7VC 2M64A 4JCZA 4PV1D 1LTAC 1D0XA 2Q4FA 2BEQD 3IQ6A 4N4WA 2W45A 3LIEA 3EG9A 2WVNA 1HVVA 3HUSB 1CGOA 5L0GA 2FXMA 2CGEA 2OU6A 1T2KD 2HS5A 1KC8Q 3A11A 3M0AA 2KK7A 3JCUE 2EPKX 2LD6A 4PJ0E 1KMIZ 3OAKA 4UB6H 2RD9A 3BEHA 3L36A 5KTBA 3MP7B 4EBBA 5CCHC 3TQOA 3Q7LA 2J0WA 4EBKA 1BE3J 1PD0A 3CXHE 1X9VA 2XLEA 4GKGA 1V4AA 1XZQA 2VH3A 3CCQP 2V7QH 3EZIA 5AVZB 1ZXGA 1MMNA 2P58A 4H13D 2NPUA 2AEFA 3RK2C 5AW6B 1NTZJ 5E33A 3RYLA 3VMZA 3A3YB 2LFFA 1L0LG 1FZEA 4E0HA 1TR2A 2BL2A 4KNWA 3FXHA 2AWCA 2H7BA 2POHA 2AVKA 1LTJB 2JX0A 2XLVA 4G7ZF 3WAQA 2Y3HA 2WPRA 2E42A 4DBRA 1GDTA 2ZD9A 2WL8A 2MJZA 2FYUG 1SQBK 2V26A 3C62A 4Y28J 1AUEA 3I5QA 4AYCA 1LT9A 1LS4A 1HMOA 1R5LA 2KI7B 1BR1A 4JURI 1SQPD 1A02J 2HV7A 3FXEA 2R25A 2WSSH 1OKKA 1L3PA 3LJBA 3F5HA 3JSEO 3IR9A 3CAXA 3U3BA 1LP1A 3DAFA 3EPVA 3G71P 1NBBA 2PX0A 1L0LK 1D7MA 5AW1B 3TJ5A 4XPXA 1Q2NA 2JR8A 2MYSA 4FX5A 1CZQA 2G8YA 3IPMO 4L75A 4FESA 2E75D 3SEOA 1N1CA 3OA7A 1A7VA 1SFCC 1GMJA 1PL5A 1BSHA 5KAFH 2LP4A 3O10A 4I1MA 256BA 1NTMD 3CCLP 1T3JA 3PH0A 3KYQA 3S9OA 3U2MA 3GLMA 1QGKB 4GOEA 1T6AA 2I8DA 3KMIA 2IYLD 3B4SA 4GYTA 5KLIC 1ZW3A 3UMHA 1P84E 2N9BA 1LTJA 2PP4A 1OW7A 2A68F 3MYIA 1KYOE 2E76C 1V55C 1T5OA 3IQ5A 3X2QC 4CDAA 2FYUE 1R5ID 1VQ6P 2KSFA 2JD3A 1PP9E 4DCKA 4JEAA 4PFPA 2OJQA 2E74B 1K9MQ 1RQVA 2ZJSE 3L71E 3RKOF 4Y99B 1KQFB 2X0CA 2V7QJ 4PD4D 4AL0A 2XXAA 3OJAB 2NUPB 2FBWC 2BC5A 3GM1A 5APUA 2Z4EA 4N6CA 2OQQA 4W8PA 4U3FG 1ZHTA 5KLVJ 3CPWO 2GUVA 3BRTB 4U9DA 3H1JE 4BJ5C 2IBZE 2QJPC 4N06A 2ZXWC 4K1OA 1UIXA 1OX3A 1LTIC 1S1CX 1LTTC 1HTLC 1T6UA 3L71D 2KQ9A 2CK3H 4PV1B 4MVMA 1HY5A 1Q86Q 5JSLA 4OH8B 2WWWA 3H1HD 1SQPG 2YLDA 3AE8C 1IFMA 5A6AA 1M8OB 3H1IJ 1WASA 3WU2H 2O01J 1P84D 1CI6A 2K9JA 4H13C 1MMAA 1BDJB 1L4AB 3MTUE 3G6EP 4JQ0D 2QJKB 4Z1MH 3KXDA 1EI7A 5B66E 4YL1A 1AQ5A 1JO5A 5BQGA 5KYYB 2LQGA 1OCZC 3GEEA 3E70C 1KILD 3E9VA 3S90A 4YPCA 2EIJC 4YTPC 1CW5A 2XL8A 4XLNF 1URQD 1NZEA 3M91A 4D6TG 3OEOA 3IF4A 3T4RA 3H1HJ 2Q7RA 4WGZA 5HV9A 3Q2YA 5APXA 1W2EA 4MS2A 2E87A 4H0LD 3AEFC 3H1ID 4NTAA 3M15A 3H6PA 3U1AA 1O87A 1FAVA 2IX7C 3QWOC 3U5SA 1SS1A 4K7BA 1BGYD 5DJUB 1S5LE 2D5RB 3K1IA 1NYHA 1XWJA 1NTKD 3ECSA 2R7RA 2NUPA 3CWBJ 4E0IA 3O6QB 1DEBA 2XLMA 3L75D 3MUDC 3NDBB 4PK4A 2LCHA 4Z9IA 3H25A 3L75J 4YK5A 1KB9E 4IB4A 2J7PD 1SQQG 4AL1A 2H8AA 5BQIA 4BJ6C 4CX9A 1N7SA 2ZVNB 1GK4A 3AGTA 4LLEA 4ZKPA 3V4WA 5AC5A 2Z15A 4M3LA 1RF1C 2Q3EA 4RJTA 4C7OB 5T3WA 2OTJP 3HE5A 5EHHA 4PV1C 3DKAA 3V2RA 1DD4A 4P9FA 1PIXA 1J8YF 1NOHA 2V3CC 1DOWA 1KILA 3NFQA 2H89C 1MZ9A 1OKKD 5A6KA 4K3AA 4OINF 2H7HA 1SZIA 2UUIA 3ABKC 3A2AA 5KYNA 3TK1A 1RJ9B 2W4BA 2YXRB 1OCCC 1JMWA 1HWTC 1QPUA 2DYSC 2L6HA 3DM5A 3N0TA 1IO4A 1Z3IX 1VL2A 1YTZI 1HW1A 5E3CA 3C8GB 1NU7D 3FHDA 2Q9BA 2J9UA 3DD7A 1L4AC 2YKZA 3SWKA 3VP8A 1OCOC 1SQQJ 1KTMA 1N7LA 4EI2A 2QY9A 2ASRA 4JW1A 1WGWA 4QI2A 5KJ7C 2YO3A 3SSUA 3JZ0A 1NAFA 3WMM0 2Q00A 2CPBA 2P7VA 3GWNA 1NTMG 1LT1A 4CDYA 3AEDC 4IL6E 3RL0D 3V5BA 3U9JA 4CS9A 2XU6A 1AVOA 2W8ZA 4NY3A 3CMEP 1N86A 2JO1A 3AEEC 3U8VA 5EK0A 4GT1A 3RK3C 3K5BA 3S1KA 3AEGC 1I5NA 2CCYA 3IFMA 2JKVA 3H65A 4XPWA 4PD4H 1JY2O 1YZCA 1LTGC 2VC9A 3LEOA 1LE2A 2LKMA 3ABVC 3SYNA 2IBZD 1WT6A 3ZDMA 4R32A 3E1IA 2KJGA 3CXHI 4A7PA 1DOVA 1LI5A 3A9CA 4IARA 1Q7YQ 3T97B 2QSIA 2YXQB 2A6EF 4CS8C 1BGYE 2RMZA 2C0WA 1KYOH 2CNWA 4XTKA 5F5FA 1JMBA 1LT9B 3JCUQ 3ZQVA 1JUNA 1SQBJ 2PBEA 3UMIA 3NMDA 3MLGA 2P1JA 1O5HA 4C3DA 3CL3D 4IOIH 4Q5SF 3EZHA 2WSEH 4WABA 4RO0A 4YXWH 1BR2A 1Q90D 4U5GA 1BE3D 3RH3A 2R05A 1QX8A 1TQGA 4JRZA 4DVZA 1SQVJ 3CCEP 2J45A 1M90Q 1HE1A 1RE4C 1RE3C 2EPMX 2ZPAA 4BPMA 4I7ZB 4BJTA 3US6A 2CDQA 3L74D 2UWJE 1Z56A 1J1EC 2JWAA 2XL4A 3K66A 3L8JA 2KS1A 3A0HE 3SWFA 1QVGO 3L4FA 1M1JC 2SPZA 1IZNB 1L0NE 1YYJA 3UGPA 1SQPK 1GL2C 2IBFA 4N78D 1SQVD 1QLED 3AQCA 3C8VA 4WY4C 3JSVC 3M9BA 1Q0GA 4EBJA 5TJHA 1R4TA 3C9IA 4O9BA 3H1LJ 3O55A 3VYWA 5AVXB 2W90A 2GDCA 3V2NA 4IFFA 3I4UA 4G7OF 2A69F 1Y4CA 1S7ZA 1M7LA 3BASA 2K1AA 4A2NB 3LAYA 2BCCJ 3CX5I 2XS8A 2ZXEB 2W6AA 2R44A 5B66H 1SQVK 5L0JA 5AVWB 1BR4A 1G1IA 4DRJB 3QVZA 1FDIA 1ORYA 3TGUG 5L0FA 2O3JA 4H44C 1JPJA 2YNYA 4JVSA 2PAJA 1FZCA 2K88A 3CCUP 5E3AA 4WWIA 1S9KE 3B29A 1M2OA 1JCCA 3RL0B 1AEPA 1Z7Qc 1HGVA 5JUAA 4JIOA 1K04A 3T9OA 1VB5A 2O01H 2KOGA 3QMKA 1VQ7P 3CLQA 3HD7B 4XQ1A 4DZOA 1SF8A 2OYHA 3E1RA 3AE4C 2AXCA 3G3ZA 5AW0B 3VP9A 3HUSC 1BDDA 4NPDA 4JYBA 4UB8H 1FOSE 3NKEA 2FFDA 4GODA 3GEHA 1KILC 2FYUK 2KS1B 5JRAA 4BXLA 2B88A 1DX7A 4RDAA 3NYLA 4IAOA 3BVHA 1NVOA 1VQ4P 3MGNA 2YHSA 2B0HA 4U5HA 3P7KA 3CCJP 3K1HA 3C8GA 3AE5C 5F28E 1V74B 2PP6A 3OA1A 1IFIA 1M56C 1B68A 5KLIB 2GA1A 2HLOA 4ASVA 2D4UA 3LIDA 3H32B 3RBZA 1SQBE 2XDJA 3EGDB 1RKCA 2KGOA 2L6FA 4MW3A 3ATPA 4JTCB 3KYIA 3BRVB 3SXYA 3MD0A 1H9TA 1G4US 5KJ7A 1UFBA 1JTHB 5DS5A 3B0UX
chains in the Genus database with same CATH topology
2ZT9D 3AJMA 3FGAD 5KKZC 2G8YA 4IL6X 1KTMA 4XFJA 2E75D 1EXJA 2JPUA 1K40A 1MKMA 1ZMEC 3AE7C 4R4LA 4YTPC 2LK4A 3JZ0A 1GMJA 4U7JA 1PL5A 2Q00A 4PV1D 3Q3DA 3O10A 2BEQD 3D70A 1R8EA 3U0CA 3AEDC 3U3FA 1Y9BA 3Q2YA 2JO1A 2QIWA 3GMAA 2YWAA 3AEEC 2K9YA 3RQFA 4XEKA 4H44D 3S9OA 1FDIA 3AEFC 1IK7A 4H0LD 1NGMB 3C18A 3GLMA 1ZZPA 2BEZF 4H44C 2E74C 4H0LC 1KORA 2E76B 3AEGC 1WMKA 3AE9C 3Q5RA 5KLIC 1KMIZ 2E74D 3GF7A 3JYYA 1NYHA 2FYNC 1OW7A 1VF5D 3SFEC 4H0LB 1HF9A 4GDOA 2E76C 2WSEJ 2QJYC 3L8IA 1YQ3C 2D2CD 4RKUJ 1KQGB 3ABVC 1KILE 2E76D 4KT0J 3RQEA 4R32A 1OW8A 1PV3A 4OGQB 1O3UA 4EBKA 4OGQD 3K7DA 2QJKC 4H44B 2QSIA 3T97B 2E74B 2L6GA 2D2CB 1K04A 1RQVA 2ZT9C 4OGQC 1K05A 2WSCJ 1V4AA 1RQUA 1TU3F 3C8GD 4H13B 3SFDC 2E75B 3H25A 3RQGA 3TULA 3AE6C 1YQ4C 1OMIA 3IN6A 2V7QJ 1DD3A 4H13D 1KQFB 1ZP0C 3AE4C 4NQFA 1WOLA 2FBWC 1ZOYC 3GM1A 2YMKA 3AECC 2PBEA 1JB0J 2OQQA 1VF5B 1U57A 1ZRTE 4XEFA 2WPVB 2JX0A 1OW6A 2QJPC 2E75C 4XEVA 2NZ2A 2WSFJ 1Q90D 3Q5PA 1EXIA 4YXDC 1UIXA 2FXPA 3GF3A 3O6QA 1S1CX 3AE1C 4PV1C 1FDOA 4TT3H 3B71A 2J5UA 3IAOA 1AJYA 1DD4A 1JOGA 1PIXA 2KK1A 3RL0g 3BRJA 1QVXA 4I7ZB 3GM3A 3LW5J 4Y28J 4PV1B 1KNYA 2D2CC 2ZT9B 3AE5C 2HSBA 3EWKA 3C8GA 5F28E 2H89C 3R4YA 3L8JA 1S5LX 1WTYA 4R4MA 3RK3E 4I7ZC 3GM2A 3AE8C 3AEBC 2G3AA 2H88C 2JP3A 5L8RJ 3D6ZA 3Q1MA 1WWPA 1DIPA 2YIUC 2L6FA 2O01J 5M1BA 1VF5C 3AEAC 3G9RA 4H13C 2P10A 2L6HA 2MKVA 3Q5SA 3AE3C 2IDBA 1VL2A 1HJ0A 3D71A 3C8VA 3AE2C 1UFBA 3C8GB 4EBJA 4Z1MH 2WQYC 3MFNA 3D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  1KTM A;  2JPU A;  1K40 A;  3AE7 C;  4YTP C;  2LK4 A;  3JZ0 A;  2Q00 A;  3O10 A;  3U0C A;  3AED C;  3U3F A;  2YWA A;  3AEE C;  3RQF A;  4XEK A;  3S9O A;  3AEF C;  3C18 A;  1ZZP A;  3AEG C;  3AE9 C;  3JYY A;  1OW7 A;  3SFE C;  3L8I A;  1YQ3 C;  3ABV C;  3RQE A;  4R32 A;  1OW8 A;  1PV3 A;  1O3U A;  4EBK A;  3K7D A;  2L6G A;  1K04 A;  1V4A A;  1K05 A;  3C8G D;  3SFD C;  3RQG A;  3TUL A;  3AE6 C;  1YQ4 C;  4NQF A;  1ZP0 C;  3AE4 C;  1WOL A;  2FBW C;  1ZOY C;  3GM1 A;  3AEC C;  2PBE A;  4XEF A;  2JX0 A;  1OW6 A;  4XEV A;  4YXD C;  3AE1 C;  3B71 A;  1JOG A;  2KK1 A;  3BRJ A;  1QVX A;  3GM3 A;  2HSB A;  1KNY A;  3C8G A;  3AE5 C;  5F28 E;  2H89 C;  3L8J A;  1WTY A;  3GM2 A;  3AE8 C;  3AEB C;  2G3A A;  2H88 C;  1WWP A;  2L6F A;  3AEA C;  2L6H A;  3AE3 C;  3AE2 C;  1UFB A;  3C8G B;  4EBJ A;  2WQY C;  3MFN A; 
#chains in the Genus database with same CATH topology
 1ZU4 A;  2I15 A;  1MMD A;  2UUH A;  4IWB A;  2R7V A;  5COM A;  3C7J A;  4O6N A;  4OIR F;  4X0R A;  1D1A A;  2CNW D;  2Q9A A;  3GWL A;  3TK0 A;  1RXQ A;  2BEZ F;  1YJ9 P;  1IZM A;  1W2W A;  3A0B H;  4XWJ A;  2R7W A;  1A0B A;  1VQ8 P;  1HE9 A;  2HYN A;  3H1J D;  3FWL A;  1Y6D A;  4HFK B;  1QKR A;  2EIK C;  5H2F H;  1PV3 A;  1Q81 Q;  2Q1K A;  3M9H A;  2FAP B;  2D2C B;  2ZT9 C;  3H1L D;  3WUU A;  2QE9 A;  2KIK A;  3WUT A;  5DS6 A;  2WPQ A;  1X8Y A;  2PFX A;  4U3F D;  2YKP A;  1X22 A;  2ZXX A;  3VMX A;  3S29 A;  4EUK B;  1H6G A;  1L0N D;  2IBZ I;  1VF5 B;  3IEE A;  4MVQ A;  4JE9 A;  2KC3 A;  2OYI B;  2Y69 C;  3HJC A;  3S0X A;  4XEF A;  3RVZ A;  1KYO D;  3RGU A;  3FOO A;  2MWQ A;  1AFO A;  3TD7 A;  1NU1 E;  1RF0 C;  3B0V C;  3GM3 A;  1QVX A;  2OJE D;  1BE3 E;  2XRH A;  3H1L E;  2KLV A;  4N6H A;  5B3I A;  4CS7 A;  3NRH A;  3L0I A;  1T8Z A;  1YAR O;  1PPJ D;  1SMY F;  1T6I A;  2HMQ A;  1ZLL A;  1IFP A;  1P84 H;  1YDI A;  1SQP J;  2YLI A;  3W8I A;  5JLI A;  1L0N J;  5T3T A;  1Z23 A;  4Y99 C;  2BAS A;  1Q0F A;  3EH2 A;  3AE3 C;  1VDF A;  2HOD B;  5D92 A;  3B0P A;  2YVK A;  3H1K J;  5A6B A;  1NH4 A;  3U9M A;  4MTG A;  3FGA D;  2HUJ A;  4DVY P;  1RH5 B;  4EHP A;  1YI2 P;  1EXJ A;  2JPU A;  4JCH A;  2J58 A;  3H1L G;  3B8E B;  5DVW A;  5AW5 B;  4MND A;  4J7T A;  3E7K A;  3HTK B;  3P32 A;  3H32 A;  3RK3 D;  2KSJ A;  4NCQ A;  4XA4 A;  5GTI E;  2NUT B;  3M0D C;  4XEK A;  4HEA J;  1VK5 A;  2J9B A;  2CW0 F;  5TIS E;  2GA0 A;  1ZHZ A;  2M4E A;  3C1L A;  1KFM A;  3HD7 A;  1KOR A;  4D4X A;  1WMK A;  1SVF A;  3AE9 C;  2NPS C;  1FFH A;  2H7O A;  1A41 A;  2FYN C;  4W7Z A;  2Y3D A;  1YIJ P;  1LS1 A;  2AXT E;  1EA8 A;  3C8Z A;  1FC2 C;  2G3K A;  1QL2 A;  5DLJ A;  1OW8 A;  2VCB A;  3QZC A;  4BWN A;  3W68 A;  3SZR A;  1K8A Q;  3HUS A;  1OXB A;  1TKN A;  4DXW A;  2A45 I;  1BGY J;  1AVO B;  4B6I A;  4DRI B;  1GL2 D;  2E75 B;  3LS0 A;  2DYR C;  3TUL A;  2YL3 A;  1YBK A;  5DS4 A;  5L0I A;  1KQS O;  3K6B A;  3H1I E;  3GAN A;  1ZOY C;  1SLQ A;  1Z6A A;  1U0B B;  1GU5 A;  3EHM A;  1U57 A;  5CBN A;  4WJ0 A;  4O79 A;  2WIT A;  1PP9 D;  3PCV A;  1YJW P;  2R03 A;  4H54 A;  5L0H A;  1EZV I;  4NPE A;  5IY5 C;  3AG3 C;  2R7O A;  4PD4 E;  2W6J H;  1M57 D;  4MVO A;  4EDF A;  2XL6 A;  3MUD A;  3V5Y A;  3LW5 J;  1IJD B;  2D2C C;  1PPJ G;  2ZT9 B;  4MN4 C;  1FMW A;  3NMK A;  1YYX A;  3P8M C;  3R4Y A;  1S5L X;  1NTZ D;  4OVN F;  4F4B A;  3RK3 E;  1A02 F;  2G3V A;  3GM2 A;  3HLZ A;  2FYU D;  2GM4 A;  1WWP A;  2OAR A;  1PGJ A;  3FWN A;  1R5S A;  1YYC A;  1QSP A;  4PJL A;  3HE5 B;  1RKE B;  4D4N A;  5AVS B;  1PZQ A;  3QW1 A;  4D6T D;  2N1T D;  2KXP B;  2WQY C;  3H1J G;  1EDJ A;  3CZ6 A;  2WTY A;  4EWC A;  3UNG C;  4JC7 A;  1KV4 A;  1YA7 O;  2L7A A;  2GUS A;  2L5G B;  1JPN A;  1JNM A;  3UGO A;  4KI2 A;  1FZB A;  5KLV G;  1NTK E;  1S4X A;  1CGM E;  2IXO A;  5APQ A;  5APY A;  1L0N K;  2M8R A;  3L73 E;  1D1B A;  2K9Y A;  4I1O B;  4NC3 A;  4RD9 A;  5L3V A;  4H44 D;  3WOD F;  2JDI H;  3C18 A;  3CSK A;  2E74 C;  1A7E A;  4KBL A;  2H8P D;  2HOD A;  2B89 A;  3A7O A;  5KAF E;  3L74 G;  3FX0 A;  2OTL P;  3CEX A;  3L35 A;  4W7Y A;  1KIL E;  1APC A;  2QM8 A;  3AOU A;  3W67 A;  4OGQ B;  1ORS C;  2Q9I A;  2EIM C;  2WB7 A;  3UMK A;  1LWU B;  3K7D A;  2L6G A;  4FWV A;  4EIY A;  1TFO B;  1Q0D A;  4WBA A;  1ZHW A;  4E17 A;  3S27 A;  4A4A A;  4CS9 C;  3KDP B;  3B5N D;  2HZ8 A;  1OVV A;  2Q9C A;  1LGH B;  1RY3 A;  1E84 A;  2IPP A;  3W4Y A;  2W6B A;  4BRY B;  1NG1 A;  1G5Z A;  2R5D A;  1QZX A;  1VYI A;  2W83 C;  3AG4 C;  1RF0 A;  2A45 G;  2W9Y A;  4LDQ A;  2Y39 A;  1H89 A;  2HKV A;  4JPZ B;  4XEV A;  4PD4 I;  1EXI A;  3NMJ A;  3JT1 A;  3LEV A;  5CCH A;  4WB4 A;  2KSE A;  4J32 B;  5KYX B;  2A06 G;  1RKE A;  3TOL A;  1KNY A;  4JZA A;  5AW2 B;  5BVZ A;  2HG5 D;  4LAC B;  1AA0 A;  4O7G A;  4R4M A;  2R5B A;  3W8H A;  4HE8 D;  3MZW B;  2R7T A;  1JTH A;  1FTS A;  4L76 A;  3JSZ A;  1KYO I;  3FAP B;  3TF5 A;  2DGJ A;  1GQA A;  4W80 A;  3GHG C;  2BCC E;  1GM5 A;  2QUP A;  1S05 A;  3QVY A;  2ICW G;  2WSC H;  2LFD A;  2QNL A;  4Q7C A;  1JY3 N;  3ABM C;  4ANJ A;  1SQX E;  4G0H A;  3HD7 D;  5KYW A;  4G7H F;  1Q0M A;  1G2C B;  2WMM A;  3KKB A;  3TOM A;  3FMS A;  1NTZ G;  1FE6 A;  3TJ6 A;  1S3J A;  5KKZ C;  3FVY A;  3CCM P;  1KD1 Q;  1RE4 A;  5KAI E;  1OXZ A;  2NRG A;  3PHL A;  3Q3D A;  1CI6 B;  2K9J B;  5AVV B;  3GW6 A;  3II6 A;  3L70 E;  5DQZ A;  3U0C A;  1NTM K;  3TYY A;  2WZ7 A;  1M1J B;  3FOP A;  2R02 A;  3SXZ A;  3SXK A;  1YA9 A;  2E5T A;  2Y0E A;  1LTB C;  2E76 B;  3H1J J;  2OYH B;  2AEM A;  3Q5R A;  4PJN A;  2L91 A;  3N7N A;  1TWA A;  1Y47 A;  3MHV A;  4L73 A;  3L71 J;  3T6G B;  1FFT C;  4FAP B;  3RQE A;  2KUB A;  1G4W R;  1FR0 A;  3IHU A;  4IRU A;  1IK9 A;  2R32 A;  1D1C A;  1VYK A;  4OGQ C;  1GU4 A;  2IZ0 A;  5KLV D;  2B87 A;  3RQG A;  3UIA A;  1M2V A;  4KJM A;  3JYH A;  4IFM A;  3CX5 H;  1H88 A;  4N78 E;  3POV A;  2DB4 A;  3B5N C;  1KB9 I;  1TWG A;  4CSA C;  2FYZ A;  3RW0 A;  4EYY Q;  2NSF A;  1OW6 A;  5KYW B;  1VLS A;  2OCC C;  3KH2 A;  1NHL A;  4N3Y B;  1ZHY A;  3DE8 A;  3DM9 B;  3EHN A;  2O9X A;  4JTA B;  4TT3 H;  5B3S C;  5JVE A;  3CI9 A;  5AW4 B;  2A6H F;  3J06 A;  1VTM P;  1FZG A;  2I1J A;  1VPC A;  2YL1 A;  2YO2 A;  1K73 Q;  2YRF A;  4JJF A;  2OYH C;  1T9K A;  1BGY G;  2G3A A;  2Y9Z A;  1NTK J;  3EFG A;  2BCC D;  1EDL A;  3PMR A;  1OVR A;  2IXP A;  5L3Q A;  1MND A;  3WHN A;  3NG1 A;  4PJ0 H;  2KNC B;  1IFJ A;  1I4Y A;  1QLE C;  1GW3 A;  2C03 A;  3SXM A;  3EG9 B;  3H2U A;  4P9T A;  1ZYR F;  3GOD A;  1EDK A;  4DT0 A;  1URQ C;  3L73 G;  5D91 A;  1K40 A;  2QG4 A;  3TDK A;  2R7S A;  1PGO A;  4LGD E;  3S4R A;  4GEH A;  3VAY A;  3U3F A;  1H8A A;  1BDC A;  4C3E A;  3FAJ A;  1KB9 D;  1JCD A;  1SQV G;  1LWU A;  2K3R A;  1WN0 A;  2G62 A;  3RQF A;  1NGM B;  2LR2 A;  3X1O A;  1L0N G;  3BCC G;  3Q6N A;  3CC2 P;  1J8M F;  1M57 C;  1N73 B;  1H0T A;  4U5C E;  4MTO A;  1YZA A;  1IFN A;  5AVU B;  1HF9 A;  3DXJ F;  2QA4 P;  4HH2 A;  3H1K G;  3RK2 B;  2D2C D;  5DQT A;  3Q7G A;  4JKV A;  3CWB G;  2OYI A;  2A06 D;  5B1B C;  1IC2 A;  1NTM J;  3DI5 A;  2OQM A;  5FZT A;  1HJB A;  1I4Z A;  3NKD A;  4DOZ A;  1QL1 A;  4I6M C;  2M3E A;  5EFW B;  2PFD A;  1SQX K;  3C8G D;  1TU3 F;  3MX3 A;  1MV8 A;  1OMI A;  3IN6 A;  4NQF A;  1DD3 A;  2WSF H;  3HE4 B;  5KYX A;  1BCC G;  5CBO A;  2XS1 A;  3TNU B;  1RJ9 A;  3L72 E;  1G8X A;  2YL7 A;  2YL0 A;  2B0J A;  1BBH A;  1LPE A;  4P6I C;  1KFN A;  1MFZ A;  5AVY B;  1HGZ A;  1T01 A;  2WPV B;  2KNC A;  2CYD A;  3VMA A;  3K1I C;  2W27 A;  1T2K C;  2M5A B;  4G78 A;  3WUV A;  4I2L C;  3AQB A;  4LER A;  2PX3 A;  5AVQ B;  3CCV P;  2AXT H;  3IAO A;  1S2E A;  3VN0 A;  3GHG A;  4C7N A;  4AE4 A;  2HMZ A;  1LKX A;  4O6Y A;  3IQC A;  1QEX A;  4AQR D;  1SQV E;  2Q5U A;  1SQX G;  3AEB C;  2JP3 A;  3M1C B;  1E79 H;  5L0C A;  1VQ9 P;  1NU1 K;  1DIP A;  2F22 A;  3DMD A;  3MBG A;  2AU5 A;  2FFD B;  3AEA C;  3LLK A;  4PJJ A;  3R2P A;  2WZL A;  3HNK A;  5K0I A;  3G4Z A;  1Y8A A;  2AEJ A;  3Q5S A;  2XKM A;  3T6B A;  2R7X A;  2IDB A;  3H1K E;  1JY2 P;  4CJO A;  1YTZ T;  3CWB E;  3AG2 C;  4IL6 X;  3P8C D;  1SFC B;  1NFO A;  2M3B A;  3TGU D;  2P61 A;  2Q3I A;  5AW7 B;  1W2B O;  4GOF A;  4TLF A;  1SQB D;  1SP4 A;  1NTK K;  1H0T B;  4JF7 A;  3D70 A;  1PPJ E;  2XLW A;  4EIJ A;  1EKY A;  3QTH A;  1J2J B;  2QIW A;  4JYC A;  2XLD A;  1N2D C;  4YT5 A;  3L75 G;  2BE5 F;  2VCC A;  1QVF O;  1P84 I;  3PJS K;  4BJ5 A;  1S72 P;  2EPN A;  3LNR A;  4KNV A;  1GW4 A;  3EQ2 A;  4W8K A;  1AVY A;  4NTB A;  2E76 D;  4KT0 J;  1PFI A;  1C02 A;  3KL4 A;  4XPY A;  1SQQ E;  5BUO A;  3H1I G;  3CCR P;  2ZYG A;  2NUT A;  3I5P A;  3B5N A;  5GPG B;  3CD6 P;  1RQU A;  1RF1 B;  5KKZ B;  3AE6 C;  3ITK A;  2Q6Q A;  3A5T A;  3RIP A;  1XTC C;  2XNX A;  1GGQ A;  4OIQ F;  1NTZ K;  5GTH E;  2P6V A;  1XTG B;  3MIW A;  2PGD A;  4U3F J;  3NMI A;  3L75 E;  2XSE A;  2NSG A;  1FJK A;  3I5C A;  1JAF A;  4XE5 B;  4IGG A;  1ZR4 A;  2NZ2 A;  3KYJ A;  2WVO A;  4YXD C;  2VCA A;  5EGY A;  2XM4 A;  2YMY A;  4IL6 H;  3HNJ A;  1YLM A;  2YEV A;  1FDO A;  1FBM A;  1EZV E;  5KLV E;  2KK1 A;  1S5L H;  4CPG A;  5AW8 B;  3RL0 g;  1OR3 A;  3BRJ A;  5FCL A;  3U8P A;  2A1D D;  3A0H H;  1U7M A;  3VYI A;  5GTI H;  2A45 H;  1WTY A;  4U5D E;  2YKO A;  3DJN B;  5CIV A;  1GK6 A;  2V4H A;  4YJW A;  4UB8 E;  2KZJ A;  3EGX B;  4YL3 A;  5KYU A;  2TMV P;  4U5F E;  4I3M A;  1FJP A;  4MVS A;  1CPQ A;  2IM8 A;  4YN0 B;  3ZG1 A;  1SQQ K;  2Q3T A;  1DH3 A;  4XFJ A;  1FS0 E;  3U1C A;  4B86 A;  1ZR2 A;  3G4X A;  4OIP F;  1LWU C;  1MKM A;  3QH9 A;  1YAU O;  3V6I A;  5BU8 B;  1EZV G;  4C7N B;  3RK2 D;  2J46 A;  1TFK B;  3OWT A;  4AE4 B;  1S9K D;  5AW9 B;  3B5N B;  1MUU A;  4D6T J;  5CCG A;  1GD2 E;  1R8E A;  4YL0 A;  3VTP C;  2FGY A;  3V5X A;  1Y9B A;  2B87 B;  4YWQ A;  3GMA A;  1EQ7 A;  3V5Z A;  1CPR A;  2IXM A;  2I8B A;  3HNI A;  1ZZP A;  3LLI A;  1D0Y A;  1ZW0 A;  2OYI C;  4H0L C;  1NTM E;  1WAT A;  1OXK A;  4DBQ A;  2OEV A;  2XXA B;  4BEM J;  1RF1 A;  3JYY A;  2IYO A;  1VQN P;  1KN7 A;  1BZ4 A;  3L8I A;  1YQ3 C;  3HTK A;  1L7C A;  3M06 A;  1KQG B;  2Y3G A;  1USE A;  2DI3 A;  4BRY A;  2KLU A;  4BEJ A;  1ST6 A;  4L74 A;  3L74 J;  2KZI A;  3G4S P;  3AGU A;  4H44 B;  2C9N Y;  1VQM P;  5E79 E;  1FAP B;  3L70 G;  3DAG A;  1IW7 F;  3EGX A;  1JB0 J;  3N24 A;  3I55 P;  4OWF A;  3MYF A;  3RFY A;  1TWC A;  3VM6 A;  1A7D A;  4ZLC A;  1Q0K A;  2FY8 A;  1YVI A;  3LUT B;  2XLH A;  2A0U A;  1URQ B;  1KU2 A;  2ZVO B;  2E75 C;  4GIF A;  3FXD A;  2HR3 A;  2N1T A;  1SFC D;  1UG7 A;  4LLH A;  3O6Q A;  4NPF X;  2NPS D;  4UB6 E;  2EIL C;  5APW A;  1L0L J;  1M1K Q;  5F5H A;  1LP1 B;  2J5U A;  3M4B A;  4YT2 A;  5E79 H;  1SQB G;  1MQV A;  4WGY A;  4PFO A;  1FDM A;  4HFF B;  3LW5 H;  1LNQ A;  4MW8 A;  3ZDL A;  2R3S A;  4M63 A;  2NPS B;  3OW2 O;  1U7J A;  3EJN A;  5M1B A;  1OR2 A;  2QLA A;  3JRM O;  2WVR A;  5A6J A;  2LXC B;  1HBW A;  4MVU A;  2FFD C;  5CJ4 A;  1CGN A;  2FYN B;  2QRX A;  2XV5 A;  4ZMD A;  3L73 D;  3ASN C;  3EFF K;  4C46 A;  3CXH D;  1Z63 A;  3AJM A;  2KP8 A;  1VQK P;  1T3U A;  2WT7 A;  4ZLD A;  1ZV8 A;  3EGD A;  1YJG A;  4U5E E;  1ORJ A;  2EPL X;  2RKL A;  1E85 A;  5K5G B;  2OYO A;  4LDR A;  2LK4 A;  3RF3 A;  4U7J A;  1LIH A;  4CS8 A;  4CBE A;  3JCU H;  2OTK E;  2J8W A;  5JT4 A;  1V54 C;  3ZTZ A;  4JJG A;  3L72 J;  4CIH A;  3G50 A;  4MVR A;  5T1D B;  4C7R A;  2IZ1 A;  3N4X A;  3ZQY A;  3TNU A;  3SWY A;  2RSE B;  3JTL O;  1N7S D;  1RHZ B;  2HV6 A;  1VQP P;  2OKU A;  3VMY A;  2E74 D;  3QW0 A;  5APS A;  2GWW A;  1VF5 D;  3SFE C;  4I44 A;  3U2L A;  3M4C A;  1E86 A;  2WSE J;  2QE7 H;  3A0B E;  1RMV A;  4RKU J;  1OVU A;  1FOS F;  2HFI A;  3NYJ A;  1LJ2 A;  4PAC A;  2QJK C;  3H1H E;  1NSG B;  4E7S A;  1ZU5 A;  1LT9 C;  2QVA A;  1K05 A;  2IFM A;  2WSC J;  3KQG A;  1SQX D;  1LE4 A;  4H13 B;  2HJ3 A;  3V2Q A;  3ABL C;  1NTK G;  2XZR A;  1ZP0 C;  4U9E A;  4HKZ H;  1GL2 A;  2Z5H A;  3RL0 C;  2VB6 A;  5HSW A;  4CJG A;  3L37 A;  1BSN A;  4L6R A;  3S28 A;  5TJ5 E;  4WY4 A;  4OD5 A;  2KYV A;  4DOJ A;  2CPS A;  3V7O A;  1JOC A;  4K35 A;  1L0L E;  4ULW A;  2FXP A;  1KZU B;  1SQX J;  1M2V B;  2YQY A;  3TSI A;  2AWY A;  4HYT B;  3ZIB A;  1T6Q A;  3CC7 P;  1VLT A;  1SFC A;  4H4K C;  4WVZ A;  4DJ9 A;  2K37 A;  3KZI E;  2YLG A;  2L81 A;  5L8R J;  1ZRT D;  5CJ0 A;  1FU1 A;  1PD1 A;  1NTZ E;  1BCC E;  5L0D A;  3CCS P;  5CI8 A;  4CSA A;  1KB9 H;  2RH0 A;  1EQ1 A;  4UDV A;  2Y9Y A;  1LTJ C;  3AE2 C;  1JR8 A;  2Y0C A;  3ITF A;  5JS5 A;  3H2V A;  4MTF A;  3DWW A;  1VQO P;  1VOM A;  3AE7 C;  2AP3 A;  2I1K A;  4EKW A;  3V4Q A;  2OEX A;  1PCX A;  1J1D B;  3DJU B;  1NO4 A;  2WZF A;  1HMD A;  1G2C A;  3L72 G;  5KAI H;  3PTZ A;  2YWA A;  4Z9H A;  4HB1 A;  1LTS C;  1JY3 P;  1GL2 B;  3KZI H;  3F46 A;  3HTK C;  1NFN A;  2IOQ A;  2J9W A;  5AVR B;  5AW3 B;  1L0L D;  3GF7 A;  2E43 A;  2KB7 P;  4H0L B;  4U5B E;  2QJY C;  4QI0 A;  1GS9 A;  2C9L Y;  1FMV A;  2GAQ A;  2JWD A;  2Q7C A;  3LS1 A;  3HRN A;  3FDQ A;  3L1M A;  2YKQ A;  1URQ A;  3M79 A;  1OQC A;  2J7P A;  5CCG D;  2ITA A;  1LVK A;  1GZL A;  3VOP A;  3NYM A;  1OWA A;  3L73 J;  2N1T B;  1KIL B;  4RES B;  4AK9 A;  5B5E H;  1YIT P;  3NTN A;  4JTD B;  1HH0 A;  2ZAE B;  3HKK A;  2P7J A;  2Y3B A;  3M0D A;  2PNO A;  2R9R B;  3GG2 A;  1L4A D;  1N8R Q;  1C17 M;  4NTF A;  3BAT A;  1ZRT E;  5JP7 A;  1FZF A;  1NJI Q;  2HPC B;  2NPS A;  1N73 C;  1JY3 O;  3BCC J;  1FZC B;  2VRS A;  3B9Q A;  5APT A;  3W2W A;  4BJ6 A;  4E18 A;  3Q5P A;  2OGU A;  3F89 A;  4ER9 A;  1N7S C;  1LM3 B;  4LLC A;  2P0N A;  3AE1 C;  1L2P A;  4U3F E;  4ZNC A;  4KHX A;  5BU5 A;  1JOG A;  1MMG A;  2IBZ G;  3RBX A;  3K33 A;  5CCH D;  2FXO A;  5COG A;  1KQL A;  1NWQ A;  4CIP A;  5TIS H;  3U59 A;  5H2F E;  4AUW A;  1HW2 A;  3L71 G;  1ZN5 A;  1Z5Z A;  3D6Z A;  3Q1M A;  3DE9 A;  1NU1 J;  2C04 A;  2YIU C;  5APV A;  1FZA A;  3NXS A;  2QTV A;  4ULV A;  3G9R A;  1JY2 N;  4XLP F;  5B5E E;  2MKV A;  1TWH A;  1NU1 D;  4DJG A;  1X79 B;  4J30 B;  1ZHX A;  3S84 A;  1HJ0 A;  2H43 A;  2ZXR A;  4JEB A;  1W5C E;  3JC2 2;  1PGQ A;  3VRC A;  1G1J A;  3GEI A;  1PP9 G;  2ZXP A;  3L70 J;  3ZWI A;  4AX2 A;  1EZV D;  3RVY A;  3USS A;  1SR2 A;  2YZS A;  3HNL A;  5KJ7 D;  3EFO A;  4J7Y A;  3AG1 C;  1ZVZ A;  2EPO A;  2FFH A;  4R4L A;  4C3B A;  3PLN A;  3T97 A;  4YT8 A;  1GTW A;  4O6M A;  2MHR A;  4N6J A;  2W4M A;  1U89 A;  1NKZ B;  4QDL A;  2JJL A;  3CWB D;  1OZH A;  1D0Z A;  2J9V A;  1OCR C;  1J1E B;  2GFH A;  1YHQ P;  2LIG A;  1PP9 J;  3PRJ A;  1WRG A;  2WVQ A;  2KNH A;  1SQQ D;  2C0X A;  2ZFC A;  4PR9 A;  4GDO A;  2LXB A;  2IYP A;  5CI9 A;  3WG7 C;  4BG0 A;  1N7S B;  5C39 A;  4HJG H;  3M9Q A;  2KYH A;  1DEE G;  2Y0D A;  4WY4 B;  3ZC4 A;  1Q82 Q;  5A69 A;  3I56 P;  2YIU B;  3KPH A;  2P2U A;  4LC1 A;  5DJT B;  4MVZ A;  3O39 A;  4E7Z A;  2ZXO A;  3DZA A;  1JEK A;  4ONS A;  2QM7 A;  2IFN A;  3LNM B;  3ASO C;  3AEC C;  3H1H G;  4EOT A;  4WY4 D;  3C63 A;  5COF A;  2A06 E;  2FYU J;  1VQ5 P;  4K0D A;  1CSB A;  2PRR A;  2WPS A;  2WSF J;  1NLX A;  1L4A A;  2Z5I A;  3HE4 A;  3CMA P;  2XND H;  5GTH H;  5CMZ A;  2M0B A;  5KYU B;  5A6B D;  3CX5 E;  3PP5 A;  2ZYA A;  3EFO B;  1M6T A;  2IXN A;  1IFD A;  5CHX A;  2HSB A;  4D6T E;  1E2X A;  3EWK A;  1BCC D;  3RK3 B;  1U6H A;  4IAQ A;  3SP1 A;  3V2P A;  4MQ9 F;  4KC9 A;  2M5A A;  5AVT B;  3JRT A;  1NU1 G;  2WT7 B;  4IJJ A;  1QQ3 A;  1VF5 C;  4GQH A;  1PGP A;  5AGF A;  2WZG A;  1JRA A;  3W2V A;  3HD7 C;  1XZP A;  1YJN P;  2O1J A;  3D71 A;  1C03 A;  2E5Y A;  1NU9 C;  4DRH B;  4OD4 A;  1JMM A;  3CXH H;  3D6Y A;  1BCC J;  3O6X A;  2HSQ A;  2X51 A;  1EC5 A;  2JEE A;  2RN0 A;  3GHG B;  2QEX P;  1UII A;  1OFC X;  1X0T A;  2QJP B;  3BCC D;  3IQT A;  3R7C A;  3TGU J;  3KHU A;  1NKN A;  1BE3 G;  3GOR A;  3L72 D;  5B1A C;  2PF4 E;  1J1D C;  5KYY A;  1IK7 A;  2NG1 A;  2VAS A;  2ZYD A;  2OG2 A;  2DW3 A;  4YT4 A;  3N2Z B;  1USD A;  3EQL F;  3Q6M A;  5AC4 A;  3LES A;  3UR3 C;  2R7U A;  1JM0 A;  3ZSU A;  2A0B A;  5BQH A;  2P1A A;  2R3C A;  2J0X A;  3TGU E;  1MFT A;  3CC4 P;  1RE3 A;  1O3U A;  2ETS A;  4OGQ D;  2O01 N;  2HPC A;  3PHF 2;  1M56 D;  3L34 A;  3L74 E;  2B9B A;  2N9Y B;  3H1K D;  4I1L A;  2FKW B;  4ZKU A;  3SFD C;  2J59 M;  2P67 A;  1NAY A;  1YQ4 C;  1AV1 A;  3CX5 D;  1N73 A;  4OIO F;  1M1J A;  1WOL A;  2YMK A;  1RCP A;  4CDV A;  1E83 A;  1ZW2 A;  3O8Z A;  4LDK A;  1F1M A;  2XM0 A;  1H9G A;  3ZVR A;  2EIN C;  4Z9J A;  5KLV K;  1HUC A;  1LI7 A;  2XLO A;  1EDI A;  3GF3 A;  4RBN A;  5E2Q A;  1H7I A;  2OOC A;  1FNT c;  3B71 A;  1AJY A;  3ZTM A;  3WU2 E;  2BCC G;  3VF0 A;  4IFD K;  3KPE A;  2L9J A;  1VQL P;  4QMA A;  4I7Z C;  1E5W A;  2H88 C;  4C7O A;  1VMA A;  3CQZ A;  4Q4Z F;  2HJM A;  3T6J A;  2O1K A;  1MNE A;  2QJY B;  3BCC E;  2R7Q A;  1SYQ A;  4BJ1 A;  2P10 A;  1SQP E;  2HFE D;  3P8C E;  1OIP A;  1FZC C;  4ASW A;  1AQT A;  3PDM P;  4PJM A;  3MFN A;  5CCG C;  2N1T C;  2ZT9 D;  4JBZ A;  3SNH A;  3F47 A;  3L70 D;  2KW3 C;  1ZME C;  3EH1 A;  2LSE A;  2H7V C;  2M64 A;  4JCZ A;  4PV1 D;  1LTA C;  1D0X A;  2Q4F A;  2BEQ D;  3IQ6 A;  4N4W A;  2W45 A;  3LIE A;  3EG9 A;  2WVN A;  1HVV A;  3HUS B;  1CGO A;  5L0G A;  2FXM A;  2CGE A;  2OU6 A;  1T2K D;  2HS5 A;  1KC8 Q;  3A11 A;  3M0A A;  2KK7 A;  3JCU E;  2EPK X;  2LD6 A;  4PJ0 E;  1KMI Z;  3OAK A;  4UB6 H;  2RD9 A;  3BEH A;  3L36 A;  5KTB A;  3MP7 B;  4EBB A;  5CCH C;  3TQO A;  3Q7L A;  2J0W A;  4EBK A;  1BE3 J;  1PD0 A;  3CXH E;  1X9V A;  2XLE A;  4GKG A;  1V4A A;  1XZQ A;  2VH3 A;  3CCQ P;  2V7Q H;  3EZI A;  5AVZ B;  1ZXG A;  1MMN A;  2P58 A;  4H13 D;  2NPU A;  2AEF A;  3RK2 C;  5AW6 B;  1NTZ J;  5E33 A;  3RYL A;  3VMZ A;  3A3Y B;  2LFF A;  1L0L G;  1FZE A;  4E0H A;  1TR2 A;  2BL2 A;  4KNW A;  3FXH A;  2AWC A;  2H7B A;  2POH A;  2AVK A;  1LTJ B;  2JX0 A;  2XLV A;  4G7Z F;  3WAQ A;  2Y3H A;  2WPR A;  2E42 A;  4DBR A;  1GDT A;  2ZD9 A;  2WL8 A;  2MJZ A;  2FYU G;  1SQB K;  2V26 A;  3C62 A;  4Y28 J;  1AUE A;  3I5Q A;  4AYC A;  1LT9 A;  1LS4 A;  1HMO A;  1R5L A;  2KI7 B;  1BR1 A;  4JUR I;  1SQP D;  1A02 J;  2HV7 A;  3FXE A;  2R25 A;  2WSS H;  1OKK A;  1L3P A;  3LJB A;  3F5H A;  3JSE O;  3IR9 A;  3CAX A;  3U3B A;  1LP1 A;  3DAF A;  3EPV A;  3G71 P;  1NBB A;  2PX0 A;  1L0L K;  1D7M A;  5AW1 B;  3TJ5 A;  4XPX A;  1Q2N A;  2JR8 A;  2MYS A;  4FX5 A;  1CZQ A;  2G8Y A;  3IPM O;  4L75 A;  4FES A;  2E75 D;  3SEO A;  1N1C A;  3OA7 A;  1A7V A;  1SFC C;  1GMJ A;  1PL5 A;  1BSH A;  5KAF H;  2LP4 A;  3O10 A;  4I1M A;  256B A;  1NTM D;  3CCL P;  1T3J A;  3PH0 A;  3KYQ A;  3S9O A;  3U2M A;  3GLM A;  1QGK B;  4GOE A;  1T6A A;  2I8D A;  3KMI A;  2IYL D;  3B4S A;  4GYT A;  5KLI C;  1ZW3 A;  3UMH A;  1P84 E;  2N9B A;  1LTJ A;  2PP4 A;  1OW7 A;  2A68 F;  3MYI A;  1KYO E;  2E76 C;  1V55 C;  1T5O A;  3IQ5 A;  3X2Q C;  4CDA A;  2FYU E;  1R5I D;  1VQ6 P;  2KSF A;  2JD3 A;  1PP9 E;  4DCK A;  4JEA A;  4PFP A;  2OJQ A;  2E74 B;  1K9M Q;  1RQV A;  2ZJS E;  3L71 E;  3RKO F;  4Y99 B;  1KQF B;  2X0C A;  2V7Q J;  4PD4 D;  4AL0 A;  2XXA A;  3OJA B;  2NUP B;  2FBW C;  2BC5 A;  3GM1 A;  5APU A;  2Z4E A;  4N6C A;  2OQQ A;  4W8P A;  4U3F G;  1ZHT A;  5KLV J;  3CPW O;  2GUV A;  3BRT B;  4U9D A;  3H1J E;  4BJ5 C;  2IBZ E;  2QJP C;  4N06 A;  2ZXW C;  4K1O A;  1UIX A;  1OX3 A;  1LTI C;  1S1C X;  1LTT C;  1HTL C;  1T6U A;  3L71 D;  2KQ9 A;  2CK3 H;  4PV1 B;  4MVM A;  1HY5 A;  1Q86 Q;  5JSL A;  4OH8 B;  2WWW A;  3H1H D;  1SQP G;  2YLD A;  3AE8 C;  1IFM A;  5A6A A;  1M8O B;  3H1I J;  1WAS A;  3WU2 H;  2O01 J;  1P84 D;  1CI6 A;  2K9J A;  4H13 C;  1MMA A;  1BDJ B;  1L4A B;  3MTU E;  3G6E P;  4JQ0 D;  2QJK B;  4Z1M H;  3KXD A;  1EI7 A;  5B66 E;  4YL1 A;  1AQ5 A;  1JO5 A;  5BQG A;  5KYY B;  2LQG A;  1OCZ C;  3GEE A;  3E70 C;  1KIL D;  3E9V A;  3S90 A;  4YPC A;  2EIJ C;  4YTP C;  1CW5 A;  2XL8 A;  4XLN F;  1URQ D;  1NZE A;  3M91 A;  4D6T G;  3OEO A;  3IF4 A;  3T4R A;  3H1H J;  2Q7R A;  4WGZ A;  5HV9 A;  3Q2Y A;  5APX A;  1W2E A;  4MS2 A;  2E87 A;  4H0L D;  3AEF C;  3H1I D;  4NTA A;  3M15 A;  3H6P A;  3U1A A;  1O87 A;  1FAV A;  2IX7 C;  3QWO C;  3U5S A;  1SS1 A;  4K7B A;  1BGY D;  5DJU B;  1S5L E;  2D5R B;  3K1I A;  1NYH A;  1XWJ A;  1NTK D;  3ECS A;  2R7R A;  2NUP A;  3CWB J;  4E0I A;  3O6Q B;  1DEB A;  2XLM A;  3L75 D;  3MUD C;  3NDB B;  4PK4 A;  2LCH A;  4Z9I A;  3H25 A;  3L75 J;  4YK5 A;  1KB9 E;  4IB4 A;  2J7P D;  1SQQ G;  4AL1 A;  2H8A A;  5BQI A;  4BJ6 C;  4CX9 A;  1N7S A;  2ZVN B;  1GK4 A;  3AGT A;  4LLE A;  4ZKP A;  3V4W A;  5AC5 A;  2Z15 A;  4M3L A;  1RF1 C;  2Q3E A;  4RJT A;  4C7O B;  5T3W A;  2OTJ P;  3HE5 A;  5EHH A;  4PV1 C;  3DKA A;  3V2R A;  1DD4 A;  4P9F A;  1PIX A;  1J8Y F;  1NOH A;  2V3C C;  1DOW A;  1KIL A;  3NFQ A;  2H89 C;  1MZ9 A;  1OKK D;  5A6K A;  4K3A A;  4OIN F;  2H7H A;  1SZI A;  2UUI A;  3ABK C;  3A2A A;  5KYN A;  3TK1 A;  1RJ9 B;  2W4B A;  2YXR B;  1OCC C;  1JMW A;  1HWT C;  1QPU A;  2DYS C;  2L6H A;  3DM5 A;  3N0T A;  1IO4 A;  1Z3I X;  1VL2 A;  1YTZ I;  1HW1 A;  5E3C A;  3C8G B;  1NU7 D;  3FHD A;  2Q9B A;  2J9U A;  3DD7 A;  1L4A C;  2YKZ A;  3SWK A;  3VP8 A;  1OCO C;  1SQQ J;  1KTM A;  1N7L A;  4EI2 A;  2QY9 A;  2ASR A;  4JW1 A;  1WGW A;  4QI2 A;  5KJ7 C;  2YO3 A;  3SSU A;  3JZ0 A;  1NAF A;  3WMM 0;  2Q00 A;  2CPB A;  2P7V A;  3GWN A;  1NTM G;  1LT1 A;  4CDY A;  3AED C;  4IL6 E;  3RL0 D;  3V5B A;  3U9J A;  4CS9 A;  2XU6 A;  1AVO A;  2W8Z A;  4NY3 A;  3CME P;  1N86 A;  2JO1 A;  3AEE C;  3U8V A;  5EK0 A;  4GT1 A;  3RK3 C;  3K5B A;  3S1K A;  3AEG C;  1I5N A;  2CCY A;  3IFM A;  2JKV A;  3H65 A;  4XPW A;  4PD4 H;  1JY2 O;  1YZC A;  1LTG C;  2VC9 A;  3LEO A;  1LE2 A;  2LKM A;  3ABV C;  3SYN A;  2IBZ D;  1WT6 A;  3ZDM A;  4R32 A;  3E1I A;  2KJG A;  3CXH I;  4A7P A;  1DOV A;  1LI5 A;  3A9C A;  4IAR A;  1Q7Y Q;  3T97 B;  2QSI A;  2YXQ B;  2A6E F;  4CS8 C;  1BGY E;  2RMZ A;  2C0W A;  1KYO H;  2CNW A;  4XTK A;  5F5F A;  1JMB A;  1LT9 B;  3JCU Q;  3ZQV A;  1JUN A;  1SQB J;  2PBE A;  3UMI A;  3NMD A;  3MLG A;  2P1J A;  1O5H A;  4C3D A;  3CL3 D;  4IOI H;  4Q5S F;  3EZH A;  2WSE H;  4WAB A;  4RO0 A;  4YXW H;  1BR2 A;  1Q90 D;  4U5G A;  1BE3 D;  3RH3 A;  2R05 A;  1QX8 A;  1TQG A;  4JRZ A;  4DVZ A;  1SQV J;  3CCE P;  2J45 A;  1M90 Q;  1HE1 A;  1RE4 C;  1RE3 C;  2EPM X;  2ZPA A;  4BPM A;  4I7Z B;  4BJT A;  3US6 A;  2CDQ A;  3L74 D;  2UWJ E;  1Z56 A;  1J1E C;  2JWA A;  2XL4 A;  3K66 A;  3L8J A;  2KS1 A;  3A0H E;  3SWF A;  1QVG O;  3L4F A;  1M1J C;  2SPZ A;  1IZN B;  1L0N E;  1YYJ A;  3UGP A;  1SQP K;  1GL2 C;  2IBF A;  4N78 D;  1SQV D;  1QLE D;  3AQC A;  3C8V A;  4WY4 C;  3JSV C;  3M9B A;  1Q0G A;  4EBJ A;  5TJH A;  1R4T A;  3C9I A;  4O9B A;  3H1L J;  3O55 A;  3VYW A;  5AVX B;  2W90 A;  2GDC A;  3V2N A;  4IFF A;  3I4U A;  4G7O F;  2A69 F;  1Y4C A;  1S7Z A;  1M7L A;  3BAS A;  2K1A A;  4A2N B;  3LAY A;  2BCC J;  3CX5 I;  2XS8 A;  2ZXE B;  2W6A A;  2R44 A;  5B66 H;  1SQV K;  5L0J A;  5AVW B;  1BR4 A;  1G1I A;  4DRJ B;  3QVZ A;  1FDI A;  1ORY A;  3TGU G;  5L0F A;  2O3J A;  4H44 C;  1JPJ A;  2YNY A;  4JVS A;  2PAJ A;  1FZC A;  2K88 A;  3CCU P;  5E3A A;  4WWI A;  1S9K E;  3B29 A;  1M2O A;  1JCC A;  3RL0 B;  1AEP A;  1Z7Q c;  1HGV A;  5JUA A;  4JIO A;  1K04 A;  3T9O A;  1VB5 A;  2O01 H;  2KOG A;  3QMK A;  1VQ7 P;  3CLQ A;  3HD7 B;  4XQ1 A;  4DZO A;  1SF8 A;  2OYH A;  3E1R A;  3AE4 C;  2AXC A;  3G3Z A;  5AW0 B;  3VP9 A;  3HUS C;  1BDD A;  4NPD A;  4JYB A;  4UB8 H;  1FOS E;  3NKE A;  2FFD A;  4GOD A;  3GEH A;  1KIL C;  2FYU K;  2KS1 B;  5JRA A;  4BXL A;  2B88 A;  1DX7 A;  4RDA A;  3NYL A;  4IAO A;  3BVH A;  1NVO A;  1VQ4 P;  3MGN A;  2YHS A;  2B0H A;  4U5H A;  3P7K A;  3CCJ P;  3K1H A;  3C8G A;  3AE5 C;  5F28 E;  1V74 B;  2PP6 A;  3OA1 A;  1IFI A;  1M56 C;  1B68 A;  5KLI B;  2GA1 A;  2HLO A;  4ASV A;  2D4U A;  3LID A;  3H32 B;  3RBZ A;  1SQB E;  2XDJ A;  3EGD B;  1RKC A;  2KGO A;  2L6F A;  4MW3 A;  3ATP A;  4JTC B;  3KYI A;  3BRV B;  3SXY A;  3MD0 A;  1H9T A;  1G4U S;  5KJ7 A;  1UFB A;  1JTH B;  5DS5 A;  3B0U X; 
#chains in the Genus database with same CATH homology
 2ZT9 D;  3AJM A;  3FGA D;  5KKZ C;  2G8Y A;  4IL6 X;  1KTM A;  4XFJ A;  2E75 D;  1EXJ A;  2JPU A;  1K40 A;  1MKM A;  1ZME C;  3AE7 C;  4R4L A;  4YTP C;  2LK4 A;  3JZ0 A;  1GMJ A;  4U7J A;  1PL5 A;  2Q00 A;  4PV1 D;  3Q3D A;  3O10 A;  2BEQ D;  3D70 A;  1R8E A;  3U0C A;  3AED C;  3U3F A;  1Y9B A;  3Q2Y A;  2JO1 A;  2QIW A;  3GMA A;  2YWA A;  3AEE C;  2K9Y A;  3RQF A;  4XEK A;  4H44 D;  3S9O A;  1FDI A;  3AEF C;  1IK7 A;  4H0L D;  1NGM B;  3C18 A;  3GLM A;  1ZZP A;  2BEZ F;  4H44 C;  2E74 C;  4H0L C;  1KOR A;  2E76 B;  3AEG C;  1WMK A;  3AE9 C;  3Q5R A;  5KLI C;  1KMI Z;  2E74 D;  3GF7 A;  3JYY A;  1NYH A;  2FYN C;  1OW7 A;  1VF5 D;  3SFE C;  4H0L B;  1HF9 A;  4GDO A;  2E76 C;  2WSE J;  2QJY C;  3L8I A;  1YQ3 C;  2D2C D;  4RKU J;  1KQG B;  3ABV C;  1KIL E;  2E76 D;  4KT0 J;  3RQE A;  4R32 A;  1OW8 A;  1PV3 A;  4OGQ B;  1O3U A;  4EBK A;  4OGQ D;  3K7D A;  2QJK C;  4H44 B;  2QSI A;  3T97 B;  2E74 B;  2L6G A;  2D2C B;  1K04 A;  1RQV A;  2ZT9 C;  4OGQ C;  1K05 A;  2WSC J;  1V4A A;  1RQU A;  1TU3 F;  3C8G D;  4H13 B;  3SFD C;  2E75 B;  3H25 A;  3RQG A;  3TUL A;  3AE6 C;  1YQ4 C;  1OMI A;  3IN6 A;  2V7Q J;  1DD3 A;  4H13 D;  1KQF B;  1ZP0 C;  3AE4 C;  4NQF A;  1WOL A;  2FBW C;  1ZOY C;  3GM1 A;  2YMK A;  3AEC C;  2PBE A;  1JB0 J;  2OQQ A;  1VF5 B;  1U57 A;  1ZRT E;  4XEF A;  2WPV B;  2JX0 A;  1OW6 A;  2QJP C;  2E75 C;  4XEV A;  2NZ2 A;  2WSF J;  1Q90 D;  3Q5P A;  1EXI A;  4YXD C;  1UIX A;  2FXP A;  3GF3 A;  3O6Q A;  1S1C X;  3AE1 C;  4PV1 C;  1FDO A;  4TT3 H;  3B71 A;  2J5U A;  3IAO A;  1AJY A;  1DD4 A;  1JOG A;  1PIX A;  2KK1 A;  3RL0 g;  3BRJ A;  1QVX A;  4I7Z B;  3GM3 A;  3LW5 J;  4Y28 J;  4PV1 B;  1KNY A;  2D2C C;  2ZT9 B;  3AE5 C;  2HSB A;  3EWK A;  3C8G A;  5F28 E;  2H89 C;  3R4Y A;  3L8J A;  1S5L X;  1WTY A;  4R4M A;  3RK3 E;  4I7Z C;  3GM2 A;  3AE8 C;  3AEB C;  2G3A A;  2H88 C;  2JP3 A;  5L8R J;  3D6Z A;  3Q1M A;  1WWP A;  1DIP A;  2YIU C;  2L6F A;  2O01 J;  5M1B A;  1VF5 C;  3AEA C;  3G9R A;  4H13 C;  2P10 A;  2L6H A;  2MKV A;  3Q5S A;  3AE3 C;  2IDB A;  1VL2 A;  1HJ0 A;  3D71 A;  3C8V A;  3AE2 C;  1UFB A;  3C8G B;  4EBJ A;  4Z1M H;  2WQY C;  3MFN A;  3D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...