1A7EA

Hydroxomet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWNVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport
molecule keywords MYOHEMERYTHRIN
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7eA00
2HMZA 1HMOA 1HMDA 4XPYA 1A7EA 2MHRA 1I4YA 4XPWA 3WHNA 3WAQA 1A7DA 2AWYA 2AWCA 2AVKA 2HMQA 3AGTA 4XPXA 1I4ZA 4XQ1A 3AGUA
chains in the Genus database with same CATH superfamily
3W2WA 2WB7A 3G4ZA 1FFTC 1D0ZA 2R7XA 2NUPB 2DGJA 3V5ZA 2EPKX 4CDVA 1Q0GA 3QVZA 4E17A 3IQ5A 5EK0A 1CGNA 2GDCA 1G4WR 2J9VA 4O7GA 4WJ0A 1ZVZA 4XEVA 2P6VA 4C3DA 2LIGA 1VTMP 1L7CA 4X0RA 3J06A 3ZIBA 1BR1A 1Z3IX 1V54C 4U5GA 2C04A 2QTVA 1LPEA 2LFDA 2IXNA 1MMNA 1Q0FA 4YN0B 3L0IA 3RVZA 2R7OA 3C18A 3LEVA 1FAPB 2ZXOA 1PCXA 3JZ0A 4J30B 3KYIA 1U0BB 5B3IA 4K0DA 1M2OA 4NC3A 2QUPA 3S29A 2P1AA 3GANA 4XPXA 2Y39A 2ZXRA 4XQ1A 3S9OA 3F46A 2F22A 4MVMA 3EJNA 3ZDLA 1ZHYA 2G3KA 3RQEA 4DOZA 2PP4A 1RKEA 3EH1A 1BBHA 4MVOA 3ABMC 3GORA 4JCZA 1NU9C 4HE8D 4JEAA 3UR3C 3JT1A 3L34A 5DVWA 3H2VA 4NCQA 3A9CA 2EILC 5KYUB 2AU5A 3IQ6A 4HEAJ 4LDQA 1OXBA 2OG2A 1KNYA 1O5HA 2NG1A 4AL1A 1DOVA 3L8JA 1VYKA 1TWCA 1OCCC 4N4WA 3JYHA 1F1MA 3EHNA 3PDMP 4JEBA 4BJ5A 3S90A 1OCRC 3IQCA 2XXAB 2IM8A 3JCUQ 1TR2A 1AEPA 4AE4B 4EBKA 256BA 5COGA 1K04A 4N06A 4RD9A 2J7PD 3I5QA 3U5SA 3ZQYA 5JS5A 3HNLA 4MTFA 3BEHA 2W45A 1AVOB 2YHSA 4E7ZA 4YT8A 4O6MA 2X51A 4ER9A 2XLDA 1GQAA 1A7EA 2LCHA 2XLEA 4J7YA 4J32B 3C7JA 1MMGA 2Q3TA 3DJUB 4O79A 3C8GB 4U5BE 4YT5A 3WHNA 1A7VA 1V74B 3ABLC 3US6A 3LLIA 1QQ3A 1ZHXA 2KGOA 1MQVA 1T6UA 4HFKB 5FZTA 3SEOA 1A7DA 2AWYA 2A68F 4U5DE 1BR2A 3TQOA 4FAPB 3UMHA 1QKRA 2AVKA 4GYTA 1WWPA 4I1OB 3SP1A 3R2PA 2XSEA 2WVNA 4BJTA 2R7SA 1OKKD 3TJ6A 2CYDA 2Y69C 3V7OA 2MYSA 2Q00A 3DI5A 4JW1A 2CNWD 3NDBB 3FVYA 2R7WA 4BJ6A 3Q7GA 2KK1A 4I3MA 2DYRC 3K66A 2D5RB 1WATA 2YZSA 1FMVA 5DS4A 2AP3A 2Y3BA 3NMKA 3SZRA 1D1AA 1EA8A 1SMYF 2PX3A 1GM5A 2NUTB 3DXJF 3FAPB 2JD3A 2PNOA 4MW8A 1LI5A 4YJWA 4O6YA 5COFA 5FCLA 3I5PA 3DMDA 4G78A 4MQ9F 4MVUA 1RJ9A 1YAUO 2YL7A 3DM5A 3SXMA 2HZ8A 3HJCA 3V5XA 1Z5ZA 3FHDA 3GM3A 4DJ9A 4XWJA 2AWCA 3C63A 2PF4E 1KU2A 1Y4CA 1XZQA 2L7AA 3GWLA 5B3SC 3VM6A 2IBFA 5JT4A 5L0CA 4OIQF 4IAQA 1LS4A 4XTKA 3JRMO 3NMIA 3ECSA 2R03A 2OKUA 1K05A 3QMKA 4JC7A 4NTAA 2CCYA 3K7DA 4AX2A 3AG3C 2QE9A 3U9JA 4KI2A 2HS5A 1GS9A 2L9JA 4XEFA 3O55A 2P0NA 3IPMO 4PJLA 1B68A 1VYIA 5E33A 3UGOA 5KYXB 5T1DB 2LD6A 4I44A 1TFKB 4XPWA 2KQ9A 2LP4A 2R7UA 2OEXA 1C17M 2WZGA 4OINF 3VRCA 1QZXA 1N1CA 5F5HA 5KYNA 2HUJA 1H9TA 2CDQA 3PCVA 2EIMC 2WVQA 4E0IA 2YL0A 4PACA 3ASNC 5DQZA 2DYSC 4MS2A 4E18A 4MVRA 2OQMA 2M4EA 1OCZC 4XEKA 1OR3A 3M4CA 2XM4A 4G7HF 1EKYA 1JOGA 1VB5A 3ZVRA 1M2VB 1JPJA 2O9XA 1BR4A 1YDIA 1M57C 2ASRA 1OCOC 1I4ZA 3AG1C 3HNJA 3S28A 3H2UA 2YRFA 3ZQVA 3FOPA 4EIYA 1LVKA 2XLVA 2XS1A 4MNDA 4Z9HA 3TD7A 4CSAC 4L6RA 2CGEA 2HSBA 3DE8A 2LK4A 1JPNA 1WGWA 2ZXWC 4ULVA 2J9BA 3EGDA 4Z9JA 2J8WA 2L6FA 3GEEA 5T3WA 1WTYA 1D0YA 1UFBA 2J9WA 3B0PA 2Y3HA 1RXQA 3IHUA 4JZAA 3KMIA 1LKXA 2Q9AA 4IRUA 3WG7C 5KYYA 2BE5F 4E0HA 1YYXA 1V55C 4DBQA 4IJJA 3BRJA 3K1IA 4P9TA 4CJOA 4ONSA 5CI9A 1YYJA 1Z6AA 3RF3A 1JRAA 5L0GA 4CIHA 3EZHA 2I8BA 3Q6NA 1NBBA 2RD9A 2QNLA 3DJNB 3LNRA 4JTDB 1YLMA 1LM3B 1O87A 3AGTA 4YL3A 2MWQA 3FDQA 4PK4A 1TKNA 4YK5A 4FESA 4EHPA 1QVXA 2H7VC 3AOUA 3LAYA 3CQZA 5AGFA 4DRIB 1LS1A 1HMOA 3EPVA 5A6BA 2IXMA 1RKEB 2A6HF 3M4BA 4E7SA 2MHRA 3EHMA 3EG9A 3K6BA 1ORYA 4YL0A 3RKOF 4IWBA 4DRHB 3N24A 2HFIA 1CGOA 3ZWIA 1U89A 4N6HA 1G5ZA 4WGYA 1T9KA 3K33A 4YT2A 3GEHA 4BJ1A 2WZFA 3U3BA 1EQ1A 5B1BC 4OD4A 4OIPF 2HV6A 2PX0A 1IW7F 2J7PA 2NSFA 4NTFA 5D91A 4CX9A 5JLIA 3B0VC 1SF8A 4Q5SF 2GFHA 5K0IA 1FTSA 3TK0A 4LDRA 2G62A 1T01A 2ZXPA 3S84A 1HY5A 4A4AA 3EGXA 3W8HA 4NQFA 4BPMA 5EGYA 5KYWA 5L3QA 4H54A 1NLXA 2H8AA 2VCAA 3K1IC 4CS7A 1D1BA 4ZLCA 2J0XA 2XLMA 3CZ6A 1ST6A 1WOLA 3GODA 2WZLA 3PMRA 3RFYA 1TQGA 2VCCA 3O39A 1FNTc 2OJQA 5DS6A 1MNDA 2FFHA 4IAOA 3GEIA 1VOMA 3U8VA 4EUKB 3NG1A 1ZU4A 4XLPF 2R05A 1K40A 1HE9A 2B0JA 1XZPA 2P7VA 2Q9BA 4OIOF 3E9VA 3JRTA 4D4XA 5BUOA 2YLGA 1JAFA 2CNWA 4JRZA 4MVSA 3V5YA 3M1CB 4H4KC 3E70C 3W2VA 4YL1A 4RDAA 3QZCA 3M79A 4J7TA 1Z7Qc 3AGUA 2L6HA 3O10A 1S05A 3R7CA 2G3VA 3T6JA 5AC4A 5EHHA 4XPYA 3KKBA 3UMKA 1LE4A 1Q0MA 4C3BA 4CDYA 2UUHA 1I4YA 3JSZA 4NTBA 3LLKA 3S0XA 2J0WA 3AJMA 2R9RB 3C8GD 1TFOB 2EPLX 3DWWA 3NMJA 4U9EA 5BQHA 2WL8A 3HNIA 1RJ9B 4BEJA 2XL8A 3TOMA 2XL6A 1E83A 2RSEB 3C62A 4QI0A 4CSAA 4C7OA 4JVSA 3B29A 3Q6MA 5L0JA 4YWQA 1T6IA 4GEHA 2Y3DA 1TWGA 4EBBA 1IZMA 1WASA 1LI7A 1OXKA 4AK9A 1ORJA 3HKKA 2DB4A 1WN0A 1SZIA 3DZAA 3AG2C 2IXPA 3F47A 1H7IA 4N6CA 3U2MA 2BC5A 3VAYA 3S27A 2FGYA 4MTOA 2L81A 2A1DD 3HNKA 3X2QC 4MVQA 2YVKA 5JVEA 2OOCA 3GM2A 3QTHA 4U5CE 5A6AA 3FOOA 2B0HA 1Z63A 4K7BA 1ZHZA 1D1CA 3RQFA 3B9QA 3WODF 1S7ZA 4CS8C 2R7VA 2EIJC 3DM9B 3EFOA 1A0BA 2LSEA 1MMDA 3LUTB 4IGGA 4PJNA 4R32A 3LNMB 5JP7A 1OW8A 4JCHA 3T6GB 4LLEA 3I4UA 3LESA 3ZC4A 2DI3A 4MW3A 1NFNA 4DBRA 1OW7A 3ZTMA 3UGPA 3OA1A 4PFPA 2A0BA 1VLSA 3ITFA 3SXYA 2JPUA 1VMAA 3G4XA 3OWTA 3K1HA 4QDLA 4LERA 3A11A 4U5HA 3T9OA 4PJJA 2H7OA 2JX0A 2YKZA 2HJMA 3CEXA 4JURI 2M64A 2HKVA 2W9YA 3U0CA 5BQGA 5F28E 3T4RA 2V26A 2KC3A 3EGDB 4P6IC 3ZTZA 2P61A 3PHF2 3UNGC 4LLCA 2L6GA 1RKCA 4WGZA 5COMA 3DAFA 5GPGB 5AC5A 1EI7A 5D92A 5DLJA 4IARA 3M15A 4Q7CA 3N0TA 2Q7RA 5KYYB 1H9GA 3LEOA 1ZW2A 4PR9A 1NSGB 1PD1A 2KSFA 3MYIA 3NYJA 5A6KA 4JJFA 1YA9A 2OCCC 2Z15A 2HMQA 3JTLO 2XLOA 3SYNA 1Z23A 1FFHA 3KPHA 1E84A 1G4US 2ETSA 2J9UA 3EH2A 3U2LA 2OEVA 2J45A 2GWWA 5HV9A 2EPMX 2NUPA 4HFFB 1C02A 2A0UA 4B6IA 2Y3GA 1HMDA 2BL2A 2ZPAA 3H65A 3OEOA 2HJ3A 4EWCA 2R02A 5JRAA 3LS1A 1PV3A 3Q7LA 2Q4FA 4XLNF 3POVA 2W4MA 3L1MA 5JSLA 1QPUA 3EG9B 5E3AA 3QW0A 2XLHA 2YLDA 4M63A 2VB6A 3N2ZB 3TJ5A 2I15A 1YJGA 1V4AA 2XM0A 5L0FA 3KL4A 3MYFA 2KW3C 1HE1A 1ZHTA 3ATPA 3GM1A 4GQHA 2EPOA 1QLEC 5HSWA 2KYHA 3KH2A 3NYLA 4DXWA 1TWAA 1E85A 1BDJB 4KC9A 3VYWA 1CPQA 1ZZPA 2HSQA 2YQYA 4ANJA 1OW6A 4DVYP 2XLWA 1AUEA 1A41A 2CW0F 4ZLDA 3CSKA 1T5OA 1PD0A 2HMZA 5L3VA 4UDVA 3EGXB 1R5ID 2GAQA 4AL0A 4CBEA 5KYWB 1SYQA 2XL4A 5A6BD 5E2QA 2XRHA 5KYUA 1BZ4A 2YEVA 4K1OA 4MVZA 1OR2A 1ZW3A 2KJGA 2UUIA 4JJGA 4RBNA 3U8PA 3VF0A 1D0XA 4EKWA 3JSEO 1KTMA 2E87A 1ZU5A 3KYJA 4U5FE 5TJ5E 1R4TA 3DKAA 1U6HA 1FMWA 3EQLF 1E86A 1OKKA 3DE9A 2XXAA 4G7ZF 1CGME 4MTGA 4AE4A 1TWHA 3ASOC 2YL1A 1W2WA 1DOWA 2IOQA 3RVYA 1YA7O 1M56C 1O3UA 2W4BA 4Z9IA 1XWJA 4CJGA 4O6NA 3AG4C 5L0IA 2R7RA 2PBEA 2KNHA 1RMVA 1NZEA 4CS8A 3EZIA 3U9MA 3DD7A 4F4BA 1I5NA 3ABKC 1HW2A 1JR8A 2A69F 4WABA 3C8GA 3NRHA 4KNWA 2R7TA 4JE9A 3WAQA 4OD5A 1JMWA 4ULWA 4CS9A 3SXZA 1L3PA 4W8KA 5L0DA 3TULA 1GGQA 1NG1A 1VLTA 1ZYRF 1YARO 1Q0KA 4FX5A 2LQGA 2C03A 3TOLA 1H6GA 1UG7A 3ZG1A 4C3EA 5DS5A 2IYLD 4C7OB 5A6JA 1J8YF 1T6QA 1FR0A 2LFFA 2R25A 2GA0A 3FXHA 3T6BA 3IEEA 4U5EE 3NYMA 1CPRA 4JIOA 2VASA 2YWAA 3NKDA 4G7OF 2NUTA 3O6XA 2EIKC 2YL3A 4BJ5C 1HW1A 2EPNA 3IQTA 1YVIA 1J8MF 2PFDA 2QY9A 4JTCB 4JKVA 2NSGA 2OU6A 2QLAA 1VK5A 2WVOA 3CAXA 1ORSC 2R7QA 3C8ZA 4DRJB 1YZAA 1LIHA 2X0CA 3FMSA 5CI8A 3MX3A 4D4NA 5IY5C 3RQGA 3RH3A 2NPUA 2H7BA 4CDAA 3GWNA 3RIPA 4CIPA 4LACB 3LJBA 3AQCA 2FAPB 4BG0A 2Q9CA 3LS0A 1MNEA 2IXOA 2VC9A 3EFOB 1MMAA 4PJMA 3B0UX 4U9DA 1G8XA 4KBLA 3ZSUA 1Y6DA 3U3FA 2OJED 3W4YA 3W8IA 1YZCA 5A69A 4CS9C 3QVYA 4I1MA 1E2XA 1M6TA 1QSPA 2A6EF 4JTAB 5KYXA 3HLZA 4QI2A 3UMIA 1Q0DA 4FWVA 5CIVA 4KNVA 3MLGA 5JUAA 5L0HA 3RW0A 4DVZA 5B1AC 1OQCA 2VCBA 1NFOA 4EBJA 1SR2A 3QW1A 4BJ6C 5T3TA 2J46A 2VH3A 4IB4A 2YLIA 3X1OA 1NU7D 4A2NB 3FAJA 2TMVP 3NKEA 1APCA 3JYYA 1C03A 3SNHA 4YT4A 1ZHWA 5BQIA 3DAGA 3B71A 3G50A 4PFOA 4G0HA 3RYLA 2EINC 5DQTA 3L8IA 4Q4ZF 2XS8A 2ICWG 1M2VA 4BEMJ 1LE2A 4NY3A 3SXKA 4P9FA 2V3CC 2ZD9A 2HV7A 3HTKC 5F5FA 4LDKA 3AQBA 4OIRF 5E3CA 2D4UA 4W8PA 3MFNA 3MBGA 1RCPA
chains in the Genus database with same CATH topology
2HMZA 1HMOA 1HMDA 4XPYA 1A7EA 2MHRA 1I4YA 4XPWA 3WHNA 3WAQA 1A7DA 2AWYA 2AWCA 2AVKA 2HMQA 3AGTA 4XPXA 1I4ZA 4XQ1A 3AGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMZ A;  1HMO A;  1HMD A;  4XPY A;  1A7E A;  2MHR A;  1I4Y A;  4XPW A;  3WHN A;  3WAQ A;  1A7D A;  2AWY A;  2AWC A;  2AVK A;  2HMQ A;  3AGT A;  4XPX A;  1I4Z A;  4XQ1 A;  3AGU A; 
#chains in the Genus database with same CATH topology
 3W2W A;  2WB7 A;  3G4Z A;  1FFT C;  1D0Z A;  2R7X A;  2NUP B;  2DGJ A;  3V5Z A;  2EPK X;  4CDV A;  1Q0G A;  3QVZ A;  4E17 A;  3IQ5 A;  5EK0 A;  1CGN A;  2GDC A;  1G4W R;  2J9V A;  4O7G A;  4WJ0 A;  1ZVZ A;  4XEV A;  2P6V A;  4C3D A;  2LIG A;  1VTM P;  1L7C A;  4X0R A;  3J06 A;  3ZIB A;  1BR1 A;  1Z3I X;  1V54 C;  4U5G A;  2C04 A;  2QTV A;  1LPE A;  2LFD A;  2IXN A;  1MMN A;  1Q0F A;  4YN0 B;  3L0I A;  3RVZ A;  2R7O A;  3C18 A;  3LEV A;  1FAP B;  2ZXO A;  1PCX A;  3JZ0 A;  4J30 B;  3KYI A;  1U0B B;  5B3I A;  4K0D A;  1M2O A;  4NC3 A;  2QUP A;  3S29 A;  2P1A A;  3GAN A;  4XPX A;  2Y39 A;  2ZXR A;  4XQ1 A;  3S9O A;  3F46 A;  2F22 A;  4MVM A;  3EJN A;  3ZDL A;  1ZHY A;  2G3K A;  3RQE A;  4DOZ A;  2PP4 A;  1RKE A;  3EH1 A;  1BBH A;  4MVO A;  3ABM C;  3GOR A;  4JCZ A;  1NU9 C;  4HE8 D;  4JEA A;  3UR3 C;  3JT1 A;  3L34 A;  5DVW A;  3H2V A;  4NCQ A;  3A9C A;  2EIL C;  5KYU B;  2AU5 A;  3IQ6 A;  4HEA J;  4LDQ A;  1OXB A;  2OG2 A;  1KNY A;  1O5H A;  2NG1 A;  4AL1 A;  1DOV A;  3L8J A;  1VYK A;  1TWC A;  1OCC C;  4N4W A;  3JYH A;  1F1M A;  3EHN A;  3PDM P;  4JEB A;  4BJ5 A;  3S90 A;  1OCR C;  3IQC A;  2XXA B;  2IM8 A;  3JCU Q;  1TR2 A;  1AEP A;  4AE4 B;  4EBK A;  256B A;  5COG A;  1K04 A;  4N06 A;  4RD9 A;  2J7P D;  3I5Q A;  3U5S A;  3ZQY A;  5JS5 A;  3HNL A;  4MTF A;  3BEH A;  2W45 A;  1AVO B;  2YHS A;  4E7Z A;  4YT8 A;  4O6M A;  2X51 A;  4ER9 A;  2XLD A;  1GQA A;  1A7E A;  2LCH A;  2XLE A;  4J7Y A;  4J32 B;  3C7J A;  1MMG A;  2Q3T A;  3DJU B;  4O79 A;  3C8G B;  4U5B E;  4YT5 A;  3WHN A;  1A7V A;  1V74 B;  3ABL C;  3US6 A;  3LLI A;  1QQ3 A;  1ZHX A;  2KGO A;  1MQV A;  1T6U A;  4HFK B;  5FZT A;  3SEO A;  1A7D A;  2AWY A;  2A68 F;  4U5D E;  1BR2 A;  3TQO A;  4FAP B;  3UMH A;  1QKR A;  2AVK A;  4GYT A;  1WWP A;  4I1O B;  3SP1 A;  3R2P A;  2XSE A;  2WVN A;  4BJT A;  2R7S A;  1OKK D;  3TJ6 A;  2CYD A;  2Y69 C;  3V7O A;  2MYS A;  2Q00 A;  3DI5 A;  4JW1 A;  2CNW D;  3NDB B;  3FVY A;  2R7W A;  4BJ6 A;  3Q7G A;  2KK1 A;  4I3M A;  2DYR C;  3K66 A;  2D5R B;  1WAT A;  2YZS A;  1FMV A;  5DS4 A;  2AP3 A;  2Y3B A;  3NMK A;  3SZR A;  1D1A A;  1EA8 A;  1SMY F;  2PX3 A;  1GM5 A;  2NUT B;  3DXJ F;  3FAP B;  2JD3 A;  2PNO A;  4MW8 A;  1LI5 A;  4YJW A;  4O6Y A;  5COF A;  5FCL A;  3I5P A;  3DMD A;  4G78 A;  4MQ9 F;  4MVU A;  1RJ9 A;  1YAU O;  2YL7 A;  3DM5 A;  3SXM A;  2HZ8 A;  3HJC A;  3V5X A;  1Z5Z A;  3FHD A;  3GM3 A;  4DJ9 A;  4XWJ A;  2AWC A;  3C63 A;  2PF4 E;  1KU2 A;  1Y4C A;  1XZQ A;  2L7A A;  3GWL A;  5B3S C;  3VM6 A;  2IBF A;  5JT4 A;  5L0C A;  4OIQ F;  4IAQ A;  1LS4 A;  4XTK A;  3JRM O;  3NMI A;  3ECS A;  2R03 A;  2OKU A;  1K05 A;  3QMK A;  4JC7 A;  4NTA A;  2CCY A;  3K7D A;  4AX2 A;  3AG3 C;  2QE9 A;  3U9J A;  4KI2 A;  2HS5 A;  1GS9 A;  2L9J A;  4XEF A;  3O55 A;  2P0N A;  3IPM O;  4PJL A;  1B68 A;  1VYI A;  5E33 A;  3UGO A;  5KYX B;  5T1D B;  2LD6 A;  4I44 A;  1TFK B;  4XPW A;  2KQ9 A;  2LP4 A;  2R7U A;  2OEX A;  1C17 M;  2WZG A;  4OIN F;  3VRC A;  1QZX A;  1N1C A;  5F5H A;  5KYN A;  2HUJ A;  1H9T A;  2CDQ A;  3PCV A;  2EIM C;  2WVQ A;  4E0I A;  2YL0 A;  4PAC A;  3ASN C;  5DQZ A;  2DYS C;  4MS2 A;  4E18 A;  4MVR A;  2OQM A;  2M4E A;  1OCZ C;  4XEK A;  1OR3 A;  3M4C A;  2XM4 A;  4G7H F;  1EKY A;  1JOG A;  1VB5 A;  3ZVR A;  1M2V B;  1JPJ A;  2O9X A;  1BR4 A;  1YDI A;  1M57 C;  2ASR A;  1OCO C;  1I4Z A;  3AG1 C;  3HNJ A;  3S28 A;  3H2U A;  2YRF A;  3ZQV A;  3FOP A;  4EIY A;  1LVK A;  2XLV A;  2XS1 A;  4MND A;  4Z9H A;  3TD7 A;  4CSA C;  4L6R A;  2CGE A;  2HSB A;  3DE8 A;  2LK4 A;  1JPN A;  1WGW A;  2ZXW C;  4ULV A;  2J9B A;  3EGD A;  4Z9J A;  2J8W A;  2L6F A;  3GEE A;  5T3W A;  1WTY A;  1D0Y A;  1UFB A;  2J9W A;  3B0P A;  2Y3H A;  1RXQ A;  3IHU A;  4JZA A;  3KMI A;  1LKX A;  2Q9A A;  4IRU A;  3WG7 C;  5KYY A;  2BE5 F;  4E0H A;  1YYX A;  1V55 C;  4DBQ A;  4IJJ A;  3BRJ A;  3K1I A;  4P9T A;  4CJO A;  4ONS A;  5CI9 A;  1YYJ A;  1Z6A A;  3RF3 A;  1JRA A;  5L0G A;  4CIH A;  3EZH A;  2I8B A;  3Q6N A;  1NBB A;  2RD9 A;  2QNL A;  3DJN B;  3LNR A;  4JTD B;  1YLM A;  1LM3 B;  1O87 A;  3AGT A;  4YL3 A;  2MWQ A;  3FDQ A;  4PK4 A;  1TKN A;  4YK5 A;  4FES A;  4EHP A;  1QVX A;  2H7V C;  3AOU A;  3LAY A;  3CQZ A;  5AGF A;  4DRI B;  1LS1 A;  1HMO A;  3EPV A;  5A6B A;  2IXM A;  1RKE B;  2A6H F;  3M4B A;  4E7S A;  2MHR A;  3EHM A;  3EG9 A;  3K6B A;  1ORY A;  4YL0 A;  3RKO F;  4IWB A;  4DRH B;  3N24 A;  2HFI A;  1CGO A;  3ZWI A;  1U89 A;  4N6H A;  1G5Z A;  4WGY A;  1T9K A;  3K33 A;  4YT2 A;  3GEH A;  4BJ1 A;  2WZF A;  3U3B A;  1EQ1 A;  5B1B C;  4OD4 A;  4OIP F;  2HV6 A;  2PX0 A;  1IW7 F;  2J7P A;  2NSF A;  4NTF A;  5D91 A;  4CX9 A;  5JLI A;  3B0V C;  1SF8 A;  4Q5S F;  2GFH A;  5K0I A;  1FTS A;  3TK0 A;  4LDR A;  2G62 A;  1T01 A;  2ZXP A;  3S84 A;  1HY5 A;  4A4A A;  3EGX A;  3W8H A;  4NQF A;  4BPM A;  5EGY A;  5KYW A;  5L3Q A;  4H54 A;  1NLX A;  2H8A A;  2VCA A;  3K1I C;  4CS7 A;  1D1B A;  4ZLC A;  2J0X A;  2XLM A;  3CZ6 A;  1ST6 A;  1WOL A;  3GOD A;  2WZL A;  3PMR A;  3RFY A;  1TQG A;  2VCC A;  3O39 A;  1FNT c;  2OJQ A;  5DS6 A;  1MND A;  2FFH A;  4IAO A;  3GEI A;  1VOM A;  3U8V A;  4EUK B;  3NG1 A;  1ZU4 A;  4XLP F;  2R05 A;  1K40 A;  1HE9 A;  2B0J A;  1XZP A;  2P7V A;  2Q9B A;  4OIO F;  3E9V A;  3JRT A;  4D4X A;  5BUO A;  2YLG A;  1JAF A;  2CNW A;  4JRZ A;  4MVS A;  3V5Y A;  3M1C B;  4H4K C;  3E70 C;  3W2V A;  4YL1 A;  4RDA A;  3QZC A;  3M79 A;  4J7T A;  1Z7Q c;  3AGU A;  2L6H A;  3O10 A;  1S05 A;  3R7C A;  2G3V A;  3T6J A;  5AC4 A;  5EHH A;  4XPY A;  3KKB A;  3UMK A;  1LE4 A;  1Q0M A;  4C3B A;  4CDY A;  2UUH A;  1I4Y A;  3JSZ A;  4NTB A;  3LLK A;  3S0X A;  2J0W A;  3AJM A;  2R9R B;  3C8G D;  1TFO B;  2EPL X;  3DWW A;  3NMJ A;  4U9E A;  5BQH A;  2WL8 A;  3HNI A;  1RJ9 B;  4BEJ A;  2XL8 A;  3TOM A;  2XL6 A;  1E83 A;  2RSE B;  3C62 A;  4QI0 A;  4CSA A;  4C7O A;  4JVS A;  3B29 A;  3Q6M A;  5L0J A;  4YWQ A;  1T6I A;  4GEH A;  2Y3D A;  1TWG A;  4EBB A;  1IZM A;  1WAS A;  1LI7 A;  1OXK A;  4AK9 A;  1ORJ A;  3HKK A;  2DB4 A;  1WN0 A;  1SZI A;  3DZA A;  3AG2 C;  2IXP A;  3F47 A;  1H7I A;  4N6C A;  3U2M A;  2BC5 A;  3VAY A;  3S27 A;  2FGY A;  4MTO A;  2L81 A;  2A1D D;  3HNK A;  3X2Q C;  4MVQ A;  2YVK A;  5JVE A;  2OOC A;  3GM2 A;  3QTH A;  4U5C E;  5A6A A;  3FOO A;  2B0H A;  1Z63 A;  4K7B A;  1ZHZ A;  1D1C A;  3RQF A;  3B9Q A;  3WOD F;  1S7Z A;  4CS8 C;  2R7V A;  2EIJ C;  3DM9 B;  3EFO A;  1A0B A;  2LSE A;  1MMD A;  3LUT B;  4IGG A;  4PJN A;  4R32 A;  3LNM B;  5JP7 A;  1OW8 A;  4JCH A;  3T6G B;  4LLE A;  3I4U A;  3LES A;  3ZC4 A;  2DI3 A;  4MW3 A;  1NFN A;  4DBR A;  1OW7 A;  3ZTM A;  3UGP A;  3OA1 A;  4PFP A;  2A0B A;  1VLS A;  3ITF A;  3SXY A;  2JPU A;  1VMA A;  3G4X A;  3OWT A;  3K1H A;  4QDL A;  4LER A;  3A11 A;  4U5H A;  3T9O A;  4PJJ A;  2H7O A;  2JX0 A;  2YKZ A;  2HJM A;  3CEX A;  4JUR I;  2M64 A;  2HKV A;  2W9Y A;  3U0C A;  5BQG A;  5F28 E;  3T4R A;  2V26 A;  2KC3 A;  3EGD B;  4P6I C;  3ZTZ A;  2P61 A;  3PHF 2;  3UNG C;  4LLC A;  2L6G A;  1RKC A;  4WGZ A;  5COM A;  3DAF A;  5GPG B;  5AC5 A;  1EI7 A;  5D92 A;  5DLJ A;  4IAR A;  3M15 A;  4Q7C A;  3N0T A;  2Q7R A;  5KYY B;  1H9G A;  3LEO A;  1ZW2 A;  4PR9 A;  1NSG B;  1PD1 A;  2KSF A;  3MYI A;  3NYJ A;  5A6K A;  4JJF A;  1YA9 A;  2OCC C;  2Z15 A;  2HMQ A;  3JTL O;  2XLO A;  3SYN A;  1Z23 A;  1FFH A;  3KPH A;  1E84 A;  1G4U S;  2ETS A;  2J9U A;  3EH2 A;  3U2L A;  2OEV A;  2J45 A;  2GWW A;  5HV9 A;  2EPM X;  2NUP A;  4HFF B;  1C02 A;  2A0U A;  4B6I A;  2Y3G A;  1HMD A;  2BL2 A;  2ZPA A;  3H65 A;  3OEO A;  2HJ3 A;  4EWC A;  2R02 A;  5JRA A;  3LS1 A;  1PV3 A;  3Q7L A;  2Q4F A;  4XLN F;  3POV A;  2W4M A;  3L1M A;  5JSL A;  1QPU A;  3EG9 B;  5E3A A;  3QW0 A;  2XLH A;  2YLD A;  4M63 A;  2VB6 A;  3N2Z B;  3TJ5 A;  2I15 A;  1YJG A;  1V4A A;  2XM0 A;  5L0F A;  3KL4 A;  3MYF A;  2KW3 C;  1HE1 A;  1ZHT A;  3ATP A;  3GM1 A;  4GQH A;  2EPO A;  1QLE C;  5HSW A;  2KYH A;  3KH2 A;  3NYL A;  4DXW A;  1TWA A;  1E85 A;  1BDJ B;  4KC9 A;  3VYW A;  1CPQ A;  1ZZP A;  2HSQ A;  2YQY A;  4ANJ A;  1OW6 A;  4DVY P;  2XLW A;  1AUE A;  1A41 A;  2CW0 F;  4ZLD A;  3CSK A;  1T5O A;  1PD0 A;  2HMZ A;  5L3V A;  4UDV A;  3EGX B;  1R5I D;  2GAQ A;  4AL0 A;  4CBE A;  5KYW B;  1SYQ A;  2XL4 A;  5A6B D;  5E2Q A;  2XRH A;  5KYU A;  1BZ4 A;  2YEV A;  4K1O A;  4MVZ A;  1OR2 A;  1ZW3 A;  2KJG A;  2UUI A;  4JJG A;  4RBN A;  3U8P A;  3VF0 A;  1D0X A;  4EKW A;  3JSE O;  1KTM A;  2E87 A;  1ZU5 A;  3KYJ A;  4U5F E;  5TJ5 E;  1R4T A;  3DKA A;  1U6H A;  1FMW A;  3EQL F;  1E86 A;  1OKK A;  3DE9 A;  2XXA A;  4G7Z F;  1CGM E;  4MTG A;  4AE4 A;  1TWH A;  3ASO C;  2YL1 A;  1W2W A;  1DOW A;  2IOQ A;  3RVY A;  1YA7 O;  1M56 C;  1O3U A;  2W4B A;  4Z9I A;  1XWJ A;  4CJG A;  4O6N A;  3AG4 C;  5L0I A;  2R7R A;  2PBE A;  2KNH A;  1RMV A;  1NZE A;  4CS8 A;  3EZI A;  3U9M A;  3DD7 A;  4F4B A;  1I5N A;  3ABK C;  1HW2 A;  1JR8 A;  2A69 F;  4WAB A;  3C8G A;  3NRH A;  4KNW A;  2R7T A;  4JE9 A;  3WAQ A;  4OD5 A;  1JMW A;  4ULW A;  4CS9 A;  3SXZ A;  1L3P A;  4W8K A;  5L0D A;  3TUL A;  1GGQ A;  1NG1 A;  1VLT A;  1ZYR F;  1YAR O;  1Q0K A;  4FX5 A;  2LQG A;  2C03 A;  3TOL A;  1H6G A;  1UG7 A;  3ZG1 A;  4C3E A;  5DS5 A;  2IYL D;  4C7O B;  5A6J A;  1J8Y F;  1T6Q A;  1FR0 A;  2LFF A;  2R25 A;  2GA0 A;  3FXH A;  3T6B A;  3IEE A;  4U5E E;  3NYM A;  1CPR A;  4JIO A;  2VAS A;  2YWA A;  3NKD A;  4G7O F;  2NUT A;  3O6X A;  2EIK C;  2YL3 A;  4BJ5 C;  1HW1 A;  2EPN A;  3IQT A;  1YVI A;  1J8M F;  2PFD A;  2QY9 A;  4JTC B;  4JKV A;  2NSG A;  2OU6 A;  2QLA A;  1VK5 A;  2WVO A;  3CAX A;  1ORS C;  2R7Q A;  3C8Z A;  4DRJ B;  1YZA A;  1LIH A;  2X0C A;  3FMS A;  5CI8 A;  3MX3 A;  4D4N A;  5IY5 C;  3RQG A;  3RH3 A;  2NPU A;  2H7B A;  4CDA A;  3GWN A;  3RIP A;  4CIP A;  4LAC B;  3LJB A;  3AQC A;  2FAP B;  4BG0 A;  2Q9C A;  3LS0 A;  1MNE A;  2IXO A;  2VC9 A;  3EFO B;  1MMA A;  4PJM A;  3B0U X;  4U9D A;  1G8X A;  4KBL A;  3ZSU A;  1Y6D A;  3U3F A;  2OJE D;  3W4Y A;  3W8I A;  1YZC A;  5A69 A;  4CS9 C;  3QVY A;  4I1M A;  1E2X A;  1M6T A;  1QSP A;  2A6E F;  4JTA B;  5KYX A;  3HLZ A;  4QI2 A;  3UMI A;  1Q0D A;  4FWV A;  5CIV A;  4KNV A;  3MLG A;  5JUA A;  5L0H A;  3RW0 A;  4DVZ A;  5B1A C;  1OQC A;  2VCB A;  1NFO A;  4EBJ A;  1SR2 A;  3QW1 A;  4BJ6 C;  5T3T A;  2J46 A;  2VH3 A;  4IB4 A;  2YLI A;  3X1O A;  1NU7 D;  4A2N B;  3FAJ A;  2TMV P;  3NKE A;  1APC A;  3JYY A;  1C03 A;  3SNH A;  4YT4 A;  1ZHW A;  5BQI A;  3DAG A;  3B71 A;  3G50 A;  4PFO A;  4G0H A;  3RYL A;  2EIN C;  5DQT A;  3L8I A;  4Q4Z F;  2XS8 A;  2ICW G;  1M2V A;  4BEM J;  1LE2 A;  4NY3 A;  3SXK A;  4P9F A;  2V3C C;  2ZD9 A;  2HV7 A;  3HTK C;  5F5F A;  4LDK A;  3AQB A;  4OIR F;  5E3C A;  2D4U A;  4W8P A;  3MFN A;  3MBG A;  1RCP A; 
#chains in the Genus database with same CATH homology
 2HMZ A;  1HMO A;  1HMD A;  4XPY A;  1A7E A;  2MHR A;  1I4Y A;  4XPW A;  3WHN A;  3WAQ A;  1A7D A;  2AWY A;  2AWC A;  2AVK A;  2HMQ A;  3AGT A;  4XPX A;  1I4Z A;  4XQ1 A;  3AGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...