2QY9A

Structure of the ng+1 construct of the e. coli srp receptor ftsy
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
300
structure length
300
Chain Sequence
FARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Cell division protein ftsY
publication title The E. coli SRP-receptor FTSY contains an essential and autonomous membrane-binding amphipathic helix
rcsb
source organism Escherichia coli
total genus 115
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2qy9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qy9A02
4OQFA 2GJAA 4ZCLA 3MWJA 5FTLA 4URXR 3QPVA 4C2UA 3LWNA 5DNYB 3WP1B 1KSHA 4TSFD 3NVAA 5E4FA 4TYWA 3HPQA 1CLUA 1BKDR 3U3MA 2HUPA 4HDOB 1NVVR 1OFTA 2XNSA 3RABA 1T3HA 5KTYA 4TMVA 3KJEA 1DAHA 1GRQA 3H0KA 3I4LA 4JBWA 1J8YF 5SZKB 2JLWA 3A58B 4EPYA 1ZD9A 2EYQA 2NG1A 2V1UA 3GEEA 1AA9A 1VECA 2GXUA 2QAGA 4OJQA 2V55B 2OBMA 4IJMA 3SBEA 3Q85A 4M9ZA 1L4UA 1Z5ZA 2JJ2D 4HB0A 2XB2A 2OT3B 1W1WA 3VR4A 1BIFA 1XXHE 4A2PA 2FJUA 4YONB 2GHIA 3RSLA 1Z06A 2ZRJA 3T1VA 1X6VA 2J7KA 3CM0A 1UEJA 1Z47A 3K0CA 5JWHA 1R7RA 2ZEJA 1ZM4A 2KSQA 2VF8A 3IQXA 4NYMR 3CWZA 3GFPA 4ACBA 2VH5R 3NDPA 3QBTA 3ZDQA 1E3MA 4V0OA 5G3YA 1D9ZA 2QM8A 2REBA 4ITRC 1Z07A 4MQBA 1RRPA 2OAP1 1W0JA 4UNRA 2WZQA 2ZJAA 5JS7A 1KI8A 1NIJA 2FFQA 5FUVA 1OIVA 4TYNA 2H8KA 5FL3A 5HR5A 2ZTSA 4HDCA 2VP0A 3ETLA 3CPEA 2KBFA 4LI0A 3PV0A 3QKRA 4C0AC 4P4UA 3T61A 5FTMA 3VU9B 2FGKA 2MMCA 3CNOA 4MA4A 3NBXX 1NBMA 4EPWA 4D4KA 2X19A 3EZFA 1YE8A 2DHRA 1ODFA 4NONA 3C16C 5FI0B 4KFRA 4Q9IA 1G3RA 3GJXC 1KOFA 4OHXA 1N2CE 2ZRGA 3I1FA 2YOGA 4HSEA 4ZDJA 1OFHA 2ZI7A 3LD9A 3FKQA 3TQCA 1NSFA 2X8AA 4DLXA 4AIIA 3AF4A 2QP4A 1VG9B 2F9MA 3RLFA 4V0LA 3T12A 1KY2A 1RYFA 1JR6A 1U0JA 2J45A 3W5IA 1E2FA 1GDDA 2PZFA 4DB2A 3W6NA 4EAQA 1HEIA 2ATXA 2QA5A 2ORWA 1OW3B 2ZRBA 4MYUA 1D9XA 3KKMA 4OI4A 4UNPA 3I5XA 2HYDA 1CKEA 1SVKA 1TEXA 2OM2A 2B8TA 1T0JB 2ZSAA 4FMDB 4IOKA 4Z8YA 5KO2A 4LDJA 3RC3A 3OIUA 2ZYVX 3CH4B 4LC0A 4R2IA 2CNWD 1SKYB 2OESA 2XSZD 3NBFA 1KSJA 3NXSA 5IT5A 1KK3A 1I2MA 1NVUQ 4YDHB 1S8FA 1OE0A 2GILA 1E2MA 4LJ7A 5HTKA 4F4IA 3RC8A 3SS8A 3L8YA 4IVPA 2R2AA 4FD2A 3BE4A 4BQSA 1VHTA 4Q4JB 4N0EA 4MITA 3GCGA 3KQKA 3VTKA 4R2HA 1R5NA 1XWIA 1JR3D 1XZQA 4ZPXA 2P67A 2NPFA 4DCUA 1E9SA 5JWOA 1W36C 1F2TB 3EC2A 1QZXA 5JSZA 5EXTA 1C9KA 2ZQ5A 2OILA 3ADCA 4DWJA 3S1AB 1ZAKA 3FHTA 4D81A 1G16A 1TF2A 3U60B 1KI4A 1U8ZA 3A1VA 3C14C 2GBLA 4RKEA 5LB2A 2PEZA 4TLAA 4TYYA 1GKYA 1DADA 1LB1B 1S3GA 2NTYC 1RW4A 3AP1A 1QVRA 4Q1FA 1OXSC 1VCNA 1XD9A 1YHNA 1Z08A 3B13B 2F3RA 3MD0A 3W3AA 3L0OA 3IHWA 4A8JB 3QXXA 4M9SA 4LRWA 4BPBA 2F6RA 1CU1A 1R4AA 1VCIA 2F3TA 2QTHA 2XJ4A 4CW7A 5JRZA 3ZS8A 3L0PA 5J4VA 1I4DD 3UKDA 2ZUCA 1IJEA 1W46A 1SHKA 3GD7A 4OHZA 1EG7A 1XJ0A 5DH9A 2PJZA 3THWB 3KUDA 3M1IA 1LF5A 1G291 2VYFA 3CNLA 3E2IA 3NHBA 4TMXA 5GVRA 4D25A 2VPPA 4XTRA 2PJRA 3V4RA 2DPXA 2BBWA 2GZHA 2ONJA 1I4TD 4A2QA 4LWZA 2WWFA 1DAFA 1NVXQ 2PL3A 3K0AB 2MMGA 4ERNA 4RKFA 3AVOA 2WWYA 4Q4AB 3KKPA 2G9NA 1YQTA 1FNMA 2YV5A 4CRWB 4GP6A 1Q1EA 4QKQA 5JECA 3U44A 4FIDA 1NP6A 2A5GA 2GA8A 4F4CA 4F38A 1II8A 2AD5A 2J5XA 1P2UA 3QKSB 4EIWA 2DCUA 2KE5A 3T34A 3QXSA 2O5VA 1G7RA 1S9DA 1SXJC 2IYVA 5LD2C 1H8ED 1GVNB 4WZ6A 3I5YA 1XPOA 1BS1A 5KDDA 1OKKD 1W5TA 4UNNA 2HLDA 4LJ5A 3UXMA 1ZU4A 2EFGA 3C5HA 4BRUA 3QSYA 5F98A 1U9IC 5TB5A 5KSYA 1GUAA 5P21A 1QHYA 1FUKA 5L8VA 1N0UA 2IYXA 3QQ5A 4WBSA 2D2FA 1KDOA 3TVTA 3RYTC 3ZZUA 4HLCA 5C2JB 5JI3E 3PFIA 2IYSA 4NYJQ 2IF0A 3ZH9B 3X1YA 4Q7LA 3CBQA 5CK5A 3BK7A 3WYAA 3U4QA 5J4HA 2JAQA 3IIKA 4D0NA 2AD1A 1TEVA 1UBCA 1XDBA 3UATA 2J0QA 2ZYUX 1DAGA 1E0AA 1E4VA 4PQRA 4US1R 1BOFA 2FH5B 2LWIA 4NU0A 4ASUA 2O8BA 1RZ3A 2QE7A 4C0SA 5KDLA 4HB4A 3QENA 1AQYA 2ECKA 1SVMA 2V7QA 2HEIA 4WVFA 1E1QA 3O8BA 2OFWA 2BMDA 2QPOA 2REXB 2XTMA 2OCYC 4JVSB 2OG2A 4L9SA 1SULA 2D3WA 2GK7A 2A5DA 2Z4SA 1KO8A 1CJTC 1OT3A 2Q21A 4R7ZA 2QORA 1XNJA 2YZ2A 3NH9A 5DN6A 1L7VC 5FUWA 2XTNA 4F91B 3Q72A 4QBIA 1TQDA 721PA 1FTNA 1T5IA 3ND9A 3PXGA 4K8OA 4DCVA 1WBDA 1P5ZB 1W0JD 4U7DA 3AUXA 1TADA 3U6BA 4QNRA 5FTKA 3NBYC 2ZPTX 2GNOA 1COWA 221PA 4JKIA 3A1TA 2GETA 4Q18A 3NWJA 4KHZA 3K0FA 2HJVA 2WIAA 4C2TA 1OXTA 1ZYUA 3PVSA 1UPTA 1GWNA 3B60A 4QFMA 3SFZA 4QM6A 1FQKA 1KDRA 1J99A 1NBMD 3KJIA 1EK0A 3QEJA 5TVKA 821PA 3THYA 4LSGA 1G9XA 4DT1B 2CDNA 2QRZA 3H1TA 4M1MA 3PEWA 8OHMA 3CRRA 1G6OA 5CIQA 4HZUA 3GLIA 1AZTA 1IY1A 5IDVA 2QTFA 5BYKA 1CJKC 2HXYA 3EA0A 4XSGA 5CM9C 4WZAE 2QMOA 5GJCA 5E7MA 3K70D 3A1UA 1DO2A 3R8CA 1TU4A 2N42A 1Q22A 3IO3A 4M8NE 3MG9A 1ZC3A 2GJ9A 2IBMA 3KDSE 1E2LA 1EFTA 2QAGB 4CEJB 5CDFE 1ZIPA 2ZS8A 4B3FX 4UXJA 2C9CA 3PG5A 1YR6A 2WVJA 4TZ0A 2YKGA 5H70A 1E6CA 1XXHB 1JAIA 3GJ3A 4GNKA 1ZNXA 4Q1AA 4BZQA 5L3QB 1X8KA 4IOMA 3TBKA 2PBRA 4DLWA 1KI7A 1EFRA 5HE8A 3EAQA 2R6FA 1E9CA 2F55A 2GJSA 4DEXA 2QUZA 2ZR0A 4AKGA 1PUIA 3EZ6A 4EJSA 2KB0A 4OK3A 1N6KA 1NN1A 1ZP6A 1NL3A 3UMSA 2ORVA 4C30A 1IBRA 3FMIA 3IKJA 3P4XA 1G5TA 2BBOA 2BEJA 1LNZA 2GXQA 3K09A 3WRYC 1ZRHA 2REOA 3KKOA 1KSGA 3DZDA 4ESHA 5J4YA 3LW7A 4KAXA 4II7A 3L8ZA 3O47A 2W58A 2ZAOA 5FPTA 2ZU6A 5KNCA 4ZIRB 3NEYA 2IS6A 3KUCA 1NKSA 3WHKA 4D4JA 1KHTA 1DAEA 2ZE7A 3WP0A 3QUSA 3EXAA 1K6MA 4RD4A 4HLQB 1IN4A 4RVCA 4AURA 2AFHE 3GJ6A 3TUJC 2OSBA 3LRPA 3IEUA 5JS8A 3HYTA 4I99A 3AKEA 3W6PA 3RRYA 1U94A 4FCTA 1ZJ6A 1I2DA 3HU3A 2C04A 2GCOB 2XB4A 1IXRC 3V00A 1ZU5A 3A4MA 4PO9A 4DSNA 1XEFA 2YOFA 2QMUA 4FMDF 2TMKA 3UG7A 3IEVA 1L4YA 2RCNA 4JLNA 3UPUA 1W47A 1T3SA 3LO5A 2W00A 1N6NA 4FI3C 1MT0A 1SHZA 3VQTA 1Y3AA 1OJLA 3VAAA 3EARA 1M7BA 2X2FA 4HUQA 5AUPB 2ANBA 2MSDB 4DIEA 3Q9LA 1D2MA 2FSFA 3CH5A 4OQLA 3EWAA 3ZVNA 2Z0MA 4QC2A 1U2RA 4PANA 2PLFA 4C0LA 1GP2A 5BW8A 4OHYA 3SFVA 1VDZA 1DG1G 5EUMA 3K53A 4X8MA 3AF3A 4AYXA 3CUEF 1KO5A 4GRAA 2IK8A 1UEIA 4K46A 1ZW6A 2OZEA 3AH8A 2VP6A 4FXPA 4LHVA 4QBFA 3B1YA 3N2IA 2DWOA 1SKYE 3BH7A 4WA7A 4POAA 4LV5B 4U5XA 4L15A 1PUJA 3M6AA 2A5YB 4PR0A 3R20A 3ZLJA 5FPHA 5FOTA 3BRWD 2QU8A 5D3MA 2PZGA 2WM9B 3MWLA 4IDHA 2OEPA 3EIHA 4HZIA 3GPLA 1XX6A 2R65A 4PO1A 3A1WA 4Q1CA 4DLUA 2OXRA 3BS4A 3CRW1 2FE4A 4EPTA 1VYTA 2ZRPA 2C9OA 3RWMB 4LC1A 1Z22A 3FDIA 3PUXA 4EDHA 5TMPA 5JSZB 4MDFA 2ERXA 3DM9B 1TF7A 3LLUA 3SYNA 3VKWA 3G0HA 4JJKA 5H68A 2DWPA 4BLTA 3B82A 4TTRA 3SJZA 2GVDC 1GTVA 4Q7MB 3LBHA 4LUCA 1EFCA 5HCIA 3H2YA 4IRUB 1OLOA 1G41A 2V4ZA 4AI6A 1AS3A 2YOHA 4ASUD 1U0LA 3ADKA 2QE7D 3OEHA 2ZRIA 3K0SA 2A78A 1T5LA 2V7QD 1IXSB 2XXAA 3R9XA 1E1QD 4QL3A 4RZXA 1O87A 1UKVY 3AQ4A 3QPUA 2Z83A 2FA9A 5FTJA 4OQNA 3RSOA 4UXHA 4DLVA 4E07A 2J41A 4MYTA 2RHMA 4Z8XA 2FF7A 2H18A 5DN6D 1R10A 4DXAA 3KQHA 2QMEA 1US8B 4O25A 4V0NA 5DHFA 4OI1A 1J7KA 3TIFA 4CDGA 5EE1A 4V0MA 1QHHA 1KO4A 3SHWA 1F60A 1TF5A 4B47A 2WWWA 1CTQA 1G20E 4RD0A 1G5RA 4URZR 4Q1EA 4B43A 3U44B 3MMPA 3EC1A 1KI1A 2CL6X 1NJGA 4PHFA 4A6XA 1COWD 5AWFC 1TPZA 3L2OB 1IXZA 2IYWA 4FCVA 1XD2A 5TXGA 5H8WA 1II8B 3U2QA 2D7DA 4TMZA 3DM5A 3Q5DA 4BWYA 4AK9A 3GJ0A 2D62A 1FNNA 2F7SA 4GMDA 4B48A 3OHMA 5CK4A 1UBGA 2J9RA 1RJ9A 3PIRA 2UZIR 2QQ0A 3QBVA 4QHTA 2H5EA 1ZUHA 2VF7A 4KITB 2F1IA 4MRPA 3A6PC 4MRVA 1YZNA 5B64A 1JR3E 1GRRA 3FHCB 1GITA 1P72A 4IEEA 3RWOA 4JLKA 2NPIA 1R0XA 3FFBA 3BJIC 2DFTA 3THXB 2WBLC 4XWOA 3IO5A 3K9GA 3SYKA 5DISB 3P20A 5AJZA 4TLDA 4CYMA 4YC7A 1FUUA 4L16A 1KO1A 2ZS9A 5BYJA 1N0WA 2RGNC 2BMJA 4JMPA 2CXXA 4MRNA 3SJBA 2YHSA 2GEVA 3X1DA 5CYOA 4US0R 2RH5A 4AWXA 2ZSEA 2FGJA 1JQJC 1E2DA 3ASZA 3RHFA 3CRVA 3L82B 1LW7A 1KK1A 4C0QC 5EE3A 4B75A 2O8DA 1SXJA 3SU8A 1EFRD 4A36A 2QQEA 1XP8A 4LBWA 1V5WA 2GZAA 3PCRB 1QG2A 4JZKA 2FV8A 2A30A 1TL7C 3FHOA 1AKYA 1S2MA 4DLSA 3EPHA 1E2PA 1XEXA 2IA5A 1GL7A 1XU4A 3KFVA 4PC3A 2IS2A 1E2NA 1S9HA 5C4MA 4HB3A 4AC9A 1G4UR 1R5BA 4QGGA 1ZUIA 2I1QA 4L4UA 1G17A 5FBRB 3C8UA 4TMTA 2C96A 4HAXA 1TUIA 3F3YA 3RS3A 1XPUA 4P3YA 1CJVC 3UK6A 4BFZA 5EP3A 3N70A 2QBYB 2GDJA 4PHGA 3W8RA 1CR4A 3ZQJA 3AF0A 3TUZC 1M8PA 3K0FB 4C0BA 1RRGA 2KI5A 2GTPA 4TQ9A 4MGYR 1FMLA 2NO9A 1QVAA 2DFLA 1IQPA 3BWDD 3RAPR 5KOYA 4A0RA 3DOFA 4E09A 4IDPA 1A1VA 1ZUNB 2J7PA 4MH0R 1JJ7A 2HF9A 3HWSA 1HT1E 4TL6A 5HKKA 4CIDA 1WCV1 2B7CA 4PSKA 2BBSA 3GFOA 1FMJA 2FN4A 1ZM2A 4FWIB 1E2JA 2IUSA 2H57A 4AKIA 4D0LB 1VG1A 4WXRA 1E2IA 1F3OA 4RFSA 2RGBA 2ZRNA 2QROA 2VP2A 5FUXA 4JL6A 3BH6A 1G8HA 4HAZA 2ZRFA 4ABYA 4P31A 2PT7A 1SKQA 2IYZA 3TGPA 2Z43A 4GPTA 4NH0A 1KI2A 1W7AA 1XCGB 2O0KA 1W0KA 4LBYA 2F43A 3OIVA 1FX0A 3A4NA 1JI0A 1FP6A 1XEWY 4A6PA 2VHCA 2Z4RA 4EJSB 1P7CA 1P9RA 2V9PA 3KTAB 1Z0FA 4C4PA 1T9HA 3I3SR 4KBGA 4AKEA 3GFTA 1TNDA 5LBIA 1XTIA 1P75A 5FBQB 1G3UA 4HI0E 1OV4A 2ODNA 4DLYA 1QBKC 1GL9B 1JEEA 1FZQA 1GM5A 4P4TA 3WNDA 3CKLA 2ZE6A 3P1JA 4Q1DA 4RD3A 2SHKA 1U90A 5DO9A 5K8UA 1NY6A 3P4YA 1JPNA 4NMMA 4YMTA 2G1KA 1HY3A 1P73A 2ZSFA 3MRSA 1XF9A 4PTLA 4OHVA 1H65A 1M34E 5TDHA 1GAJA 3C7KA 3VKHA 4P32A 3SJAA 1F2UA 1E2KA 4P33A 3CLVA 5KSPA 1NG1A 2CMKA 2GRJA 1OH5A 3PUYA 1NBME 1M74A 4B44A 2RGCA 3FMPB 2RGDA 2AKAB 2CLCX 4OKSA 4ZV4A 1HTWA 4JBYA 1NRJB 5CITA 2C8VA 3Q7QA 3AUYA 4ILEA 4KU4A 2BV3A 3OEHD 2JGNA 1OH8A 3KXLA 3T35A 4G1UC 4NYIR 5TARA 4B76A 3ECCA 4BFUA 3JVVA 1QHGA 3ICEA 2BWJA 4HUQB 3GJ5A 1GRNA 2G77B 5DI3A 4M2LA 1OIWA 4C0HA 2WKQA 3CR7A 5JLJA 1J2JA 2ZYWX 4NCNA 3QF4A 2QT1A 4HB2A 4Q9KA 3LFUA 2C77A 4NCIA 1W5SA 1IONA 5EE5B 1IY0A 2CEAA 3N5CA 3WMGA 1GIAA 5CJPA 2NO0A 2KBEA 4XVRA 2G6BA 3H86A 2JDIA 3FWYA 4BASA 1N6OA 1MABA 3W8NA 3ZIAA 1CR0A 4RFVA 1MR3F 5AJWA 4QHSA 3I61A 1KZGB 2WIBA 3DOEA 2XZLA 2OCBA 2J0SA 3KJHA 4K81B 4Q03A 3UANA 3Q8XB 3LVRE 5D3MB 1CR2A 1J8MF 1QHIA 1D6JA 3TSZA 1VCOA 1DAMA 2VBCA 1PV4A 3H84A 2ZAMA 4Z51A 1MO4A 1MV5A 2Y8EA 2VHUA 3IHLA 3PENA 3WRXC 5FR2A 5A4JA 5KU1A 3CF2A 1UFQA 3Q3JB 2ZVPX 2IEZA 2ATVA 2ZI4A 1UADA 4GSYA 4Y0VA 4B74A 2D2EA 1VYUA 1N6RA 2VSOA 2A5JA 1RKBA 4JVLA 4G0NA 4IDQA 4XD7A 3X2SA 2VLIA 5HCNA 1EWQA 2C03A 4QJ4A 3OF5A 2C9YA 2QI9C 2IYTA 4FW9A 2R6AA 4UNQA 4TZ6A 2V1XA 2AL7A 1XMSA 2ZREA 4BZPA 5DYGA 3VX4A 2ZRMA 4BEBA 2CE2X 2QT0A 3MFYA 4OQMA 4A8JC 2IX3A 1OB2A 4BFVA 4R71A 4W5HA 3R7WA 2ZE8A 1XPRA 2YVUA 3R8FA 2XXAB 2BCGY 1SXJD 1JNYA 3ONWA 3NTUA 2QY9A 5EE9A 2Z6VA 2ZJ8A 4WXPA 2ZR7A 1E0JA 4CGZA 3Q5EA 2PX3A 4GOKA 4W5WA 3OFNA 1XMVA 2WICA 1DO0A 1KI6A 2GKSA 5E3HA 3TW4A 2XZOA 4GMXA 4XIGS 4ZDIA 2PMDA 4IDNA 4C7OB 3NG1A 3D7MA 1QHHB 1WE2A 3DMNA 2DWQA 2P5TB 1DARA 3I8SA 2W6ID 2WJYA 3CRMA 4BEJA 2QEQA 5KUTA 1E9EA 3U5ZB 1ZC4A 2C95A 3NBZC 5FBLB 2ZUDA 3CPJB 1FFHA 1E9DA 2WKRA 3OESA 4C0JA 4XOIA 4X8HA 5H1YA 1BMFA 1XMIA 1XD2B 1YVDA 1M7GA 1T6NA 1XTKA 2E87A 3BIFA 4RZ3A 5TV2A 3OAAA 2NMVA 2OV2A 3AF1A 5FOVA 4LJYA 3FKSA 4B73A 3CF6R 2Q6TA 3BERA 2CCJA 2FEOA 5C4GB 5IK2A 4JL8A 4QG7A 3CX6A 3MWYW 2XNDA 2J7PD 1P2VA 4Q19A 4XVQA 2IYLD 4TL7A 3EWSA 4F4JA 2DFNA 5HKKD 4OJKA 4B3XA 2Q9AA 1OYWA 1Z8FA 4DLZA 4MRRA 4G5QA 1KAGA 4Q21A 4KVGA 3CRQA 4HLUA 4LJ4A 4FMBB 1ESNA 3HU2A 4B3CA 3AVTA 4A0GA 2D74A 1T4GA 4B6FA 4DC9A 2XZPA 3RDPA 3WYGA 4XWAA 2IF2A 2XGJA 1W4CA 4G5GA 3ZGXA 3QNUA 2QRNA 3QPWA 3M4YA 4B71A 3LX5A 1KO7A 2ERYA 1IN5A 4LPKA 4LV6A 4GP7A 4B6EA 1HYQA 1ZM9A 4QHYA 4KXFB 3TNFA 4D2IA 5JBQA 2ZJ2A 3FOZA 3ZVRA 4PHHA 1Z6GA 4NP6A 4JLAA 1G7TA 5G41A 3AVQA 3TAUA 2O8DB 1W0KD 5AJYA 2ZRDA 2CL7X 1GKIA 5EJEA 3IIMA 3AVWA 1OH6A 1JBKA 1GG2A 1R2QA 1Z29A 5FI1B 3LXXA 1N6PA 2FSGA 3KB2A 4Q47A 4BECA 1X1RA 2IHBA 3QXHA 4DJTA 5L3SB 3GP8A 4ZCMA 3U3JA 1IM2A 1DTSA 4PAMA 3IIJA 3I8XA 4JS0A 4IXMA 1E2QA 1Q1QA 1NKTA 3LBIA 4R98A 3TKLA 2FPLA 4WW0A 4TLCA 4OK5A 5J5CA 4YQFA 2GF0A 3VHXA 4FINA 1XD8A 4UJ5A 4V0KA 2JATA 3LQQA 4TLEA 1MO3A 2AX4A 4I1SA 1QF9A 3ZD6A 3ND8A 1X86B 2A9KA 1E0KA 4XJXA 2AR7A 3L0IB 4Z54A 3UWOA 1F48A 4B3DA 5GVSA 2DY1A 4B33A 2ZI6A 3W3ZB 4JIMA 3EPKA 2P6UA 3RS0A 3A1SA 3F5FA 5C18A 4G5OA 3WY9A 2X2EA 4URYR 1JQLB 3QG5A 4JLDA 2ZITA 2IXFA 4MKIA 2R44A 1ANKA 2XTZA 3BFKA 1MKYA 3GLIE 1JEDA 3V9PA 2AXPA 2HCJB 1LV7A 2P5SA 1G1MA 3NIBA 2G1JA 4L8GA 5CYPA 4Q9LA 4RFSB 1G8FA 5B57C 1W2GA 3TUIC 2IUTA 2WWGA 3VKGA 1YU9A 1NLYA 1DPFA 2QAGC 3FMFA 3LBNA 3PEUA 3QIAA 4NCHA 2Q9CA 2NZ8A 4PO8A 1ZBDA 3TRFA 2BJWA 4Q9JA 3H4MA 1HH4A 1PLLA 1FL9A 4LBVA 3EPJA 1KJZA 5AK0A 5EP1A 2JLUA 4AD8A 5IF9A 4DUGA 1T8TA 1KKMA 1VKJA 3MLEA 3P32A 5EQTA 2CHVA 3ZIAD 1A2BA 2GF9A 1G3MA 3BGWA 4ON9A 1S1MA 4KODA 1CXZA 2AN9A 2CHQA 3W9YA 4I1OA 1AGPA 4XSHA 1P4SA 2B21A 2IYQA 2RMKA 3U7FB 1G64A 2H16A 3DEFA 2V3CC 1YR9A 2Q0HA 2W2VA 1VCMA 2AWNA 3RNLA 4EUNA 2P65A 3A37A 3CIOA 4WIAA 1YZQA 4LYAA 3NEJA 1X1SA 5JCPA 1N6IA 1T8UA 4B2LA 4IEIA 2FZ4A 4QJ3A 4TYQA 1CJUC 1CBUA 1KJYA 1G3IA 5A0FA 2OHFA 1P60A 1XCPA 1KY3A 3QKRB 4XD7D 4A15A 2OBLA 2WSSA 2G3YA 3SE0A 1OH7A 2J3EA 4FCWA 3A4LA 3W6OA 2D7CA 1A82A 2QENA 1OPXA 2GAAA 4JSYA 1UDXA 3QJYA 4BE7B 3RS2A 3U7GA 2IHYA 1ELOA 3FGNA 4A0HA 4JT4A 5JJLA 1NN3A 5D3QA 4E5UA 1MH1A 4DB4A 4KFUA 3HDTA 3GEIA 1Q44A 4CEHA 4YDSA 4XTCS 3LLMA 3MGCA 1Q1ZA 2IWHA 3K70B 4LHYA 4TMKA 3X1ZA 2OFXA 3R9IA 5EUQB 5DI3B 1UKYA 1NG9A 3AGPA 3REFA 4PPFA 4J0QA 4HDQB 5SZJA 1NVVQ 3SC3A 3QF4B 3OFND 4OYHA 3J81k 1G5PA 1SVWA 2R62A 3VU9A 4JKYA 3KB1A 2JASA 3CX8A 3F0TA 3QEOA 1T0HB 4DIDA 2P0EA 4RD6A 1V43A 1MABB 2QSYA 2X77A 3BXZA 2FSIA 1DS6A 5KPDA 4JLMA 1CS4C 5LB4A 2ZJOA 1YR8A 3EPLA 2WJIA 1WDTA 1XTSA 2HT1A 3IPXA 4Q7JB 1Z2AA 4DCTA 1BMFD 4NTZA 4Q9HA 5EE0A 4A9AA 3PUVA 5EP2A 3SHFA 4LY6A 3PEYA 1NLZA 3OAAD 1ZMXA 3ZD7A 3FKSD 1HE8B 1KIMA 2VHJA 2GJKA 1SZPA 4G5SA 4G3XA 1YZTA 5FOXA 2FWRA 5AUQA 3SOPA 5IK2D 2XNDD 3PEVA 4UXIA 5FOUA 4TMWA 3RS7A 4LZZA 2WJJA 1UKEA 2CLDX 2BDTA 1M7HA 1KZ7B 1U98A 2EWVA 5BWMA 1JAHA 1P61B 1NSTA 2CE7A 4HAYA 4PZZA 2WJGA 121PA 2HLDD 3MSXA 4LYJA 3GLGA 2A5FA 3AF2A 2NO6A 4LPSA 1IJFA 4NCJA 3ZVMA 4HYYA 1VIAA 4M1KA 4JSTA 2YJTD 4RZ2A 2GBLC 1NNEA 2PMKA 3V4FA 4PC1A 1JECA 1S3SA 1E99A 1Z63A 3MUFA 3QE0A 2ZRKA 1K5GA 2WAYA 2AK3A 2UKDA 3GLFA 4HATA 3E5HA 2O52A 1AM4D 1N5JA 2FSHA 3HU1A 5HE9A 2ANCA 4YLGA 1JXOA 3R7WB 3CF0A 3I92A 2BHRA 4I81A 4JVMA 3B9QA 5CM8B 2CHGA 4Q4JA 2ZETA 1CR1A 4GFDA 1E96A 4O2RA 4A92A 1DELA 1PLJA 2QMHA 3KQLA 4NYJR 2F9LA 1YKSA 4X8LA 2L0XA 3U61B 2IL1A 2HF8A 4W5JA 1TAGA 2DBYA 3S1AA 3VNVA 1N6HA 3SJCA 2DFKB 2XAUA 1PLKA 4XH9B 2ZE5A 3X1XA 2EQBA 2VRWA 2GWHA 4JL5A 1ZCAA 4LK2A 2DR3A 4HLDA 5DI9A 4V0ME 3VR3A 3CWQA 2GJ8A 4BFWA 2FFBA 1CP2A 2ZIAA 2FEMA 1G8YA 5TY0A 5JHHB 1O3YA 3CW2A 1ZNYA 3OEEA 4A8JA 2J87A 1Z6TA 4UKDA 2W2XA 5IRCD 1XTQA 3GEHA 2NGRA 5UKDA 1D8TA 3BB3A 3QXJA 1OYYA 5DE3A 4Q7KA 3VNUA 1EFUA 1NMXA 2W83A 4DZZA 2J59A 4GBMA 4KLNA 4D26A 4UNSA 1E79A 2ONKA 3QVVA 1B23P 4PPQA 4Q4HA 5BN3A 3KQNA 1N25A 3QVUA 3WBKA 3AV0B 3FVQA 3IBGA 3LW8A 4URWR 1C1YA 2H17A 4NE2A 4LHWA 3WHLA 1EX7A 4OK6A 3SNHA 3B5JA 4PC7A 1NMZA 2CNWA 1UJ2A 1VPLA 1AIPA 1Q1BA 1SVOA 2CLSA 2QM7A 4HUTA 4LHZA 2BC9A 1II0A 2WWHA 3I73A 4KFTA 3CO5A 3U4QB 1DBSA 4BGDA 2IW3A 4M9QA 4IHQA 1J70A 3KJGA 2K5UA 2O8BB 1Z0AA 4D4LA 1E1RA 1E94E 4DUGD 1G8GA 4DLRA 5M04A 4KCGA 1WB9A 2ODEA 4M21A 1SXJE 1E69A 5CIWA 3UMFA 1VG0B 2HCBA 3GLHA 3BD9A 3U3KA 2CVFA 2WPDA 3BB1A 1U9IA 4QGAA 2ODBA 2R6CA 3U7HB 5JJKA 5F9FA 2LKCA 4WZBE 3DVLA 1XCMA 3NH6A 3P27A 1VG8A 3I72A 4OI2A 2FPKA 1E4YA 1WA5A 5L3VA 2HXSA 2OLJA 2W6JA 2IEYA 2WMOB 4Q02A 3VX3A 1N6LA 1XTRA 1H8HA 3B7GA 2N46A 1NN5A 2RGGA 4JJZA 1R8SA 2NOAA 1XJCA 5HPYB 2N1BA 2X1VA 3B2EA 4O0MA 5E7JA 3ZVLA 4KV9A 4BFTA 1R0WA 1KK2A 5AUNB 1OF1A 2QP3A 4F92B 3AP3A 5JZVA 3FPAA 3LNCA 2WSSD 5FL7A 3I32A 4GL2A 1D2NA 3THYB 1GSIA 1SVSA 2QL6A 4F93B 4FN5A 1NJFA 2JLQA 1KDTA 2Z5FA 1R8QA 3TW8B 2GZDA 2VSFA 5AJVB 4EPVA 5C46F 1D5CA 1R0YA 2CK3A 4HZUB 3GLIB 1G19A 2IUUA 2C99A 3D3QA 4ACAA 3AVVA 4Q4LA 1DG3A 5JJIA 4E03A 5JEEA 1AN0A 3SZRA 2RGEA 6Q21A 2O8CA 4BLQA 3LH5A 1JJVA 2ASEA 1M6NA 4A2WA 5J4KA 1XRJA 3QF7A 5BXQC 2FFAA 2VHTA 5BQ5A 2DYKA 4N1AA 2C78A 1JPJA 4LYHA 3T1OA 1CF4A 1ZM3A 1ZD1A 4MUAA 5G40A 1E98A 3KKQA 3IQWA 3REGA 2FG5A 3VR5A 3AVXA 4DSUA 2RB4A 2UZ3A 2AKYA 3KXKA 3M0EA 1RVDA 2CBZA 4P0TA 3DKVA 4Q5IA 2FOLA 4W9MC 4EJSC 2W0SA 4M22A 1A2KC 5JI2E 3L43A 1IN8A 1P62B 3U3OA 1HQCA 1HV8A 1YR7A 3K9NA 2WMNB 3FB4A 5B30A 2YYZA 1X8LA 2JCSA 2BM0A 3KZ1E 3K09C 2QP9X 3B1ZA 2O0HA 3OIYA 1FP7A 4IVQA 3VFDA 1G21E 2VSXA 3ZZ0A 5JCZA 3RS4A 4CEJA 5JHGB 2EYUA 1SGWA 1E2GA 1VYVA 1XZPA 1S1CA 1N3BA 2BCJQ 2WJHA 1MRSA 2XOKA 1SVLA 4US2R 2YWEA 2B6HA 3GMTA 2JIZA 1XXHA 3OZXA 3AGQA 5L3QA 1OFIA 3WXMA 2EWWA 2ZRCA 3ADBA 2JLXA 4CEIA 1IY2A 5JRJA 2Q3FA 3P26A 1AGRA 1RFLA 3PQCA 1W4RA 1P9WA 2VA8A 4L9WA 1QDEA 3SBDA 4DCSA 4QBHA 3LAWA 3ZS9A 1KJWA 1UBFA 1Z28A 4R9UC 4DHEA 5FPKA 2AFIE 1AK2A 4IDOA 4JYBA 2DB3A 4KYIB 1NN0A 1GKUB 4PX9A 4KSCA 4CVNA 1CJMA 1Z0IA 1Q0UA 3FE2A 3AP2A 3K9HA 3WBJA 3SQWA 3T5DA 3O8CA 4CEHB 3DMDA 1QRAA 4W7SA 5C1BA 2J0VA 2EVWX 2GCNA 4DSOA 1IN7A 1S0UA 3FYHA 4KBFA 3TK1A 1EX6A 2IYUA 2F1RA 5JFGA 3HJNA 4ZIRA 3MJRA 3R9WA 1LFDB 3B6EA 5DLQC 4H1VA 1XEWX 5E7IA 1KI3A 1EXMA 3MWKA 1N0VC 2EW1A 1W36D 2E1RA 4BLPA 5FPYA 1U99A 4EPRA 3EASA 3E70C 1NMYA 1Z0DA 3E1SA 4LCBA 4LX0A 1Q57A 2Q3MA 1EWRA 1UAAA 2PLRA 4M1OA 2XJ9A 3T1QA 1B0UA 1YZKA 2V6JA 2IWRA 4AG6A 1OIXA 4MGIR 3T5GA 5FBVB 4IXNA 2GCOA 1E0SA 1U8YA 2NO7A 4M1TA 1ZNWA 4PZYA 2JEOA 4ARZA 4D0GA 1RPZA 3KL4A 2H1LA 5SZHB 5KHOC 4U00A 3OEED 4IW3B 2GXSA 2OE2A 1R0ZA 4IVRA 4YMSA 5HZHA 2ZXUA 2VTKA 4YXWA 1G7CA 3B9PA 1E9RA 3VR2A 2P6NA 3VR1A 4MGZR 1G6HA 1LTQA 3LVQE 5DSZA 3HR7A 5FOSA 1E9AA 2IS1A 521PA 1X8JA 1E79D 4YMVA 5IHPA 2BBTA 3GLGB 3PJRA 1N5IA 1M2OB 1JB1A 1JALA 2GEUA 3ZQ6A 4B3GA 5CLQA 4OHWA 5K8LA 2ZRHA 4B34A 4M1WA 1AKEA 4LOAA 1ZNZA 1HUQA 4Q48A 5EXXA 1G4AE 4A4DA 3HPRA 1Z0KA 4LHXA 5SZIA 2D06A 4JLVA 2GCPA 4PPNA 2B7BA 4GZLA 5JMTA 3WYFA 5CB6A 3GLFB 1D2EA 1E9FA 1OSNA 2G88A 1EESA 4QGHA 2PT5A 4RZUA 5J47A 2ZRLA 4E22A 4H9GA 4ZI3A 3TQFA 2MSCB 4LJ8A 4QJ5A 3KFXA 1E1RD 3K1JA 4NDZA 2H7VA 2FPMA 3UIEA 3EZ9A 1XJQA 1FW6A 1KDPA 3FTQA 1QHSA 4JLJA 4RY2A 3NHAA 1FOEB 4XVUA 2WKPA 2HYIC 1G3QA 3F8TA 4TT3A 4AKHA 1W49A 421PA 2AK2A 2EU8A 4MYCA 4Z1MA 1W36B 2B8WA 2WPDD 4ZI2A 2OUKA 2OLKA 3ASYA 1RRFA 3DZ8A 3TR5A 1KNXA 4RD2A 1P2TA 4NL4H 2CL0X 2W6JD 2RGXA 4BLSA 1KTVA 4B35A 3TH5A 1H8HD 2R6DA 3GJ8A 2IXGA 1F5NA 4CZ2A 5G3ZA 4FMCB 2QAJA 1ZCBA 3EW9A 2IXEA 3L0SA 4OI0A 5GJBA 2RHDA 4KFSA 1Z3IX 4P4SA 2HT6A 3NKVA 5CJ2A 5EXSA 1R5OA 5FL7D 2C5LA 1L8QA 3QY0A 1L2TA 2EFEB 2YC4C 1RJ9B 3CZQA 1IN6A 4BFYA 4PSVA 1AJEA 1GL6A 4AYWA 3IPYA 4Q4HB 4F7WA 3TJZA 4PC6A 2J0UA 4TL8A 1US8A 1W44A 4YMWA 3B8HA 2CK3D 3TR0A 1DAIA 2PCLA 1RC8A 1T3LA 4IKEA 5CB8A 4JLOA 3AVUA 3IBYA 1YRAA 1A7JA 3LDAA 4JBXA 5AUOB 1GNPA 4M1SA 1N5KA 3CR8A 4EQ6A 1IAQA 2BM1A 3CNNA 1LS6A 2NO1A 1X3SA 3BBPA 4LGMA 3KXIA 4M53A 2CVHA 4QBGB 3WMFA 4D6PA 1ESMA 1ONBA 1P2SA 4MUBA 4C3ZA 4O3MA 1KMHA 4KJZA 4PAQA 2QPAA 3CZPA 2IYYA 2LKDA 4EFMA 1ZVQA 4ZKEA 2RGAA 2WWIA 3I62A 1WMSA 3MAAC 5EXPA 5LD2B 1E2HA 1SXJB 4GI7A 1K8RA 1BH2A 3KX2A 2I3BA 3GLHB 3LX8A 2UVQA 4BLRA 1W4BA 4DBLC 1XEXB 2OFOA 1M1YE 1VTKA 3HYRA 4QRHA 3THXA 4HEJA 4LBZA 4GT1A 1HQYE 1YRBA 2W0MA 2O8EA 3RANA 1AS2A 2EFHB 1YZLA 1R6BX 4URVR 1WGWA 2ZJZA 4TN1A 2VP9A 2C98A 3SDZA 3AB3A 1Q20A 2BKUA 2RGNA 2XOKD 1IOZA 1MO6A 5FOWA 3TSOA 2HJGA 3DL0A 1PZNA 2JIZD 4DDWA 1GOTA 2OCPA 4N3NA 4TL9A 4BLOA 3CB4A 4MKHA 1P6XA 3OE7A 3SYLA 3UWKA 1Q3HA 2G83A 4GDFA 2ZYTX 4JLPA 2JLSA 4MYHA 2BIFA 3AKDA 3ADDA 2CJWA 4ZO4A 5FFMA 5FR1A 3EIQA 2KJQA 2ODWA 3FMOB 1VHLA 2ZI9A 3LQRA 2ZJ5A 2QN6A 1MO5A 2G0NA 3BFVA 2RAPA 4LJ6A 1KNQA 1Z6AA 2ZM5A 2O8CB 3EIEA 1Z2CA 1G8PA 3NC0C 2NIPA 2O8FA 2ZSBA 1UDWA 2FX3A 3AVPA 2QBYA 1P3JA 3RRNA 4DDVA 3GQBA 4D4MA 2JLZA 4TTPA 4M1YA 1Z83A 3VHLB 5FBWB 2J1LA 3TSWA 3IUYA 3U7EB 4I1VA 2QG6A 2OXCA 2GVZC 1HA3A 2ORIA 4EPXA 621PA 2PEYA 4AY2A 2R6GA 2YWHA 3GJ7A 4NPHA 5GJWC 1S96A 4QNMA 1HE1C 3NC1C 2YNMA 2F43B 1WP9A 2QTVB 1FX0B 1KSFX 3D6TB 3AEZA 3Q7PA 5AR1A 4H1UA 2AWOA 3EX7C 3THOA 2JDID 3RS5A 2V8OA 3K0CC 4LJ9A 3SI7A 3ZYCA 4LJAA 3UG6A 4PC2A 1WF3A 3GJ4A 2WV9A 4I4LA 4HAUA 2WWXA 2ZI3A 5A5GA 3QOFA 4YXWD 2JJ1A 2ZU0C 3LXRA 3VR6A 1DVRA 1NI3A 2VP4A 2ZR9A 4M0LA 4ESVA 1UKZA 4PXAA 4YMUA 5CDFA 3K8YA 3TE6A 1U81A 2GEDA 1Z6YA 3WNCA 4EFLA 1GNRA 3BB4A 3B1VA 4CEIB 2H92A 4MKFA 2GAOA 3RRZA 3RVBA 2EFDB 1S4QA 1RYHA 4XWKA 1F2UB 4FWTA 4RCZA 5DYIA 2OCAA 3KTAA 1HT2E 1TQ4A 2A2ZA 1OHHA 1QHNA 3AKYA 4UQOA 1MOZA 2BOVA 1LY1A 3C41J 2VL7A 4URUR 4ZDWA 4NZYA 3U6KA 5ELXA 4D82A 1ETUA 4OL0A 5DGXA 5F9HA 1TQ6A 4Q1BA 3CX7A 1DAKA 5E95A 4TLBA 5JEDA 5KSZA 3TVDA 1LS1A 3QI2A 4ZKDA 2YC2C 4CT5A 3O8RA 3LV8A 2JLYA 3K70C 4KSBA 4PPGA 2FU5C 4S2EA 4DCNA 1RRCA 3CONA 2F1JA 4U02A 4IFBA 2V6IA 2J46A 4QM7A 4TT3D 3SQXA 4KVAA 4Z1MD 1DEKA 1XFAA 2WTUA 1TMKA 3EA5A 4AG5A 1DOAA 2IS4A 1QHXA 3DDCA 4O2LA 1K5DA 3T1TA 4KO8A 4V03A 4OQXA 4TTQA 1Q3TA 1KK0A 5EZ6B 3C5CA 5JWRA 1LVGA 1Z0JA 1FTSA 4BFXA 4NBSA 4ARZB 1EGAA 3G82C 3BAFA 5HZKA 1DE0A 2WOJA 4N0DA 3B1WA 4M4SA 5GADl 3PUZA 2HDNB 2YINC 1OXXK 3JZMA 1F6BA 4TSFA 5AJXA 3T06B 1VIYA 4TQUS 3SN6A 4D80A 1II9A 3K9LA 1I4LD 4RJLA 4QXAA 1Z6XA 3DHWC 3TLXA 1XMJA 3CPHA 4RCYA 3NDBB 3B85A 1TTTA 3LY5A 4G01B 2ZSDA 2IT1A 4V02A 3PUWA 4NYMQ 1NLFA 4ZDKA 1UM8A 2NQ2C 2JJ8A 2JJ2A 2I4IA 4Y0AA 1AQUA 2AHOA 3QG1A 3W34A 3BH0A 4AYTA 3RRMA 1TQ2A 1FPMA 5B58C 1KMQA 3GLGE 2XITA 1WRBA 1PVOA 1KI9A 4UJ3A 3DO6A 2EFCB 2QGNA 1E32A 1J90A 4ZCIA 4NCKA 5G53C 1U8AA 4DEYA 3MJHA 3A8TA 1Q12A 4LV8B 5EP4A 1W4AA 4MRSA 5F2EA 3A36A 1A4RA 3SR0A 3WMEA 3X1WA 3GLFE 2KWIA 2PCJA 3BORA 4MDEA 1TU3A 2FDCA 4B2PA 2FMXA 1AS0A 2VO1A 2WOOA 4C9BA 1OB5A 4X8OA 1GNQA 5LDDC 2QGZA 4TWZA 1ZIOA 1CEEA 5CLLA 1XB2A 2VIIA 2A7QA 4JLBA 1GFIA 4KYUA 1ZD8A 5EZ5A 4DLTA 3JVUA 1MRNA 4FMCF 1QG4A 1OFUX 4DVGA 5LPNA 2BMEA 2R9VA 1NVWQ 2PH1A 4NYIQ 1F2TA 1PJRA 3QKTA 2P2LA 1BYIA 1JXMA 2G0TA 1KI6B 5KNBA 2R8RA 4BFSA 2ZUBA 2Q9BA 2VHQA 2QSZA 2VEDA 2Q3HA 2ZI5A 5J40A 1G18A 4DSTA 2F1HA 4M9XA 1AZSC 3EG5A 3TAHA 1CIPA 5GJVC 1TUEA 1GILA 4JVNA 5F3WB 3EZ2A 4KLZA 1SQ5A 5FPSA 2WAXA 3AKCA 1W48A 2JA1A 1OXUA 2ZANA 4P4SB 3HP1A 2IC5A 3OE7D 2B92A 1OXVA 1C4OA 3AM1A 1XTJA 2W2TA 4QOSA 1E9BA 3BOSA 3PR1A 4WOPA 2J0UB 3QXCA 1WXQA 4HLUC 4HAWA 2P6RA 3THWA 1XBTA 5KYKA 3IILA 4C7OA 3O8DA 1Q21A 4RSGA 3WNBA 1YJ5A 2D4HA 2WSMA 3W5JA 3ICQB 2WHXA 1FQJA 4EQ6B 2CCKA 1NIPA 4B32A 4OBEA 3K0AA 4PSAA 3FFAA 5KPJA 3EZ7A 1ZM7A 2YWFA 2XSZA 3D8BA 4PFSA 4Q4AA 4A82A 3ZJYA 5KSOA 1N5LA 2WJVA 1KKLA 1KMHB 2CCGA 2ZJYA 2FFHA 2ZROA 4GZMA 4BUJA 4A0FA 3DKPA 1E2EA 4QGFA 5ANRB 2BMFA 3QKSA 2QZ4A 5DHAA 4RD1A 1GZSA 2YWGA 2LCFA 3IGFA 2ZJBA 3MCAA 4GOXA 4PQYA 2VQSA 3W90A 2I1VB 5L3RA 2NZJA 2IYRA 3BFXA 1JR3A 3UMRA 3SEAA 2BVNA 4NKRA 2FZLA 2BKEA 4B2IA 3C15C 3ZZTA 4IOLA 3TMKA 5K8IA 4CF7A 2ZS7A 3GLHE 5K8TA 2RKOA 5J4LA 2JLVA 5BN5A 3D31A 3C4JA 1Y63A 1NF3A 2OBNA 2ZVQX 2O8EB 3HR8A 1EFHA 2JJ1D 2O0JA 4DDUA 1G7SA 1HURA 5FUYA 3VMFA 5FTNA 4A1FA 1LF0A 1SVIA 4G5RA 4DRZA 4HAVA 2V54A 3K0EA 3PITA 4BRWA 2AXNA 1ZINA 2QNRA 3LA6A 3QKUA 4I1UA 2GESA 4LYFA 1T91A 5FH9A 4B3BA 1RE0A 4S35A 1BYUA 4MKGA 2QPTA 1KGDA 5B2ZA 2BEKA 3OIWA 1KYIA 4Q00A 2HV8A 1YZGA 3KQUA 2CJWB 2E9SA 2FNAA 4NHOA 4TQAA 1UF9A 4BZXA 4IOJA 5KNDA 1OHHD 2BJVA 5L3SA 1KAOA 4PZLA 2A3RA 3T15A 2PZEA 4GOJA 5KDOA 1WQ1R 1CULC 2XEXA 3DPUA 4C0KA 4JT2A 2XX3A 4DDTA 1CRPA 3B78A 1NY5A 2W6IA 4PHTA 4WAUA 2O8FB 4DKXA 2VP5A 2JLRA 2OAQ1 1P9NA 1CRQA 1TX4B 3U3RA 2C2HA 5BN4A 3IDQA 3BC1A 4IFEA 2MSEB 4Q66C 2ZRAA 2PX0A 4KI0A 4Q01A 1W2HA 4EFNA 1YZUA 1VMAA 2OO7A 1BO6A 4JYCA 4CT4B 3G5UA 4EKDA 2GXAA 3KKNA 1U0HC 3JZAA 2GK6A 3B1XA 4L5BA 3AVYA 1UBEA 4PAOA 2P3SA 1WBBA 1RIFA 1IHUA 1A5TA 4TYPA 1H8EA 4MGKR 3N2EA 5DIFA 4DT1A 4PQFA 1OKKA
chains in the Genus database with same CATH superfamily
1IG3A 1QRUA 4CM7A 3AJMA 3KVVA 3NVAA 4KXNA 5DBGA 1NVVR 5FXMA 5IZCC 3KJEA 4JBWA 1J8YF 3FAJA 2FZCA 3STXA 1NE7A 2IEBA 2GXUA 4XLZA 5D5PA 3SBEA 2ZXPA 2OT3B 1XXHE 1JHMA 1U3GA 1ND6A 5IBRA 1ZH6A 4FT2A 4V0RA 3ZK9A 5A6BA 4OM7A 4TYNA 4AJLA 5BQHA 3AETB 4H6VA 4D4KA 1EVZA 3C98A 2DHRA 1J00A 1ODFA 2WD8A 1NNSA 2XPCA 3VR3D 5JNLA 2AOXA 2DUWA 3LD9A 1E85A 3BHNA 3T12A 4JB0A 1SKBA 1UEXC 3RW9A 3AMVA 4TS4A 2VQ6A 1CQJA 1KIFA 3ZGLA 3R6LA 2FMHA 3K6KA 5JIBA 1SKYB 1U0TA 2OV8A 1CY2A 3AKZA 1KK3A 1E2MA 5TC4A 3OCWA 2WAOA 1GN9A 5B4UA 3I4FA 5KKNB 2Z9CA 5IXYA 4KDRA 3EXIA 3ZY5A 3KRTA 1U8ZA 1Q3KA 3KVRA 5EPUA 5EEGA 2B5OA 4QUAA 3DJUB 3KEQA 4OHZA 1B0AA 1XJ0A 3K0KA 2D1TA 5T67A 3SSAA 4G9GA 1E8MA 4UQLA 3C3PA 4Q4AB 2G9NA 5JZ9A 2QD1A 3TD7A 1HY5A 2JAUA 3EFEA 4J0HA 1GPYA 3EXHB 3BRWA 5BV0A 4LFCB 2O5VA 2WUFA 3ZKWA 1L5QA 4YP0A 2P7HA 4RGVA 1U9IC 5P21A 4NYJQ 1URPA 3NHMA 2IF0A 4QYTA 2LFFA 2IYOA 2QS9A 1CY6A 2ZYUX 1DAGA 4G0ZA 4US1R 2G7MC 3AJ9A 3VR4D 1OLUA 2P77A 4HRVA 4UM9D 1SVMA 4B5LA 3O4FA 1BE1A 4F71A 2XTMA 4B5KA 3QMKA 2Q62A 1Y3BE 4F91B 4LDRA 4D9FA 1ILEA 1P5ZB 4MB6A 3T3GA 5HX7A 221PA 4Z1OA 3NWJA 3F5QA 3P2KA 1V5EA 1E59A 1BVUA 4IB4A 2M2IA 4MARA 3BEOA 5BR7A 2GB4A 3TW8A 1G8AA 1ZGAA 3VTAA 3B29A 3H7IA 3N0WA 1CJBA 1C7QA 3U3XA 1DO2A 1N1MA 1JDZA 3JQGB 1A98A 3KDSE 1SMKA 3PD1A 3TPCA 2LIGA 4PS0A 2VTEA 5J5VA 2IPNA 3GAZA 3SVLA 4H6PA 4CF3A 2XCUA 4K28A 5CDGA 2ORVA 1C30B 4G4SP 1HNNA 2XLEA 4RWEA 5HRUA 1MN6A 3NGMA 2NV0A 1I5RA 1KHTA 2ZE7A 5T3UA 5CLGA 1VLLA 1MPTA 3FDZB 3HYTA 4EG1A 4U9IS 3PJEA 2PMCA 2MSLA 1PAUA 5E9JA 3O4RA 2AGVA 3VQTA 2IELA 5C53B 2BYTA 3HCEA 4LOKA 4M36A 4LOLA 3OF3A 4RO0A 1FK8A 3W1VA 3ANSA 4FMPA 3G5MA 1YS2X 3GL9A 3K31A 4QBFA 2X22A 4OTZA 1TJ3A 3EVAA 2YV4A 2AHRA 3OP4A 4IDHA 5DNWA 2LE0A 4DQ0A 1V6AA 4LC1A 5IAEA 4YI3A 1T8YA 2IXDA 2VCYA 3KB8A 3SJZA 5CGQB 1PJSA 3F6EX 3H2YA 4AI6A 3WZ2A 5CVVA 4P86A 1OILA 3R9XA 2Y6UA 4QUHA 3JYHA 3ISTA 3LUCA 1S2GA 4DXAA 4O25A 4V0NA 3MC1A 3LQKA 4N01A 2WWWA 1RYZA 1T8WA 4W99A 3UMHA 3DEHA 1VHWA 3Q5DA 4GMDA 5G0VA 2F8SA 5CK4A 3HGTA 1RJ9A 1XLUA 2QQ0A 1ZUHA 4CMEA 1MJ5A 4K88A 3LP6A 3BX1A 3N0XA 4YC7A 1P17A 3TZHA 4HDRB 3DZFA 3X1DA 4X91A 2HJSA 1XDWA 4KWTA 3T7TA 4IIVA 2B34A 3IPAA 7AT1A 1TW3A 4NEQA 1ONPA 1QG2A 2H1HA 2RDMA 3L5KA 3JW8A 4R84A 2CSUA 3KQSA 5EUBA 5A5FA 3D5QA 4HAXA 2RHBA 4J1NA 3LPAA 1MMNA 4RIFA 4L74A 1HBJA 1XVTA 1UKBA 3DZJA 3RSZA 1TVMA 1Q7EA 2Q99A 3O9MA 1CUHA 2NUAB 2H57A 3ORFA 1P77A 1CDZA 4FCCA 2E5LB 3REQA 4DA8A 1JEYA 4NE9A 3BXOA 1YARO 1G8HA 3GNLA 2OAGA 3HXQA 2OFFA 2Z43A 3C7DB 4NH0A 2FCAA 1VL1A 1B93A 1V3QE 3A4NA 4ZXFA 2QNIA 2P27A 1P7CA 5BMVA 2W98A 13PKA 3HXMA 2QXUA 4FOLA 3FOEC 2ZE6A 1VB5A 2YTZA 5K8UA 3AW9A 1P73A 1BEEA 5CH8A 3F7NA 1O89A 5FDFA 3WK8A 5KTTA 2UZAA 1E2KA 1SZJG 4I2VA 4BNHA 1V3TA 3QFRA 2HY7A 1NBME 1LDMA 2ZP1A 1OR2A 1OPRA 4FSHA 4D4GA 2VCCA 1L8AA 1H0RA 3DXFA 3FDFA 4Y7CA 3ZDYB 2MINA 3DVSX 2C4TA 3CO0S 3IOCA 3QF4A 5EJ4A 4MIOA 1O6FA 5KVSA 4TWJA 3G9UA 1H85A 4BP3A 3ZIAA 5C8YF 1PNVA 2XZLA 4K81B 5FEUA 2B3TA 5ALMA 3L0CA 1I3CA 3L8IA 4QUJA 2Y8EA 4CNBA 4EA7A 3O3MB 2R48A 3UA3A 3Q3JB 2ZI4A 3O92A 3ANNA 1CZNA 4GX5A 2I33A 2B4YA 5EA2A 3FXHA 2AG5A 3PNMA 5BNTA 2R6AA 4Y9RA 4P9FA 5HFJA 2L81A 2QR5A 4K6FA 2GBCA 5IANA 3N3BC 3HADA 1F1JA 3R8FA 1SXJD 1FYXA 1M9NA 1JNYA 3U62A 3VSBA 4R1MA 5BW4A 4MS4A 3TQHA 4Q4DA 3VPAA 5IUJC 3MNFA 5T6BA 2XLVA 2NWQA 4FR0A 3N05A 5EZYF 1SCUB 2WJYA 3KETA 2XOXA 3EXFB 3FR7A 1PWZA 3SKXA 2CDQA 1GLNA 1XG5A 1VLTA 1UJ4A 2NZYA 1JYSA 5KX5B 1NKVA 1U3DA 3FGPA 4TQGA 2HM7A 5KI6A 1SUBA 3U4AA 1KAGA 1RJWA 2PWZA 4KVGA 4FONA 5AW0A 5DM60 1VI2A 4XWAA 2XE6A 3LO8A 5BV2P 1JHQA 1HT3A 2X0FA 2DR0A 2BSQA 4Y7DA 5LOVB 4M76B 4CMCA 5AJYA 3E3NA 2C4VA 4G4GA 2Z3WA 1TK2A 2WVHA 1GKIA 4UTZA 3EF0A 1OH6A 4H2DA 3LXXA 4X66B 2BFPA 4RC9A 2P9HA 4HGZA 3CYFA 1PL0A 4ZMBA 4YJDA 4EEKA 5IXJA 3DT6A 4TRJA 1XD8A 4UJ5A 1UFKA 1QQAA 1X86B 3OEWA 3SGLA 3LI2A 3K33A 3AOEA 3F5FA 1MA3A 4ZI7F 1MKYA 4RHUA 3WY9A 4V0QA 3ZN2A 4XM1A 1FZTA 2YIVX 3JCUQ 3R5KA 2Q1XA 5A3JA 1O77A 4GS5A 3BCHA 4DUGA 4UM9B 1JSLA 5LDHA 3ZK7A 4D8WA 5EKTA 1KKUA 1FDUA 1H0KA 1YAJA 1W75A 3B3AA 2RMKA 1PHPA 3DEFA 3AJAA 4DR2B 4EUNA 1RHUA 4YACA 4B2LA 4QOGA 3COWA 4C04A 1G3IA 4BQNA 1JT9A 4MVJG 2UXBB 3TL3A 2C94A 4JSYA 1GG5A 1JXQA 2IHYA 3NTLA 4JT4A 5JJLA 2R87A 1FCJA 3KBBA 2ODPA 5D3QA 5DJ5A 3S2IA 4E4TA 2WTMA 1Q1ZA 3FR8A 3KAJA 1AURA 5C8ZA 3UY4A 4DOZA 2VYVD 5KPDA 1Z2EA 3EPLA 1TLLA 4X7MA 3ROQA 1JHDA 3SHFA 4LY6A 2NUPB 5CCBA 5IC5A 3ZOKA 2HHLA 3QVJA 2FZEA 5IK2D 1E2XA 2WILA 2ZJ6A 5U4QA 4LZZA 4KQCA 7ADHA 1AUEA 4QDKA 1KZ7B 4IAOA 121PA 3MOSA 3AF2A 3WLPA 4NCJA 4YRCA 4HYYA 1VIAA 2YJGA 3UJ6A 4DANA 1QH8A 2UYCA 3ZK8A 1MW9X 5HE9A 5LQSA 1T4CB 3OQMA 4CIXA 2RJ3A 4S1VA 4BVLA 2W6OA 1PLJA 5KYVA 2P61A 1EJ6A 5A7HA 1G60A 2OLEA 5COAA 2AN1A 3TCXB 2XM0A 4KKXB 2UZ1B 3KWMA 5DI9A 4PWZA 1J20A 5MF6A 2R79A 2M1ZA 2WVAA 5F5NA 2J87A 4WK2B 3KEGA 3TJ6A 2P75A 3GEHA 3DLAA 4J6FA 4KLNA 3N86A 3DWWA 4UBKA 2ONKA 3L0ZA 5F77A 1PT6A 1O5TA 3H9QA 2CXQA 1NMZA 2IXOA 2BC9A 3ICCA 4YJFB 4FM9A 3GR6A 3GFBA 1W8DA 2YRXA 4DLRA 4L9AA 5ICEA 1H66A 4RXTA 2PUEA 2YASA 5FWXA 3U3KA 1HZJA 1EFVB 4LI3X 2PF4E 2QTZA 4P08A 3FIJA 4OI2A 1YQDA 1Y6JA 1ABFA 4OFWA 5D7NA 3IX7A 4ZOLA 5CX4A 2BFCB 2DR2A 4LQ4A 1Q50A 2QVBA 4LDQA 1W5FA 2I15A 4O0MA 4BFTA 1NVGA 4D98A 1EE2A 3AZOA 1WXXA 4P93A 1D2NA 1MP0A 3UBMA 5DKFA 1SURA 2JLQA 3D64A 1PGJA 5AJVB 2OPHA 1RXYA 1TO6A 3GLIB 3K94A 3MMSA 4YIHA 2ZUUA 4U5EE 3IHKA 5IH7A 1PWHA 1TZKA 3VR5A 4ALMA 1EUZA 4JURI 1R50A 2BLLA 1DJNA 4W9MC 3R3VA 3U3OA 3M6XA 3MYFA 4I1OB 3JRMO 2BM0A 1FFYA 1P6QA 5F28E 1ADYA 3TIVA 4EFDA 1S8AA 3UTDA 5LNK6 4CTJA 1PWYE 1RC1A 3DXZA 2ET6A 3UOWA 2J8ZA 3EDRA 1QYCA 1GG8A 4A27A 4NNJA 2P2ZA 4X54A 2HA0A 1Q0UA 1DTEA 3K9HA 2ON6A 2Z95A 3LBYA 2EVWX 1QO0A 3FYHA 2IYUA 5JFGA 3MJRA 1VE7A 1FVHA 3MJTA 3KM0A 4JX9A 4EPRA 5ADHA 6NULA 1TFRA 3W8IA 5AKYA 4Y9SA 4LG1A 1GDHA 3D0QA 3W06A 1HOXA 4DA7A 4GICA 1ZHXA 2I3GA 5E6UA 3CLKA 5LM3A 1G6HA 4LHSA 1U2EA 1X8JA 1N5IA 4JGBA 1ZHOA 4UVEA 1YZFA 1YVEI 1RM0A 2PFSA 3AEKB 3KZVA 3LCRA 4DZRA 1LTKA 5J47A 4CUKA 1E1RD 5JUAA 1B3BA 3R1IA 1M0SA 4YGYA 4XVUA 4LNUA 2HYIC 5JAIA 4YCLA 2HI0A 4MYCA 5C8YA 2I55A 1RRFA 3CEHA 4GDMA 2QIOA 1WKVA 3P0RA 3O38A 1Y8RA 4M88A 3TH5A 3P0HA 2HLNA 5E1DA 3MSCA 1LQUA 1WLYA 1S2LA 4OI0A 4LJLA 1BW9A 1XQ9A 3IURA 1Z2NX 1PWEA 3O1LA 3CZQA 1GL6A 2AIRA 4PC6A 4IXWA 1H6DA 4LYDA 3WMFA 1YASA 2Y4NA 3RGGA 3WVNA 1YTLA 2UYYA 5K0JA 2WWIA 2FW9A 1HDYA 1SXJB 1G4HA 1PEYA 1S01A 3GLHB 4LGCA 3HYRA 4RVUA 2QMYA 3EZXA 2R8OA 4GT1A 3JAKB 2RHGB 3DT9A 3S68A 1PZNA 3SVZA 1G9SA 1P6XA 1OTHA 3LY9A 3M34A 1QH1B 5FJJA 2V7EA 2RAPA 4FN4A 4EJFA 3PLAE 2ROQA 3NIDB 4P7BA 3ZUPA 2RHLA 1RQXA 1SIOA 1S96A 3UMCA 2YNMA 2JAXA 3L18A 4L8LA 2V6GA 2B8NA 2PJDA 3ROKA 2P6OA 1WCIA 1C9MA 2WWXA 2ZU0C 2UDPA 4M0LA 1GPAA 3WB0A 1YA9A 4OLFA 3WB2A 1F0KA 1FX1A 4K1XA 2FQWA 1EE1A 4JUDX 4MO9A 4CEIB 4ZI7A 3DE5X 1JEOA 5KTNA 4RCZA 3A25A 1TZJA 2QTNA 3G23A 3KLOA 1MOZA 3C41J 2DPHA 4ZDWA 5JD3A 2HCTA 5KSZA 1T9AA 1M2VB 3TR6A 1L1FA 3O8RA 2NYRA 3WGUA 3GZJA 1IXKA 4QA9A 4U02A 2QYHA 2YN0A 4YRFA 3W2HA 3TAXA 4DRXA 2XGMA 2PIAA 3EQLF 2GF2A 2EZ8A 3SBXA 3IB6A 4O5AA 3M2PA 2W93A 2R97A 1XYGA 4GF5A 4A23A 3U13A 3T06B 3NUZA 4D4HA 3VI3B 3SP1A 4FFPA 2IX9A 4QXAA 3Q8KA 4RCYA 3PUWA 4D44A 1E3TA 2I91A 1BMDA 1TKBA 4LTDA 4UJ3A 1XR3A 3WLTA 1BE6A 5C3UA 2QZ9A 4CMBA 3Q3EA 1CF2O 3GLFE 3UM9A 4RMNA 1E18A 2QGZA 5F7ZA 3C48A 4OXNA 1QG4A 3SJ7A 4BGIA 1ATZA 4BFSA 2I6QA 4M9XA 5DCWA 3VDNB 4U5QA 4KRGA 3EIOA 4M0CA 3EZ2A 3DAFA 5ALFA 1SQ5A 2UUAB 4E5YA 3DVAA 2C7GA 3WLIA 3MRXA 1JW9B 1CQIB 1DBIA 4E6PA 5CBPB 2ZTVA 3VZCA 4DUPA 1WNTA 1DZIA 3GRYA 3WNBA 2VF2A 2JH8A 3U81A 1F6WA 1ZM7A 4F11A 1UM9B 1DC5A 1RM3A 5A4IS 3L5OA 2FQYA 4QDUA 4QNNA 1E2EA 1EVLA 4QPDA 2ZJBA 4JCOA 4F60A 1BKSB 4U7HA 4AO6A 3BULA 3KLBA 4CLHA 4NAHA 4H3SA 4ENVA 1V8DA 1FLDA 4YT4A 4H7DA 4DRZA 4BRWA 4W5QA 1FDWA 1NW8A 1G98A 2EC5A 2H06A 4B3BA 2IQ5A 2ECOA 2PSSA 3BWEA 2HR1A 4NHOA 4ZGGA 2BJVA 5KDOA 3TW6A 4L4YA 4YMGA 2XS8A 3B78A 2HA5A 2VP5A 4OOFA 3ENWA 5BN4A 3VVMA 3SMVA 1Y5LA 2XHEA 3I23A 3HH8A 2F1OA 3WGTA 3N2EA 4MPDA 4PQFA 4LJRA 1ENZA 1H93A 1M10A 5DVWA 4QYIA 1TCAA 1KSHA 5IM5A 5CAEB 5KTYA 2PU7A 2JLWA 1CLEA 3IUJA 1N9GA 2WTEA 2C3YA 1WZNA 4WN9A 4OJQA 2LQGA 4MR8A 1J06A 3NGLA 1P4HA 3CISA 4BMCA 2ZRJA 4YB8A 3B1FA 3V6MA 3WL7A 1LLFA 2QJOA 2ZEJA 2CW5A 3FPKA 2KSQA 3EMKA 2O9JA 2E82A 4WJKB 2IDKA 4XGIA 4OHKA 2OAP1 4RVHA 5SY4A 3PDWA 5B3JA 4Y2UA 2QRQA 5CW2A 1VLHA 3TJRA 5IAJA 4GI2A 3DLHA 4FI3F 2W5UA 3Q6MA 5FTMA 4J0CA 4NONA 2ZDGA 3D6JA 3QU9A 1YZCA 3SY8A 2VCAA 3BMNB 2YY7A 2X51A 3IYLW 2H2WA 3JALA 5EJ6A 1XZCA 1U0JA 4JA2A 4L78A 5CYGA 5ULLA 4GWGA 3S2UA 2ORWA 1HF3A 1G2IA 1D9XA 4R2WA 2IGBA 2DFVA 4LC0A 2CNWD 4Z4CA 2FW8A 3CUVA 5D1NA 1L3BA 5KWEA 9MHTA 5DX8A 1VHTA 5I7WA 2BM9A 1W94A 3VTKA 4R2HA 1F2TB 3H9EO 3I0NA 1Z7GA 1N7HA 4DWJA 3S1AB 3HKCB 3FHTA 1KJJA 2PEZA 1PK7A 3I9MA 1KEEA 1A27A 5BSVA 1HE3A 2NU9B 1FJXA 3G7NA 3NT4A 5JSYA 5JRZA 3UJBA 3LAYA 3GD7A 3TOCA 2GARA 3V3TA 3NHBA 1VP3A 3R09A 1K97A 2RKWA 10MHA 4O2BA 1LA2A 1QWOA 2PYDA 2BSAA 3TG8A 4JNKA 1UFOA 1O1YA 1JJFA 2Y1DA 4B3MB 5FHQA 2Y77A 2BFOA 3JX9A 1JKXA 3E9EA 1G2OA 1L7DA 3NHZA 5JADA 1ZU4A 4FHFA 2Q3CA 3GEGA 3FAPB 1GTJ1 3LF2A 4WLNA 1O96A 5EWJB 4I3FA 4LYGA 2PO7A 3PFIA 3MTIA 3X1YA 1U7OA 2HTFA 3ZY3A 5JQGF 5HF6A 4PQRA 1Z0ZA 1BOFA 5CA0F 4XOUA 4V2IA 2QE7A 4QXMA 2W2MA 4KDCA 2IKQA 1SQGA 4K8RB 2YVAA 3STHA 1ZVJA 1LLQA 1FP2A 1XCJA 4OXIA 2PUDA 5BV1A 3PXGA 2QRKA 4ZOBA 1KL7A 3WLRA 1EFAA 3K2QA 5TQ2B 1LGYA 3LUFA 1EK0A 3GDGA 2CDNA 5C32A 2RHRA 2Z56A 1IY1A 4EA8A 3DB1A 2HMSA 4M8NE 4BNMA 1IBLB 2GJ9A 5CDFE 1VRWA 3T7KA 3GJ3A 2CLKB 3IP3A 4DV2B 1VBMA 1K8QA 2GJSA 2QUZA 1QTQA 3WKAA 4OK3A 2FHPA 7REQB 3CEMA 5FYDA 4GPZA 3WRYC 1ZRHA 2OTCA 3I8OA 4I55A 2CN1A 4KACA 4CKZA 4IEFB 5LP6C 2LUOA 3LRPA 2FQQA 3RRYA 3A14A 4H18A 5TS3A 4G0XA 2ZB8A 3PGKA 3EEIA 2LNDA 1HNXB 1Z7WA 1M7BA 2ANBA 5ITZB 2ZCJA 2IZ5A 4TV9F 2PGAA 4QC2A 1U2RA 4PANA 3CCFA 5BW8A 2A0XA 3WL3A 4DABA 1DXYA 3W3AH 5AXAA 3K9QO 3PYLA 4POAA 3UYLA 2KMLA 4YJ2B 5IT9A 4MJ7A 3SYNA 1D7OA 1HLGA 3GBVA 4WNAB 2W2LA 4G6ZA 3L6UA 3QHAA 3UHFA 1B26A 4M8KA 2HWYA 1NGSA 3COSA 3FTDA 4LZWA 3WIBA 3W2TA 1VZ3A 2P5YA 2FA9A 1YFLA 2J41A 3T7JA 3HXTA 2H18A 3DE7X 1IHPA 4CDGA 1TF5A 5J23A 5MN6A 2X7JA 5TXGA 1H1LA 3DM5A 2YDXA 3QVWA 1UAYA 4LJKA 5C8XA 5KOHB 1QFMA 1Z8DA 5KYWB 5IH3A 1YZNA 4X24A 3FHCB 4JLKA 3ENNA 3BJIC 3THXB 4K9NA 2XL6A 4UVDA 4LTNA 1NVTA 4JEMA 1FUUA 1ZCJA 2RCYA 4F9EA 4TKZA 1T2NA 1TJ4A 5JRAA 3OFKA 1FNBA 3CRVA 4FR2A 2D2IA 2FV8A 4DLSA 3OOEA 1HR0B 1GL7A 1E58A 1I24A 1E2NA 4XPIB 4AC9A 4XDGA 4FSXA 4TMTA 5KU7A 2DX7A 3RADC 2QBYB 4WQMA 1SHTX 3AF0A 2C92A 1M2FA 1RADA 2NO9A 3W9UA 5DMXA 3R76A 4E09A 2J31A 5FV4A 5DX1A 1OA0A 2P9CA 1DCMA 1EGMB 4BO4A 1F3OA 3FLEA 1C0EA 2ZRNA 1NP3A 5CFPA 1TC1A 1CYEA 3PC8A 5BQFA 1SCIA 1RCUA 1XEWY 4A6PA 4L2IB 3UMKA 1ZIYA 4KR6A 4CX9A 2W43A 3GDWA 1XTIA 3WNDA 4ZV9A 1BWSA 1MC5A 3P4YA 3DMFA 4B6RA 1O9BA 4P32A 1J25A 5I5EA 1Z56C 2EPMX 3WV5A 1VIVA 2GRJA 4JC5A 3CLSD 2RGCA 2CLCX 3DJYA 1N36B 3NBQA 3OEHD 1OH8A 4A8HA 3WFJA 2Z5LA 4E14A 2Q8NA 1Z8HA 1UFRA 2CLIB 4W9RA 1IONA 5EE5B 2CEAA 4LWQA 4ITUA 4IMIB 1N6OA 2G04A 4YUAA 3HYNA 1NJ5A 5I45A 2Q2NA 4IILA 5A4JA 3IIEA 4XUDA 3RT1A 1BE8A 4C5BA 4CKBA 4XWGA 4PLFA 4U5HA 3OF5A 2C9YA 4TZ6A 5D92A 2DG2A 2ZREA 2FSPA 4GECA 4OQMA 2X0EA 4KWHA 3F5MA 3AG5A 3JQ9C 2XZDA 4YALA 3SNKA 2Z6VA 2PX6A 5CG2A 3K20A 2XUAA 4X6YA 3AL3A 3BMXA 4FFOA 2GKSA 1I7NA 3NG1A 1ZGJA 4BBPA 2QEQA 1POWA 3MGGA 2HZ7A 3UCEA 1E9DA 2KLBA 3OT4A 3NB0A 2OV2A 5FOVA 3GA5A 2KSFA 3BIOA 2FEOA 5EVCA 4TL7A 1DAPA 2V8BA 1QYVA 3UV7A 1RJGA 4G89A 4DN6A 4W5TA 3UJCA 3ZHSA 1E7RA 3S2ZA 4PZ0A 2AE2A 4DLNA 2H6EA 3ETEA 1B1CA 1L4GA 4XX1A 3R44A 1GPBA 1WZIA 2NUTB 1G7TA 1VJGA 3IQEA 3L84A 4CV3A 4MR9B 3FFWA 5IARA 2GUGA 5LQJA 2H2AA 3K32A 1IM2A 1JMWA 1DTSA 2L7AA 2I34A 1RRKA 3EGWA 2QNBA 5C1OA 2G76A 4TLCA 1ESEA 1REQB 1RWQA 2JATA 3DF9A 4TLEA 4N5MA 3ZD6A 1E0KA 3GEBA 3SD7A 4JASB 2AR7A 3QLJA 1JIVA 3GWLA 5L3ZA 1DRJA 5GVSA 4OIQF 1V45E 1AZWA 5JQGA 3GANA 3BRJA 1WV1A 2AXPA 1CUGA 1X7XA 2QW1A 2H54A 3HL4A 1MENA 4YRQA 1OCOC 3NO4A 3JQRA 1WU8A 5B3SC 1NLYA 2GAIA 3LBNA 5GY7A 2AFVA 2A8YA 3GELA 3A6GA 2Y71A 1BQ4A 5IAGA 4C7XA 4EVSA 4IDCA 5IVHA 3U3DA 2C0PA 3CGWA 1DRUA 2JARA 3RC2A 3IAUA 3FN4A 4DIOA 3N6XA 4R1OA 5DGDA 4YHHB 3NAQA 1N1CA 2Y1GA 2L18A 5BQPA 2GAAA 3OQVA 1MTZA 3U7GA 1M1NB 5IJ9A 5D3ZA 5DDIP 2HQBA 1TAUA 4DB4A 4KFUA 1AK1A 1TK3A 3O4IA 4Y2JA 3HDQA 5EUQB 2VYQA 3WYBA 4F4HA 2TMGA 2AEEA 5BVGB 2JFWA 4OYHA 3J81k 1DWQA 5ED0A 2PDAA 5JISA 1YDIA 4NBRA 1DS6A 1FXWA 4LRTB 5HKBA 4HDKB 4QDZA 1MB3A 1ICEA 4RK1A 4IKOA 4A9AA 2SCUA 2JEZA 2TRSB 4G5SA 5K5EA 3KU1A 2J48A 1RMYA 4GR4A 4QTTB 2BDTA 1NSTA 1YRHA 2HSBA 4Y2QA 3LBAA 4C0WA 4C5AA 1UDBA 1BS9A 3QKIA 1K5GA 2EBWA 3JD3A 1B42A 4LZJA 4YLGA 3DE6X 3I92A 3O90A 4XGQA 5FI3A 1CR1A 2OHJA 1RR6A 4RM2A 3O8OB 4NYJR 4X8LA 3EQ9A 3U61B 3KLNA 2JBWA 5DBIA 2DBYA 3SJCA 3ED1A 4D9IA 1RYMA 2VYND 1M54A 3RH0A 2DY0A 4HLDA 5DHSA 4QDOA 2CF5A 2GJ8A 2ZIUB 2XWJI 3HFJA 4GNRA 3DBIA 5TY0A 1O3YA 1Q16A 3UPTA 1XOIA 1D8TA 3M5WA 5A4DA 4EMTA 2PA0A 1XZLA 2PY6A 2Y99A 2YHUA 3LY8A 2PM8A 3AHFA 2IW3A 3G4ZA 5DNUA 4BO8A 1Z0AA 3HRHA 3V55A 2Q1SA 2ODEA 3H8JA 2EJVA 3W04A 1WXWA 4G1MB 5JAZA 2WEKA 2XLBA 1FVXA 4Q02A 3KWLA 1R0RE 4JP3A 2RGGA 2J3KA 3WAKA 4F3KA 3THRA 5AVZA 5I9TA 2XIJA 1ZVVA 1R0WA 4I14A 4PZAA 3KE8A 3M79A 5FL7A 1C3JA 2ERCA 4GL2A 5F9MA 4TM8A 2W6PA 4EPVA 2JFHA 5BXYA 2ZYSA 2BMAA 3W5CA 4MVOA 2PUHA 1YCHA 1GYPA 3QF7A 5BQ5A 1RTTA 1J9ZA 2BE5F 1Q84A 5JXWA 2P2SA 3WL8A 5B55A 2BFBB 3KLMX 5REQB 1RLOA 1FDTA 3CJRA 3KZ1E 1TLFA 4U3JB 2PUFA 1EK6A 1G21E 2EPNA 3RIGA 1XZPA 1N3BA 3I6BA 1OWNA 1B3RA 1A9QA 3WGNA 5DBHX 2B6HA 1JG4A 3UAXA 5TF0A 1OFIA 2EWWA 1RFLA 2H3EA 2FEPA 3A1EA 3PEEA 1SMYF 3ZS9A 2DB3A 1AK2A 1VPEA 4IDOA 4PX9A 4KSCA 3WBJA 2XZTA 1ZRNA 2GCNA 2RSEB 4EY4A 4ZTZB 3HJNA 1M34A 4CKWB 1JA9A 1EIWA 4UQPA 5E7IA 4PRYA 2RE8A 3R3UA 4UTOA 1UJ5A 4LCBA 1WKBA 4E70A 1B8PA 5B58T 4Z3DA 2GRUA 4GR5A 1XP5A 3OJ0A 2PUTA 4JE9A 2PIDA 5TGDA 2ASRA 1JFVA 3O84A 4LMRA 3ZCPA 2P2DA 4AZ0B 5IHPA 3RYCA 4MTOA 4JI1B 2VB6A 3T5MA 4HPWA 2D06A 1G5ZA 3B2NA 1K04A 4GEHA 3N59A 2BHLA 4EK9A 1NU7D 2WUWE 3K1JA 5B4VA 3EODA 3FTQA 4RY2A 1WUTA 4DDMA 1JHPA 5LLTA 1W36B 3O2NA 3KSRA 1XDSA 2GR9A 4ID3A 5E2QA 2EKQA 1J23A 4J94A 4MWDA 4S1PA 3G6KA 1RPTA 3BRSA 4CZ2A 3HCFA 2H29A 1YHZA 4TLLB 1R0SA 1YU6A 4BFYA 2O3QA 1KDYA 2WJPA 5FT9A 4YMWA 1EFDN 4O4LB 2VWGA 5B3IA 4H7KA 4Y9DA 4BVGA 1LS6A 1PG0A 2GA0A 3GH3A 3WQRA 2LKDA 5IYZB 1KMMA 4F45A 2JC3A 3WB1A 1TM3E 1WMSA 3U3BA 2I3BA 1LE4A 1E66A 1XEXB 2OYSA 2R5WA 5LNK1 2W0MA 1GCUA 3SDZA 3AIMA 2D5RB 3RIMA 2XOKD 3N2GB 1IOZA 1P1HA 4YAOA 4OD5A 3HNKA 1YJAA 2OD7A 8GPBA 4HX9A 4QOIA 4JLPA 2Q5JA 2VPXA 3UFXA 1OW8A 1KNQA 4J90A 3NC0C 4UBMA 2HBRA 1MFPA 4D4MA 1CPQA 5J5AA 4DMRA 3DZCA 5FBWB 3POVA 3ENVA 4D4IA 3FI9A 3SYRA 2X0KA 2QTBA 1D6SA 4ZAVA 1MZPA 5B7PA 4HAUA 3I9V6 4YXWD 3MXOA 1MC8A 2E18A 2FPXA 4MR7A 3PC6A 1CZRA 2DQZA 1AQNA 3AXTA 3S9OA 2XRYA 2B36A 4K9PA 1GNRA 5BWCA 3GOQA 3RVBA 2EFDB 4K26A 3T5PA 3LKDA 5CT6A 1CIJA 1D0SA 2O19A 3DZGA 1LY1A 4PFJA 2QD3A 1JEQA 3HXLA 1GUZA 5E95A 4XKJA 1ZXXA 3IS3A 2YC2C 3K70C 5HKAA 5JNVA 3Q0IA 4EABA 2V6IA 5EWMA 5BQGA 2CZQA 4AP9A 4R68A 2Q07A 4TTQA 1TYBE 1TU0A 2V0NA 1QQ7A 2I0FA 2QUKA 1Y6ZA 1A7EA 3HVUA 2YINC 4N3GA 5DYNA 4JB8A 1QLEC 1N75A 4RF5A 3CPHA 3WO0A 3LY5A 4NYMQ 3ONDA 1A77A 4ENPA 3Q15C 2AF4C 1IWBB 3KQPA 4RXUA 5H0IA 4NE7A 1EAMA 2BISA 2FDCA 2GUWA 5ENZA 2WOOA 1L1EA 1JLSA 5CR9A 4DQKA 3M2TA 1GNQA 1ZIOA 4M0UA 3JVUA 4FMCF 1QKRA 1TWGA 5JO9A 3X2QC 3G8DA 4UCQA 4G56A 4EGAA 4HNQA 2VHQA 2Q3HA 1P0IA 1X7ZA 2BEVB 4UPDA 4ADSG 3EG5A 4JB2A 1TO1E 1WD5A 4IIYA 3J80A 4X1YA 3D0OA 5C34B 4MQ6A 2M32A 3WR5A 2P6RA 1XBTA 4C6TA 1N8KA 1DG9A 2HSDA 1EI7A 1XL0A 2MWQA 1JHXA 1HEUA 3ZI4A 4BBZA 2WSIA 2ZT7A 2H00A 3TSYA 5TQ0A 2AXQA 4ZOLF 5T4HA 2CXSA 2BSXA 4I4TB 1EB8A 1VPTA 4YYZA 1ORHA 1X7WB 1BWQA 5K8IA 2WYHA 1N2ZA 4H7EA 4LZAA 1YJ8A 3STWA 1X1DA 1HURA 5FCLA 3NMUF 2O50A 2UYOA 3K0EA 1VJDA 4I1UA 5IJZA 4RABA 3RTCA 3JWEA 4I5EA 1LEHA 1TQ8A 5JLIA 1OHHD 4PZLA 2HF7A 1UWVA 3VYWA 5D1HA 4JT2A 2FP4A 4TOIA 4GMFA 3PR3A 3IDQA 2CHFA 4NMXB 3EHEA 2VK1A 3UKJA 4YAEA 5F2OA 3B6ZA 3F7MA 3BD8A 5E3JA 4DXDA 2FDRA 4WDQA 1R18A 1Y1QA 1YS9A 1YBVA 1NFOA 2R8XA 5E4FA 1BKDR 5IWAB 3E9NA 1DAHA 1JT2A 5ADUS 4G78A 4MKZA 4Y6OA 1Z2DA 2E89A 1P0FA 4KBLA 4DJJA 1L4UA 1FRQA 3WHPA 3PUJA 3A3YA 3PDUA 3R7FA 2PLWA 4ETMA 3FLMA 4IV0A 3I39X 3T1VA 4HWOA 4OJYA 2JLAA 1ZM4A 2A1IA 3AFHA 3D7NA 3UMVA 4UAUA 3EZNA 3HFSA 2J6IA 4H7HA 1M5TA 3HEMA 4OJMX 2W8BB 2HC9A 3AIOA 1RQGA 4CMGA 5ELLA 3ZV4A 1HMYA 1PZGA 3CPEA 3NJ4A 3PV0A 5KNBD 3T61A 1GQAA 2YJ5A 2NVWA 1QE0A 3Q8MA 5FI0B 5EJGA 2Q5HA 1NQVA 2C1EA 1YA4A 2FZ5A 4UBIA 3PNLA 3HI4A 3GHYA 1RYFA 2XVYA 5EQFA 3OA1A 2CJYA 1GDDA 4ZN6A 2PZFA 3THSA 4EAQA 1OY1A 1OW3B 1MJFA 2R11A 3EYAA 3VH4A 1K7EB 1PR1A 3DHNA 3FPLA 1UOPA 4HFMA 4BNJA 3C74A 3RC8A 3SS8A 3DBHB 2B4AA 2V96A 4RIGA 2NXEA 1JR3D 3VPCA 4K6HA 5K7SA 3OQNA 4AMZA 1C9KA 2E6UX 3GGPA 4B4DA 2R00C 1C7RA 5D3KA 1LBSA 4JI8B 1PSDA 1F7VA 4NY1A 1K6XA 3QXXA 1CU1A 4CW7A 3K4HA 4L7VA 1WXGA 1IJEA 5LYYA 1UUFA 2YY5A 4XTRA 4YRRA 5AVJA 3NBAA 1TMGE 2WWYA 1J5EB 2Z8XA 3JYLA 3KPHA 4XVCA 4EIWA 4RKYA 1BXKA 1CY8A 2FX2A 4WZ6A 1I80A 1XPOA 1OKKD 2HLDA 3UXMA 1DFHA 3C5HA 4AZ3B 1WXFA 1FTGA 4HLCA 2X8LA 4DVZA 1YJGA 1WULS 2D8MA 1JIJA 4ARSA 2C2WA 3FROA 1U8FO 1F38A 3IP7A 2GGSA 2SECE 4R7ZA 5KC9A 3QE4A 9ABPA 1PJ4A 721PA 4DCVA 4MPJA 1LRKA 1H2AS 3RBXA 3EY4A 2VK2A 5A6KA 4EB0A 2CNBA 4YCDA 4ZTUB 1WATA 4HH4A 2ILVA 2B2XA 1TLTA 3MG9A 2I66A 4HNRA 2A14A 4RGYA 5CLHA 3K8OE 2HMYB 4JEUA 4B3FX 3IR5A 4I3HA 3NOQA 4BZQA 1JLKA 2IDZA 5DTRA 3BCRA 4L27A 1E9CA 4DEXA 4EJSA 2MSWA 4MLDA 3ED5A 4G65A 2ES4A 1IBRA 1UBOS 4EUSA 3DHEA 2RIPA 3DA8A 1T6ZA 3GJYA 4YL0A 2ZAOA 3WK9A 3ZY2A 4NLLA 2WB4A 3QUSA 2OSBA 3B1JA 4MSUA 2C04A 1UWLA 2VUSA 4QYXA 1UC9A 4EKNB 2PZBA 3A6FA 4H7IA 4BNDB 3TQQA 3IEPA 4IGEA 4G1FA 2C2GA 3JATB 2V58A 3K96A 5E33A 5HS6A 4GIBA 4DCMA 3KT8A 3VU3A 5JBIA 2BGIA 2WU1A 1GQYA 1F14A 2O0LA 1ST3A 1IUKA 2PD3A 1PUJA 1D1CA 2QI9F 3EIHA