1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
b'GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOHEMERYTHRIN
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen transport
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
4XPYA 3WAQA 1HMDA 2AVKA 3AGTA 1I4ZA 2HMZA 1I4YA 4XPXA 1A7DA 1HMOA 3AGUA 4XPWA 2MHRA 2AWYA 2AWCA 2HMQA 3WHNA 1A7EA 4XQ1A
chains in the Genus database with same CATH superfamily
2PFDA 1HW1A 3N24A 3OEOA 1TKNA 1MMDA 3FOPA 3WAQA 2XXAB 4XWJA 256BA 2UUHA 2YLDA 1YARO 3GEEA 3VYWA 1YJGA 1K04A 2XM0A 3DM5A 2R9RB 4JVSA 4X0RA 5B1BC 5L0JA 4YT4A 1MMNA 2A1DD 2IYLD 4HE8D 4MQ9F 3CZ6A 3QTHA 4JTCB 2J9WA 4YT5A 2R7XA 2TMVP 1FMVA 1FTSA 1WOLA 2Z15A 2HFIA 3B29A 4Z9JA 4CS9A 3GM1A 3Q7LA 1OW6A 2MHRA 4E0IA 5FCLA 1J8YF 2R02A 4J7TA 4DJ9A 2BC5A 1SMYF 2D5RB 2EIJC 4QDLA 3L8IA 2XRHA 2C04A 2LK4A 4ZLCA 2DYSC 4HEAJ 1VK5A 2WB7A 3CSKA 1XWJA 3ASOC 3EG9A 3AGTA 3G4XA 1CGNA 3M79A 4JTAB 4BJ5C 3B9QA 1RJ9B 3ABMC 2R25A 2WVQA 4CS8A 2J9UA 2YLGA 2WL8A 3EQLF 3K1IC 1OCCC 3DKAA 4CDAA 3JRTA 1OW8A 3O10A 4P9FA 4FX5A 3K7DA 3FVYA 2G3KA 4PR9A 3HNIA 1Z6AA 3RQFA 5A6BD 1PD1A 4YL1A 5L0GA 2J0WA 2M4EA 4G78A 2AP3A 3MX3A 2IXPA 4GEHA 2QLAA 1LI7A 1JPJA 1PCXA 1Z23A 3ZQYA 1SYQA 1LVKA 5KYNA 3FHDA 2HV6A 5A69A 1FNTc 3QMKA 4MW3A 4RBNA 1D0ZA 2LCHA 4O6YA 1GM5A 2P61A 3EFOA 3Q6NA 4PACA 2Y3GA 2AVKA 5KYXA 4UDVA 4OIOF 1EA8A 2LFFA 3MYFA 1H9GA 3IPMO 4U5EE 1HW2A 2DYRC 2BE5F 2L7AA 3ATPA 3U0CA 1MMGA 3POVA 3RYLA 3HTKC 3M15A 3EGDA 4BJ5A 4EIYA 1OKKA 1ZW2A 2YL1A 2W45A 3W8IA 4EBBA 1LS1A 2VASA 1G5ZA 1Z63A 1JAFA 4BEJA 2Q3TA 3QW0A 4CDVA 5A6KA 3AQBA 3K1IA 3LAYA 1OXKA 1B68A 3FMSA 5CI9A 3RFYA 3TULA 1CGME 3HNJA 1S7ZA 5KYUA 5BUOA 3DWWA 4D4XA 4NY3A 3RVYA 5T3WA 3CEXA 4WABA 3RQGA 4MTGA 2PP4A 4YWQA 4CIPA 4Q7CA 4DRHB 1QKRA 1RKEA 2H7OA 4W8KA 3S84A 1VTMP 3U2LA 2WVOA 2XL6A 1Z5ZA 3GM2A 4XLPF 1VMAA 2I8BA 1FR0A 2VCAA 1WTYA 4P9TA 5JP7A 4I1MA 2CNWA 4XTKA 5KYYA 3TK0A 3SXYA 3U3BA 3HKKA 4C7OA 5FZTA 3LNMB 3NRHA 1YA9A 2PNOA 3U3FA 1FMWA 3EZHA 1QSPA 4PJLA 3S0XA 2G3VA 3RH3A 1NFNA 2Y39A 4JRZA 4JTDB 1G8XA 3CAXA 2CGEA 2Y3BA 5DS5A 3J06A 1GQAA 2R7VA 1D0XA 2GDCA 4I1OB 4JIOA 4BJ1A 1AUEA 1ZHXA 3DD7A 5B3SC 5DS4A 2J9VA 2Y69C 3LEOA 3RW0A 5F5HA 2HV7A 1AEPA 3KYIA 1W2WA 3T9OA 4LLEA 1H9TA 2KC3A 4PFOA 1QPUA 3ASNC 4XQ1A 3SXKA 3ZC4A 2G62A 4YT8A 2R7TA 3NYJA 2HUJA 1NBBA 2R7UA 3JCUQ 2JX0A 1HE1A 5BQIA 2J7PD 3JSZA 3ZVRA 4IJJA 1Q0FA 3G4ZA 1KNYA 3ECSA 3SXZA 1G4WR 2H7BA 3T6BA 2KJGA 3ABLC 4G7OF 3UGPA 5EGYA 1MMAA 4KNWA 2JD3A 2M64A 4U5DE 1TWGA 1TFKB 2Q9AA 3VAYA 1TWAA 3A11A 3TJ6A 1ZU4A 1ORYA 3KH2A 1DOVA 1S05A 5DLJA 4WGZA 2ASRA 1WASA 2Q9BA 3M4CA 4OIPF 2L6FA 2J0XA 1E85A 1YA7O 2VB6A 4H54A 3U2MA 3U8PA 1NLXA 2O9XA 1BZ4A 1NU9C 3A9CA 5COFA 4MVZA 2XLMA 3L34A 3AG2C 1VLSA 4LACB 4CS7A 4EBJA 2QUPA 4Z9HA 2Q4FA 2QTVA 4WGYA 1SF8A 5D92A 4JZAA 3NDBB 2R7QA 3LESA 4LERA 1YLMA 3G50A 3SEOA 3NG1A 1LI5A 3ZG1A 4J32B 4JW1A 3X2QC 2CDQA 3WODF 4MVMA 4CIHA 3KKBA 2BL2A 1N1CA 1F1MA 3EJNA 4WJ0A 1E86A 3DAFA 3LS0A 1YAUO 3BRJA 2KW3C 4IGGA 1Q0GA 3U9MA 5L0CA 1XZPA 4I44A 1M2VA 1YZAA 2I15A 5A6JA 1ORJA 4RDAA 5JS5A 3H2UA 4K1OA 5BQGA 1CPRA 1G4US 3E9VA 4JCZA 1D1AA 1BDJB 1C02A 2HKVA 2YL7A 5EK0A 1WN0A 2NSFA 3EGXA 3LS1A 4ULVA 1M6TA 3HLZA 4O6MA 5DVWA 4YL3A 4AK9A 2FGYA 5DQZA 2NG1A 2F22A 2GFHA 4CDYA 2KQ9A 2L6GA 2VCBA 3GANA 5DS6A 5L0FA 4E18A 3K6BA 3S90A 3OWTA 3SZRA 2HS5A 3JRMO 3EG9B 3HNLA 4ANJA 2OKUA 1LE2A 2MYSA 2XM4A 3H2VA 3EH1A 3EZIA 4U9EA 1PV3A 3SYNA 1T9KA 3N0TA 4EKWA 1WATA 2A6HF 1K40A 1ZW3A 4MVUA 1YVIA 4JJGA 1D0YA 1MQVA 2LFDA 2WVNA 3OA1A 2XLVA 4O6NA 4D4NA 2YVKA 3Q6MA 1JR8A 4MS2A 2NSGA 5DQTA 4KNVA 1QQ3A 1V55C 1OCRC 1HMDA 2A6EF 1GS9A 4FAPB 1NG1A 1TWCA 2J9BA 1HY5A 3DE8A 1BR1A 4OINF 1QVXA 4QI2A 1A41A 1I4YA 1ZHWA 1NFOA 1EI7A 2EILC 3I5PA 3NYMA 1OKKD 3US6A 4JJFA 4DVYP 4P6IC 3S9OA 1HMOA 2GWWA 4MW8A 2HJMA 2NUPB 4MVOA 2P6VA 2H8AA 5JRAA 2PF4E 3EFOB 5KYXB 2VH3A 4EUKB 2OG2A 3ZTMA 4OD5A 2P1AA 4IAQA 1ZVZA 4IARA 2OCCC 5B3IA 4NC3A 5HSWA 4BJ6C 4Q5SF 1Z3IX 4E17A 4EHPA 5JVEA 1V54C 2QE9A 3NMKA 4Z9IA 3VRCA 3GEIA 3ZDLA 3C62A 3C63A 3ZIBA 4L6RA 2YL0A 4MNDA 1C17M 5E3AA 4N6CA 3IQ5A 3ZWIA 3C8GA 2WZLA 4KI2A 2CNWD 4NTAA 1C03A 4PJJA 1SR2A 1OCZC 4XLNF 4C3EA 4U9DA 4AL0A 1R4TA 3IEEA 4AE4A 2D4UA 1R5ID 2B0JA 2Q9CA 1BBHA 2WZGA 2P7VA 3HNKA 3KYJA 3V5ZA 3WG7C 1E83A 1MNDA 4W8PA 1RKEB 5COMA 4DVZA 2EPKX 1VOMA 3T6GB 4E0HA 3JYYA 4U5CE 1U6HA 3GORA 4R32A 3UMHA 3LJBA 2EIMC 3LLKA 3MFNA 3R2PA 1D1BA 4EWCA 1Q0DA 4Q4ZF 3O55A 5KYYB 1LKXA 1A7EA 4XEVA 3IHUA 2DI3A 3FOOA 4C7OB 1LE4A 1NSGB 1OCOC 2OOCA 2CYDA 2L81A 3N2ZB 1OXBA 2RSEB 4C3BA 4XPYA 2YWAA 1O3UA 3NYLA 2LSEA 2Q00A 3DM9B 4XEFA 2VC9A 3DJNB 4BJ6A 1RKCA 3JSEO 5AGFA 2R7OA 2ZXPA 3U9JA 1U89A 2H7VC 3AG1C 4C3DA 4CJOA 2L9JA 2HZ8A 2HMZA 2XLOA 3QVYA 2R7RA 3TOLA 1Y4CA 1T5OA 1CPQA 4ZLDA 1ZZPA 1A0BA 5COGA 2Y3DA 3EPVA 3FAPB 3E70C 2OQMA 3GWLA 2XLDA 5D91A 3JYHA 5KYWA 2B0HA 3B71A 4XPWA 5JSLA 3ZQVA 3DXJF 2NUTA 3PMRA 3I5QA 2HMQA 3MBGA 2V3CC 5E33A 2J45A 4MVQA 1NU7D 2A69F 4YN0B 4CJGA 1YDIA 2HJ3A 2IXNA 2OEVA 2YLIA 5GPGB 3KL4A 1ST6A 4LLCA 3PCVA 4DRIB 3K66A 5CIVA 3W2VA 3GEHA 2YKZA 1WWPA 3C18A 4M63A 1LIHA 4N4WA 1APCA 3O39A 1HE9A 2L6HA 4NTBA 3V5YA 3FXHA 2IXOA 2OJQA 1OW7A 3DE9A 3FAJA 4MVSA 2E87A 3PDMP 2DB4A 3AQCA 2W4MA 4BG0A 1BR4A 1VYKA 2V26A 3JT1A 3AJMA 3NMIA 4DOZA 2XXAA 1Y6DA 1K05A 2YHSA 4A4AA 2R05A 3KPHA 2CW0F 3VF0A 4PJMA 1YYJA 2J8WA 1UG7A 3PHF2 1Q0KA 3QVZA 2HSBA 1EQ1A 3K33A 4OD4A 4GYTA 1OR2A 4O7GA 2XS8A 3S29A 3CQZA 4CSAA 3U5SA 4I3MA 4JKVA 4HFKB 2IOQA 4H4KC 1OQCA 1IZMA 2LQGA 1O87A 2ZD9A 2X0CA 2YEVA 3TOMA 4BJTA 1FAPB 3GODA 3DAGA 1YZCA 2CCYA 5L0IA 1I4ZA 3V7OA 2DGJA 5L3QA 4U5HA 4NCQA 2XSEA 1I5NA 4PK4A 3FDQA 3BEHA 2LP4A 4JE9A 1M2VB 3UR3C 4IRUA 3V5XA 1BR2A 1O5HA 4DRJB 1L3PA 5A6AA 4DXWA 4YT2A 3LLIA 4IB4A 4CBEA 1V74B 4J30B 2IXMA 4PFPA 1T6IA 3W8HA 1RJ9A 3EGXB 2W4BA 2YZSA 2AWCA 3ZSUA 2JPUA 3RIPA 2GAQA 1KU2A 3WHNA 3EHNA 1YYXA 2W9YA 3HJCA 2AU5A 1RXQA 3GWNA 5TJ5E 3GM3A 1A7VA 3W2WA 2R7SA 2P0NA 1JOGA 5JT4A 1Z7Qc 4JURI 5F5FA 3B0VC 1L7CA 3K1HA 1JPNA 2QNLA 4F4BA 2EPMX 1DOWA 1CGOA 1ORSC 3EHMA 4KC9A 4QI0A 2ZPAA 2XLEA 3W4YA 5E3CA 1GGQA 2X51A 1EKYA 2UUIA 4BEMJ 1RMVA 1A7DA 2PX3A 3EH2A 1UFBA 3DMDA 1LPEA 3L0IA 4CX9A 1U0BB 4RD9A 3ZTZA 2Q7RA 2ZXOA 5A6BA 4FESA 4K0DA 4MTOA 3I4UA 2FFHA 3LNRA 3B0PA 3SNHA 2NPUA 3TQOA 4JEBA 3ABKC 2ICWG 3RKOF 5AC4A 5JUAA 2XL8A 4KBLA 3VM6A 1H6GA 2EINC 2NUPA 4U5BE 3UMIA 5L0HA 3EGDB 2YL3A 3B0UX 3C8GD 1VB5A 4GQHA 3JZ0A 3SXMA 1FFHA 1JMWA 1M57C 1TR2A 3IQTA 4LDKA 5B1AC 2FAPB 4AL1A 2C03A 3ITFA 3M1CB 2VCCA 1XZQA 4ULWA 5KYUB 3QZCA 4OIQF 4JEAA 3S27A 3LUTB 4FWVA 2PBEA 3C8ZA 2OJED 4MVRA 3UNGC 3QW1A 1RCPA 1VLTA 3DZAA 3C8GB 2XLWA 3RQEA 3NMJA 4YK5A 4B6IA 4BPMA 3IQCA 3AG3C 1ZU5A 2KYHA 4AE4B 4PJNA 5BQHA 1T6UA 4HFFB 4LDQA 4LDRA 4DBQA 1M56C 1E2XA 4G0HA 4JCHA 1FFTC 4XEKA 2MWQA 3RF3A 1ZHZA 3DJUB 1M2OA 1D1CA 4N06A 3RVZA 4IAOA 2ZXWC 2XL4A 3L1MA 4U5FE 3MLGA 3LEVA 1TWHA 4A2NB 3UGOA 2OU6A 1V4AA 3NKDA 1LM3B 4XPXA 5IY5C 1TFOB 1IW7F 2KK1A 2QY9A 4O79A 5AC5A 5L3VA 2GA0A 3TD7A 5T1DB 2ZXRA 3T6JA 3F46A 3M4BA 2KGOA 4E7ZA 4G7HF 3MYIA 3AGUA 3L8JA 2AWYA 2XLHA 5CI8A 4CSAC 5L0DA 2R03A 3O6XA 1ZHTA 1T01A 1VYIA 2HSQA 3SP1A 1ZHYA 1AVOB 2KSFA 2LIGA 2XS1A 3F47A 3Q7GA 4YJWA 5F28E 2IBFA 1T6QA 2J46A 4ONSA 2YQYA 4DBRA 1WGWA 3R7CA 3KMIA 4NQFA 2Y3HA 3UMKA 2A0UA 2IM8A 3JTLO 5E2QA 5JLIA 1E84A 2J7PA 2A68F 1SZIA 3S28A 1TQGA 1MNEA 1OR3A 1QZXA 4K7BA 1PD0A 2EIKC 5KYWB 3DI5A 3AOUA 2NUTB 2WZFA 3AG4C 4G7ZF 4NTFA 4AX2A 4CS9C 1KTMA 2EPNA 4YL0A 1J8MF 3H65A 3IQ6A 2EPLX 2PX0A 4E7SA 4N6HA 2R7WA 1Q0MA 1ZYRF 4MTFA 3T4RA 4U5GA 1NZEA 2LD6A 2EPOA 2YRFA 2KNHA 5T3TA 4OIRF 4JC7A 2A0BA 4EBKA 5EHHA 4IWBA 2ETSA 3NKEA 1QLEC 1LS4A 1H7IA 2RD9A 4J7YA 3C7JA 3U8VA 5K0IA 1JRAA 4ER9A 3X1OA 2OEXA 5HV9A 3TJ5A 4CS8C
chains in the Genus database with same CATH topology
4XPYA 3WAQA 1HMDA 2AVKA 3AGTA 1I4ZA 2HMZA 1I4YA 4XPXA 1A7DA 1HMOA 3AGUA 4XPWA 2MHRA 2AWYA 2AWCA 2HMQA 3WHNA 1A7EA 4XQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPY A;  3WAQ A;  1HMD A;  2AVK A;  3AGT A;  1I4Z A;  2HMZ A;  1I4Y A;  4XPX A;  1A7D A;  1HMO A;  3AGU A;  4XPW A;  2MHR A;  2AWY A;  2AWC A;  2HMQ A;  3WHN A;  1A7E A;  4XQ1 A; 
#chains in the Genus database with same CATH topology
 2PFD A;  1HW1 A;  3N24 A;  3OEO A;  1TKN A;  1MMD A;  3FOP A;  3WAQ A;  2XXA B;  4XWJ A;  256B A;  2UUH A;  2YLD A;  1YAR O;  3GEE A;  3VYW A;  1YJG A;  1K04 A;  2XM0 A;  3DM5 A;  2R9R B;  4JVS A;  4X0R A;  5B1B C;  5L0J A;  4YT4 A;  1MMN A;  2A1D D;  2IYL D;  4HE8 D;  4MQ9 F;  3CZ6 A;  3QTH A;  4JTC B;  2J9W A;  4YT5 A;  2R7X A;  2TMV P;  1FMV A;  1FTS A;  1WOL A;  2Z15 A;  2HFI A;  3B29 A;  4Z9J A;  4CS9 A;  3GM1 A;  3Q7L A;  1OW6 A;  2MHR A;  4E0I A;  5FCL A;  1J8Y F;  2R02 A;  4J7T A;  4DJ9 A;  2BC5 A;  1SMY F;  2D5R B;  2EIJ C;  4QDL A;  3L8I A;  2XRH A;  2C04 A;  2LK4 A;  4ZLC A;  2DYS C;  4HEA J;  1VK5 A;  2WB7 A;  3CSK A;  1XWJ A;  3ASO C;  3EG9 A;  3AGT A;  3G4X A;  1CGN A;  3M79 A;  4JTA B;  4BJ5 C;  3B9Q A;  1RJ9 B;  3ABM C;  2R25 A;  2WVQ A;  4CS8 A;  2J9U A;  2YLG A;  2WL8 A;  3EQL F;  3K1I C;  1OCC C;  3DKA A;  4CDA A;  3JRT A;  1OW8 A;  3O10 A;  4P9F A;  4FX5 A;  3K7D A;  3FVY A;  2G3K A;  4PR9 A;  3HNI A;  1Z6A A;  3RQF A;  5A6B D;  1PD1 A;  4YL1 A;  5L0G A;  2J0W A;  2M4E A;  4G78 A;  2AP3 A;  3MX3 A;  2IXP A;  4GEH A;  2QLA A;  1LI7 A;  1JPJ A;  1PCX A;  1Z23 A;  3ZQY A;  1SYQ A;  1LVK A;  5KYN A;  3FHD A;  2HV6 A;  5A69 A;  1FNT c;  3QMK A;  4MW3 A;  4RBN A;  1D0Z A;  2LCH A;  4O6Y A;  1GM5 A;  2P61 A;  3EFO A;  3Q6N A;  4PAC A;  2Y3G A;  2AVK A;  5KYX A;  4UDV A;  4OIO F;  1EA8 A;  2LFF A;  3MYF A;  1H9G A;  3IPM O;  4U5E E;  1HW2 A;  2DYR C;  2BE5 F;  2L7A A;  3ATP A;  3U0C A;  1MMG A;  3POV A;  3RYL A;  3HTK C;  3M15 A;  3EGD A;  4BJ5 A;  4EIY A;  1OKK A;  1ZW2 A;  2YL1 A;  2W45 A;  3W8I A;  4EBB A;  1LS1 A;  2VAS A;  1G5Z A;  1Z63 A;  1JAF A;  4BEJ A;  2Q3T A;  3QW0 A;  4CDV A;  5A6K A;  3AQB A;  3K1I A;  3LAY A;  1OXK A;  1B68 A;  3FMS A;  5CI9 A;  3RFY A;  3TUL A;  1CGM E;  3HNJ A;  1S7Z A;  5KYU A;  5BUO A;  3DWW A;  4D4X A;  4NY3 A;  3RVY A;  5T3W A;  3CEX A;  4WAB A;  3RQG A;  4MTG A;  2PP4 A;  4YWQ A;  4CIP A;  4Q7C A;  4DRH B;  1QKR A;  1RKE A;  2H7O A;  4W8K A;  3S84 A;  1VTM P;  3U2L A;  2WVO A;  2XL6 A;  1Z5Z A;  3GM2 A;  4XLP F;  1VMA A;  2I8B A;  1FR0 A;  2VCA A;  1WTY A;  4P9T A;  5JP7 A;  4I1M A;  2CNW A;  4XTK A;  5KYY A;  3TK0 A;  3SXY A;  3U3B A;  3HKK A;  4C7O A;  5FZT A;  3LNM B;  3NRH A;  1YA9 A;  2PNO A;  3U3F A;  1FMW A;  3EZH A;  1QSP A;  4PJL A;  3S0X A;  2G3V A;  3RH3 A;  1NFN A;  2Y39 A;  4JRZ A;  4JTD B;  1G8X A;  3CAX A;  2CGE A;  2Y3B A;  5DS5 A;  3J06 A;  1GQA A;  2R7V A;  1D0X A;  2GDC A;  4I1O B;  4JIO A;  4BJ1 A;  1AUE A;  1ZHX A;  3DD7 A;  5B3S C;  5DS4 A;  2J9V A;  2Y69 C;  3LEO A;  3RW0 A;  5F5H A;  2HV7 A;  1AEP A;  3KYI A;  1W2W A;  3T9O A;  4LLE A;  1H9T A;  2KC3 A;  4PFO A;  1QPU A;  3ASN C;  4XQ1 A;  3SXK A;  3ZC4 A;  2G62 A;  4YT8 A;  2R7T A;  3NYJ A;  2HUJ A;  1NBB A;  2R7U A;  3JCU Q;  2JX0 A;  1HE1 A;  5BQI A;  2J7P D;  3JSZ A;  3ZVR A;  4IJJ A;  1Q0F A;  3G4Z A;  1KNY A;  3ECS A;  3SXZ A;  1G4W R;  2H7B A;  3T6B A;  2KJG A;  3ABL C;  4G7O F;  3UGP A;  5EGY A;  1MMA A;  4KNW A;  2JD3 A;  2M64 A;  4U5D E;  1TWG A;  1TFK B;  2Q9A A;  3VAY A;  1TWA A;  3A11 A;  3TJ6 A;  1ZU4 A;  1ORY A;  3KH2 A;  1DOV A;  1S05 A;  5DLJ A;  4WGZ A;  2ASR A;  1WAS A;  2Q9B A;  3M4C A;  4OIP F;  2L6F A;  2J0X A;  1E85 A;  1YA7 O;  2VB6 A;  4H54 A;  3U2M A;  3U8P A;  1NLX A;  2O9X A;  1BZ4 A;  1NU9 C;  3A9C A;  5COF A;  4MVZ A;  2XLM A;  3L34 A;  3AG2 C;  1VLS A;  4LAC B;  4CS7 A;  4EBJ A;  2QUP A;  4Z9H A;  2Q4F A;  2QTV A;  4WGY A;  1SF8 A;  5D92 A;  4JZA A;  3NDB B;  2R7Q A;  3LES A;  4LER A;  1YLM A;  3G50 A;  3SEO A;  3NG1 A;  1LI5 A;  3ZG1 A;  4J32 B;  4JW1 A;  3X2Q C;  2CDQ A;  3WOD F;  4MVM A;  4CIH A;  3KKB A;  2BL2 A;  1N1C A;  1F1M A;  3EJN A;  4WJ0 A;  1E86 A;  3DAF A;  3LS0 A;  1YAU O;  3BRJ A;  2KW3 C;  4IGG A;  1Q0G A;  3U9M A;  5L0C A;  1XZP A;  4I44 A;  1M2V A;  1YZA A;  2I15 A;  5A6J A;  1ORJ A;  4RDA A;  5JS5 A;  3H2U A;  4K1O A;  5BQG A;  1CPR A;  1G4U S;  3E9V A;  4JCZ A;  1D1A A;  1BDJ B;  1C02 A;  2HKV A;  2YL7 A;  5EK0 A;  1WN0 A;  2NSF A;  3EGX A;  3LS1 A;  4ULV A;  1M6T A;  3HLZ A;  4O6M A;  5DVW A;  4YL3 A;  4AK9 A;  2FGY A;  5DQZ A;  2NG1 A;  2F22 A;  2GFH A;  4CDY A;  2KQ9 A;  2L6G A;  2VCB A;  3GAN A;  5DS6 A;  5L0F A;  4E18 A;  3K6B A;  3S90 A;  3OWT A;  3SZR A;  2HS5 A;  3JRM O;  3EG9 B;  3HNL A;  4ANJ A;  2OKU A;  1LE2 A;  2MYS A;  2XM4 A;  3H2V A;  3EH1 A;  3EZI A;  4U9E A;  1PV3 A;  3SYN A;  1T9K A;  3N0T A;  4EKW A;  1WAT A;  2A6H F;  1K40 A;  1ZW3 A;  4MVU A;  1YVI A;  4JJG A;  1D0Y A;  1MQV A;  2LFD A;  2WVN A;  3OA1 A;  2XLV A;  4O6N A;  4D4N A;  2YVK A;  3Q6M A;  1JR8 A;  4MS2 A;  2NSG A;  5DQT A;  4KNV A;  1QQ3 A;  1V55 C;  1OCR C;  1HMD A;  2A6E F;  1GS9 A;  4FAP B;  1NG1 A;  1TWC A;  2J9B A;  1HY5 A;  3DE8 A;  1BR1 A;  4OIN F;  1QVX A;  4QI2 A;  1A41 A;  1I4Y A;  1ZHW A;  1NFO A;  1EI7 A;  2EIL C;  3I5P A;  3NYM A;  1OKK D;  3US6 A;  4JJF A;  4DVY P;  4P6I C;  3S9O A;  1HMO A;  2GWW A;  4MW8 A;  2HJM A;  2NUP B;  4MVO A;  2P6V A;  2H8A A;  5JRA A;  2PF4 E;  3EFO B;  5KYX B;  2VH3 A;  4EUK B;  2OG2 A;  3ZTM A;  4OD5 A;  2P1A A;  4IAQ A;  1ZVZ A;  4IAR A;  2OCC C;  5B3I A;  4NC3 A;  5HSW A;  4BJ6 C;  4Q5S F;  1Z3I X;  4E17 A;  4EHP A;  5JVE A;  1V54 C;  2QE9 A;  3NMK A;  4Z9I A;  3VRC A;  3GEI A;  3ZDL A;  3C62 A;  3C63 A;  3ZIB A;  4L6R A;  2YL0 A;  4MND A;  1C17 M;  5E3A A;  4N6C A;  3IQ5 A;  3ZWI A;  3C8G A;  2WZL A;  4KI2 A;  2CNW D;  4NTA A;  1C03 A;  4PJJ A;  1SR2 A;  1OCZ C;  4XLN F;  4C3E A;  4U9D A;  4AL0 A;  1R4T A;  3IEE A;  4AE4 A;  2D4U A;  1R5I D;  2B0J A;  2Q9C A;  1BBH A;  2WZG A;  2P7V A;  3HNK A;  3KYJ A;  3V5Z A;  3WG7 C;  1E83 A;  1MND A;  4W8P A;  1RKE B;  5COM A;  4DVZ A;  2EPK X;  1VOM A;  3T6G B;  4E0H A;  3JYY A;  4U5C E;  1U6H A;  3GOR A;  4R32 A;  3UMH A;  3LJB A;  2EIM C;  3LLK A;  3MFN A;  3R2P A;  1D1B A;  4EWC A;  1Q0D A;  4Q4Z F;  3O55 A;  5KYY B;  1LKX A;  1A7E A;  4XEV A;  3IHU A;  2DI3 A;  3FOO A;  4C7O B;  1LE4 A;  1NSG B;  1OCO C;  2OOC A;  2CYD A;  2L81 A;  3N2Z B;  1OXB A;  2RSE B;  4C3B A;  4XPY A;  2YWA A;  1O3U A;  3NYL A;  2LSE A;  2Q00 A;  3DM9 B;  4XEF A;  2VC9 A;  3DJN B;  4BJ6 A;  1RKC A;  3JSE O;  5AGF A;  2R7O A;  2ZXP A;  3U9J A;  1U89 A;  2H7V C;  3AG1 C;  4C3D A;  4CJO A;  2L9J A;  2HZ8 A;  2HMZ A;  2XLO A;  3QVY A;  2R7R A;  3TOL A;  1Y4C A;  1T5O A;  1CPQ A;  4ZLD A;  1ZZP A;  1A0B A;  5COG A;  2Y3D A;  3EPV A;  3FAP B;  3E70 C;  2OQM A;  3GWL A;  2XLD A;  5D91 A;  3JYH A;  5KYW A;  2B0H A;  3B71 A;  4XPW A;  5JSL A;  3ZQV A;  3DXJ F;  2NUT A;  3PMR A;  3I5Q A;  2HMQ A;  3MBG A;  2V3C C;  5E33 A;  2J45 A;  4MVQ A;  1NU7 D;  2A69 F;  4YN0 B;  4CJG A;  1YDI A;  2HJ3 A;  2IXN A;  2OEV A;  2YLI A;  5GPG B;  3KL4 A;  1ST6 A;  4LLC A;  3PCV A;  4DRI B;  3K66 A;  5CIV A;  3W2V A;  3GEH A;  2YKZ A;  1WWP A;  3C18 A;  4M63 A;  1LIH A;  4N4W A;  1APC A;  3O39 A;  1HE9 A;  2L6H A;  4NTB A;  3V5Y A;  3FXH A;  2IXO A;  2OJQ A;  1OW7 A;  3DE9 A;  3FAJ A;  4MVS A;  2E87 A;  3PDM P;  2DB4 A;  3AQC A;  2W4M A;  4BG0 A;  1BR4 A;  1VYK A;  2V26 A;  3JT1 A;  3AJM A;  3NMI A;  4DOZ A;  2XXA A;  1Y6D A;  1K05 A;  2YHS A;  4A4A A;  2R05 A;  3KPH A;  2CW0 F;  3VF0 A;  4PJM A;  1YYJ A;  2J8W A;  1UG7 A;  3PHF 2;  1Q0K A;  3QVZ A;  2HSB A;  1EQ1 A;  3K33 A;  4OD4 A;  4GYT A;  1OR2 A;  4O7G A;  2XS8 A;  3S29 A;  3CQZ A;  4CSA A;  3U5S A;  4I3M A;  4JKV A;  4HFK B;  2IOQ A;  4H4K C;  1OQC A;  1IZM A;  2LQG A;  1O87 A;  2ZD9 A;  2X0C A;  2YEV A;  3TOM A;  4BJT A;  1FAP B;  3GOD A;  3DAG A;  1YZC A;  2CCY A;  5L0I A;  1I4Z A;  3V7O A;  2DGJ A;  5L3Q A;  4U5H A;  4NCQ A;  2XSE A;  1I5N A;  4PK4 A;  3FDQ A;  3BEH A;  2LP4 A;  4JE9 A;  1M2V B;  3UR3 C;  4IRU A;  3V5X A;  1BR2 A;  1O5H A;  4DRJ B;  1L3P A;  5A6A A;  4DXW A;  4YT2 A;  3LLI A;  4IB4 A;  4CBE A;  1V74 B;  4J30 B;  2IXM A;  4PFP A;  1T6I A;  3W8H A;  1RJ9 A;  3EGX B;  2W4B A;  2YZS A;  2AWC A;  3ZSU A;  2JPU A;  3RIP A;  2GAQ A;  1KU2 A;  3WHN A;  3EHN A;  1YYX A;  2W9Y A;  3HJC A;  2AU5 A;  1RXQ A;  3GWN A;  5TJ5 E;  3GM3 A;  1A7V A;  3W2W A;  2R7S A;  2P0N A;  1JOG A;  5JT4 A;  1Z7Q c;  4JUR I;  5F5F A;  3B0V C;  1L7C A;  3K1H A;  1JPN A;  2QNL A;  4F4B A;  2EPM X;  1DOW A;  1CGO A;  1ORS C;  3EHM A;  4KC9 A;  4QI0 A;  2ZPA A;  2XLE A;  3W4Y A;  5E3C A;  1GGQ A;  2X51 A;  1EKY A;  2UUI A;  4BEM J;  1RMV A;  1A7D A;  2PX3 A;  3EH2 A;  1UFB A;  3DMD A;  1LPE A;  3L0I A;  4CX9 A;  1U0B B;  4RD9 A;  3ZTZ A;  2Q7R A;  2ZXO A;  5A6B A;  4FES A;  4K0D A;  4MTO A;  3I4U A;  2FFH A;  3LNR A;  3B0P A;  3SNH A;  2NPU A;  3TQO A;  4JEB A;  3ABK C;  2ICW G;  3RKO F;  5AC4 A;  5JUA A;  2XL8 A;  4KBL A;  3VM6 A;  1H6G A;  2EIN C;  2NUP A;  4U5B E;  3UMI A;  5L0H A;  3EGD B;  2YL3 A;  3B0U X;  3C8G D;  1VB5 A;  4GQH A;  3JZ0 A;  3SXM A;  1FFH A;  1JMW A;  1M57 C;  1TR2 A;  3IQT A;  4LDK A;  5B1A C;  2FAP B;  4AL1 A;  2C03 A;  3ITF A;  3M1C B;  2VCC A;  1XZQ A;  4ULW A;  5KYU B;  3QZC A;  4OIQ F;  4JEA A;  3S27 A;  3LUT B;  4FWV A;  2PBE A;  3C8Z A;  2OJE D;  4MVR A;  3UNG C;  3QW1 A;  1RCP A;  1VLT A;  3DZA A;  3C8G B;  2XLW A;  3RQE A;  3NMJ A;  4YK5 A;  4B6I A;  4BPM A;  3IQC A;  3AG3 C;  1ZU5 A;  2KYH A;  4AE4 B;  4PJN A;  5BQH A;  1T6U A;  4HFF B;  4LDQ A;  4LDR A;  4DBQ A;  1M56 C;  1E2X A;  4G0H A;  4JCH A;  1FFT C;  4XEK A;  2MWQ A;  3RF3 A;  1ZHZ A;  3DJU B;  1M2O A;  1D1C A;  4N06 A;  3RVZ A;  4IAO A;  2ZXW C;  2XL4 A;  3L1M A;  4U5F E;  3MLG A;  3LEV A;  1TWH A;  4A2N B;  3UGO A;  2OU6 A;  1V4A A;  3NKD A;  1LM3 B;  4XPX A;  5IY5 C;  1TFO B;  1IW7 F;  2KK1 A;  2QY9 A;  4O79 A;  5AC5 A;  5L3V A;  2GA0 A;  3TD7 A;  5T1D B;  2ZXR A;  3T6J A;  3F46 A;  3M4B A;  2KGO A;  4E7Z A;  4G7H F;  3MYI A;  3AGU A;  3L8J A;  2AWY A;  2XLH A;  5CI8 A;  4CSA C;  5L0D A;  2R03 A;  3O6X A;  1ZHT A;  1T01 A;  1VYI A;  2HSQ A;  3SP1 A;  1ZHY A;  1AVO B;  2KSF A;  2LIG A;  2XS1 A;  3F47 A;  3Q7G A;  4YJW A;  5F28 E;  2IBF A;  1T6Q A;  2J46 A;  4ONS A;  2YQY A;  4DBR A;  1WGW A;  3R7C A;  3KMI A;  4NQF A;  2Y3H A;  3UMK A;  2A0U A;  2IM8 A;  3JTL O;  5E2Q A;  5JLI A;  1E84 A;  2J7P A;  2A68 F;  1SZI A;  3S28 A;  1TQG A;  1MNE A;  1OR3 A;  1QZX A;  4K7B A;  1PD0 A;  2EIK C;  5KYW B;  3DI5 A;  3AOU A;  2NUT B;  2WZF A;  3AG4 C;  4G7Z F;  4NTF A;  4AX2 A;  4CS9 C;  1KTM A;  2EPN A;  4YL0 A;  1J8M F;  3H65 A;  3IQ6 A;  2EPL X;  2PX0 A;  4E7S A;  4N6H A;  2R7W A;  1Q0M A;  1ZYR F;  4MTF A;  3T4R A;  4U5G A;  1NZE A;  2LD6 A;  2EPO A;  2YRF A;  2KNH A;  5T3T A;  4OIR F;  4JC7 A;  2A0B A;  4EBK A;  5EHH A;  4IWB A;  2ETS A;  3NKE A;  1QLE C;  1LS4 A;  1H7I A;  2RD9 A;  4J7Y A;  3C7J A;  3U8V A;  5K0I A;  1JRA A;  4ER9 A;  3X1O A;  2OEX A;  5HV9 A;  3TJ5 A;  4CS8 C; 
#chains in the Genus database with same CATH homology
 4XPY A;  3WAQ A;  1HMD A;  2AVK A;  3AGT A;  1I4Z A;  2HMZ A;  1I4Y A;  4XPX A;  1A7D A;  1HMO A;  3AGU A;  4XPW A;  2MHR A;  2AWY A;  2AWC A;  2HMQ A;  3WHN A;  1A7E A;  4XQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...