1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOHEMERYTHRIN
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen transport
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
2MHRA 1A7DA 2HMZA 1HMOA 1A7EA 4XPXA 3WHNA 1HMDA 2AVKA 3AGUA 4XPYA 4XPWA 3WAQA 4XQ1A 1I4ZA 2AWCA 1I4YA 2AWYA 3AGTA 2HMQA
chains in the Genus database with same CATH superfamily
5JP7A 2ASRA 5L0JA 4GQHA 4IARA 3ZG1A 4U5BE 3RYLA 4XPXA 4EUKB 1AEPA 3T6GB 4BJ6A 3FMSA 5JT4A 5B1AC 2W4MA 2YWAA 4XPWA 1U89A 3ECSA 1QLEC 3HNLA 1M57C 5E2QA 3S29A 3TOMA 2IXPA 4D4NA 2J9VA 4DOZA 4O6MA 3AG2C 4Q7CA 3Q6NA 4U5GA 1T9KA 2J0WA 3U8VA 3LUTB 2KGOA 2JD3A 4Z9IA 4CDYA 3OEOA 5AC4A 1L3PA 4CS7A 5FZTA 4AL0A 2OU6A 5JSLA 2DB4A 1ZW2A 3DXJF 3U8PA 3NKEA 4P9TA 1VOMA 1UG7A 3NMJA 1T6QA 3RFYA 2OOCA 4CJOA 5EGYA 3MFNA 3FOPA 1SR2A 5CIVA 2WL8A 4J7TA 4UDVA 3EFOA 1V74B 4LERA 1E83A 4WGZA 4MTOA 1JRAA 3C63A 5L0FA 3U5SA 3G50A 3I5QA 4HFFB 2XLVA 3ASOC 2YL1A 3N2ZB 4FWVA 1APCA 1Q0KA 4YK5A 3JZ0A 1MMAA 2KW3C 4JVSA 4LACB 3DZAA 2NPUA 1Q0DA 2A6EF 1RKEA 3TK0A 1Z6AA 3RW0A 4YT2A 5L0IA 2IBFA 4E17A 4OD5A 1SZIA 1YVIA 1M56C 2EPLX 4N06A 4CJGA 4ER9A 2OG2A 2ETSA 1RJ9A 1TWGA 3NRHA 4U5HA 4U5CE 3SXYA 4YT4A 4H54A 4CDAA 3K1HA 1C17M 5CI8A 1QKRA 3U3FA 1LPEA 3O55A 5COGA 4DVZA 2J9BA 2YL7A 2OEVA 3NG1A 5T1DB 5JUAA 4CSAA 2L9JA 1OXBA 1FFTC 1A7EA 1E86A 4EBKA 3LS1A 1RKEB 3B0VC 2Q9BA 4NQFA 3ABKC 3RQGA 2R7VA 4YN0B 2W4BA 4I3MA 3V5YA 3X1OA 1KU2A 1TWAA 3G4ZA 2QTVA 2AU5A 2IOQA 1RJ9B 2LIGA 1KTMA 2YLIA 3S84A 1S05A 4P6IC 1Y6DA 1D0XA 2WZFA 3UMIA 4CX9A 1OKKA 4U9EA 3DKAA 2V3CC 1WTYA 5L0GA 3PHF2 1Z7Qc 3N0TA 3S90A 3C8ZA 3KKBA 4MVOA 2F22A 3C7JA 4IWBA 3C62A 3U9JA 4DBQA 3JYYA 2R7RA 1WWPA 3AGTA 3DAFA 3T4RA 1BBHA 3CZ6A 3K1IC 4JURI 3R2PA 1O3UA 4FX5A 3G4XA 4KC9A 4MVUA 2KK1A 2Q3TA 3SXZA 4LLEA 3S27A 3EGDA 4BG0A 1AUEA 3FVYA 2X0CA 3RVZA 1GQAA 3UR3C 4D4XA 3QMKA 4DBRA 2IXNA 1Z63A 3IEEA 3ASNC 3WG7C 4MVZA 2PX0A 4XWJA 5A6KA 1NU7D 4XEKA 1ORJA 4MW8A 3KPHA 2HJMA 1JPJA 2EIMC 3L8JA 1LS4A 3MX3A 2DGJA 3NYMA 3IQCA 2LSEA 3GM3A 3LJBA 4XEFA 2RD9A 4PFOA 2ZXPA 3JRMO 4KBLA 1ST6A 4GEHA 1NSGB 2J9WA 4OIPF 2XM0A 5L0DA 4YT5A 2R7SA 3JCUQ 1R5ID 3F46A 3LESA 1C02A 3C18A 5IY5C 3OWTA 1ZW3A 3EGDB 1XZPA 1D1AA 1HW2A 1TQGA 1OCRC 4O6NA 5A6AA 5HV9A 1RKCA 1KNYA 2KSFA 2PP4A 2ZXOA 2G62A 2HJ3A 1PCXA 2TMVP 4PJMA 3FDQA 2HMZA 1GS9A 1NFNA 4G0HA 2XL4A 4JIOA 4OINF 5DS4A 1ZHYA 5E3CA 1GGQA 3L0IA 3M4BA 5L3QA 2O9XA 1OW7A 4BJ1A 2XM4A 3T6BA 1ZHTA 1A0BA 2EPOA 2LQGA 2QNLA 2VASA 3W4YA 1NFOA 1ZU5A 3DM9B 3GEHA 4FESA 5AGFA 3EQLF 3PDMP 3T9OA 3B0UX 4KNWA 4XLPF 4KI2A 3AOUA 2NUPA 3U2LA 4HFKB 3ZTMA 4JW1A 4U5EE 3V7OA 2GDCA 2H7BA 4IGGA 1N1CA 2E87A 3DMDA 1G8XA 1Q0MA 2JX0A 2ZD9A 1LKXA 1XWJA 3AJMA 3AG4C 1LIHA 3SXKA 3W8IA 5KYYA 2GA0A 4DRJB 1WATA 1RCPA 4CS9C 3U3BA 2L6HA 2FAPB 4IAOA 3J06A 2HV6A 4XLNF 4XPYA 2J7PD 1YYJA 2LP4A 3K6BA 5HSWA 4QI0A 5JS5A 1LI5A 2NUPB 4Q4ZF 3CSKA 2R7XA 3SEOA 3ABMC 1D0YA 4A4AA 3IQ5A 1TKNA 2G3VA 1CPRA 3V5ZA 4K1OA 1VYIA 5KYXB 3TD7A 1CPQA 1QPUA 3N24A 1TFKB 2P7VA 4JEAA 5COFA 2WVOA 2QY9A 4A2NB 5BUOA 2VH3A 3HLZA 2OQMA 2R05A 4FAPB 4QDLA 4NC3A 2AWYA 3K66A 1IW7F 4JCHA 3VAYA 2H7VC 2EPNA 2KC3A 2GAQA 3GODA 4EWCA 2CNWD 2HMQA 3DE9A 3L1MA 4F4BA 4BJ5A 3RF3A 3UNGC 4BJ6C 4PJNA 1LS1A 1OCCC 1YYXA 3FXHA 3QVZA 3EHMA 2LFDA 3EZHA 2Y39A 3GEIA 3JRTA 3W2VA 2L6GA 3HNIA 5KYNA 1YARO 3C8GA 1JAFA 3K7DA 1JOGA 3L8IA 2YLDA 4L6RA 5K0IA 5E33A 1D1BA 4NCQA 1SF8A 5JVEA 5D92A 2GWWA 4MNDA 3K33A 2OCCC 5F5FA 4JJFA 1VYKA 2FFHA 2PF4E 2PX3A 4YWQA 5E3AA 1WN0A 3BEHA 4X0RA 3EFOB 3T6JA 5A69A 2P6VA 3MYFA 4YL3A 4C7OA 1LE4A 2XLWA 1NU9C 2VCCA 1G5ZA 1FFHA 2CDQA 4BJTA 2WB7A 1M2VA 3JYHA 4YT8A 1FMVA 4CS8C 3NMKA 4K7BA 3TJ5A 2Z15A 4MW3A 3Q6MA 1MNEA 3EH2A 2HS5A 1O5HA 5BQGA 1LVKA 1M2OA 2H7OA 3C8GB 2VC9A 3LNMB 4NTFA 3DJNB 2YL0A 4U5DE 1UFBA 4AL1A 3RKOF 3A9CA 4HE8D 2HKVA 1M6TA 1OW6A 2J46A 2J0XA 1VLSA 4RDAA 1VTMP 3ABLC 1T6IA 1JPNA 1MMGA 2Q00A 2JPUA 2V26A 4C7OB 4PJJA 2NUTA 1CGOA 3EJNA 3HTKC 3V5XA 1M2VB 2DI3A 3SXMA 4E0IA 5B3SC 1T6UA 1G4WR 3Q7GA 4JRZA 1FNTc 4AE4A 4JKVA 2J7PA 3EZIA 1U0BB 2X51A 3FHDA 2A0UA 1OXKA 2DYSC 3UGPA 4JEBA 2R02A 1J8YF 1H9GA 2I15A 4JCZA 1TWCA 3UMKA 4CSAC 2YRFA 1CGME 3K1IA 2MHRA 1VLTA 1ZVZA 3ZTZA 1RMVA 2UUHA 2C03A 1WASA 2VCAA 4OIOF 2VCBA 3M79A 5D91A 2NUTB 5KYYB 1U6HA 3KMIA 1LE2A 2R7WA 3ZQVA 3SNHA 1HY5A 2LCHA 4J7YA 4AE4B 2XLHA 4CDVA 2HSQA 1NLXA 3US6A 1Y4CA 1J8MF 3R7CA 1G4US 5F5HA 1YZAA 3LEVA 2ZPAA 1OR2A 2XL6A 5B1BC 1SMYF 5DLJA 4ULWA 4YL0A 2P0NA 3VRCA 4C3EA 4E7SA 4BEMJ 2A68F 4H4KC 4IAQA 1YJGA 2P61A 3ZIBA 4C3BA 4EBBA 2W9YA 3BRJA 5COMA 1RXQA 1TFOB 4NY3A 1WOLA 3LS0A 4U5FE 4I44A 5KYUA 4JJGA 1BR1A 2AP3A 3S0XA 3VF0A 4W8KA 2CW0F 2B0HA 3MLGA 4RBNA 1OR3A 1OQCA 3WHNA 1V55C 2WZLA 1Q0FA 3AGUA 3RIPA 1H7IA 3W8HA 3EG9A 2J45A 4AX2A 1EQ1A 4PFPA 3NDBB 2ZXWC 3ZC4A 1K05A 1VK5A 2OEXA 2PFDA 2YKZA 3HNKA 2CYDA 2G3KA 1ORSC 2HZ8A 3QW1A 5KYUB 2IXOA 3PCVA 1QQ3A 1E85A 4XTKA 4E18A 1XZQA 1ZYRF 3GM2A 1FR0A 2YQYA 5JRAA 2PNOA 2YL3A 4WGYA 2R03A 3FAJA 1D0ZA 1H9TA 4G78A 3GANA 4EHPA 4Q5SF 3M15A 1K40A 3EG9B 5DQZA 1H6GA 1YAUO 2KNHA 2WZGA 1EA8A 2XLOA 3FOOA 3CQZA 4JE9A 3DAGA 3EGXA 5T3TA 3M1CB 3QVYA 3QW0A 4MVMA 3RH3A 5A6JA 2GFHA 4BEJA 4PR9A 4DXWA 3F47A 1OCZC 2AVKA 3O10A 3LEOA 1I5NA 1ZZPA 3KYIA 4I1MA 2Q7RA 5CI9A 5A6BD 2MYSA 1A41A 4GYTA 1W2WA 2A6HF 2WVQA 2Y3DA 3DD7A 4J30B 3TULA 2M4EA 3JT1A 1T01A 1S7ZA 2Q9AA 4BPMA 3MYIA 1DOWA 1V4AA 1TR2A 2XS1A 2EPMX 4KNVA 1ZHZA 2IM8A 2L7AA 3TOLA 2XLMA 2A0BA 3O6XA 3GEEA 1K04A 1GM5A 2Y3BA 3B0PA 2YLGA 3SP1A 3DI5A 2EINC 3SZRA 4ANJA 1LM3B 1YA7O 1BZ4A 1Q0GA 3H2UA 4ONSA 1OKKD 3L34A 4DRIB 2XXAA 1A7VA 3POVA 2A69F 5B3IA 2OKUA 5JLIA 2NG1A 3EPVA 4MTGA 1JR8A 3O39A 3GWLA 2D5RB 4WABA 3KYJA 4WJ0A 3WAQA 2LK4A 4XEVA 4G7HF 1YZCA 1NBBA 4MVSA 1I4ZA 2D4UA 1Z23A 1MNDA 1EI7A 5A6BA 2DYRC 3KH2A 4JTCB 3TJ6A 4I1OB 3ITFA 4DJ9A 2A1DD 3PMRA 4JTAB 5DS5A 2ICWG 1FAPB 2XXAB 1LI7A 5AC5A 1BR2A 1HW1A 256BA 3JSZA 3WODF 3DE8A 1CGNA 1D1CA 3DWWA 4BJ5C 5T3WA 1HE9A 4IJJA 1R4TA 4CS8A 3EHNA 4YL1A 4EIYA 2J9UA 4MVQA 1AVOB 3UMHA 3VM6A 3GORA 1HMOA 3UGOA 3M4CA 3MBGA 2IYLD 5KYWA 1BR4A 4DRHB 5BQHA 4OIQF 4OD4A 4O6YA 1SYQA 3IHUA 2CCYA 1NG1A 1OW8A 1YLMA 1PD1A 3HJCA 4N6HA 2H8AA 2PBEA 2YZSA 3S28A 3TQOA 1QZXA 4LDKA 3JSEO 5BQIA 2R7UA 2I8BA 4O79A 4YJWA 3H2VA 2J8WA 4IRUA 4C3DA 3LLKA 2YEVA 1VB5A 3AQCA 5DS6A 4B6IA 1I4YA 2R25A 2FGYA 3B9QA 2LFFA 5KYWB 2NSGA 4EKWA 1F1MA 4G7OF 4G7ZF 2P1AA 1WGWA 4MVRA 2CGEA 3ZQYA 3RQFA 1PD0A 2R7QA 1YA9A 3LAYA 4OIRF 4HEAJ 1NZEA 1OCOC 1Z3IX 4JC7A 4R32A 4JTDB 5L0CA 2Q4FA 3B29A 3Q7LA 4ULVA 2Y69C 3HKKA 4NTAA 5DVWA 2YHSA 3E70C 3HNJA 4LDRA 4MS2A 2CNWA 2NSFA 1DOVA 2HSBA 2C04A 1PV3A 2KYHA 2XLDA 2XSEA 3AQBA 3QTHA 4W8PA 5DQTA 3NKDA 1L7CA 3OA1A 1YDIA 3LNRA 3NMIA 5EK0A 2EIJC 2AWCA 4PK4A 2RSEB 4MQ9F 3ZDLA 4N4WA 2MWQA 4E7ZA 4DVYP 1VMAA 5TJ5E 3U2MA 4ZLDA 3X2QC 3IQTA 3NYJA 3DM5A 3IPMO 4JZAA 1FMWA 2Q9CA 1QSPA 3GWNA 3JTLO 3E9VA 3ZWIA 1IZMA 2WVNA 2Y3HA 4J32B 1E84A 1HMDA 3IQ6A 2B0JA 2EIKC 3SYNA 4NTBA 3I4UA 4N6CA 2BE5F 4IB4A 5L0HA 4RD9A 2XRHA 1MMNA 3LLIA 4EBJA 4XQ1A 3GM1A 3QZCA 1QVXA 2M64A 4U9DA 2OJED 3AG3C 3KL4A 4K0DA 1ZHXA 3DJUB 1ZHWA 3RQEA 2W45A 2XLEA 3RVYA 5L3VA 2BC5A 1BDJB 3I5PA 2R7OA 3NYLA 4E0HA 3AG1C 1C03A 1E2XA 2KQ9A 4O7GA 3CAXA 2VB6A 4CIPA 2OJQA 4PACA 2L6FA 3W2WA 4CIHA 5EHHA 2HUJA 2R7TA 1ORYA 2QE9A 2EPKX 2KJGA 4LLCA 3ZVRA 1MMDA 2IXMA 3C8GD 1MQVA 2XS8A 4M63A 2ZXRA 1TWHA 2BL2A 3U0CA 1A7DA 4QI2A 3S9OA 4Z9HA 3FAPB 3VYWA 4ZLCA 1FTSA 3ATPA 1Z5ZA 1ZU4A 4CS9A 3EH1A 4P9FA 1T5OA 2Y3GA 3A11A 2EILC 2L81A 4LDQA 4PJLA 5FCLA 1V54C 2LD6A 3B71A 3CEXA 3U9MA 3ZSUA 4CBEA 2HFIA 4AK9A 2HV7A 4MTFA 1O87A 2YVKA 2QUPA 1HE1A 1B68A 4Z9JA 3EGXB 5KYXA 2UUIA 5GPGB 1JMWA 5F28E 3H65A 2XL8A 2QLAA 1EKYA 2R9RB
chains in the Genus database with same CATH topology
2MHRA 1A7DA 2HMZA 1HMOA 1A7EA 4XPXA 3WHNA 1HMDA 2AVKA 3AGUA 4XPYA 4XPWA 3WAQA 4XQ1A 1I4ZA 2AWCA 1I4YA 2AWYA 3AGTA 2HMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHR A;  1A7D A;  2HMZ A;  1HMO A;  1A7E A;  4XPX A;  3WHN A;  1HMD A;  2AVK A;  3AGU A;  4XPY A;  4XPW A;  3WAQ A;  4XQ1 A;  1I4Z A;  2AWC A;  1I4Y A;  2AWY A;  3AGT A;  2HMQ A; 
#chains in the Genus database with same CATH topology
 5JP7 A;  2ASR A;  5L0J A;  4GQH A;  4IAR A;  3ZG1 A;  4U5B E;  3RYL A;  4XPX A;  4EUK B;  1AEP A;  3T6G B;  4BJ6 A;  3FMS A;  5JT4 A;  5B1A C;  2W4M A;  2YWA A;  4XPW A;  1U89 A;  3ECS A;  1QLE C;  3HNL A;  1M57 C;  5E2Q A;  3S29 A;  3TOM A;  2IXP A;  4D4N A;  2J9V A;  4DOZ A;  4O6M A;  3AG2 C;  4Q7C A;  3Q6N A;  4U5G A;  1T9K A;  2J0W A;  3U8V A;  3LUT B;  2KGO A;  2JD3 A;  4Z9I A;  4CDY A;  3OEO A;  5AC4 A;  1L3P A;  4CS7 A;  5FZT A;  4AL0 A;  2OU6 A;  5JSL A;  2DB4 A;  1ZW2 A;  3DXJ F;  3U8P A;  3NKE A;  4P9T A;  1VOM A;  1UG7 A;  3NMJ A;  1T6Q A;  3RFY A;  2OOC A;  4CJO A;  5EGY A;  3MFN A;  3FOP A;  1SR2 A;  5CIV A;  2WL8 A;  4J7T A;  4UDV A;  3EFO A;  1V74 B;  4LER A;  1E83 A;  4WGZ A;  4MTO A;  1JRA A;  3C63 A;  5L0F A;  3U5S A;  3G50 A;  3I5Q A;  4HFF B;  2XLV A;  3ASO C;  2YL1 A;  3N2Z B;  4FWV A;  1APC A;  1Q0K A;  4YK5 A;  3JZ0 A;  1MMA A;  2KW3 C;  4JVS A;  4LAC B;  3DZA A;  2NPU A;  1Q0D A;  2A6E F;  1RKE A;  3TK0 A;  1Z6A A;  3RW0 A;  4YT2 A;  5L0I A;  2IBF A;  4E17 A;  4OD5 A;  1SZI A;  1YVI A;  1M56 C;  2EPL X;  4N06 A;  4CJG A;  4ER9 A;  2OG2 A;  2ETS A;  1RJ9 A;  1TWG A;  3NRH A;  4U5H A;  4U5C E;  3SXY A;  4YT4 A;  4H54 A;  4CDA A;  3K1H A;  1C17 M;  5CI8 A;  1QKR A;  3U3F A;  1LPE A;  3O55 A;  5COG A;  4DVZ A;  2J9B A;  2YL7 A;  2OEV A;  3NG1 A;  5T1D B;  5JUA A;  4CSA A;  2L9J A;  1OXB A;  1FFT C;  1A7E A;  1E86 A;  4EBK A;  3LS1 A;  1RKE B;  3B0V C;  2Q9B A;  4NQF A;  3ABK C;  3RQG A;  2R7V A;  4YN0 B;  2W4B A;  4I3M A;  3V5Y A;  3X1O A;  1KU2 A;  1TWA A;  3G4Z A;  2QTV A;  2AU5 A;  2IOQ A;  1RJ9 B;  2LIG A;  1KTM A;  2YLI A;  3S84 A;  1S05 A;  4P6I C;  1Y6D A;  1D0X A;  2WZF A;  3UMI A;  4CX9 A;  1OKK A;  4U9E A;  3DKA A;  2V3C C;  1WTY A;  5L0G A;  3PHF 2;  1Z7Q c;  3N0T A;  3S90 A;  3C8Z A;  3KKB A;  4MVO A;  2F22 A;  3C7J A;  4IWB A;  3C62 A;  3U9J A;  4DBQ A;  3JYY A;  2R7R A;  1WWP A;  3AGT A;  3DAF A;  3T4R A;  1BBH A;  3CZ6 A;  3K1I C;  4JUR I;  3R2P A;  1O3U A;  4FX5 A;  3G4X A;  4KC9 A;  4MVU A;  2KK1 A;  2Q3T A;  3SXZ A;  4LLE A;  3S27 A;  3EGD A;  4BG0 A;  1AUE A;  3FVY A;  2X0C A;  3RVZ A;  1GQA A;  3UR3 C;  4D4X A;  3QMK A;  4DBR A;  2IXN A;  1Z63 A;  3IEE A;  3ASN C;  3WG7 C;  4MVZ A;  2PX0 A;  4XWJ A;  5A6K A;  1NU7 D;  4XEK A;  1ORJ A;  4MW8 A;  3KPH A;  2HJM A;  1JPJ A;  2EIM C;  3L8J A;  1LS4 A;  3MX3 A;  2DGJ A;  3NYM A;  3IQC A;  2LSE A;  3GM3 A;  3LJB A;  4XEF A;  2RD9 A;  4PFO A;  2ZXP A;  3JRM O;  4KBL A;  1ST6 A;  4GEH A;  1NSG B;  2J9W A;  4OIP F;  2XM0 A;  5L0D A;  4YT5 A;  2R7S A;  3JCU Q;  1R5I D;  3F46 A;  3LES A;  1C02 A;  3C18 A;  5IY5 C;  3OWT A;  1ZW3 A;  3EGD B;  1XZP A;  1D1A A;  1HW2 A;  1TQG A;  1OCR C;  4O6N A;  5A6A A;  5HV9 A;  1RKC A;  1KNY A;  2KSF A;  2PP4 A;  2ZXO A;  2G62 A;  2HJ3 A;  1PCX A;  2TMV P;  4PJM A;  3FDQ A;  2HMZ A;  1GS9 A;  1NFN A;  4G0H A;  2XL4 A;  4JIO A;  4OIN F;  5DS4 A;  1ZHY A;  5E3C A;  1GGQ A;  3L0I A;  3M4B A;  5L3Q A;  2O9X A;  1OW7 A;  4BJ1 A;  2XM4 A;  3T6B A;  1ZHT A;  1A0B A;  2EPO A;  2LQG A;  2QNL A;  2VAS A;  3W4Y A;  1NFO A;  1ZU5 A;  3DM9 B;  3GEH A;  4FES A;  5AGF A;  3EQL F;  3PDM P;  3T9O A;  3B0U X;  4KNW A;  4XLP F;  4KI2 A;  3AOU A;  2NUP A;  3U2L A;  4HFK B;  3ZTM A;  4JW1 A;  4U5E E;  3V7O A;  2GDC A;  2H7B A;  4IGG A;  1N1C A;  2E87 A;  3DMD A;  1G8X A;  1Q0M A;  2JX0 A;  2ZD9 A;  1LKX A;  1XWJ A;  3AJM A;  3AG4 C;  1LIH A;  3SXK A;  3W8I A;  5KYY A;  2GA0 A;  4DRJ B;  1WAT A;  1RCP A;  4CS9 C;  3U3B A;  2L6H A;  2FAP B;  4IAO A;  3J06 A;  2HV6 A;  4XLN F;  4XPY A;  2J7P D;  1YYJ A;  2LP4 A;  3K6B A;  5HSW A;  4QI0 A;  5JS5 A;  1LI5 A;  2NUP B;  4Q4Z F;  3CSK A;  2R7X A;  3SEO A;  3ABM C;  1D0Y A;  4A4A A;  3IQ5 A;  1TKN A;  2G3V A;  1CPR A;  3V5Z A;  4K1O A;  1VYI A;  5KYX B;  3TD7 A;  1CPQ A;  1QPU A;  3N24 A;  1TFK B;  2P7V A;  4JEA A;  5COF A;  2WVO A;  2QY9 A;  4A2N B;  5BUO A;  2VH3 A;  3HLZ A;  2OQM A;  2R05 A;  4FAP B;  4QDL A;  4NC3 A;  2AWY A;  3K66 A;  1IW7 F;  4JCH A;  3VAY A;  2H7V C;  2EPN A;  2KC3 A;  2GAQ A;  3GOD A;  4EWC A;  2CNW D;  2HMQ A;  3DE9 A;  3L1M A;  4F4B A;  4BJ5 A;  3RF3 A;  3UNG C;  4BJ6 C;  4PJN A;  1LS1 A;  1OCC C;  1YYX A;  3FXH A;  3QVZ A;  3EHM A;  2LFD A;  3EZH A;  2Y39 A;  3GEI A;  3JRT A;  3W2V A;  2L6G A;  3HNI A;  5KYN A;  1YAR O;  3C8G A;  1JAF A;  3K7D A;  1JOG A;  3L8I A;  2YLD A;  4L6R A;  5K0I A;  5E33 A;  1D1B A;  4NCQ A;  1SF8 A;  5JVE A;  5D92 A;  2GWW A;  4MND A;  3K33 A;  2OCC C;  5F5F A;  4JJF A;  1VYK A;  2FFH A;  2PF4 E;  2PX3 A;  4YWQ A;  5E3A A;  1WN0 A;  3BEH A;  4X0R A;  3EFO B;  3T6J A;  5A69 A;  2P6V A;  3MYF A;  4YL3 A;  4C7O A;  1LE4 A;  2XLW A;  1NU9 C;  2VCC A;  1G5Z A;  1FFH A;  2CDQ A;  4BJT A;  2WB7 A;  1M2V A;  3JYH A;  4YT8 A;  1FMV A;  4CS8 C;  3NMK A;  4K7B A;  3TJ5 A;  2Z15 A;  4MW3 A;  3Q6M A;  1MNE A;  3EH2 A;  2HS5 A;  1O5H A;  5BQG A;  1LVK A;  1M2O A;  2H7O A;  3C8G B;  2VC9 A;  3LNM B;  4NTF A;  3DJN B;  2YL0 A;  4U5D E;  1UFB A;  4AL1 A;  3RKO F;  3A9C A;  4HE8 D;  2HKV A;  1M6T A;  1OW6 A;  2J46 A;  2J0X A;  1VLS A;  4RDA A;  1VTM P;  3ABL C;  1T6I A;  1JPN A;  1MMG A;  2Q00 A;  2JPU A;  2V26 A;  4C7O B;  4PJJ A;  2NUT A;  1CGO A;  3EJN A;  3HTK C;  3V5X A;  1M2V B;  2DI3 A;  3SXM A;  4E0I A;  5B3S C;  1T6U A;  1G4W R;  3Q7G A;  4JRZ A;  1FNT c;  4AE4 A;  4JKV A;  2J7P A;  3EZI A;  1U0B B;  2X51 A;  3FHD A;  2A0U A;  1OXK A;  2DYS C;  3UGP A;  4JEB A;  2R02 A;  1J8Y F;  1H9G A;  2I15 A;  4JCZ A;  1TWC A;  3UMK A;  4CSA C;  2YRF A;  1CGM E;  3K1I A;  2MHR A;  1VLT A;  1ZVZ A;  3ZTZ A;  1RMV A;  2UUH A;  2C03 A;  1WAS A;  2VCA A;  4OIO F;  2VCB A;  3M79 A;  5D91 A;  2NUT B;  5KYY B;  1U6H A;  3KMI A;  1LE2 A;  2R7W A;  3ZQV A;  3SNH A;  1HY5 A;  2LCH A;  4J7Y A;  4AE4 B;  2XLH A;  4CDV A;  2HSQ A;  1NLX A;  3US6 A;  1Y4C A;  1J8M F;  3R7C A;  1G4U S;  5F5H A;  1YZA A;  3LEV A;  2ZPA A;  1OR2 A;  2XL6 A;  5B1B C;  1SMY F;  5DLJ A;  4ULW A;  4YL0 A;  2P0N A;  3VRC A;  4C3E A;  4E7S A;  4BEM J;  2A68 F;  4H4K C;  4IAQ A;  1YJG A;  2P61 A;  3ZIB A;  4C3B A;  4EBB A;  2W9Y A;  3BRJ A;  5COM A;  1RXQ A;  1TFO B;  4NY3 A;  1WOL A;  3LS0 A;  4U5F E;  4I44 A;  5KYU A;  4JJG A;  1BR1 A;  2AP3 A;  3S0X A;  3VF0 A;  4W8K A;  2CW0 F;  2B0H A;  3MLG A;  4RBN A;  1OR3 A;  1OQC A;  3WHN A;  1V55 C;  2WZL A;  1Q0F A;  3AGU A;  3RIP A;  1H7I A;  3W8H A;  3EG9 A;  2J45 A;  4AX2 A;  1EQ1 A;  4PFP A;  3NDB B;  2ZXW C;  3ZC4 A;  1K05 A;  1VK5 A;  2OEX A;  2PFD A;  2YKZ A;  3HNK A;  2CYD A;  2G3K A;  1ORS C;  2HZ8 A;  3QW1 A;  5KYU B;  2IXO A;  3PCV A;  1QQ3 A;  1E85 A;  4XTK A;  4E18 A;  1XZQ A;  1ZYR F;  3GM2 A;  1FR0 A;  2YQY A;  5JRA A;  2PNO A;  2YL3 A;  4WGY A;  2R03 A;  3FAJ A;  1D0Z A;  1H9T A;  4G78 A;  3GAN A;  4EHP A;  4Q5S F;  3M15 A;  1K40 A;  3EG9 B;  5DQZ A;  1H6G A;  1YAU O;  2KNH A;  2WZG A;  1EA8 A;  2XLO A;  3FOO A;  3CQZ A;  4JE9 A;  3DAG A;  3EGX A;  5T3T A;  3M1C B;  3QVY A;  3QW0 A;  4MVM A;  3RH3 A;  5A6J A;  2GFH A;  4BEJ A;  4PR9 A;  4DXW A;  3F47 A;  1OCZ C;  2AVK A;  3O10 A;  3LEO A;  1I5N A;  1ZZP A;  3KYI A;  4I1M A;  2Q7R A;  5CI9 A;  5A6B D;  2MYS A;  1A41 A;  4GYT A;  1W2W A;  2A6H F;  2WVQ A;  2Y3D A;  3DD7 A;  4J30 B;  3TUL A;  2M4E A;  3JT1 A;  1T01 A;  1S7Z A;  2Q9A A;  4BPM A;  3MYI A;  1DOW A;  1V4A A;  1TR2 A;  2XS1 A;  2EPM X;  4KNV A;  1ZHZ A;  2IM8 A;  2L7A A;  3TOL A;  2XLM A;  2A0B A;  3O6X A;  3GEE A;  1K04 A;  1GM5 A;  2Y3B A;  3B0P A;  2YLG A;  3SP1 A;  3DI5 A;  2EIN C;  3SZR A;  4ANJ A;  1LM3 B;  1YA7 O;  1BZ4 A;  1Q0G A;  3H2U A;  4ONS A;  1OKK D;  3L34 A;  4DRI B;  2XXA A;  1A7V A;  3POV A;  2A69 F;  5B3I A;  2OKU A;  5JLI A;  2NG1 A;  3EPV A;  4MTG A;  1JR8 A;  3O39 A;  3GWL A;  2D5R B;  4WAB A;  3KYJ A;  4WJ0 A;  3WAQ A;  2LK4 A;  4XEV A;  4G7H F;  1YZC A;  1NBB A;  4MVS A;  1I4Z A;  2D4U A;  1Z23 A;  1MND A;  1EI7 A;  5A6B A;  2DYR C;  3KH2 A;  4JTC B;  3TJ6 A;  4I1O B;  3ITF A;  4DJ9 A;  2A1D D;  3PMR A;  4JTA B;  5DS5 A;  2ICW G;  1FAP B;  2XXA B;  1LI7 A;  5AC5 A;  1BR2 A;  1HW1 A;  256B A;  3JSZ A;  3WOD F;  3DE8 A;  1CGN A;  1D1C A;  3DWW A;  4BJ5 C;  5T3W A;  1HE9 A;  4IJJ A;  1R4T A;  4CS8 A;  3EHN A;  4YL1 A;  4EIY A;  2J9U A;  4MVQ A;  1AVO B;  3UMH A;  3VM6 A;  3GOR A;  1HMO A;  3UGO A;  3M4C A;  3MBG A;  2IYL D;  5KYW A;  1BR4 A;  4DRH B;  5BQH A;  4OIQ F;  4OD4 A;  4O6Y A;  1SYQ A;  3IHU A;  2CCY A;  1NG1 A;  1OW8 A;  1YLM A;  1PD1 A;  3HJC A;  4N6H A;  2H8A A;  2PBE A;  2YZS A;  3S28 A;  3TQO A;  1QZX A;  4LDK A;  3JSE O;  5BQI A;  2R7U A;  2I8B A;  4O79 A;  4YJW A;  3H2V A;  2J8W A;  4IRU A;  4C3D A;  3LLK A;  2YEV A;  1VB5 A;  3AQC A;  5DS6 A;  4B6I A;  1I4Y A;  2R25 A;  2FGY A;  3B9Q A;  2LFF A;  5KYW B;  2NSG A;  4EKW A;  1F1M A;  4G7O F;  4G7Z F;  2P1A A;  1WGW A;  4MVR A;  2CGE A;  3ZQY A;  3RQF A;  1PD0 A;  2R7Q A;  1YA9 A;  3LAY A;  4OIR F;  4HEA J;  1NZE A;  1OCO C;  1Z3I X;  4JC7 A;  4R32 A;  4JTD B;  5L0C A;  2Q4F A;  3B29 A;  3Q7L A;  4ULV A;  2Y69 C;  3HKK A;  4NTA A;  5DVW A;  2YHS A;  3E70 C;  3HNJ A;  4LDR A;  4MS2 A;  2CNW A;  2NSF A;  1DOV A;  2HSB A;  2C04 A;  1PV3 A;  2KYH A;  2XLD A;  2XSE A;  3AQB A;  3QTH A;  4W8P A;  5DQT A;  3NKD A;  1L7C A;  3OA1 A;  1YDI A;  3LNR A;  3NMI A;  5EK0 A;  2EIJ C;  2AWC A;  4PK4 A;  2RSE B;  4MQ9 F;  3ZDL A;  4N4W A;  2MWQ A;  4E7Z A;  4DVY P;  1VMA A;  5TJ5 E;  3U2M A;  4ZLD A;  3X2Q C;  3IQT A;  3NYJ A;  3DM5 A;  3IPM O;  4JZA A;  1FMW A;  2Q9C A;  1QSP A;  3GWN A;  3JTL O;  3E9V A;  3ZWI A;  1IZM A;  2WVN A;  2Y3H A;  4J32 B;  1E84 A;  1HMD A;  3IQ6 A;  2B0J A;  2EIK C;  3SYN A;  4NTB A;  3I4U A;  4N6C A;  2BE5 F;  4IB4 A;  5L0H A;  4RD9 A;  2XRH A;  1MMN A;  3LLI A;  4EBJ A;  4XQ1 A;  3GM1 A;  3QZC A;  1QVX A;  2M64 A;  4U9D A;  2OJE D;  3AG3 C;  3KL4 A;  4K0D A;  1ZHX A;  3DJU B;  1ZHW A;  3RQE A;  2W45 A;  2XLE A;  3RVY A;  5L3V A;  2BC5 A;  1BDJ B;  3I5P A;  2R7O A;  3NYL A;  4E0H A;  3AG1 C;  1C03 A;  1E2X A;  2KQ9 A;  4O7G A;  3CAX A;  2VB6 A;  4CIP A;  2OJQ A;  4PAC A;  2L6F A;  3W2W A;  4CIH A;  5EHH A;  2HUJ A;  2R7T A;  1ORY A;  2QE9 A;  2EPK X;  2KJG A;  4LLC A;  3ZVR A;  1MMD A;  2IXM A;  3C8G D;  1MQV A;  2XS8 A;  4M63 A;  2ZXR A;  1TWH A;  2BL2 A;  3U0C A;  1A7D A;  4QI2 A;  3S9O A;  4Z9H A;  3FAP B;  3VYW A;  4ZLC A;  1FTS A;  3ATP A;  1Z5Z A;  1ZU4 A;  4CS9 A;  3EH1 A;  4P9F A;  1T5O A;  2Y3G A;  3A11 A;  2EIL C;  2L81 A;  4LDQ A;  4PJL A;  5FCL A;  1V54 C;  2LD6 A;  3B71 A;  3CEX A;  3U9M A;  3ZSU A;  4CBE A;  2HFI A;  4AK9 A;  2HV7 A;  4MTF A;  1O87 A;  2YVK A;  2QUP A;  1HE1 A;  1B68 A;  4Z9J A;  3EGX B;  5KYX A;  2UUI A;  5GPG B;  1JMW A;  5F28 E;  3H65 A;  2XL8 A;  2QLA A;  1EKY A;  2R9R B; 
#chains in the Genus database with same CATH homology
 2MHR A;  1A7D A;  2HMZ A;  1HMO A;  1A7E A;  4XPX A;  3WHN A;  1HMD A;  2AVK A;  3AGU A;  4XPY A;  4XPW A;  3WAQ A;  4XQ1 A;  1I4Z A;  2AWC A;  1I4Y A;  2AWY A;  3AGT A;  2HMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...