1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
b'GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOHEMERYTHRIN
molecule tags Oxygen transport
source organism Themiste zostericola
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
2HMZA 1I4YA 3AGTA 1A7EA 4XPYA 2AWCA 3AGUA 1HMDA 1I4ZA 2HMQA 3WAQA 4XQ1A 3WHNA 4XPWA 2AVKA 1A7DA 2AWYA 2MHRA 4XPXA 1HMOA
chains in the Genus database with same CATH superfamily
3JSEO 2EPOA 2OU6A 4CSAA 1RXQA 3U2MA 5BQIA 5TJ5E 4Q5SF 4E0IA 2IXNA 1D0ZA 3S29A 4HFKB 3LEVA 2Q9CA 4PJLA 3QMKA 5L0CA 4Z9JA 2ZD9A 1C17M 4D4XA 2XLOA 1O3UA 4BJ1A 2J7PD 3HNLA 4U5DE 3UGPA 4MVMA 4CIPA 3US6A 1GGQA 4NTFA 1G8XA 4OINF 1FFTC 3TQOA 5L0FA 1ZHTA 3LNMB 3W8HA 3J06A 3DD7A 3ZVRA 3FVYA 3L1MA 3CAXA 2PF4E 1PCXA 3M1CB 2XS1A 3VRCA 2YVKA 2WVNA 4U9DA 4EUKB 2OQMA 1F1MA 3S0XA 1WASA 1MMAA 1RKEA 1ZYRF 3DM9B 3RYLA 2R7TA 3SNHA 3ZTZA 2VASA 4EKWA 1UFBA 3ABMC 4NTBA 4XPWA 3AQCA 1VMAA 2QY9A 4JJFA 5L0IA 1VTMP 3IEEA 1G4WR 2Y69C 5L3QA 3TK0A 2R7WA 4MVUA 4E7ZA 1D0YA 1K05A 3HNKA 4FX5A 5B1BC 4KNWA 5T1DB 3SYNA 2AVKA 1TWHA 2GA0A 5KYUA 4ANJA 4CJOA 1V54C 2IYLD 2XSEA 4WABA 3ASNC 1VLSA 2HJMA 2ZXOA 1OKKD 3ABKC 3EGDA 3NYMA 3EZHA 4NCQA 1Q0DA 2M4EA 3ECSA 2OKUA 3HNIA 1M6TA 3NG1A 3T6GB 2AP3A 4CS8C 5EGYA 2GWWA 4O6MA 3GM3A 1TR2A 4C7OB 2V26A 1YYJA 4FWVA 2Y3HA 1TWGA 3OEOA 2R7OA 3GWNA 4BJ5A 2W9YA 3GWLA 1OXBA 3H65A 3CZ6A 2EILC 2R9RB 3C8GD 5T3TA 2A6HF 4N4WA 2EPLX 3MYFA 1APCA 4I44A 4KI2A 1S05A 4BEJA 4YL1A 1YLMA 3B29A 4CS9C 2J9UA 2IBFA 4RD9A 3Q6MA 2AWYA 5AGFA 1ORSC 5KYNA 1VOMA 2FFHA 3AG1C 3PMRA 2XRHA 4MTGA 2W4BA 1QQ3A 1OCOC 3X2QC 3DMDA 4MVZA 3Q6NA 3LUTB 5DLJA 1GQAA 3UMIA 1A41A 1RKEB 2RSEB 3AG2C 3U5SA 4CS8A 1T6IA 4MTFA 4U5CE 4DJ9A 1XZPA 4YT4A 3EHMA 3KMIA 5DQTA 4J32B 3DKAA 3S27A 4NC3A 1KNYA 1G5ZA 3EFOA 4RBNA 2EIMC 3U8VA 1VLTA 5KYWB 4PJJA 1ZZPA 4YL3A 3ZTMA 4EBKA 1H9TA 5JT4A 1BR4A 2DGJA 3DWWA 3JZ0A 3W2WA 5DQZA 5AC4A 5B1AC 5B3SC 1CGME 2IXMA 5B3IA 2EIKC 2L6HA 1SR2A 1O87A 2YLDA 3NKEA 4KC9A 2KYHA 1LIHA 3ZDLA 1JMWA 1L7CA 3EJNA 2NSGA 1V4AA 3FHDA 2DYRC 3ZQYA 1OXKA 2KQ9A 1M2OA 2E87A 3RW0A 2AU5A 4Q7CA 1OW8A 1IZMA 1BR1A 1LI5A 4MVOA 3T4RA 1AVOB 4EWCA 1K40A 2H7VC 2YRFA 4XEKA 2PP4A 3IQTA 4YK5A 3PDMP 3B0VC 1E83A 1KTMA 4MS2A 2R7VA 1LI7A 2YHSA 3L0IA 4JW1A 3RH3A 1AEPA 2XM0A 4PACA 4N6HA 1FMWA 1O5HA 2L6FA 3O39A 4IAQA 2PFDA 4IARA 1ORJA 1HE1A 1UG7A 4IWBA 2R03A 1LVKA 4XTKA 2NSFA 2KSFA 4BPMA 4B6IA 4JJGA 1XWJA 1AUEA 4WGZA 3RVZA 1Q0KA 4DBRA 3FAPB 4JEAA 1T6QA 2L6GA 1QVXA 3HJCA 1BDJB 1SMYF 5BQGA 4CSAC 3IQ5A 1Y6DA 4AX2A 5A6AA 3U0CA 1NFNA 1YDIA 4NY3A 2W45A 2DB4A 1HE9A 1XZQA 1TWAA 2A6EF 3EGXB 5COGA 3R7CA 1RKCA 3SXMA 1OR2A 2B0HA 3DAGA 1ZVZA 2WVQA 5KYXA 3W2VA 2HS5A 3EZIA 3WODF 4MNDA 4YJWA 4PFPA 2DYSC 2ZXWC 3KKBA 4CJGA 1R4TA 1Z6AA 4AE4A 1JPNA 1OCZC 3AQBA 2XLWA 4G7OF 5KYXB 5KYYB 4DVYP 2X51A 1D0XA 5L0DA 3L8JA 1L3PA 1Z3IX 2J46A 2PNOA 3FOPA 2VCAA 3U3BA 3I5PA 3EGXA 3K66A 1CPRA 3ZSUA 4CX9A 3W4YA 3UMHA 2ASRA 2YWAA 3TOMA 4XEVA 2EPKX 1RMVA 2ETSA 4AL1A 4E18A 2YLGA 4CDVA 4H4KC 3RIPA 1WTYA 1NU9C 4U9EA 3WG7C 3V7OA 1E85A 3L34A 4Q4ZF 4JEBA 1HW1A 4JCHA 2XLMA 3LLKA 3TD7A 3T6BA 1ZHWA 3LESA 3ZIBA 1Q0MA 4AE4B 2NPUA 2HUJA 1TQGA 1D1AA 2KJGA 2VCBA 3QVZA 4GQHA 1NZEA 3C63A 3K7DA 3B0UX 2XL8A 1T9KA 1FNTc 3POVA 3CEXA 1PD0A 2WB7A 3KYIA 3M79A 4XPXA 3N0TA 4O79A 1OCRC 3DAFA 1DOVA 2P0NA 1A7EA 4U5BE 4ULVA 2EIJC 4N06A 3CQZA 1IW7F 2VC9A 3WHNA 5K0IA 5L0JA 3B71A 3TULA 1OR3A 4QI2A 5E3AA 1LE2A 3MBGA 5DS6A 2R05A 3N24A 4HE8D 2R7XA 5DS5A 2LIGA 4H54A 4NQFA 1Y4CA 3EG9B 3C62A 3DJNB 5A6KA 5A6BA 3C8GA 4XQ1A 4BJ5C 2J7PA 3GM1A 2L7AA 1FAPB 1NSGB 2KC3A 2OJQA 2WL8A 2Y3BA 3CSKA 2XLVA 3FAJA 3NYJA 2HKVA 2R25A 4DRJB 1WN0A 1NBBA 4JRZA 3GM2A 4K1OA 4DRIB 3JRTA 1LPEA 3WAQA 5KYWA 5E3CA 2NG1A 1QSPA 1V74B 3ZC4A 3K33A 2R7UA 3RVYA 3AG4C 1KU2A 1A7VA 4PK4A 4C3BA 1ST6A 3AGTA 3C8GB 3NMIA 2HV7A 2PBEA 2UUHA 2MWQA 2XLDA 5JLIA 3C18A 2NUPA 2XM4A 1NLXA 1S7ZA 3HNJA 5DS4A 2R7RA 1U0BB 3LEOA 1BR2A 4J7TA 3TJ6A 3C7JA 4JKVA 2V3CC 4XWJA 3EH1A 2C04A 3NMKA 3A11A 1VYKA 3SXYA 3T6JA 4X0RA 4QI0A 2QUPA 4MW3A 4CS9A 2WZGA 3QW0A 1M2VB 4DOZA 4JZAA 2LFFA 3EGDB 5JSLA 1CGOA 3U9JA 2DI3A 1BBHA 2WVOA 3C8ZA 4LLCA 3K1HA 1QKRA 4DVZA 5L0GA 2EPMX 3TOLA 3ZG1A 3FOOA 4C3EA 4DXWA 2LP4A 3G50A 2HSQA 5JS5A 4K7BA 4JIOA 3S28A 3ATPA 3K1IA 3L8IA 3NRHA 3HTKC 4A4AA 4WJ0A 2FGYA 5BQHA 1WATA 2ICWG 2HV6A 1EI7A 4G78A 2OG2A 4PFOA 1Q0GA 3BRJA 2Q3TA 4PR9A 2PX3A 1E2XA 1Z5ZA 2I8BA 1M56C 2A0UA 3DJUB 1BZ4A 3VAYA 2GFHA 2XXAA 1U6HA 2GDCA 2FAPB 2IM8A 1OCCC 4YT8A 1TFOB 2A1DD 2H7OA 1TKNA 4KBLA 4PJNA 3JYHA 2F22A 1SF8A 2OJED 5AC5A 3V5YA 1OKKA 4MVRA 2XXAB 2QTVA 2OEVA 4MW8A 1MNEA 2HSBA 1LKXA 5F28E 4OD5A 5EHHA 4AL0A 4J7YA 3G4ZA 1NU7D 1YZCA 1JAFA 1J8MF 1Z23A 1ZU5A 5CI8A 2ZXPA 4HFFB 2NUPB 2L9JA 4CIHA 2HJ3A 2YZSA 1TWCA 4CBEA 2JX0A 1H7IA 1Z63A 5CIVA 1I5NA 5F5FA 5KYYA 4G0HA 1WGWA 4ZLCA 4R32A 2H7BA 2PX0A 5L0HA 4XLPF 4XPYA 2LCHA 4LACB 3F47A 2JD3A 2YL7A 1EQ1A 5JP7A 3NYLA 256BA 2KNHA 2Y39A 4FESA 5JVEA 1YAUO 2J45A 4E17A 4G7ZF 2W4MA 1CPQA 4IB4A 4NTAA 4U5FE 3PHF2 1SYQA 2HZ8A 2G62A 2B0JA 4UDVA 4M63A 2CNWA 1I4YA 3UGOA 2YL1A 4YT5A 4DBQA 1HY5A 4RDAA 4YT2A 4BG0A 3H2VA 4MTOA 4QDLA 3U9MA 2QE9A 2CCYA 2LD6A 1G4US 2Q9BA 5D92A 4JTDB 4OIOF 3K6BA 3MX3A 4MVQA 1FR0A 4LDQA 3S84A 2J0WA 3KL4A 1HW2A 1I4ZA 3EPVA 3RQEA 1NFOA 4K0DA 3U3FA 3FXHA 2XLEA 4PJMA 4W8KA 3DE8A 4IGGA 3SXZA 4EBJA 4JTCB 1OW7A 1E86A 2M64A 1T6UA 1VB5A 2BE5F 4F4BA 1RCPA 4OD4A 2HFIA 2J8WA 2A68F 2D5RB 2L81A 3AG3C 1HMDA 1MQVA 1JOGA 2HMQA 3IHUA 3LS0A 3I5QA 3O55A 4E0HA 4EIYA 5E33A 4ZLDA 1ZHYA 2Q9AA 3TJ5A 5F5HA 1ZW3A 2J9VA 3NMJA 3QW1A 3GODA 2D4UA 2ZXRA 3T9OA 2YKZA 5JUAA 4EBBA 5BUOA 3B9QA 4U5EE 1ZU4A 2IXOA 3U2LA 3S90A 2YLIA 2KGOA 2NUTA 5GPGB 2OOCA 2C03A 4OIRF 1DOWA 2Q00A 2XS8A 3IQ6A 1ZHXA 1D1CA 4ONSA 3W8IA 1YVIA 1YA7O 1YARO 1MMGA 3V5XA 2YEVA 4P6IC 4JVSA 4JC7A 2J9BA 3PCVA 3DXJF 3OA1A 2H8AA 1A7DA 3JT1A 4CDAA 4O7GA 2Q7RA 2IXPA 4G7HF 2EPNA 3Q7GA 2UUIA 4ER9A 3UMKA 1A0BA 1ORYA 1ZW2A 2P1AA 3EFOB 3EH2A 3QZCA 4J30B 1QLEC 1C03A 1K04A 1YYXA 4KNVA 4W8PA 3GORA 4YN0B 4BJTA 3LLIA 3I4UA 1MMNA 3EG9A 3KPHA 3M4BA 1PD1A 2O9XA 3H2UA 2GAQA 2WZFA 4U5HA 1M2VA 1C02A 1GS9A 4U5GA 3A9CA 3UNGC 3ITFA 3JCUQ 2KK1A 2R02A 1R5ID 1YA9A 2BL2A 3E70C 3MFNA 4YL0A 2AWCA 3AGUA 3E9VA 2XL4A 3HKKA 1FMVA 2CNWD 1VYIA 5JRAA 3ABLC 3MLGA 4N6CA 2Y3GA 1ZHZA 3ASOC 3V5ZA 4GYTA 4IAOA 2YL3A 3RFYA 4C3DA 1T01A 3GANA 1Q0FA 3KH2A 3IQCA 3O10A 4I1MA 4L6RA 4MQ9F 4FAPB 2I15A 5FCLA 2VH3A 4Z9HA 4XLNF 4ULWA 1YJGA 2MHRA 5FZTA 3SZRA 2OCCC 3DM5A 2LK4A 4JE9A 2J9WA 3K1IC 2G3VA 3VM6A 2Y3DA 1H9GA 4GEHA 2LFDA 2R7SA 3RKOF 3SEOA 3ZQVA 4EHPA 2CDQA 1RJ9A 4LDKA 1JR8A 3U8PA 2VCCA 5IY5C 3JSZA 5HSWA 4E7SA 2P6VA 4I3MA 4Z9IA 2IOQA 3AJMA 1M57C 1FTSA 4A2NB 4OIPF 3O6XA 3ZWIA 1YZAA 1JPJA 3S9OA 4JCZA 4IRUA 1H6GA 1W2WA 1SZIA 2ZPAA 1HMOA 2HMZA 2J0XA 1JRAA 5E2QA 4XEFA 2LSEA 3VYWA 4AK9A 3B0PA 4JURI 2A0BA 3F46A 3HLZA 1V55C 2EINC 5D91A 4BJ6A 3EHNA 3OWTA 3UR3C 3G4XA 5KYUB 4LERA 4BEMJ 4WGYA 2OEXA 4DRHB 2TMVP 1LE4A 5A6JA 1D1BA 1VK5A 3LNRA 1CGNA 4HEAJ 2KW3C 1WWPA 2Z15A 1N1CA 3EQLF 1E84A 1WOLA 3DZAA 4I1OB 4BJ6C 4MVSA 3N2ZB 2BC5A 4C7OA 1EA8A 5DVWA 3SXKA 3NKDA 2QLAA 4CDYA 3SP1A 1LM3B 3GEEA 5COMA 1J8YF 1FFHA 3M15A 4P9TA 3RQFA 3GEIA 3KYJA 3M4CA 3Q7LA 2JPUA 2MYSA 2P61A 5A69A 2NUTB 1T5OA 2WZLA 4YWQA 2CGEA 4P9FA 1QZXA 4D4NA 1GM5A 3LJBA 1MNDA 1TFKB 3GEHA 5T3WA 4LDRA 3AOUA 3X1OA 4JTAB 3DI5A 3DE9A 1LS4A 1U89A 4O6YA 1OW6A 1OQCA 1NG1A 3NDBB 2XLHA 5EK0A 3FMSA 1RJ9B 2QNLA 2G3KA 3JTLO 1EKYA 3JYYA 4IJJA 4OIQF 5CI9A 2P7VA 3QTHA 2VB6A 2R7QA 3RQGA 3LAYA 4CS7A 5COFA 1MMDA 2A69F 3LS1A 3JRMO 4O6NA 2X0CA 3RF3A 2CW0F 5A6BD 2YQYA 2CYDA 2LQGA 2YL0A 3R2PA 1QPUA 1Z7Qc 5L3VA 3VF0A 1LS1A 3FDQA 3MYIA 3BEHA 3IPMO 5HV9A 1B68A 4LLEA 2RD9A 2XL6A 2Q4FA 3QVYA 1PV3A
chains in the Genus database with same CATH topology
2HMZA 1I4YA 3AGTA 1A7EA 4XPYA 2AWCA 3AGUA 1HMDA 1I4ZA 2HMQA 3WAQA 4XQ1A 3WHNA 4XPWA 2AVKA 1A7DA 2AWYA 2MHRA 4XPXA 1HMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMZ A;  1I4Y A;  3AGT A;  1A7E A;  4XPY A;  2AWC A;  3AGU A;  1HMD A;  1I4Z A;  2HMQ A;  3WAQ A;  4XQ1 A;  3WHN A;  4XPW A;  2AVK A;  1A7D A;  2AWY A;  2MHR A;  4XPX A;  1HMO A; 
#chains in the Genus database with same CATH topology
 3JSE O;  2EPO A;  2OU6 A;  4CSA A;  1RXQ A;  3U2M A;  5BQI A;  5TJ5 E;  4Q5S F;  4E0I A;  2IXN A;  1D0Z A;  3S29 A;  4HFK B;  3LEV A;  2Q9C A;  4PJL A;  3QMK A;  5L0C A;  4Z9J A;  2ZD9 A;  1C17 M;  4D4X A;  2XLO A;  1O3U A;  4BJ1 A;  2J7P D;  3HNL A;  4U5D E;  3UGP A;  4MVM A;  4CIP A;  3US6 A;  1GGQ A;  4NTF A;  1G8X A;  4OIN F;  1FFT C;  3TQO A;  5L0F A;  1ZHT A;  3LNM B;  3W8H A;  3J06 A;  3DD7 A;  3ZVR A;  3FVY A;  3L1M A;  3CAX A;  2PF4 E;  1PCX A;  3M1C B;  2XS1 A;  3VRC A;  2YVK A;  2WVN A;  4U9D A;  4EUK B;  2OQM A;  1F1M A;  3S0X A;  1WAS A;  1MMA A;  1RKE A;  1ZYR F;  3DM9 B;  3RYL A;  2R7T A;  3SNH A;  3ZTZ A;  2VAS A;  4EKW A;  1UFB A;  3ABM C;  4NTB A;  4XPW A;  3AQC A;  1VMA A;  2QY9 A;  4JJF A;  5L0I A;  1VTM P;  3IEE A;  1G4W R;  2Y69 C;  5L3Q A;  3TK0 A;  2R7W A;  4MVU A;  4E7Z A;  1D0Y A;  1K05 A;  3HNK A;  4FX5 A;  5B1B C;  4KNW A;  5T1D B;  3SYN A;  2AVK A;  1TWH A;  2GA0 A;  5KYU A;  4ANJ A;  4CJO A;  1V54 C;  2IYL D;  2XSE A;  4WAB A;  3ASN C;  1VLS A;  2HJM A;  2ZXO A;  1OKK D;  3ABK C;  3EGD A;  3NYM A;  3EZH A;  4NCQ A;  1Q0D A;  2M4E A;  3ECS A;  2OKU A;  3HNI A;  1M6T A;  3NG1 A;  3T6G B;  2AP3 A;  4CS8 C;  5EGY A;  2GWW A;  4O6M A;  3GM3 A;  1TR2 A;  4C7O B;  2V26 A;  1YYJ A;  4FWV A;  2Y3H A;  1TWG A;  3OEO A;  2R7O A;  3GWN A;  4BJ5 A;  2W9Y A;  3GWL A;  1OXB A;  3H65 A;  3CZ6 A;  2EIL C;  2R9R B;  3C8G D;  5T3T A;  2A6H F;  4N4W A;  2EPL X;  3MYF A;  1APC A;  4I44 A;  4KI2 A;  1S05 A;  4BEJ A;  4YL1 A;  1YLM A;  3B29 A;  4CS9 C;  2J9U A;  2IBF A;  4RD9 A;  3Q6M A;  2AWY A;  5AGF A;  1ORS C;  5KYN A;  1VOM A;  2FFH A;  3AG1 C;  3PMR A;  2XRH A;  4MTG A;  2W4B A;  1QQ3 A;  1OCO C;  3X2Q C;  3DMD A;  4MVZ A;  3Q6N A;  3LUT B;  5DLJ A;  1GQA A;  3UMI A;  1A41 A;  1RKE B;  2RSE B;  3AG2 C;  3U5S A;  4CS8 A;  1T6I A;  4MTF A;  4U5C E;  4DJ9 A;  1XZP A;  4YT4 A;  3EHM A;  3KMI A;  5DQT A;  4J32 B;  3DKA A;  3S27 A;  4NC3 A;  1KNY A;  1G5Z A;  3EFO A;  4RBN A;  2EIM C;  3U8V A;  1VLT A;  5KYW B;  4PJJ A;  1ZZP A;  4YL3 A;  3ZTM A;  4EBK A;  1H9T A;  5JT4 A;  1BR4 A;  2DGJ A;  3DWW A;  3JZ0 A;  3W2W A;  5DQZ A;  5AC4 A;  5B1A C;  5B3S C;  1CGM E;  2IXM A;  5B3I A;  2EIK C;  2L6H A;  1SR2 A;  1O87 A;  2YLD A;  3NKE A;  4KC9 A;  2KYH A;  1LIH A;  3ZDL A;  1JMW A;  1L7C A;  3EJN A;  2NSG A;  1V4A A;  3FHD A;  2DYR C;  3ZQY A;  1OXK A;  2KQ9 A;  1M2O A;  2E87 A;  3RW0 A;  2AU5 A;  4Q7C A;  1OW8 A;  1IZM A;  1BR1 A;  1LI5 A;  4MVO A;  3T4R A;  1AVO B;  4EWC A;  1K40 A;  2H7V C;  2YRF A;  4XEK A;  2PP4 A;  3IQT A;  4YK5 A;  3PDM P;  3B0V C;  1E83 A;  1KTM A;  4MS2 A;  2R7V A;  1LI7 A;  2YHS A;  3L0I A;  4JW1 A;  3RH3 A;  1AEP A;  2XM0 A;  4PAC A;  4N6H A;  1FMW A;  1O5H A;  2L6F A;  3O39 A;  4IAQ A;  2PFD A;  4IAR A;  1ORJ A;  1HE1 A;  1UG7 A;  4IWB A;  2R03 A;  1LVK A;  4XTK A;  2NSF A;  2KSF A;  4BPM A;  4B6I A;  4JJG A;  1XWJ A;  1AUE A;  4WGZ A;  3RVZ A;  1Q0K A;  4DBR A;  3FAP B;  4JEA A;  1T6Q A;  2L6G A;  1QVX A;  3HJC A;  1BDJ B;  1SMY F;  5BQG A;  4CSA C;  3IQ5 A;  1Y6D A;  4AX2 A;  5A6A A;  3U0C A;  1NFN A;  1YDI A;  4NY3 A;  2W45 A;  2DB4 A;  1HE9 A;  1XZQ A;  1TWA A;  2A6E F;  3EGX B;  5COG A;  3R7C A;  1RKC A;  3SXM A;  1OR2 A;  2B0H A;  3DAG A;  1ZVZ A;  2WVQ A;  5KYX A;  3W2V A;  2HS5 A;  3EZI A;  3WOD F;  4MND A;  4YJW A;  4PFP A;  2DYS C;  2ZXW C;  3KKB A;  4CJG A;  1R4T A;  1Z6A A;  4AE4 A;  1JPN A;  1OCZ C;  3AQB A;  2XLW A;  4G7O F;  5KYX B;  5KYY B;  4DVY P;  2X51 A;  1D0X A;  5L0D A;  3L8J A;  1L3P A;  1Z3I X;  2J46 A;  2PNO A;  3FOP A;  2VCA A;  3U3B A;  3I5P A;  3EGX A;  3K66 A;  1CPR A;  3ZSU A;  4CX9 A;  3W4Y A;  3UMH A;  2ASR A;  2YWA A;  3TOM A;  4XEV A;  2EPK X;  1RMV A;  2ETS A;  4AL1 A;  4E18 A;  2YLG A;  4CDV A;  4H4K C;  3RIP A;  1WTY A;  1NU9 C;  4U9E A;  3WG7 C;  3V7O A;  1E85 A;  3L34 A;  4Q4Z F;  4JEB A;  1HW1 A;  4JCH A;  2XLM A;  3LLK A;  3TD7 A;  3T6B A;  1ZHW A;  3LES A;  3ZIB A;  1Q0M A;  4AE4 B;  2NPU A;  2HUJ A;  1TQG A;  1D1A A;  2KJG A;  2VCB A;  3QVZ A;  4GQH A;  1NZE A;  3C63 A;  3K7D A;  3B0U X;  2XL8 A;  1T9K A;  1FNT c;  3POV A;  3CEX A;  1PD0 A;  2WB7 A;  3KYI A;  3M79 A;  4XPX A;  3N0T A;  4O79 A;  1OCR C;  3DAF A;  1DOV A;  2P0N A;  1A7E A;  4U5B E;  4ULV A;  2EIJ C;  4N06 A;  3CQZ A;  1IW7 F;  2VC9 A;  3WHN A;  5K0I A;  5L0J A;  3B71 A;  3TUL A;  1OR3 A;  4QI2 A;  5E3A A;  1LE2 A;  3MBG A;  5DS6 A;  2R05 A;  3N24 A;  4HE8 D;  2R7X A;  5DS5 A;  2LIG A;  4H54 A;  4NQF A;  1Y4C A;  3EG9 B;  3C62 A;  3DJN B;  5A6K A;  5A6B A;  3C8G A;  4XQ1 A;  4BJ5 C;  2J7P A;  3GM1 A;  2L7A A;  1FAP B;  1NSG B;  2KC3 A;  2OJQ A;  2WL8 A;  2Y3B A;  3CSK A;  2XLV A;  3FAJ A;  3NYJ A;  2HKV A;  2R25 A;  4DRJ B;  1WN0 A;  1NBB A;  4JRZ A;  3GM2 A;  4K1O A;  4DRI B;  3JRT A;  1LPE A;  3WAQ A;  5KYW A;  5E3C A;  2NG1 A;  1QSP A;  1V74 B;  3ZC4 A;  3K33 A;  2R7U A;  3RVY A;  3AG4 C;  1KU2 A;  1A7V A;  4PK4 A;  4C3B A;  1ST6 A;  3AGT A;  3C8G B;  3NMI A;  2HV7 A;  2PBE A;  2UUH A;  2MWQ A;  2XLD A;  5JLI A;  3C18 A;  2NUP A;  2XM4 A;  1NLX A;  1S7Z A;  3HNJ A;  5DS4 A;  2R7R A;  1U0B B;  3LEO A;  1BR2 A;  4J7T A;  3TJ6 A;  3C7J A;  4JKV A;  2V3C C;  4XWJ A;  3EH1 A;  2C04 A;  3NMK A;  3A11 A;  1VYK A;  3SXY A;  3T6J A;  4X0R A;  4QI0 A;  2QUP A;  4MW3 A;  4CS9 A;  2WZG A;  3QW0 A;  1M2V B;  4DOZ A;  4JZA A;  2LFF A;  3EGD B;  5JSL A;  1CGO A;  3U9J A;  2DI3 A;  1BBH A;  2WVO A;  3C8Z A;  4LLC A;  3K1H A;  1QKR A;  4DVZ A;  5L0G A;  2EPM X;  3TOL A;  3ZG1 A;  3FOO A;  4C3E A;  4DXW A;  2LP4 A;  3G50 A;  2HSQ A;  5JS5 A;  4K7B A;  4JIO A;  3S28 A;  3ATP A;  3K1I A;  3L8I A;  3NRH A;  3HTK C;  4A4A A;  4WJ0 A;  2FGY A;  5BQH A;  1WAT A;  2ICW G;  2HV6 A;  1EI7 A;  4G78 A;  2OG2 A;  4PFO A;  1Q0G A;  3BRJ A;  2Q3T A;  4PR9 A;  2PX3 A;  1E2X A;  1Z5Z A;  2I8B A;  1M56 C;  2A0U A;  3DJU B;  1BZ4 A;  3VAY A;  2GFH A;  2XXA A;  1U6H A;  2GDC A;  2FAP B;  2IM8 A;  1OCC C;  4YT8 A;  1TFO B;  2A1D D;  2H7O A;  1TKN A;  4KBL A;  4PJN A;  3JYH A;  2F22 A;  1SF8 A;  2OJE D;  5AC5 A;  3V5Y A;  1OKK A;  4MVR A;  2XXA B;  2QTV A;  2OEV A;  4MW8 A;  1MNE A;  2HSB A;  1LKX A;  5F28 E;  4OD5 A;  5EHH A;  4AL0 A;  4J7Y A;  3G4Z A;  1NU7 D;  1YZC A;  1JAF A;  1J8M F;  1Z23 A;  1ZU5 A;  5CI8 A;  2ZXP A;  4HFF B;  2NUP B;  2L9J A;  4CIH A;  2HJ3 A;  2YZS A;  1TWC A;  4CBE A;  2JX0 A;  1H7I A;  1Z63 A;  5CIV A;  1I5N A;  5F5F A;  5KYY A;  4G0H A;  1WGW A;  4ZLC A;  4R32 A;  2H7B A;  2PX0 A;  5L0H A;  4XLP F;  4XPY A;  2LCH A;  4LAC B;  3F47 A;  2JD3 A;  2YL7 A;  1EQ1 A;  5JP7 A;  3NYL A;  256B A;  2KNH A;  2Y39 A;  4FES A;  5JVE A;  1YAU O;  2J45 A;  4E17 A;  4G7Z F;  2W4M A;  1CPQ A;  4IB4 A;  4NTA A;  4U5F E;  3PHF 2;  1SYQ A;  2HZ8 A;  2G62 A;  2B0J A;  4UDV A;  4M63 A;  2CNW A;  1I4Y A;  3UGO A;  2YL1 A;  4YT5 A;  4DBQ A;  1HY5 A;  4RDA A;  4YT2 A;  4BG0 A;  3H2V A;  4MTO A;  4QDL A;  3U9M A;  2QE9 A;  2CCY A;  2LD6 A;  1G4U S;  2Q9B A;  5D92 A;  4JTD B;  4OIO F;  3K6B A;  3MX3 A;  4MVQ A;  1FR0 A;  4LDQ A;  3S84 A;  2J0W A;  3KL4 A;  1HW2 A;  1I4Z A;  3EPV A;  3RQE A;  1NFO A;  4K0D A;  3U3F A;  3FXH A;  2XLE A;  4PJM A;  4W8K A;  3DE8 A;  4IGG A;  3SXZ A;  4EBJ A;  4JTC B;  1OW7 A;  1E86 A;  2M64 A;  1T6U A;  1VB5 A;  2BE5 F;  4F4B A;  1RCP A;  4OD4 A;  2HFI A;  2J8W A;  2A68 F;  2D5R B;  2L81 A;  3AG3 C;  1HMD A;  1MQV A;  1JOG A;  2HMQ A;  3IHU A;  3LS0 A;  3I5Q A;  3O55 A;  4E0H A;  4EIY A;  5E33 A;  4ZLD A;  1ZHY A;  2Q9A A;  3TJ5 A;  5F5H A;  1ZW3 A;  2J9V A;  3NMJ A;  3QW1 A;  3GOD A;  2D4U A;  2ZXR A;  3T9O A;  2YKZ A;  5JUA A;  4EBB A;  5BUO A;  3B9Q A;  4U5E E;  1ZU4 A;  2IXO A;  3U2L A;  3S90 A;  2YLI A;  2KGO A;  2NUT A;  5GPG B;  2OOC A;  2C03 A;  4OIR F;  1DOW A;  2Q00 A;  2XS8 A;  3IQ6 A;  1ZHX A;  1D1C A;  4ONS A;  3W8I A;  1YVI A;  1YA7 O;  1YAR O;  1MMG A;  3V5X A;  2YEV A;  4P6I C;  4JVS A;  4JC7 A;  2J9B A;  3PCV A;  3DXJ F;  3OA1 A;  2H8A A;  1A7D A;  3JT1 A;  4CDA A;  4O7G A;  2Q7R A;  2IXP A;  4G7H F;  2EPN A;  3Q7G A;  2UUI A;  4ER9 A;  3UMK A;  1A0B A;  1ORY A;  1ZW2 A;  2P1A A;  3EFO B;  3EH2 A;  3QZC A;  4J30 B;  1QLE C;  1C03 A;  1K04 A;  1YYX A;  4KNV A;  4W8P A;  3GOR A;  4YN0 B;  4BJT A;  3LLI A;  3I4U A;  1MMN A;  3EG9 A;  3KPH A;  3M4B A;  1PD1 A;  2O9X A;  3H2U A;  2GAQ A;  2WZF A;  4U5H A;  1M2V A;  1C02 A;  1GS9 A;  4U5G A;  3A9C A;  3UNG C;  3ITF A;  3JCU Q;  2KK1 A;  2R02 A;  1R5I D;  1YA9 A;  2BL2 A;  3E70 C;  3MFN A;  4YL0 A;  2AWC A;  3AGU A;  3E9V A;  2XL4 A;  3HKK A;  1FMV A;  2CNW D;  1VYI A;  5JRA A;  3ABL C;  3MLG A;  4N6C A;  2Y3G A;  1ZHZ A;  3ASO C;  3V5Z A;  4GYT A;  4IAO A;  2YL3 A;  3RFY A;  4C3D A;  1T01 A;  3GAN A;  1Q0F A;  3KH2 A;  3IQC A;  3O10 A;  4I1M A;  4L6R A;  4MQ9 F;  4FAP B;  2I15 A;  5FCL A;  2VH3 A;  4Z9H A;  4XLN F;  4ULW A;  1YJG A;  2MHR A;  5FZT A;  3SZR A;  2OCC C;  3DM5 A;  2LK4 A;  4JE9 A;  2J9W A;  3K1I C;  2G3V A;  3VM6 A;  2Y3D A;  1H9G A;  4GEH A;  2LFD A;  2R7S A;  3RKO F;  3SEO A;  3ZQV A;  4EHP A;  2CDQ A;  1RJ9 A;  4LDK A;  1JR8 A;  3U8P A;  2VCC A;  5IY5 C;  3JSZ A;  5HSW A;  4E7S A;  2P6V A;  4I3M A;  4Z9I A;  2IOQ A;  3AJM A;  1M57 C;  1FTS A;  4A2N B;  4OIP F;  3O6X A;  3ZWI A;  1YZA A;  1JPJ A;  3S9O A;  4JCZ A;  4IRU A;  1H6G A;  1W2W A;  1SZI A;  2ZPA A;  1HMO A;  2HMZ A;  2J0X A;  1JRA A;  5E2Q A;  4XEF A;  2LSE A;  3VYW A;  4AK9 A;  3B0P A;  4JUR I;  2A0B A;  3F46 A;  3HLZ A;  1V55 C;  2EIN C;  5D91 A;  4BJ6 A;  3EHN A;  3OWT A;  3UR3 C;  3G4X A;  5KYU B;  4LER A;  4BEM J;  4WGY A;  2OEX A;  4DRH B;  2TMV P;  1LE4 A;  5A6J A;  1D1B A;  1VK5 A;  3LNR A;  1CGN A;  4HEA J;  2KW3 C;  1WWP A;  2Z15 A;  1N1C A;  3EQL F;  1E84 A;  1WOL A;  3DZA A;  4I1O B;  4BJ6 C;  4MVS A;  3N2Z B;  2BC5 A;  4C7O A;  1EA8 A;  5DVW A;  3SXK A;  3NKD A;  2QLA A;  4CDY A;  3SP1 A;  1LM3 B;  3GEE A;  5COM A;  1J8Y F;  1FFH A;  3M15 A;  4P9T A;  3RQF A;  3GEI A;  3KYJ A;  3M4C A;  3Q7L A;  2JPU A;  2MYS A;  2P61 A;  5A69 A;  2NUT B;  1T5O A;  2WZL A;  4YWQ A;  2CGE A;  4P9F A;  1QZX A;  4D4N A;  1GM5 A;  3LJB A;  1MND A;  1TFK B;  3GEH A;  5T3W A;  4LDR A;  3AOU A;  3X1O A;  4JTA B;  3DI5 A;  3DE9 A;  1LS4 A;  1U89 A;  4O6Y A;  1OW6 A;  1OQC A;  1NG1 A;  3NDB B;  2XLH A;  5EK0 A;  3FMS A;  1RJ9 B;  2QNL A;  2G3K A;  3JTL O;  1EKY A;  3JYY A;  4IJJ A;  4OIQ F;  5CI9 A;  2P7V A;  3QTH A;  2VB6 A;  2R7Q A;  3RQG A;  3LAY A;  4CS7 A;  5COF A;  1MMD A;  2A69 F;  3LS1 A;  3JRM O;  4O6N A;  2X0C A;  3RF3 A;  2CW0 F;  5A6B D;  2YQY A;  2CYD A;  2LQG A;  2YL0 A;  3R2P A;  1QPU A;  1Z7Q c;  5L3V A;  3VF0 A;  1LS1 A;  3FDQ A;  3MYI A;  3BEH A;  3IPM O;  5HV9 A;  1B68 A;  4LLE A;  2RD9 A;  2XL6 A;  2Q4F A;  3QVY A;  1PV3 A; 
#chains in the Genus database with same CATH homology
 2HMZ A;  1I4Y A;  3AGT A;  1A7E A;  4XPY A;  2AWC A;  3AGU A;  1HMD A;  1I4Z A;  2HMQ A;  3WAQ A;  4XQ1 A;  3WHN A;  4XPW A;  2AVK A;  1A7D A;  2AWY A;  2MHR A;  4XPX A;  1HMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...