1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen transport
molecule keywords MYOHEMERYTHRIN
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
1A7EA 1I4YA 2HMZA 4XPYA 3WAQA 3WHNA 1I4ZA 2MHRA 1HMDA 1A7DA 4XPWA 3AGUA 1HMOA 2AWCA 3AGTA 2AWYA 4XPXA 2AVKA 4XQ1A 2HMQA
chains in the Genus database with same CATH superfamily
4K0DA 1TR2A 1ST6A 1L7CA 3ZTMA 3TULA 3L8IA 1JRAA 1YYJA 3HNIA 3RQGA 3QVZA 1G4WR 3C8GB 5T1DB 4CIHA 1FNTc 3S90A 4XQ1A 2Q3TA 4XPXA 5L0JA 3A9CA 3RW0A 3EGDB 1C02A 4PJNA 4H54A 4L6RA 4G7ZF 2OG2A 3B71A 3V5ZA 4U5FE 2QUPA 4YT8A 4JJGA 2EIMC 2Z15A 1ZVZA 5KYWB 3LS1A 1EI7A 2L6GA 3U3FA 4J7YA 2R7XA 1ZW2A 2D5RB 3EPVA 3LUTB 2G3VA 4JCZA 3W4YA 2CW0F 1J8YF 5CI8A 3U9MA 4EBJA 3J06A 3S84A 2IYLD 2GFHA 5D91A 4ER9A 3US6A 3S9OA 1UG7A 3IQ6A 4PR9A 4JZAA 3HKKA 5KYUA 2YQYA 4O7GA 5JLIA 2P1AA 3QVYA 4UDVA 5A6BD 2A6EF 4XLNF 1QQ3A 3N0TA 2G62A 3K1IA 2EPKX 4IRUA 4P9FA 4E0HA 3EQLF 4LLCA 4J32B 3PMRA 4JTDB 1Y4CA 3T4RA 3FAJA 3VM6A 1LI5A 2P0NA 3ZVRA 5COFA 4OIQF 3SYNA 4BJ5C 4YK5A 5JVEA 2MHRA 4U5GA 1BR1A 3NKDA 2LFDA 2OEVA 2VASA 4N6CA 4P6IC 1Z3IX 2XLVA 2WZLA 1WN0A 2J46A 2LCHA 3I5QA 2C04A 2Q4FA 2M4EA 1ZHWA 2VB6A 4Z9IA 1AVOB 3HTKC 3AOUA 2IOQA 4KBLA 2PNOA 4XWJA 3CQZA 3TK0A 2ZPAA 4J30B 1TWCA 4RD9A 4BG0A 3E70C 3T6GB 5EK0A 4IAQA 3JRTA 5L0IA 1H7IA 2YL1A 2CYDA 3B9QA 2ETSA 3AGTA 3EH2A 3LS0A 2QY9A 1ORJA 1V74B 5T3TA 3QZCA 1D1BA 2R7OA 5JUAA 2DYSC 3UMHA 3HJCA 4XEVA 4MW8A 2JD3A 1DOVA 2LSEA 3B29A 3VF0A 3GWLA 5COGA 2A68F 4DRIB 4YT2A 3R2PA 5F28E 2WZGA 5F5FA 3RIPA 3DKAA 3ASOC 3K7DA 2CCYA 1M57C 1V4AA 3RQEA 3UMKA 1JPNA 2L6FA 4GEHA 4XEKA 3EGDA 4E0IA 4MQ9F 4CS8C 1M2VA 1MMDA 1QVXA 1ZW3A 1M6TA 2YHSA 3GEEA 3RF3A 2HMQA 2KNHA 3IQCA 3MYIA 4ULVA 1FMWA 3O55A 4XEFA 1J8MF 1ORYA 3LEVA 5T3WA 1RCPA 1FAPB 2EILC 1N1CA 2QNLA 3EJNA 1FMVA 3F47A 4HEAJ 4JRZA 4C7OA 1BDJB 2L7AA 3M4BA 4XTKA 3OEOA 4EBBA 2XXAB 2J7PA 1RJ9A 1MQVA 4HFKB 4BEMJ 4AL1A 1H9GA 4NQFA 4JE9A 4DOZA 2NUTB 3JT1A 2NUPB 2XS1A 2EPLX 2YWAA 5JP7A 3L34A 2YLGA 2TMVP 3A11A 3LNRA 3O39A 2YLDA 3FOOA 4JCHA 4BJTA 1AEPA 1NU7D 1U6HA 1YYXA 1T9KA 2W9YA 1OW8A 3IQ5A 4C3EA 2R03A 1K04A 4QI2A 3LAYA 3DWWA 1SF8A 3LLIA 4FESA 2I8BA 4LDKA 2R25A 5KYWA 1VTMP 4MVOA 4YL3A 3EHNA 3EG9B 2EINC 2R7RA 1A7DA 2DI3A 3SXYA 1EA8A 2ASRA 3DJNB 5AGFA 3U5SA 2CDQA 4PACA 1Z7Qc 4MTOA 3SP1A 2WVQA 3T6JA 4U5BE 4CJOA 2CNWA 3S29A 1QSPA 1UFBA 2MYSA 2PX3A 3U3BA 3OWTA 4BEJA 5L0FA 2C03A 3EGXB 5KYYA 2L9JA 4MS2A 2KW3C 4EBKA 4I1OB 4N4WA 2OEXA 1CGNA 1NFNA 2YZSA 1AUEA 1E86A 2O9XA 3ZIBA 4JURI 5A6AA 4I3MA 1MNEA 1WOLA 1E83A 1Q0GA 3GM1A 1OQCA 4EWCA 4PJJA 5CIVA 1XWJA 1LPEA 3CEXA 4I1MA 4O79A 3Q6NA 1BBHA 1W2WA 1R5ID 1ORSC 3AGUA 2OCCC 4RDAA 4NTBA 4YL0A 4AK9A 1E85A 4CSAA 1OR3A 2B0JA 2J9BA 2HSQA 3M15A 1U89A 1LE2A 2IXOA 2IXMA 1OCCC 3AG1C 3RYLA 4A4AA 5L0DA 5KYYB 3G50A 3PCVA 2UUHA 1ZYRF 3NMKA 4CDAA 4BJ5A 1TWGA 4YT4A 3TD7A 1GM5A 3ECSA 4NTFA 4FWVA 3CSKA 2J8WA 1PCXA 4G0HA 3KKBA 3QTHA 3FAPB 1RKCA 3AG3C 2EPMX 5B3SC 2PX0A 2HJMA 3ITFA 4YL1A 1VMAA 1DOWA 4EIYA 4MVQA 1YVIA 1NBBA 1ZZPA 4LDRA 1OCOC 2XS8A 1MMNA 4X0RA 1B68A 5DS4A 1S7ZA 2MWQA 1VK5A 1S05A 4IAOA 1WGWA 4AE4B 1V54C 3VRCA 2L6HA 3EFOB 3QW1A 4WGZA 3SXZA 2J9VA 5DQZA 2DGJA 3GEIA 4D4XA 2NUPA 4DBQA 4EUKB 5BQHA 1CPQA 4E7ZA 2Y69C 2FGYA 2F22A 3JTLO 2R7VA 4ZLCA 3DXJF 5FCLA 1HW2A 4CDVA 2R7UA 3GWNA 4DVYP 2OQMA 4YWQA 4G7HF 3U8VA 3E9VA 1M2OA 1NLXA 4ANJA 4RBNA 3U8PA 1FR0A 1YA7O 3C8GD 4KNWA 5B3IA 1TKNA 4G78A 3W2VA 4LACB 1IZMA 2H7VC 1VLSA 3CAXA 5JSLA 5BQGA 3S27A 1EQ1A 1VYKA 3DD7A 1TQGA 2J7PD 3IHUA 3KYJA 4P9TA 2R7SA 1QLEC 2P6VA 4W8KA 1T6QA 3EZIA 4JIOA 1XZQA 2W4MA 4LERA 2J45A 5A6BA 2LIGA 2LD6A 2XM0A 2NUTA 5L0CA 4U9DA 2CGEA 4CIPA 3Q7LA 2HUJA 4Q5SF 1NSGB 4JTAB 1HMDA 2XXAA 3HLZA 1RJ9B 3T6BA 2NSGA 4NCQA 3TOMA 3UR3C 3H2UA 1OCZC 3QMKA 4ONSA 2X0CA 2H8AA 3ZDLA 3ASNC 4E17A 1CGME 2Y39A 3SZRA 1D0YA 2HJ3A 2H7OA 3GEHA 1T6IA 1M2VB 1WATA 2KJGA 2YVKA 4U5CE 1E84A 3G4ZA 3EGXA 5L0HA 2V3CC 1MMAA 2J9WA 2X51A 2P61A 1LM3B 1ZU5A 4Z9JA 1GS9A 2ZXOA 3F46A 5K0IA 2BE5F 1OCRC 3V5XA 2GA0A 3AG4C 3DM5A 1HE1A 3FVYA 5A69A 4OINF 5IY5C 1C17M 3L0IA 2XLMA 1HMOA 5AC5A 1G5ZA 1HE9A 1VYIA 4YN0B 4BJ1A 2NPUA 3NMIA 2KSFA 3SXKA 1VLTA 3U2LA 1JMWA 4PJMA 3VYWA 1G8XA 3O10A 4DVZA 2OJED 2OJQA 3MFNA 1I5NA 1ZHZA 3BEHA 1ZHXA 1Z63A 5DLJA 1WWPA 2XRHA 3N2ZB 2WZFA 2M64A 4C7OB 2WVNA 2Q9CA 5KYXA 1JR8A 4JEBA 3RKOF 1L3PA 1NZEA 1HW1A 4U5EE 2J9UA 1TWHA 4CSAC 5E33A 2XLDA 2Q9AA 5TJ5E 3WODF 3L8JA 3B0VC 2AWYA 2EIJC 4PFOA 3G4XA 5GPGB 3S28A 3PHF2 3HNKA 4MTFA 2YRFA 3B0PA 2PF4E 3BRJA 2DB4A 4R32A 3AQBA 4ZLDA 1NU9C 2H7BA 3B0UX 1OKKD 4AL0A 2AVKA 1NG1A 1KU2A 3JSZA 1ZHTA 3PDMP 1K40A 3K1IC 2Q7RA 5KYXB 5HSWA 3W8HA 1D1CA 1YARO 2W45A 4W8PA 3AJMA 2J0XA 1SYQA 1YZAA 4O6YA 2BL2A 3RFYA 3RQFA 1A7EA 4NC3A 3QW0A 1SMYF 5KYUB 2A0UA 4MVZA 2AP3A 2R9RB 1SZIA 4IARA 3W8IA 4BPMA 1A41A 1O5HA 4YJWA 1LIHA 1LI7A 2IXPA 2QLAA 1YA9A 3K66A 2PFDA 3FMSA 4JVSA 4LDQA 3U0CA 3FOPA 3ABKC 3DMDA 2HZ8A 3NKEA 2GDCA 3GM2A 4JJFA 4DJ9A 2R7QA 3CZ6A 4IB4A 3JRMO 4CDYA 4XPYA 3UGPA 4N6HA 1EKYA 3C63A 2RD9A 3KL4A 4U9EA 1NFOA 3DAGA 1Q0DA 1PD1A 3NG1A 1Q0FA 1Z23A 1R4TA 3KMIA 3U2MA 1FFHA 2NSFA 1VOMA 1RKEA 3IQTA 2VH3A 3X2QC 3ZTZA 4NY3A 4OIPF 3R7CA 4Z9HA 1T6UA 2QTVA 3WAQA 2XL8A 1A7VA 4Q4ZF 4HE8D 3K6BA 5CI9A 2YLIA 3FHDA 3RVYA 1BZ4A 4BJ6C 3LJBA 4NTAA 1OR2A 1RKEB 2IM8A 3ZQVA 2J0WA 4I44A 5KYNA 3H2VA 2KYHA 2OKUA 1O87A 1OXBA 4GYTA 4QDLA 4MVUA 3X1OA 4C3BA 1T01A 2QE9A 3EH1A 4G7OF 3C8ZA 1LS1A 1MNDA 1OW6A 1PD0A 3GM3A 3TJ5A 2WB7A 3SNHA 5JRAA 3OA1A 4J7TA 2VCCA 5JS5A 2HS5A 3ZSUA 2IXNA 3W2WA 5EHHA 4OIOF 2NG1A 2XLHA 4DRJB 2Y3BA 1I4YA 2BC5A 3MBGA 4D4NA 5A6JA 2WVOA 1C03A 4CS7A 1LS4A 2KQ9A 1D0XA 3DJUB 3C62A 5A6KA 4WABA 2A6HF 1LE4A 2D4UA 3SXMA 3JYYA 2G3KA 2HV7A 4H4KC 1KTMA 5AC4A 1F1MA 3TQOA 1OW7A 3M1CB 4MVMA 1MMGA 5B1AC 4ULWA 3VAYA 3LNMB 2XL6A 2YL3A 3C8GA 2FFHA 2EPOA 4JEAA 3NYMA 2V26A 4DXWA 2AU5A 4IJJA 2LFFA 3DAFA 1RXQA 4XPWA 5BQIA 5L3QA 1U0BB 2XLEA 1APCA 1GQAA 4JKVA 3GORA 2IBFA 4K1OA 2R7WA 3MLGA 2HFIA 4XLPF 1TFKB 3ZWIA 1I4ZA 3JSEO 2WL8A 5DS6A 2L81A 2DYRC 2OOCA 4GQHA 3WHNA 3NDBB 1Z5ZA 1SR2A 2HMZA 4CS8A 4CX9A 3H65A 4WGYA 2XLOA 4BJ6A 4JW1A 4EHPA 4PJLA 3POVA 2UUIA 1ZU4A 4LLEA 2FAPB 4MVRA 5FZTA 3LESA 4CBEA 4AX2A 5HV9A 1Q0KA 2R7TA 3V7OA 1PV3A 2YL7A 5B1BC 5DQTA 4B6IA 1CPRA 1HY5A 2XSEA 1ZHYA 2PBEA 3DM9B 4MW3A 4IGGA 3T9OA 4Q7CA 4A2NB 3GODA 2A69F 3RH3A 4KI2A 3IEEA 3WG7C 3AQCA 1VB5A 2JPUA 2VCBA 1JOGA 1G4US 3M79A 4N06A 4U5DE 4E7SA 4JTCB 3UGOA 2PP4A 1YDIA 1OKKA 2AWCA 3DZAA 3K33A 1K05A 2E87A 2KGOA 256BA 3N24A 3ATPA 1OXKA 2RSEB 3NYLA 1QZXA 4PK4A 2ZXPA 4U5HA 5D92A 2A0BA 2YKZA 1GGQA 2Q9BA 3HNJA 2I15A 4MVSA 1M56C 4QI0A 2W4BA 5COMA 2VCAA 3DE8A 3TOLA 4CS9A 1FFTC 2P7VA 4C3DA 1JPJA 1E2XA 5DS5A 3Q6MA 3JZ0A 1YAUO 5EGYA 1IW7F 3C7JA 3UMIA 2Y3GA 2ZXRA 3S0XA 3MYFA 1FTSA 3Q7GA 4DBRA 2LQGA 3ABMC 1YJGA 2KC3A 4MNDA 1QKRA 4MTGA 1Q0MA 1LKXA 3ZC4A 2ZXWC 2JX0A 3RVZA 4M63A 1LVKA 1Y6DA 2KK1A 3KYIA 3TJ6A 4CJGA 4JC7A 1TWAA 3FDQA 3EZHA 1D1AA 3AG2C 1T5OA 2B0HA 5L0GA 1YLMA 2HV6A 3IPMO 2HKVA 2GWWA 2XLWA 3I5PA 3EFOA 4KNVA 4WJ0A 4DRHB 2LP4A 2YL0A 3EHMA 3K1HA 1O3UA 2YEVA 3L1MA 2CNWD 3DE9A 4YT5A 1XZPA 2XL4A 3LEOA 1TFOB 3ABLC 1H6GA 1D0ZA 2EIKC 2LK4A 2Q00A 2Y3DA 1BR2A 5JT4A 1QPUA 1RMVA 2R05A 5BUOA 1A0BA 3ZG1A 3MX3A 4HFFB 1WASA 3UNGC 2HSBA 3LLKA 2GAQA 3M4CA 3JCUQ 2ICWG 3I4UA 3KPHA 3KH2A 3EG9A 3NMJA 5E3AA 2Y3HA 3SEOA 4O6NA 4OD5A 4OIRF 4OD4A 2OU6A 3DI5A 4FX5A 2XM4A 4IWBA 3FXHA 5L3VA 4K7BA 3GANA 4O6MA 1H9TA 1CGOA 2ZD9A 3HNLA 1BR4A 2A1DD 3NYJA 3O6XA 5DVWA 4EKWA 3ZQYA 4FAPB 4F4BA 1JAFA 1WTYA 3U9JA 5F5HA 5E2QA 3JYHA 1V55C 1YZCA 2VC9A 2R02A 3NRHA 5E3CA 3V5YA 2EPNA 1Z6AA 4E18A 1KNYA 4CS9C 4AE4A 3C18A 4KC9A 4PFPA
chains in the Genus database with same CATH topology
1A7EA 1I4YA 2HMZA 4XPYA 3WAQA 3WHNA 1I4ZA 2MHRA 1HMDA 1A7DA 4XPWA 3AGUA 1HMOA 2AWCA 3AGTA 2AWYA 4XPXA 2AVKA 4XQ1A 2HMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7E A;  1I4Y A;  2HMZ A;  4XPY A;  3WAQ A;  3WHN A;  1I4Z A;  2MHR A;  1HMD A;  1A7D A;  4XPW A;  3AGU A;  1HMO A;  2AWC A;  3AGT A;  2AWY A;  4XPX A;  2AVK A;  4XQ1 A;  2HMQ A; 
#chains in the Genus database with same CATH topology
 4K0D A;  1TR2 A;  1ST6 A;  1L7C A;  3ZTM A;  3TUL A;  3L8I A;  1JRA A;  1YYJ A;  3HNI A;  3RQG A;  3QVZ A;  1G4W R;  3C8G B;  5T1D B;  4CIH A;  1FNT c;  3S90 A;  4XQ1 A;  2Q3T A;  4XPX A;  5L0J A;  3A9C A;  3RW0 A;  3EGD B;  1C02 A;  4PJN A;  4H54 A;  4L6R A;  4G7Z F;  2OG2 A;  3B71 A;  3V5Z A;  4U5F E;  2QUP A;  4YT8 A;  4JJG A;  2EIM C;  2Z15 A;  1ZVZ A;  5KYW B;  3LS1 A;  1EI7 A;  2L6G A;  3U3F A;  4J7Y A;  2R7X A;  1ZW2 A;  2D5R B;  3EPV A;  3LUT B;  2G3V A;  4JCZ A;  3W4Y A;  2CW0 F;  1J8Y F;  5CI8 A;  3U9M A;  4EBJ A;  3J06 A;  3S84 A;  2IYL D;  2GFH A;  5D91 A;  4ER9 A;  3US6 A;  3S9O A;  1UG7 A;  3IQ6 A;  4PR9 A;  4JZA A;  3HKK A;  5KYU A;  2YQY A;  4O7G A;  5JLI A;  2P1A A;  3QVY A;  4UDV A;  5A6B D;  2A6E F;  4XLN F;  1QQ3 A;  3N0T A;  2G62 A;  3K1I A;  2EPK X;  4IRU A;  4P9F A;  4E0H A;  3EQL F;  4LLC A;  4J32 B;  3PMR A;  4JTD B;  1Y4C A;  3T4R A;  3FAJ A;  3VM6 A;  1LI5 A;  2P0N A;  3ZVR A;  5COF A;  4OIQ F;  3SYN A;  4BJ5 C;  4YK5 A;  5JVE A;  2MHR A;  4U5G A;  1BR1 A;  3NKD A;  2LFD A;  2OEV A;  2VAS A;  4N6C A;  4P6I C;  1Z3I X;  2XLV A;  2WZL A;  1WN0 A;  2J46 A;  2LCH A;  3I5Q A;  2C04 A;  2Q4F A;  2M4E A;  1ZHW A;  2VB6 A;  4Z9I A;  1AVO B;  3HTK C;  3AOU A;  2IOQ A;  4KBL A;  2PNO A;  4XWJ A;  3CQZ A;  3TK0 A;  2ZPA A;  4J30 B;  1TWC A;  4RD9 A;  4BG0 A;  3E70 C;  3T6G B;  5EK0 A;  4IAQ A;  3JRT A;  5L0I A;  1H7I A;  2YL1 A;  2CYD A;  3B9Q A;  2ETS A;  3AGT A;  3EH2 A;  3LS0 A;  2QY9 A;  1ORJ A;  1V74 B;  5T3T A;  3QZC A;  1D1B A;  2R7O A;  5JUA A;  2DYS C;  3UMH A;  3HJC A;  4XEV A;  4MW8 A;  2JD3 A;  1DOV A;  2LSE A;  3B29 A;  3VF0 A;  3GWL A;  5COG A;  2A68 F;  4DRI B;  4YT2 A;  3R2P A;  5F28 E;  2WZG A;  5F5F A;  3RIP A;  3DKA A;  3ASO C;  3K7D A;  2CCY A;  1M57 C;  1V4A A;  3RQE A;  3UMK A;  1JPN A;  2L6F A;  4GEH A;  4XEK A;  3EGD A;  4E0I A;  4MQ9 F;  4CS8 C;  1M2V A;  1MMD A;  1QVX A;  1ZW3 A;  1M6T A;  2YHS A;  3GEE A;  3RF3 A;  2HMQ A;  2KNH A;  3IQC A;  3MYI A;  4ULV A;  1FMW A;  3O55 A;  4XEF A;  1J8M F;  1ORY A;  3LEV A;  5T3W A;  1RCP A;  1FAP B;  2EIL C;  1N1C A;  2QNL A;  3EJN A;  1FMV A;  3F47 A;  4HEA J;  4JRZ A;  4C7O A;  1BDJ B;  2L7A A;  3M4B A;  4XTK A;  3OEO A;  4EBB A;  2XXA B;  2J7P A;  1RJ9 A;  1MQV A;  4HFK B;  4BEM J;  4AL1 A;  1H9G A;  4NQF A;  4JE9 A;  4DOZ A;  2NUT B;  3JT1 A;  2NUP B;  2XS1 A;  2EPL X;  2YWA A;  5JP7 A;  3L34 A;  2YLG A;  2TMV P;  3A11 A;  3LNR A;  3O39 A;  2YLD A;  3FOO A;  4JCH A;  4BJT A;  1AEP A;  1NU7 D;  1U6H A;  1YYX A;  1T9K A;  2W9Y A;  1OW8 A;  3IQ5 A;  4C3E A;  2R03 A;  1K04 A;  4QI2 A;  3LAY A;  3DWW A;  1SF8 A;  3LLI A;  4FES A;  2I8B A;  4LDK A;  2R25 A;  5KYW A;  1VTM P;  4MVO A;  4YL3 A;  3EHN A;  3EG9 B;  2EIN C;  2R7R A;  1A7D A;  2DI3 A;  3SXY A;  1EA8 A;  2ASR A;  3DJN B;  5AGF A;  3U5S A;  2CDQ A;  4PAC A;  1Z7Q c;  4MTO A;  3SP1 A;  2WVQ A;  3T6J A;  4U5B E;  4CJO A;  2CNW A;  3S29 A;  1QSP A;  1UFB A;  2MYS A;  2PX3 A;  3U3B A;  3OWT A;  4BEJ A;  5L0F A;  2C03 A;  3EGX B;  5KYY A;  2L9J A;  4MS2 A;  2KW3 C;  4EBK A;  4I1O B;  4N4W A;  2OEX A;  1CGN A;  1NFN A;  2YZS A;  1AUE A;  1E86 A;  2O9X A;  3ZIB A;  4JUR I;  5A6A A;  4I3M A;  1MNE A;  1WOL A;  1E83 A;  1Q0G A;  3GM1 A;  1OQC A;  4EWC A;  4PJJ A;  5CIV A;  1XWJ A;  1LPE A;  3CEX A;  4I1M A;  4O79 A;  3Q6N A;  1BBH A;  1W2W A;  1R5I D;  1ORS C;  3AGU A;  2OCC C;  4RDA A;  4NTB A;  4YL0 A;  4AK9 A;  1E85 A;  4CSA A;  1OR3 A;  2B0J A;  2J9B A;  2HSQ A;  3M15 A;  1U89 A;  1LE2 A;  2IXO A;  2IXM A;  1OCC C;  3AG1 C;  3RYL A;  4A4A A;  5L0D A;  5KYY B;  3G50 A;  3PCV A;  2UUH A;  1ZYR F;  3NMK A;  4CDA A;  4BJ5 A;  1TWG A;  4YT4 A;  3TD7 A;  1GM5 A;  3ECS A;  4NTF A;  4FWV A;  3CSK A;  2J8W A;  1PCX A;  4G0H A;  3KKB A;  3QTH A;  3FAP B;  1RKC A;  3AG3 C;  2EPM X;  5B3S C;  2PX0 A;  2HJM A;  3ITF A;  4YL1 A;  1VMA A;  1DOW A;  4EIY A;  4MVQ A;  1YVI A;  1NBB A;  1ZZP A;  4LDR A;  1OCO C;  2XS8 A;  1MMN A;  4X0R A;  1B68 A;  5DS4 A;  1S7Z A;  2MWQ A;  1VK5 A;  1S05 A;  4IAO A;  1WGW A;  4AE4 B;  1V54 C;  3VRC A;  2L6H A;  3EFO B;  3QW1 A;  4WGZ A;  3SXZ A;  2J9V A;  5DQZ A;  2DGJ A;  3GEI A;  4D4X A;  2NUP A;  4DBQ A;  4EUK B;  5BQH A;  1CPQ A;  4E7Z A;  2Y69 C;  2FGY A;  2F22 A;  3JTL O;  2R7V A;  4ZLC A;  3DXJ F;  5FCL A;  1HW2 A;  4CDV A;  2R7U A;  3GWN A;  4DVY P;  2OQM A;  4YWQ A;  4G7H F;  3U8V A;  3E9V A;  1M2O A;  1NLX A;  4ANJ A;  4RBN A;  3U8P A;  1FR0 A;  1YA7 O;  3C8G D;  4KNW A;  5B3I A;  1TKN A;  4G78 A;  3W2V A;  4LAC B;  1IZM A;  2H7V C;  1VLS A;  3CAX A;  5JSL A;  5BQG A;  3S27 A;  1EQ1 A;  1VYK A;  3DD7 A;  1TQG A;  2J7P D;  3IHU A;  3KYJ A;  4P9T A;  2R7S A;  1QLE C;  2P6V A;  4W8K A;  1T6Q A;  3EZI A;  4JIO A;  1XZQ A;  2W4M A;  4LER A;  2J45 A;  5A6B A;  2LIG A;  2LD6 A;  2XM0 A;  2NUT A;  5L0C A;  4U9D A;  2CGE A;  4CIP A;  3Q7L A;  2HUJ A;  4Q5S F;  1NSG B;  4JTA B;  1HMD A;  2XXA A;  3HLZ A;  1RJ9 B;  3T6B A;  2NSG A;  4NCQ A;  3TOM A;  3UR3 C;  3H2U A;  1OCZ C;  3QMK A;  4ONS A;  2X0C A;  2H8A A;  3ZDL A;  3ASN C;  4E17 A;  1CGM E;  2Y39 A;  3SZR A;  1D0Y A;  2HJ3 A;  2H7O A;  3GEH A;  1T6I A;  1M2V B;  1WAT A;  2KJG A;  2YVK A;  4U5C E;  1E84 A;  3G4Z A;  3EGX A;  5L0H A;  2V3C C;  1MMA A;  2J9W A;  2X51 A;  2P61 A;  1LM3 B;  1ZU5 A;  4Z9J A;  1GS9 A;  2ZXO A;  3F46 A;  5K0I A;  2BE5 F;  1OCR C;  3V5X A;  2GA0 A;  3AG4 C;  3DM5 A;  1HE1 A;  3FVY A;  5A69 A;  4OIN F;  5IY5 C;  1C17 M;  3L0I A;  2XLM A;  1HMO A;  5AC5 A;  1G5Z A;  1HE9 A;  1VYI A;  4YN0 B;  4BJ1 A;  2NPU A;  3NMI A;  2KSF A;  3SXK A;  1VLT A;  3U2L A;  1JMW A;  4PJM A;  3VYW A;  1G8X A;  3O10 A;  4DVZ A;  2OJE D;  2OJQ A;  3MFN A;  1I5N A;  1ZHZ A;  3BEH A;  1ZHX A;  1Z63 A;  5DLJ A;  1WWP A;  2XRH A;  3N2Z B;  2WZF A;  2M64 A;  4C7O B;  2WVN A;  2Q9C A;  5KYX A;  1JR8 A;  4JEB A;  3RKO F;  1L3P A;  1NZE A;  1HW1 A;  4U5E E;  2J9U A;  1TWH A;  4CSA C;  5E33 A;  2XLD A;  2Q9A A;  5TJ5 E;  3WOD F;  3L8J A;  3B0V C;  2AWY A;  2EIJ C;  4PFO A;  3G4X A;  5GPG B;  3S28 A;  3PHF 2;  3HNK A;  4MTF A;  2YRF A;  3B0P A;  2PF4 E;  3BRJ A;  2DB4 A;  4R32 A;  3AQB A;  4ZLD A;  1NU9 C;  2H7B A;  3B0U X;  1OKK D;  4AL0 A;  2AVK A;  1NG1 A;  1KU2 A;  3JSZ A;  1ZHT A;  3PDM P;  1K40 A;  3K1I C;  2Q7R A;  5KYX B;  5HSW A;  3W8H A;  1D1C A;  1YAR O;  2W45 A;  4W8P A;  3AJM A;  2J0X A;  1SYQ A;  1YZA A;  4O6Y A;  2BL2 A;  3RFY A;  3RQF A;  1A7E A;  4NC3 A;  3QW0 A;  1SMY F;  5KYU B;  2A0U A;  4MVZ A;  2AP3 A;  2R9R B;  1SZI A;  4IAR A;  3W8I A;  4BPM A;  1A41 A;  1O5H A;  4YJW A;  1LIH A;  1LI7 A;  2IXP A;  2QLA A;  1YA9 A;  3K66 A;  2PFD A;  3FMS A;  4JVS A;  4LDQ A;  3U0C A;  3FOP A;  3ABK C;  3DMD A;  2HZ8 A;  3NKE A;  2GDC A;  3GM2 A;  4JJF A;  4DJ9 A;  2R7Q A;  3CZ6 A;  4IB4 A;  3JRM O;  4CDY A;  4XPY A;  3UGP A;  4N6H A;  1EKY A;  3C63 A;  2RD9 A;  3KL4 A;  4U9E A;  1NFO A;  3DAG A;  1Q0D A;  1PD1 A;  3NG1 A;  1Q0F A;  1Z23 A;  1R4T A;  3KMI A;  3U2M A;  1FFH A;  2NSF A;  1VOM A;  1RKE A;  3IQT A;  2VH3 A;  3X2Q C;  3ZTZ A;  4NY3 A;  4OIP F;  3R7C A;  4Z9H A;  1T6U A;  2QTV A;  3WAQ A;  2XL8 A;  1A7V A;  4Q4Z F;  4HE8 D;  3K6B A;  5CI9 A;  2YLI A;  3FHD A;  3RVY A;  1BZ4 A;  4BJ6 C;  3LJB A;  4NTA A;  1OR2 A;  1RKE B;  2IM8 A;  3ZQV A;  2J0W A;  4I44 A;  5KYN A;  3H2V A;  2KYH A;  2OKU A;  1O87 A;  1OXB A;  4GYT A;  4QDL A;  4MVU A;  3X1O A;  4C3B A;  1T01 A;  2QE9 A;  3EH1 A;  4G7O F;  3C8Z A;  1LS1 A;  1MND A;  1OW6 A;  1PD0 A;  3GM3 A;  3TJ5 A;  2WB7 A;  3SNH A;  5JRA A;  3OA1 A;  4J7T A;  2VCC A;  5JS5 A;  2HS5 A;  3ZSU A;  2IXN A;  3W2W A;  5EHH A;  4OIO F;  2NG1 A;  2XLH A;  4DRJ B;  2Y3B A;  1I4Y A;  2BC5 A;  3MBG A;  4D4N A;  5A6J A;  2WVO A;  1C03 A;  4CS7 A;  1LS4 A;  2KQ9 A;  1D0X A;  3DJU B;  3C62 A;  5A6K A;  4WAB A;  2A6H F;  1LE4 A;  2D4U A;  3SXM A;  3JYY A;  2G3K A;  2HV7 A;  4H4K C;  1KTM A;  5AC4 A;  1F1M A;  3TQO A;  1OW7 A;  3M1C B;  4MVM A;  1MMG A;  5B1A C;  4ULW A;  3VAY A;  3LNM B;  2XL6 A;  2YL3 A;  3C8G A;  2FFH A;  2EPO A;  4JEA A;  3NYM A;  2V26 A;  4DXW A;  2AU5 A;  4IJJ A;  2LFF A;  3DAF A;  1RXQ A;  4XPW A;  5BQI A;  5L3Q A;  1U0B B;  2XLE A;  1APC A;  1GQA A;  4JKV A;  3GOR A;  2IBF A;  4K1O A;  2R7W A;  3MLG A;  2HFI A;  4XLP F;  1TFK B;  3ZWI A;  1I4Z A;  3JSE O;  2WL8 A;  5DS6 A;  2L81 A;  2DYR C;  2OOC A;  4GQH A;  3WHN A;  3NDB B;  1Z5Z A;  1SR2 A;  2HMZ A;  4CS8 A;  4CX9 A;  3H65 A;  4WGY A;  2XLO A;  4BJ6 A;  4JW1 A;  4EHP A;  4PJL A;  3POV A;  2UUI A;  1ZU4 A;  4LLE A;  2FAP B;  4MVR A;  5FZT A;  3LES A;  4CBE A;  4AX2 A;  5HV9 A;  1Q0K A;  2R7T A;  3V7O A;  1PV3 A;  2YL7 A;  5B1B C;  5DQT A;  4B6I A;  1CPR A;  1HY5 A;  2XSE A;  1ZHY A;  2PBE A;  3DM9 B;  4MW3 A;  4IGG A;  3T9O A;  4Q7C A;  4A2N B;  3GOD A;  2A69 F;  3RH3 A;  4KI2 A;  3IEE A;  3WG7 C;  3AQC A;  1VB5 A;  2JPU A;  2VCB A;  1JOG A;  1G4U S;  3M79 A;  4N06 A;  4U5D E;  4E7S A;  4JTC B;  3UGO A;  2PP4 A;  1YDI A;  1OKK A;  2AWC A;  3DZA A;  3K33 A;  1K05 A;  2E87 A;  2KGO A;  256B A;  3N24 A;  3ATP A;  1OXK A;  2RSE B;  3NYL A;  1QZX A;  4PK4 A;  2ZXP A;  4U5H A;  5D92 A;  2A0B A;  2YKZ A;  1GGQ A;  2Q9B A;  3HNJ A;  2I15 A;  4MVS A;  1M56 C;  4QI0 A;  2W4B A;  5COM A;  2VCA A;  3DE8 A;  3TOL A;  4CS9 A;  1FFT C;  2P7V A;  4C3D A;  1JPJ A;  1E2X A;  5DS5 A;  3Q6M A;  3JZ0 A;  1YAU O;  5EGY A;  1IW7 F;  3C7J A;  3UMI A;  2Y3G A;  2ZXR A;  3S0X A;  3MYF A;  1FTS A;  3Q7G A;  4DBR A;  2LQG A;  3ABM C;  1YJG A;  2KC3 A;  4MND A;  1QKR A;  4MTG A;  1Q0M A;  1LKX A;  3ZC4 A;  2ZXW C;  2JX0 A;  3RVZ A;  4M63 A;  1LVK A;  1Y6D A;  2KK1 A;  3KYI A;  3TJ6 A;  4CJG A;  4JC7 A;  1TWA A;  3FDQ A;  3EZH A;  1D1A A;  3AG2 C;  1T5O A;  2B0H A;  5L0G A;  1YLM A;  2HV6 A;  3IPM O;  2HKV A;  2GWW A;  2XLW A;  3I5P A;  3EFO A;  4KNV A;  4WJ0 A;  4DRH B;  2LP4 A;  2YL0 A;  3EHM A;  3K1H A;  1O3U A;  2YEV A;  3L1M A;  2CNW D;  3DE9 A;  4YT5 A;  1XZP A;  2XL4 A;  3LEO A;  1TFO B;  3ABL C;  1H6G A;  1D0Z A;  2EIK C;  2LK4 A;  2Q00 A;  2Y3D A;  1BR2 A;  5JT4 A;  1QPU A;  1RMV A;  2R05 A;  5BUO A;  1A0B A;  3ZG1 A;  3MX3 A;  4HFF B;  1WAS A;  3UNG C;  2HSB A;  3LLK A;  2GAQ A;  3M4C A;  3JCU Q;  2ICW G;  3I4U A;  3KPH A;  3KH2 A;  3EG9 A;  3NMJ A;  5E3A A;  2Y3H A;  3SEO A;  4O6N A;  4OD5 A;  4OIR F;  4OD4 A;  2OU6 A;  3DI5 A;  4FX5 A;  2XM4 A;  4IWB A;  3FXH A;  5L3V A;  4K7B A;  3GAN A;  4O6M A;  1H9T A;  1CGO A;  2ZD9 A;  3HNL A;  1BR4 A;  2A1D D;  3NYJ A;  3O6X A;  5DVW A;  4EKW A;  3ZQY A;  4FAP B;  4F4B A;  1JAF A;  1WTY A;  3U9J A;  5F5H A;  5E2Q A;  3JYH A;  1V55 C;  1YZC A;  2VC9 A;  2R02 A;  3NRH A;  5E3C A;  3V5Y A;  2EPN A;  1Z6A A;  4E18 A;  1KNY A;  4CS9 C;  4AE4 A;  3C18 A;  4KC9 A;  4PFP A; 
#chains in the Genus database with same CATH homology
 1A7E A;  1I4Y A;  2HMZ A;  4XPY A;  3WAQ A;  3WHN A;  1I4Z A;  2MHR A;  1HMD A;  1A7D A;  4XPW A;  3AGU A;  1HMO A;  2AWC A;  3AGT A;  2AWY A;  4XPX A;  2AVK A;  4XQ1 A;  2HMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...