1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen transport
molecule keywords MYOHEMERYTHRIN
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
2AWCA 1A7EA 4XPYA 2AWYA 1I4ZA 2MHRA 4XPXA 1HMOA 4XPWA 1HMDA 1I4YA 2HMZA 3WAQA 1A7DA 3AGUA 2HMQA 3AGTA 4XQ1A 3WHNA 2AVKA
chains in the Genus database with same CATH superfamily
1ZZPA 5AC5A 1TWAA 1A7EA 1RJ9B 3EGDB 3GM2A 3FHDA 3W2VA 2YEVA 3U3BA 1YZCA 2ASRA 1T6QA 4MVMA 3POVA 2VASA 2TMVP 2OG2A 1MQVA 1RKCA 4DJ9A 1Q0GA 3AOUA 3C7JA 1D0ZA 4YT8A 1ZW2A 2WZFA 3C8GB 1VK5A 4IAOA 3UGOA 4YL1A 3VRCA 2VCBA 1MNEA 4ANJA 4E18A 5L3VA 1WOLA 3NMKA 1YJGA 5B3SC 5L0CA 1TR2A 1YARO 2EINC 5COGA 5BQHA 1AUEA 1VYIA 1R4TA 1WTYA 2RSEB 3FDQA 4GEHA 4C3EA 1FTSA 1JAFA 4C3DA 1D1CA 2L6GA 4OIQF 2R7XA 4YT2A 2QTVA 2XLHA 4JEBA 4U5DE 2J7PA 3N24A 5F28E 1VMAA 3IEEA 3KKBA 3HTKC 4E7ZA 1OCOC 3EGXB 3S9OA 1Z5ZA 3DZAA 4PJNA 5E3AA 4KNVA 5JVEA 1TFOB 2L81A 1MMAA 1L3PA 5JUAA 2CNWA 4NY3A 3DM9B 4XEFA 1HW1A 2EIJC 3GM1A 2XL6A 3WG7C 2NUTB 1BDJB 3E9VA 1V74B 3FOPA 2AWYA 2PNOA 2CCYA 3GWLA 4G78A 2EILC 3RQFA 4F4BA 4JE9A 3ABMC 3IQCA 2YVKA 3A9CA 2Y3BA 2YLGA 1VOMA 3BEHA 3VAYA 1R5ID 5AC4A 4MTFA 3L8JA 4JEAA 4JJFA 4R32A 4WABA 4G7ZF 1D1AA 4I1MA 4XLNF 1M2OA 2BC5A 1S7ZA 2KYHA 5JRAA 1D0XA 4Z9JA 3DM5A 5E2QA 1T5OA 3QW1A 4KNWA 4O79A 4WGYA 1IW7F 3W4YA 1QPUA 4CDAA 3FOOA 5CI9A 4BJ5C 2P0NA 2HMQA 1CPQA 3S29A 1BR4A 2XSEA 1OCCC 2IYLD 4AK9A 1T9KA 3M4CA 3QZCA 4J7YA 1FAPB 4XWJA 2YL0A 2YL3A 4OD4A 3SEOA 2VH3A 1E83A 3B0PA 2KK1A 3SXZA 2A69F 4H4KC 3DI5A 4PJMA 1D1BA 3NMIA 4BEMJ 2W45A 3GANA 5A6BD 2IBFA 1LIHA 4JKVA 4LERA 5A69A 1JMWA 2LFFA 1GQAA 1DOWA 3ECSA 3RQGA 3ZSUA 1MMNA 2LIGA 4CIPA 5L0GA 3NRHA 3NMJA 4DRJB 1YA9A 3LEVA 4FESA 3T9OA 3B9QA 4PJLA 2A0UA 3M1CB 4U5HA 4JZAA 3U9MA 3ZQYA 4EUKB 3O6XA 1KNYA 4U9EA 2MYSA 2OJQA 1VTMP 2PX0A 3JZ0A 4HEAJ 1G5ZA 4MVQA 4HE8D 3IQ5A 3JTLO 4PK4A 4XEKA 2GAQA 4E0HA 4EIYA 3LJBA 2KW3C 1O5HA 2QY9A 4DBRA 4N6HA 1YYJA 3RVYA 1ORYA 3VF0A 3LNRA 1E84A 1CGME 1H6GA 1OCZC 2L9JA 3F46A 2FAPB 1RKEA 1QZXA 2KSFA 2XL8A 4NQFA 3R7CA 1VLSA 2FGYA 3MLGA 3N2ZB 3JYHA 4JTDB 4JURI 3RQEA 2H7VC 3NYLA 4O6YA 5JLIA 3B0VC 2BL2A 1YZAA 1OQCA 3EH1A 3O55A 4Q4ZF 4MVUA 3I5PA 1O87A 1JRAA 2DYRC 2OJED 3GWNA 3LLKA 5AGFA 5FZTA 3U5SA 1TWHA 4W8KA 3DAGA 4XPXA 5A6AA 1K40A 1WWPA 2IXOA 2XL4A 3VYWA 4IAQA 2YQYA 1FR0A 4WJ0A 3EG9B 2Y39A 1W2WA 2D4UA 4K0DA 4JC7A 4OIOF 2Y3DA 3WAQA 3FAJA 4MW3A 2R7RA 3A11A 4U9DA 1TQGA 5F5FA 4I3MA 3NKDA 4NTAA 1HW2A 1Q0MA 3ASNC 3HLZA 2J9WA 3X2QC 3ZTMA 3HNKA 1CPRA 2R7WA 3K7DA 2LP4A 1ZHYA 2WZGA 3GM3A 3RIPA 2HUJA 1T01A 1JPJA 3K6BA 4JCZA 2C04A 1WASA 2Q4FA 3O39A 5KYNA 3RVZA 2P61A 2L6FA 1YDIA 2CDQA 2R05A 5B1AC 2MWQA 2G62A 3AG1C 5DQZA 1O3UA 1PCXA 2XLDA 3RKOF 1Q0FA 3T6GB 2VCCA 4U5FE 2OOCA 4P6IC 2F22A 4WGZA 4E17A 4EKWA 1LE4A 4CS8C 4G7HF 2HMZA 3ZC4A 4O6NA 1WN0A 1V54C 3JYYA 3LAYA 1UG7A 4LDRA 4QI0A 1E2XA 1U0BB 2Y69C 2R7UA 1CGNA 2YZSA 1V4AA 2NPUA 3AJMA 3CQZA 4PACA 4PR9A 4CS7A 2HFIA 5BQGA 2ZPAA 2H8AA 2IXNA 1OKKD 4XPYA 5F5HA 1HMOA 3QTHA 2CNWD 4JIOA 3WODF 2OEXA 1SR2A 5T3TA 3RH3A 4DXWA 1SZIA 3MYIA 3B0UX 2J0WA 2J8WA 2ZXRA 4JW1A 4U5EE 4YN0B 2IM8A 2W9YA 2NUPA 2NSFA 3AQBA 3SZRA 3UMKA 1MNDA 4XLPF 3NKEA 2R7SA 3V5ZA 3Q6MA 1OKKA 3T4RA 5A6JA 3LEOA 2OQMA 2A68F 3AGTA 3JSZA 3PHF2 2D5RB 2RD9A 4KC9A 3SXKA 5JSLA 2JPUA 4MVSA 3QVZA 3EH2A 3M15A 4MNDA 5JS5A 4IARA 2FFHA 2DB4A 2Y3HA 3QMKA 5L0FA 1ZU5A 1PD1A 2R03A 3V7OA 4JTAB 4U5CE 4Z9IA 1M57C 4AE4B 3K33A 4EBBA 2PFDA 4A4AA 2PX3A 2YHSA 1RJ9A 1Z6AA 3EGDA 3RF3A 5T1DB 3U0CA 4LLCA 2HKVA 1WGWA 5COFA 1FNTc 3EHMA 1A7DA 2XRHA 1OW8A 4J32B 3US6A 2A0BA 3R2PA 2R7VA 2CW0F 4G7OF 3LLIA 2Q9CA 5EGYA 2YL1A 1LS4A 2Y3GA 2VCAA 2YLIA 2DYSC 5E33A 2PP4A 4IRUA 3RFYA 2J45A 4MQ9F 2EIMC 4CSAA 1F1MA 3QW0A 2UUIA 3SNHA 2HS5A 3IPMO 1GM5A 3EQLF 4LACB 3MBGA 4CBEA 3IQ6A 4JCHA 2VC9A 3TOMA 3ZG1A 3H65A 4MVOA 3PMRA 2A1DD 4YJWA 4RBNA 3DJUB 3FAPB 2XLVA 1HY5A 1M6TA 3HKKA 3N0TA 4MS2A 1Y4CA 4P9TA 3LESA 2NUTA 1YA7O 1J8YF 3EZHA 2EPMX 3C63A 3K1IC 4ULWA 4X0RA 5E3CA 3F47A 3C8ZA 3I5QA 4I1OB 2P6VA 4EBJA 1NBBA 3C62A 4NCQA 2J46A 4A2NB 5BUOA 5CIVA 2A6EF 4CSAC 5L0HA 4HFFB 1ZHTA 4D4NA 5KYWA 5KYUA 1OCRC 2B0HA 2LK4A 4ER9A 4ZLDA 1QKRA 2KC3A 1AVOB 1L7CA 3H2VA 2W4BA 3LS0A 3OWTA 4J30B 3MYFA 1NZEA 1QLEC 2HV6A 2M4EA 2GA0A 2R7QA 3L0IA 4QDLA 3PDMP 1KTMA 2ETSA 3L34A 5L0IA 1VYKA 1LI7A 2WVQA 4BG0A 1H9GA 3ZDLA 3K66A 1K05A 1OW6A 2L7AA 2YL7A 1GS9A 3NYMA 4CS8A 3O10A 2HSBA 4L6RA 3B29A 2BE5F 3C8GD 2AU5A 4XTKA 3EJNA 5BQIA 1OR2A 4U5GA 2ZD9A 3UR3C 3SXYA 2JX0A 2ZXWC 5B3IA 4CIHA 2DI3A 4BEJA 4MTGA 3S0XA 3AG2C 4OIRF 1NU9C 1PD0A 1BBHA 2IOQA 4ONSA 4B6IA 4N6CA 4YL3A 3M79A 5D91A 5T3WA 4E7SA 1Z3IX 4BJ6C 5A6BA 4DRIB 1A41A 1LKXA 3KYIA 5L3QA 5EHHA 1HMDA 3KH2A 2JD3A 1OR3A 2DGJA 3ITFA 4YT4A 3V5XA 4DVZA 4OINF 1Z63A 1TWCA 2LQGA 1EKYA 3FVYA 1NSGB 2EPNA 2HZ8A 2R25A 4Q5SF 2GWWA 3PCVA 4LDQA 4IB4A 4RD9A 3UNGC 3G50A 1BR1A 3GEIA 4ULVA 2HJMA 4BJ1A 2R02A 1Z23A 1QQ3A 2PF4E 2X51A 3G4ZA 1HE1A 3JRMO 5DS6A 3MX3A 2KJGA 2MHRA 2OEVA 2XLEA 2ZXOA 2CGEA 3EGXA 5L0JA 1LI5A 2ICWG 1KU2A 1JOGA 3V5YA 4RDAA 2Q7RA 1EQ1A 1EI7A 1APCA 4GQHA 1Y6DA 1YLMA 3EFOA 1ZHWA 3E70C 5DVWA 3W2WA 1B68A 1E86A 3AG4C 2Q00A 2EPOA 3VM6A 1VLTA 3J06A 2HJ3A 1BZ4A 1NFNA 3FXHA 2IXMA 1XWJA 3OEOA 1YAUO 1C17M 2XXAA 2EIKC 2HSQA 3AGUA 4IJJA 4K7BA 2CYDA 2OU6A 2G3KA 4AL0A 3DWWA 1G4US 2I15A 3TJ5A 3L1MA 1G8XA 4YT5A 5JP7A 4BJ6A 3JCUQ 1IZMA 1JPNA 1FMWA 2OCCC 3BRJA 2Q9AA 1C03A 2XLOA 3KPHA 5HSWA 1VB5A 3MFNA 3L8IA 5DLJA 2KQ9A 1T6IA 2LFDA 1WATA 3RW0A 4BJTA 4E0IA 3UMHA 1T6UA 3SP1A 5HV9A 3ZIBA 3C18A 4KBLA 3RYLA 3Q7LA 2C03A 2XM4A 1RCPA 1GGQA 3WHNA 3JT1A 3DJNB 256BA 4J7TA 1NG1A 5IY5C 3S90A 4N06A 4YK5A 2O9XA 2XLWA 3CSKA 2EPLX 3ASOC 1PV3A 4PFPA 4D4XA 4NTFA 1ORJA 4CJGA 2GFHA 3CZ6A 3TQOA 2WVOA 4MW8A 3UMIA 1TWGA 1LE2A 4MTOA 1SF8A 2QE9A 2HV7A 3T6BA 1G4WR 2J9VA 1ZVZA 4BJ5A 3HJCA 2J0XA 3B71A 5KYXB 1TFKB 4C3BA 4JTCB 3ABKC 4GYTA 4EBKA 4XEVA 4C7OA 4PJJA 4AE4A 3JRTA 2Z15A 4P9FA 1FFHA 3C8GA 1A0BA 1D0YA 2WZLA 1ZHXA 3HNLA 3NYJA 5TJ5E 1RXQA 2IXPA 1TKNA 4JRZA 3IHUA 4KI2A 1LM3B 3JSEO 3U9JA 2G3VA 4LLEA 4MVZA 4XPWA 3KYJA 4FWVA 3UGPA 4IGGA 3SXMA 3TJ6A 1LVKA 4OIPF 2P7VA 2I8BA 3U3FA 1QSPA 1FMVA 1YYXA 2XM0A 3T6JA 5K0IA 4M63A 3SYNA 3DMDA 1LS1A 2WB7A 2GDCA 3AQCA 1OXKA 1V55C 4W8PA 5B1BC 2R7OA 3DXJF 1M2VB 2EPKX 1Z7Qc 2H7OA 2H7BA 4AL1A 3ZQVA 5L0DA 3Q7GA 3FMSA 1NFOA 1AEPA 2J9BA 3U8VA 1S05A 1RKEB 1ZHZA 3LS1A 1FFTC 1M2VA 3DD7A 3DKAA 4JVSA 4NC3A 3TOLA 3ZTZA 5GPGB 2B0JA 1QVXA 5DS5A 2AVKA 1SYQA 2V26A 2ZXPA 1EA8A 3CEXA 2A6HF 3W8IA 2OKUA 2LSEA 4YWQA 3S84A 3S27A 3ABLC 3DAFA 3EZIA 2Q3TA 3KL4A 4C7OB 4XQ1A 3EFOB 2KNHA 4QI2A 4H54A 5D92A 3ATPA 5EK0A 3OA1A 4DOZA 3Q6NA 2LCHA 1C02A 2W4MA 2WVNA 1ST6A 2X0CA 5A6KA 2WL8A 3TULA 1RMVA 2XS1A 3AG3C 2XXAB 2L6HA 4K1OA 3EG9A 4DVYP 1CGOA 1XZQA 2R9RB 4PFOA 2XLMA 4HFKB 4CJOA 3QVYA 3KMIA 3U2MA 1ZW3A 5KYUB 1HE9A 1J8MF 3TK0A 3M4BA 4O7GA 4CS9A 3GODA 4N4WA 1NU7D 1K04A 2M64A 3DE8A 5CI8A 1OXBA 5JT4A 3NDBB 3LUTB 1E85A 1DOVA 4LDKA 1I4ZA 2YLDA 5DS4A 5DQTA 4CDVA 1Q0DA 2QNLA 3G4XA 2AWCA 3W8HA 3NG1A 3HNIA 2E87A 3DE9A 3K1HA 4DBQA 1MMDA 4FX5A 4YL0A 5FCLA 3H2UA 3U2LA 2Q9BA 2KGOA 2UUHA 2YKZA 5KYYB 1ZU4A 4G0HA 5KYXA 3X1OA 1YVIA 1OW7A 4O6MA 1LPEA 1MMGA 4Q7CA 1U89A 2YRFA 3EHNA 3GEHA 5COMA 1ORSC 5KYYA 2NSGA 2V3CC 4AX2A 1SMYF 3TD7A 1M56C 4OD5A 4Z9HA 3U8PA 1H7IA 1A7VA 1XZPA 1N1CA 1I5NA 3HNJA 2NUPB 2NG1A 4UDVA 4MVRA 3S28A 4DRHB 5KYWB 1I4YA 2P1AA 4EHPA 3LNMB 4FAPB 4IWBA 4CX9A 1NLXA 2J9UA 3EPVA 1ZYRF 1H9TA 3ZWIA 2VB6A 4CDYA 1Q0KA 2J7PD 4ZLCA 4U5BE 2QUPA 4JJGA 2PBEA 4EWCA 2AP3A 3GEEA 3IQTA 3ZVRA 1U6HA 2R7TA 1UFBA 2XS8A 3CAXA 4BPMA 4NTBA 3I4UA 4CS9C 3K1IA 4I44A 2QLAA 1BR2A 1JR8A 2LD6A 2YWAA 3GORA
chains in the Genus database with same CATH topology
2AWCA 1A7EA 4XPYA 2AWYA 1I4ZA 2MHRA 4XPXA 1HMOA 4XPWA 1HMDA 1I4YA 2HMZA 3WAQA 1A7DA 3AGUA 2HMQA 3AGTA 4XQ1A 3WHNA 2AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWC A;  1A7E A;  4XPY A;  2AWY A;  1I4Z A;  2MHR A;  4XPX A;  1HMO A;  4XPW A;  1HMD A;  1I4Y A;  2HMZ A;  3WAQ A;  1A7D A;  3AGU A;  2HMQ A;  3AGT A;  4XQ1 A;  3WHN A;  2AVK A; 
#chains in the Genus database with same CATH topology
 1ZZP A;  5AC5 A;  1TWA A;  1A7E A;  1RJ9 B;  3EGD B;  3GM2 A;  3FHD A;  3W2V A;  2YEV A;  3U3B A;  1YZC A;  2ASR A;  1T6Q A;  4MVM A;  3POV A;  2VAS A;  2TMV P;  2OG2 A;  1MQV A;  1RKC A;  4DJ9 A;  1Q0G A;  3AOU A;  3C7J A;  1D0Z A;  4YT8 A;  1ZW2 A;  2WZF A;  3C8G B;  1VK5 A;  4IAO A;  3UGO A;  4YL1 A;  3VRC A;  2VCB A;  1MNE A;  4ANJ A;  4E18 A;  5L3V A;  1WOL A;  3NMK A;  1YJG A;  5B3S C;  5L0C A;  1TR2 A;  1YAR O;  2EIN C;  5COG A;  5BQH A;  1AUE A;  1VYI A;  1R4T A;  1WTY A;  2RSE B;  3FDQ A;  4GEH A;  4C3E A;  1FTS A;  1JAF A;  4C3D A;  1D1C A;  2L6G A;  4OIQ F;  2R7X A;  4YT2 A;  2QTV A;  2XLH A;  4JEB A;  4U5D E;  2J7P A;  3N24 A;  5F28 E;  1VMA A;  3IEE A;  3KKB A;  3HTK C;  4E7Z A;  1OCO C;  3EGX B;  3S9O A;  1Z5Z A;  3DZA A;  4PJN A;  5E3A A;  4KNV A;  5JVE A;  1TFO B;  2L81 A;  1MMA A;  1L3P A;  5JUA A;  2CNW A;  4NY3 A;  3DM9 B;  4XEF A;  1HW1 A;  2EIJ C;  3GM1 A;  2XL6 A;  3WG7 C;  2NUT B;  1BDJ B;  3E9V A;  1V74 B;  3FOP A;  2AWY A;  2PNO A;  2CCY A;  3GWL A;  4G78 A;  2EIL C;  3RQF A;  4F4B A;  4JE9 A;  3ABM C;  3IQC A;  2YVK A;  3A9C A;  2Y3B A;  2YLG A;  1VOM A;  3BEH A;  3VAY A;  1R5I D;  5AC4 A;  4MTF A;  3L8J A;  4JEA A;  4JJF A;  4R32 A;  4WAB A;  4G7Z F;  1D1A A;  4I1M A;  4XLN F;  1M2O A;  2BC5 A;  1S7Z A;  2KYH A;  5JRA A;  1D0X A;  4Z9J A;  3DM5 A;  5E2Q A;  1T5O A;  3QW1 A;  4KNW A;  4O79 A;  4WGY A;  1IW7 F;  3W4Y A;  1QPU A;  4CDA A;  3FOO A;  5CI9 A;  4BJ5 C;  2P0N A;  2HMQ A;  1CPQ A;  3S29 A;  1BR4 A;  2XSE A;  1OCC C;  2IYL D;  4AK9 A;  1T9K A;  3M4C A;  3QZC A;  4J7Y A;  1FAP B;  4XWJ A;  2YL0 A;  2YL3 A;  4OD4 A;  3SEO A;  2VH3 A;  1E83 A;  3B0P A;  2KK1 A;  3SXZ A;  2A69 F;  4H4K C;  3DI5 A;  4PJM A;  1D1B A;  3NMI A;  4BEM J;  2W45 A;  3GAN A;  5A6B D;  2IBF A;  1LIH A;  4JKV A;  4LER A;  5A69 A;  1JMW A;  2LFF A;  1GQA A;  1DOW A;  3ECS A;  3RQG A;  3ZSU A;  1MMN A;  2LIG A;  4CIP A;  5L0G A;  3NRH A;  3NMJ A;  4DRJ B;  1YA9 A;  3LEV A;  4FES A;  3T9O A;  3B9Q A;  4PJL A;  2A0U A;  3M1C B;  4U5H A;  4JZA A;  3U9M A;  3ZQY A;  4EUK B;  3O6X A;  1KNY A;  4U9E A;  2MYS A;  2OJQ A;  1VTM P;  2PX0 A;  3JZ0 A;  4HEA J;  1G5Z A;  4MVQ A;  4HE8 D;  3IQ5 A;  3JTL O;  4PK4 A;  4XEK A;  2GAQ A;  4E0H A;  4EIY A;  3LJB A;  2KW3 C;  1O5H A;  2QY9 A;  4DBR A;  4N6H A;  1YYJ A;  3RVY A;  1ORY A;  3VF0 A;  3LNR A;  1E84 A;  1CGM E;  1H6G A;  1OCZ C;  2L9J A;  3F46 A;  2FAP B;  1RKE A;  1QZX A;  2KSF A;  2XL8 A;  4NQF A;  3R7C A;  1VLS A;  2FGY A;  3MLG A;  3N2Z B;  3JYH A;  4JTD B;  4JUR I;  3RQE A;  2H7V C;  3NYL A;  4O6Y A;  5JLI A;  3B0V C;  2BL2 A;  1YZA A;  1OQC A;  3EH1 A;  3O55 A;  4Q4Z F;  4MVU A;  3I5P A;  1O87 A;  1JRA A;  2DYR C;  2OJE D;  3GWN A;  3LLK A;  5AGF A;  5FZT A;  3U5S A;  1TWH A;  4W8K A;  3DAG A;  4XPX A;  5A6A A;  1K40 A;  1WWP A;  2IXO A;  2XL4 A;  3VYW A;  4IAQ A;  2YQY A;  1FR0 A;  4WJ0 A;  3EG9 B;  2Y39 A;  1W2W A;  2D4U A;  4K0D A;  4JC7 A;  4OIO F;  2Y3D A;  3WAQ A;  3FAJ A;  4MW3 A;  2R7R A;  3A11 A;  4U9D A;  1TQG A;  5F5F A;  4I3M A;  3NKD A;  4NTA A;  1HW2 A;  1Q0M A;  3ASN C;  3HLZ A;  2J9W A;  3X2Q C;  3ZTM A;  3HNK A;  1CPR A;  2R7W A;  3K7D A;  2LP4 A;  1ZHY A;  2WZG A;  3GM3 A;  3RIP A;  2HUJ A;  1T01 A;  1JPJ A;  3K6B A;  4JCZ A;  2C04 A;  1WAS A;  2Q4F A;  3O39 A;  5KYN A;  3RVZ A;  2P61 A;  2L6F A;  1YDI A;  2CDQ A;  2R05 A;  5B1A C;  2MWQ A;  2G62 A;  3AG1 C;  5DQZ A;  1O3U A;  1PCX A;  2XLD A;  3RKO F;  1Q0F A;  3T6G B;  2VCC A;  4U5F E;  2OOC A;  4P6I C;  2F22 A;  4WGZ A;  4E17 A;  4EKW A;  1LE4 A;  4CS8 C;  4G7H F;  2HMZ A;  3ZC4 A;  4O6N A;  1WN0 A;  1V54 C;  3JYY A;  3LAY A;  1UG7 A;  4LDR A;  4QI0 A;  1E2X A;  1U0B B;  2Y69 C;  2R7U A;  1CGN A;  2YZS A;  1V4A A;  2NPU A;  3AJM A;  3CQZ A;  4PAC A;  4PR9 A;  4CS7 A;  2HFI A;  5BQG A;  2ZPA A;  2H8A A;  2IXN A;  1OKK D;  4XPY A;  5F5H A;  1HMO A;  3QTH A;  2CNW D;  4JIO A;  3WOD F;  2OEX A;  1SR2 A;  5T3T A;  3RH3 A;  4DXW A;  1SZI A;  3MYI A;  3B0U X;  2J0W A;  2J8W A;  2ZXR A;  4JW1 A;  4U5E E;  4YN0 B;  2IM8 A;  2W9Y A;  2NUP A;  2NSF A;  3AQB A;  3SZR A;  3UMK A;  1MND A;  4XLP F;  3NKE A;  2R7S A;  3V5Z A;  3Q6M A;  1OKK A;  3T4R A;  5A6J A;  3LEO A;  2OQM A;  2A68 F;  3AGT A;  3JSZ A;  3PHF 2;  2D5R B;  2RD9 A;  4KC9 A;  3SXK A;  5JSL A;  2JPU A;  4MVS A;  3QVZ A;  3EH2 A;  3M15 A;  4MND A;  5JS5 A;  4IAR A;  2FFH A;  2DB4 A;  2Y3H A;  3QMK A;  5L0F A;  1ZU5 A;  1PD1 A;  2R03 A;  3V7O A;  4JTA B;  4U5C E;  4Z9I A;  1M57 C;  4AE4 B;  3K33 A;  4EBB A;  2PFD A;  4A4A A;  2PX3 A;  2YHS A;  1RJ9 A;  1Z6A A;  3EGD A;  3RF3 A;  5T1D B;  3U0C A;  4LLC A;  2HKV A;  1WGW A;  5COF A;  1FNT c;  3EHM A;  1A7D A;  2XRH A;  1OW8 A;  4J32 B;  3US6 A;  2A0B A;  3R2P A;  2R7V A;  2CW0 F;  4G7O F;  3LLI A;  2Q9C A;  5EGY A;  2YL1 A;  1LS4 A;  2Y3G A;  2VCA A;  2YLI A;  2DYS C;  5E33 A;  2PP4 A;  4IRU A;  3RFY A;  2J45 A;  4MQ9 F;  2EIM C;  4CSA A;  1F1M A;  3QW0 A;  2UUI A;  3SNH A;  2HS5 A;  3IPM O;  1GM5 A;  3EQL F;  4LAC B;  3MBG A;  4CBE A;  3IQ6 A;  4JCH A;  2VC9 A;  3TOM A;  3ZG1 A;  3H65 A;  4MVO A;  3PMR A;  2A1D D;  4YJW A;  4RBN A;  3DJU B;  3FAP B;  2XLV A;  1HY5 A;  1M6T A;  3HKK A;  3N0T A;  4MS2 A;  1Y4C A;  4P9T A;  3LES A;  2NUT A;  1YA7 O;  1J8Y F;  3EZH A;  2EPM X;  3C63 A;  3K1I C;  4ULW A;  4X0R A;  5E3C A;  3F47 A;  3C8Z A;  3I5Q A;  4I1O B;  2P6V A;  4EBJ A;  1NBB A;  3C62 A;  4NCQ A;  2J46 A;  4A2N B;  5BUO A;  5CIV A;  2A6E F;  4CSA C;  5L0H A;  4HFF B;  1ZHT A;  4D4N A;  5KYW A;  5KYU A;  1OCR C;  2B0H A;  2LK4 A;  4ER9 A;  4ZLD A;  1QKR A;  2KC3 A;  1AVO B;  1L7C A;  3H2V A;  2W4B A;  3LS0 A;  3OWT A;  4J30 B;  3MYF A;  1NZE A;  1QLE C;  2HV6 A;  2M4E A;  2GA0 A;  2R7Q A;  3L0I A;  4QDL A;  3PDM P;  1KTM A;  2ETS A;  3L34 A;  5L0I A;  1VYK A;  1LI7 A;  2WVQ A;  4BG0 A;  1H9G A;  3ZDL A;  3K66 A;  1K05 A;  1OW6 A;  2L7A A;  2YL7 A;  1GS9 A;  3NYM A;  4CS8 A;  3O10 A;  2HSB A;  4L6R A;  3B29 A;  2BE5 F;  3C8G D;  2AU5 A;  4XTK A;  3EJN A;  5BQI A;  1OR2 A;  4U5G A;  2ZD9 A;  3UR3 C;  3SXY A;  2JX0 A;  2ZXW C;  5B3I A;  4CIH A;  2DI3 A;  4BEJ A;  4MTG A;  3S0X A;  3AG2 C;  4OIR F;  1NU9 C;  1PD0 A;  1BBH A;  2IOQ A;  4ONS A;  4B6I A;  4N6C A;  4YL3 A;  3M79 A;  5D91 A;  5T3W A;  4E7S A;  1Z3I X;  4BJ6 C;  5A6B A;  4DRI B;  1A41 A;  1LKX A;  3KYI A;  5L3Q A;  5EHH A;  1HMD A;  3KH2 A;  2JD3 A;  1OR3 A;  2DGJ A;  3ITF A;  4YT4 A;  3V5X A;  4DVZ A;  4OIN F;  1Z63 A;  1TWC A;  2LQG A;  1EKY A;  3FVY A;  1NSG B;  2EPN A;  2HZ8 A;  2R25 A;  4Q5S F;  2GWW A;  3PCV A;  4LDQ A;  4IB4 A;  4RD9 A;  3UNG C;  3G50 A;  1BR1 A;  3GEI A;  4ULV A;  2HJM A;  4BJ1 A;  2R02 A;  1Z23 A;  1QQ3 A;  2PF4 E;  2X51 A;  3G4Z A;  1HE1 A;  3JRM O;  5DS6 A;  3MX3 A;  2KJG A;  2MHR A;  2OEV A;  2XLE A;  2ZXO A;  2CGE A;  3EGX A;  5L0J A;  1LI5 A;  2ICW G;  1KU2 A;  1JOG A;  3V5Y A;  4RDA A;  2Q7R A;  1EQ1 A;  1EI7 A;  1APC A;  4GQH A;  1Y6D A;  1YLM A;  3EFO A;  1ZHW A;  3E70 C;  5DVW A;  3W2W A;  1B68 A;  1E86 A;  3AG4 C;  2Q00 A;  2EPO A;  3VM6 A;  1VLT A;  3J06 A;  2HJ3 A;  1BZ4 A;  1NFN A;  3FXH A;  2IXM A;  1XWJ A;  3OEO A;  1YAU O;  1C17 M;  2XXA A;  2EIK C;  2HSQ A;  3AGU A;  4IJJ A;  4K7B A;  2CYD A;  2OU6 A;  2G3K A;  4AL0 A;  3DWW A;  1G4U S;  2I15 A;  3TJ5 A;  3L1M A;  1G8X A;  4YT5 A;  5JP7 A;  4BJ6 A;  3JCU Q;  1IZM A;  1JPN A;  1FMW A;  2OCC C;  3BRJ A;  2Q9A A;  1C03 A;  2XLO A;  3KPH A;  5HSW A;  1VB5 A;  3MFN A;  3L8I A;  5DLJ A;  2KQ9 A;  1T6I A;  2LFD A;  1WAT A;  3RW0 A;  4BJT A;  4E0I A;  3UMH A;  1T6U A;  3SP1 A;  5HV9 A;  3ZIB A;  3C18 A;  4KBL A;  3RYL A;  3Q7L A;  2C03 A;  2XM4 A;  1RCP A;  1GGQ A;  3WHN A;  3JT1 A;  3DJN B;  256B A;  4J7T A;  1NG1 A;  5IY5 C;  3S90 A;  4N06 A;  4YK5 A;  2O9X A;  2XLW A;  3CSK A;  2EPL X;  3ASO C;  1PV3 A;  4PFP A;  4D4X A;  4NTF A;  1ORJ A;  4CJG A;  2GFH A;  3CZ6 A;  3TQO A;  2WVO A;  4MW8 A;  3UMI A;  1TWG A;  1LE2 A;  4MTO A;  1SF8 A;  2QE9 A;  2HV7 A;  3T6B A;  1G4W R;  2J9V A;  1ZVZ A;  4BJ5 A;  3HJC A;  2J0X A;  3B71 A;  5KYX B;  1TFK B;  4C3B A;  4JTC B;  3ABK C;  4GYT A;  4EBK A;  4XEV A;  4C7O A;  4PJJ A;  4AE4 A;  3JRT A;  2Z15 A;  4P9F A;  1FFH A;  3C8G A;  1A0B A;  1D0Y A;  2WZL A;  1ZHX A;  3HNL A;  3NYJ A;  5TJ5 E;  1RXQ A;  2IXP A;  1TKN A;  4JRZ A;  3IHU A;  4KI2 A;  1LM3 B;  3JSE O;  3U9J A;  2G3V A;  4LLE A;  4MVZ A;  4XPW A;  3KYJ A;  4FWV A;  3UGP A;  4IGG A;  3SXM A;  3TJ6 A;  1LVK A;  4OIP F;  2P7V A;  2I8B A;  3U3F A;  1QSP A;  1FMV A;  1YYX A;  2XM0 A;  3T6J A;  5K0I A;  4M63 A;  3SYN A;  3DMD A;  1LS1 A;  2WB7 A;  2GDC A;  3AQC A;  1OXK A;  1V55 C;  4W8P A;  5B1B C;  2R7O A;  3DXJ F;  1M2V B;  2EPK X;  1Z7Q c;  2H7O A;  2H7B A;  4AL1 A;  3ZQV A;  5L0D A;  3Q7G A;  3FMS A;  1NFO A;  1AEP A;  2J9B A;  3U8V A;  1S05 A;  1RKE B;  1ZHZ A;  3LS1 A;  1FFT C;  1M2V A;  3DD7 A;  3DKA A;  4JVS A;  4NC3 A;  3TOL A;  3ZTZ A;  5GPG B;  2B0J A;  1QVX A;  5DS5 A;  2AVK A;  1SYQ A;  2V26 A;  2ZXP A;  1EA8 A;  3CEX A;  2A6H F;  3W8I A;  2OKU A;  2LSE A;  4YWQ A;  3S84 A;  3S27 A;  3ABL C;  3DAF A;  3EZI A;  2Q3T A;  3KL4 A;  4C7O B;  4XQ1 A;  3EFO B;  2KNH A;  4QI2 A;  4H54 A;  5D92 A;  3ATP A;  5EK0 A;  3OA1 A;  4DOZ A;  3Q6N A;  2LCH A;  1C02 A;  2W4M A;  2WVN A;  1ST6 A;  2X0C A;  5A6K A;  2WL8 A;  3TUL A;  1RMV A;  2XS1 A;  3AG3 C;  2XXA B;  2L6H A;  4K1O A;  3EG9 A;  4DVY P;  1CGO A;  1XZQ A;  2R9R B;  4PFO A;  2XLM A;  4HFK B;  4CJO A;  3QVY A;  3KMI A;  3U2M A;  1ZW3 A;  5KYU B;  1HE9 A;  1J8M F;  3TK0 A;  3M4B A;  4O7G A;  4CS9 A;  3GOD A;  4N4W A;  1NU7 D;  1K04 A;  2M64 A;  3DE8 A;  5CI8 A;  1OXB A;  5JT4 A;  3NDB B;  3LUT B;  1E85 A;  1DOV A;  4LDK A;  1I4Z A;  2YLD A;  5DS4 A;  5DQT A;  4CDV A;  1Q0D A;  2QNL A;  3G4X A;  2AWC A;  3W8H A;  3NG1 A;  3HNI A;  2E87 A;  3DE9 A;  3K1H A;  4DBQ A;  1MMD A;  4FX5 A;  4YL0 A;  5FCL A;  3H2U A;  3U2L A;  2Q9B A;  2KGO A;  2UUH A;  2YKZ A;  5KYY B;  1ZU4 A;  4G0H A;  5KYX A;  3X1O A;  1YVI A;  1OW7 A;  4O6M A;  1LPE A;  1MMG A;  4Q7C A;  1U89 A;  2YRF A;  3EHN A;  3GEH A;  5COM A;  1ORS C;  5KYY A;  2NSG A;  2V3C C;  4AX2 A;  1SMY F;  3TD7 A;  1M56 C;  4OD5 A;  4Z9H A;  3U8P A;  1H7I A;  1A7V A;  1XZP A;  1N1C A;  1I5N A;  3HNJ A;  2NUP B;  2NG1 A;  4UDV A;  4MVR A;  3S28 A;  4DRH B;  5KYW B;  1I4Y A;  2P1A A;  4EHP A;  3LNM B;  4FAP B;  4IWB A;  4CX9 A;  1NLX A;  2J9U A;  3EPV A;  1ZYR F;  1H9T A;  3ZWI A;  2VB6 A;  4CDY A;  1Q0K A;  2J7P D;  4ZLC A;  4U5B E;  2QUP A;  4JJG A;  2PBE A;  4EWC A;  2AP3 A;  3GEE A;  3IQT A;  3ZVR A;  1U6H A;  2R7T A;  1UFB A;  2XS8 A;  3CAX A;  4BPM A;  4NTB A;  3I4U A;  4CS9 C;  3K1I A;  4I44 A;  2QLA A;  1BR2 A;  1JR8 A;  2LD6 A;  2YWA A;  3GOR A; 
#chains in the Genus database with same CATH homology
 2AWC A;  1A7E A;  4XPY A;  2AWY A;  1I4Z A;  2MHR A;  4XPX A;  1HMO A;  4XPW A;  1HMD A;  1I4Y A;  2HMZ A;  3WAQ A;  1A7D A;  3AGU A;  2HMQ A;  3AGT A;  4XQ1 A;  3WHN A;  2AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...