2QY9A

Structure of the ng+1 construct of the e. coli srp receptor ftsy
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
300
structure length
300
Chain Sequence
b'FARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein ftsY
publication title The E. coli SRP-receptor FTSY contains an essential and autonomous membrane-binding amphipathic helix
rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 115
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2qy9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qy9A02
2QSZA 2FA9A 3PUZA 4NYMR 2P6UA 2QRZA 4QBIA 4MKHA 4UKDA 2GETA 1YRBA 4Q47A 2QU8A 3ASYA 3TMKA 1H65A 1R0WA 3EC1A 4WZ6A 1IY0A 4LC0A 2QP3A 5JWRA 1TUEA 1ZD8A 3U7GA 4DLVA 4P32A 1XTKA 3BE4A 5KYKA 1UEJA 2IT1A 3DEFA 3LH5A 3KKNA 2NPFA 4L4UA 1GOTA 5JLJA 2X1VA 3WYFA 3OIYA 2H1LA 2ZR9A 5HE9A 3R9WA 2HYDA 3T1OA 3I1FA 1EG7A 3DM5A 4P4SB 1ZNYA 5KSZA 5J4KA 4W7SA 4U02A 3VNUA 3P1JA 4BFZA 2FFQA 1UPTA 1F2TA 2EVWX 4JL5A 3CX7A 3RYTC 2XJ9A 3FHCB 3WNBA 4URYR 5KSYA 3M4YA 4IVPA 4CW7A 2CEAA 3SFZA 3I73A 5D3QA 3UG6A 2WOJA 4GBMA 4B43A 5EP1A 2FF7A 3CH5A 4M0LA 2F9MA 2XB4A 4V0LA 2FPMA 1PUJA 1S1MA 4M9QA 1E2JA 2YC4C 4BEBA 4CT4B 2JLVA 2PX3A 1KDOA 2KBFA 1XMVA 4D82A 1AJEA 2OM2A 3K1JA 4A82A 4B3CA 4Q66C 4BFSA 3CLVA 1CEEA 3U3OA 4FCVA 3K0FB 2PT5A 1BMFD 1CS4C 3S1AB 3U3JA 5FTMA 5JS7A 1XCGB 3PUWA 1CR2A 1OIVA 2WKPA 3TSOA 2VHQA 3JZMA 4HUTA 1KOFA 4TL8A 3UG7A 4ZKDA 1Z0IA 1Z8FA 3TQCA 4KV9A 4A2WA 1B0UA 1NIJA 2NO1A 2QRNA 4QFMA 4WXPA 5JECA 5B58C 4ACAA 2ZE7A 2NPIA 1KO7A 3IO5A 2WJHA 1T3LA 4GI7A 1W2HA 5D3MA 5FPKA 2XZLA 5HE8A 3SBDA 3VHXA 2YVUA 4IW3B 1OHHA 2DY1A 2QA5A 1NI3A 3FB4A 3GJ6A 2ZIAA 4MYTA 3U6KA 1E96A 2FDCA 3DHWC 4B35A 3FMFA 4E22A 2YKGA 3SHWA 5IHPA 2NOAA 4RD2A 4EPVA 1TMKA 1US8B 1TU3A 4WZAE 1XXHE 4Q19A 3CIOA 4JYBA 4DLXA 1DBSA 2CE2X 4N0DA 1HUQA 1X8KA 3DMNA 5EP2A 4FCTA 3T5GA 5B2ZA 2QGNA 4ASUD 4LV6A 5E4FA 2CDNA 1WA5A 1YR6A 2CNWD 3TW8B 1FUKA 1IONA 3K09C 1NLFA 4Q1AA 1KK2A 1SZPA 1WCV1 1P3JA 1XD9A 3QI2A 3D8BA 3FKSA 5DIFA 5FL7A 4HDOB 5E7MA 2OV2A 1P61B 1ZD1A 4P31A 1KSJA 1FX0A 2TMKA 1LS1A 1I4DD 3C14C 4MRSA 1VG1A 5JI3E 3WMFA 5FOUA 2C5LA 3NG1A 1XJQA 3BGWA 4NH0A 1FQJA 1T3SA 2F1RA 4QBGB 3Q5DA 4DBLC 2C96A 4QBFA 1VG8A 5G53C 3HPQA 1H8EA 4JBYA 2WWIA 2PX0A 3AKCA 4E5UA 6Q21A 5KNBA 1M7GA 2QORA 5FOWA 1G6OA 4ZCLA 4IOJA 3SC3A 1TPZA 5HPYB 1YR8A 3EZ9A 4PC7A 2ODEA 4XSGA 2YYZA 1EFCA 1I4LD 2C77A 2HT6A 4LHZA 1ZP6A 5TVKA 4GPTA 4HDQB 1YZNA 1AQYA 1M6NA 1NRJB 2W2VA 3AF4A 2J0UB 1PLLA 3BXZA 1GG2A 4GZLA 4HDCA 4C0AC 3SBEA 4KITB 2GJKA 3VR2A 1DARA 2PJZA 1YZQA 2FE4A 1YZKA 3BB4A 4CRWB 4DCVA 4B48A 1P2SA 2IUTA 2VTKA 3V9PA 2KJQA 4Q5IA 1PV4A 2EFGA 1HYQA 2AKYA 2ZUBA 4AKGA 1E94E 5G3YA 3WY9A 3LWNA 1YZUA 3LXRA 4ITRC 1AQUA 421PA 5LBIA 3DMDA 5TY0A 2ONJA 4F92B 3AVQA 1YQTA 3VAAA 3WHLA 2O8EB 1KY3A 1EGAA 1II8B 2A7QA 1G18A 2CXXA 4GZMA 3C7KA 3CPEA 2Z83A 4Q9KA 3AKEA 1E2MA 4L5BA 4QHTA 3FVQA 4F91B 1JAHA 2YINC 5JRZA 4TLAA 2VHCA 2J7PA 4ILEA 2GCOA 1E69A 4RFSB 3K0AB 4WVFA 2QMEA 4LHWA 3T34A 1NVXQ 4IDPA 5DYGA 2PZEA 3QPWA 2XXAB 2HCBA 1XD2A 1L2TA 4ZDIA 1KDPA 1NVWQ 4ARZB 1XEXB 3QIAA 1E0AA 2WOOA 4TYQA 1QZXA 2F43B 2YOHA 3PJRA 4B73A 1QHGA 2DFNA 1XF9A 1S0UA 4A8JC 1N6HA 1SVLA 2DPXA 3RRMA 2O0HA 3IHWA 2EYQA 5HTKA 2XGJA 2WSSD 3SJZA 5FUVA 3W90A 4PQFA 1GNPA 3QBTA 3RS0A 4URZR 2ANCA 1IJEA 2ZTSA 2GRJA 2GDJA 4S2EA 2YC2C 1PZNA 4P33A 1OXUA 1B23P 4EIWA 4R2HA 3SDZA 4EKDA 1RZ3A 2AXPA 5AUQA 4PSVA 3IO3A 4OHWA 4D26A 3LVRE 4XVQA 2E1RA 5C18A 4D4KA 1JPNA 3O8DA 4M9SA 1A4RA 2I1VB 5CITA 1CJVC 1P62B 2BJWA 4YMTA 4Q7MB 1GKYA 3IHLA 1E9RA 2QBYB 1SHZA 2RGNC 2BDTA 4GFDA 5JMTA 4K81B 1FOEB 3W9YA 1Y3AA 3EXAA 3I62A 4GNKA 2J87A 4NHOA 4M53A 5BQ5A 4W9MC 1DPFA 1IXSB 4NTZA 1VCNA 4PC2A 3GJ5A 3RS7A 2RGXA 1QRAA 1AM4D 1VDZA 3QXCA 4MUAA 3W6OA 3UXMA 3C15C 3WYGA 2HT1A 1KJZA 2VP0A 3Q85A 1JJVA 4G5RA 4A6PA 2ZI7A 3GPLA 1W0JA 3BD9A 2BC9A 4FMCB 5DGXA 4PQRA 1KSGA 3LW8A 2XSZA 2OHFA 2Z5FA 1SGWA 1MRNA 1R5NA 3RANA 1YHNA 3LO5A 3JVUA 1GNQA 2CLDX 2D7CA 2VA8A 3KKQA 3V4FA 2J9RA 4K46A 3ONWA 1S9HA 4F4JA 5BWMA 3GEHA 2IYWA 4M4SA 3WP0A 4ZI3A 2BMFA 2EWWA 3GLHE 3CNNA 2JATA 3DKVA 2QTVB 3P4XA 2YWEA 5AJWA 3TUIC 4A8JB 5BN5A 3U2QA 1TL7C 2C2HA 3W3ZB 1JXMA 4HLDA 3U5ZB 1M74A 4RD1A 3UK6A 3AF3A 3SN6A 2ATVA 1K5GA 3BFVA 4AD8A 3WXMA 4KXFB 3QEOA 1F60A 2C98A 3A4NA 4LV8B 4PPGA 3VU9A 1WBDA 2B21A 4JLNA 2WMOB 2F1JA 1II9A 2VHTA 3CPJB 3SOPA 5HZHA 1F5NA 2OBMA 2ODWA 3LX5A 1DO2A 1WE2A 4X8OA 4B32A 3TRFA 1W5TA 5L3SA 3GJ3A 2FZ4A 4AKIA 5FUWA 1ZC3A 3FMOB 1TX4B 1G17A 3MFYA 5FR1A 2A5YB 2CMKA 4M2LA 3SEAA 3A37A 2Y8EA 3DDCA 3ZJYA 5L3QB 2REBA 1OH6A 3CUEF 3E1SA 1DAHA 1GRQA 1AZTA 3NKVA 2IEYA 3EC2A 2Q9BA 2AWOA 4EJSA 3CF6R 3DKPA 4EFLA 1SVWA 2X19A 2IUUA 5DLQC 1E2FA 3K09A 1WQ1R 3TSWA 3KKOA 4DDTA 521PA 3ADBA 2RKOA 1DAIA 2DFKB 3QF4A 1A2KC 1AS2A 2Q21A 3SS8A 4JVSB 2G0TA 4F4IA 5KHOC 2ZS7A 2CJWA 2FPLA 4PAOA 3CR7A 4I1SA 3M1IA 1G64A 5KDLA 5AJZA 3AF0A 1SKYB 1Z6AA 5FTJA 3MSXA 3FMPB 3HU1A 4OQLA 2F9LA 3X1YA 4LY6A 3WNDA 5FPTA 1N6LA 1E0KA 1D9ZA 1RFLA 3QKRB 2YV5A 5KDDA 1UKVY 3VNVA 1F3OA 3RRNA 4A4DA 1G8FA 3V4RA 2W6JA 4EPXA 3OFNA 2Z6VA 2GJAA 1XTQA 1S3GA 4HLCA 3CZQA 4BLSA 4FN5A 4II7A 4KFRA 3QE0A 5K8LA 4D4MA 1TQ4A 4I1UA 4B3DA 2H17A 2RCNA 1Z2CA 2VSFA 4XVRA 4DLRA 2XTZA 3FPAA 1KI7A 2BIFA 4YMSA 3EIEA 4ESHA 1XMSA 5C4GB 1SXJB 2NO0A 4LC1A 1TEVA 4Q9JA 2ORIA 4N0EA 1TQDA 2BEKA 4IEEA 1NKTA 3U3RA 3UMRA 3CB4A 3GLFB 3AVVA 1KDRA 3PFIA 4C0BA 1N25A 1XZQA 1VIYA 3UWOA 1II0A 3AVWA 1ELOA 4NE2A 1ZM3A 5GJWC 2O8DA 2X2FA 3B85A 4C9BA 4BLTA 1CLUA 4CGZA 4Z1MA 2EFHB 4I81A 1MO4A 2HJGA 1KO5A 2MMCA 1MKYA 1W46A 2DB3A 1XXHA 5DYIA 4D0NA 2HEIA 4PHFA 4BLQA 2QAGA 1ZRHA 4M1KA 5GVSA 1X8JA 2CNWA 2YWFA 3FKSD 3JVVA 4HAWA 4I99A 5FL7D 3C41J 4D4JA 5JSZB 4TLBA 3NDBB 3NBFA 1O87A 3B1VA 1OXSC 2I3BA 2BJVA 3ZD6A 1SQ5A 1RC8A 3IIKA 2FH5B 5TXGA 3F8TA 1TU4A 2V8OA 1XDBA 1QHXA 2DFTA 4BLOA 8OHMA 3CX6A 3MWKA 3THXB 4LJ6A 2W0SA 3F3YA 1PLKA 3B1ZA 1G5PA 2FNAA 1H8ED 1JB1A 1R10A 4BRUA 4EPYA 2XTMA 3W8RA 5DISB 1KZ7B 2BCJQ 3BK7A 2HUPA 2UVQA 2JCSA 1JR3E 1VYUA 2ZU0C 4LJ8A 4RZ3A 4GL2A 2O8CA 1E9FA 1JR3D 3E5HA 4HLUA 4UXHA 1QHHA 3AEZA 3KKPA 4KJZA 5GJBA 1S2MA 3GLIE 2ZRJA 3Q72A 1KAOA 1U8AA 2CCJA 4Z8YA 2VP5A 4HYYA 4LDJA 4UXIA 3IUYA 1OXTA 2VIIA 1XPUA 3N2IA 1E6CA 4DLYA 3QXXA 1D2MA 2CCKA 2A5GA 3QKSA 4IVRA 2FV8A 2JJ8A 2OFOA 3W8NA 3MAAC 5JBQA 5AK0A 2BBOA 4EFNA 3FGNA 4OI2A 1OJLA 2ZREA 1YU9A 3IPXA 3I3SR 2Z0MA 1GITA 4KBFA 5J4LA 1GRRA 5EE0A 1MRSA 3A1SA 1E9BA 4XSHA 5AUOB 4OQNA 1N5IA 5CYPA 3HU2A 3AVYA 4O2RA 4M9XA 3BERA 4UJ5A 4CEHA 4U7DA 3IIMA 1T8TA 2J7PD 2GKSA 3PXGA 2SHKA 3LLUA 4AYWA 4D0LB 3AF2A 2O8BA 4C0LA 4TTRA 1G7SA 1PVOA 1HA3A 1VCOA 3HYRA 4C0JA 3DPUA 3WYAA 4IOLA 1UADA 2ZRLA 3M6AA 3P4YA 4TQUS 3O47A 5KUTA 4JJKA 3VTKA 1QBKC 1ZM9A 1ZM7A 1AS3A 4C0SA 2ZM5A 1UBEA 1XTSA 4U5XA 5J4VA 1TF5A 2QQ0A 5J40A 2GXAA 4DDUA 2JJ2A 4MGKR 3KJGA 1Y63A 1EX6A 3K53A 5JS8A 4JSYA 3C16C 1OSNA 3ZGXA 1MR3F 2FGJA 2VL7A 3Q7PA 4E09A 2MSCB 2GHIA 2BM0A 1NL3A 3A8TA 3P27A 3SJBA 1Z0DA 2N46A 2WSSA 2ZR7A 2RHDA 4AYTA 1G4AE 4MYCA 4GOKA 1PJRA 4QRHA 4BFUA 4TYWA 1BIFA 4KVAA 3K70D 4YMWA 3GCGA 4X8LA 2G1KA 3CRW1 4Q4JB 3A4MA 3WMEA 3LBHA 3LRPA 2VSXA 3TH5A 1KZGB 5CM9C 1Z0JA 3UANA 4RJLA 1L7VC 2DCUA 1XMJA 4HUQA 5EUMA 1QVAA 2P5SA 1DAFA 3C5CA 2OFXA 5D3MB 2J7KA 2NZ8A 5G40A 2CHGA 1N0VC 4W5WA 1NY5A 2R6FA 2FFBA 2IF0A 3BC1A 3MJHA 5LD2C 3UIEA 5H1YA 3O8CA 1KKLA 4L8GA 1S4QA 3EG5A 4LJAA 4KFSA 4TZ0A 1X6VA 3DZDA 2QPTA 3NHAA 4FIDA 1Z63A 3Q8XB 2DFLA 5EXSA 3U3MA 2F3TA 2JLSA 2CLCX 4A9AA 4TLEA 2XJ4A 1JEEA 121PA 4LHYA 5FBVB 3ETLA 4GSYA 3QSYA 2F55A 1R5OA 3K9NA 1MV5A 1SVKA 1W0JD 5DO9A 1FP6A 1EXMA 2H18A 2RGBA 3MJRA 2WPDA 1V5WA 1XPRA 4YDSA 5E7IA 5SZIA 4Q48A 2ZPTX 2XSZD 1D8TA 4Z51A 2CE7A 3OAAA 2DWOA 1G1MA 5JEDA 3KJEA 4B34A 1EK0A 3TSZA 2HYIC 3PUYA 1FX0B 3CWQA 2C9CA 4MYHA 2FEMA 5BYJA 3THWB 1AGPA 1OV4A 1OH7A 1KK1A 1XRJA 4AWXA 1Z0FA 5JFGA 2IYUA 4LBVA 1FPMA 4IDOA 1DE0A 4Y0VA 4JL6A 2V1UA 2ANBA 1BKDR 2ORVA 2F6RA 2JGNA 2BBWA 4NU0A 1ZU4A 1UBGA 3MD0A 1Q1QA 4LRWA 2YJTD 1XJ0A 4QHSA 3GLHA 3QJYA 3CONA 1MT0A 4US1R 3CM0A 4QNRA 3T5DA 4BASA 5H8WA 1R8SA 1G8YA 3CRQA 1RRFA 1UKYA 2ZJ8A 3PEUA 2UZIR 3NWJA 1VPLA 4R98A 1DVRA 4LUCA 1P73A 2HXYA 2YHSA 3FE2A 4HAZA 2FG5A 4MRVA 4ON9A 4M1TA 3K70C 5IF9A 2FSIA 5FOSA 4OK5A 4R2IA 4ABYA 1BO6A 2V54A 2ZI4A 2IXGA 4JVMA 2FMXA 2B92A 2VP9A 3T12A 3G82C 2QUZA 2GEUA 1RPZA 4WBSA 2DBYA 1JR6A 3EPKA 2GJ9A 2QMUA 2BMDA 3TQFA 3EW9A 5BN4A 4Q4LA 5HCNA 4MKGA 5JI2E 2L0XA 3B82A 3AF1A 4LJ7A 1E2EA 1GFIA 2QENA 1AN0A 2AHOA 3CO5A 4DSUA 5JHHB 4PZYA 3TGPA 5FUYA 2Q9CA 1U9IA 3B13B 5DI9A 1KI6A 2EFEB 4EPTA 3K8YA 3ZS9A 1Q3TA 4XD7A 3ZVNA 2ZETA 4LK2A 4JL8A 1GUAA 3U44A 4C0QC 3ZLJA 3ZQJA 2O8FA 3RVBA 1E9EA 3OESA 3TW4A 1KNXA 2J41A 4D80A 1XU4A 4JLBA 3TBKA 5KSOA 4MDEA 1XJCA 4CF7A 2V6JA 1ZUNB 3B5JA 3I8SA 3QNUA 2GCOB 4GOXA 4B2PA 1KKMA 1ZINA 3BFXA 3DZ8A 4PZZA 3LQQA 4G5QA 2JLRA 1C9KA 621PA 3ZS8A 1JALA 2EQBA 1R8QA 2W6JD 3ASZA 2RH5A 2FSGA 3OFND 2LWIA 5UKDA 4F7WA 3T35A 1KO8A 1RE0A 4AG5A 3AVTA 1L8QA 2NGRA 2G83A 2QEQA 3W6PA 3FTQA 1KI3A 1RIFA 2CBZA 1JPJA 2RB4A 1M2OB 4TMZA 4NYJQ 2NO6A 4DT1A 1CF4A 1U0JA 4HATA 1EESA 3L0SA 5EZ6B 3K9LA 2CL6X 5KPJA 1FFHA 3W34A 2W6IA 2V4ZA 4ZIRB 2BMJA 4RCZA 2WZQA 3TIFA 4EQ6A 4MQBA 1Q1EA 2H57A 2G0NA 3B1XA 1KI8A 1CULC 3R20A 2NIPA 3W5JA 3RS3A 3VR3A 5DH9A 1Q57A 3QOFA 3GP8A 4MITA 4UNNA 4Z1MD 5F9FA 4BFVA 3F0TA 2V3CC 4KI0A 5DSZA 3TKLA 3LFUA 5IDVA 3U7EB 3ADKA 1P5ZB 1U0LA 4EJSC 1L4UA 3MWJA 3EA5A 1TQ6A 5EXTA 2D2FA 3E70C 2QPAA 1X8LA 1XPOA 4NZYA 1R6BX 2AD5A 4V0ME 3HWSA 1KJWA 1G9XA 1LTQA 4QGAA 3BH0A 4Q02A 2O0JA 4IOKA 4UNQA 3TLXA 1SKQA 2BKEA 1SVIA 3VFDA 4IDQA 4BWYA 2O0KA 4LBZA 2HCJB 4XIGS 4Z8XA 3QKUA 3A58B 4AURA 3PEWA 1G7TA 2AKAB 5CB8A 2Q6TA 3GFTA 2XEXA 4NPHA 1EFRA 2EU8A 2JEOA 3B60A 4CYMA 4V0OA 5DN6A 2W83A 2C03A 3LX8A 1Z6GA 4A2PA 3NHBA 1VHTA 1NLYA 2CK3A 4ZCIA 3KB2A 4V0KA 2GF9A 3QENA 3FDIA 4HSEA 3LA6A 1E4VA 2F3RA 3BIFA 3I8XA 4DSNA 2YOFA 1IQPA 1DO0A 5SZKB 2ZSDA 1Z28A 4O0MA 3K0EA 5FBRB 2GNOA 1YVDA 2IK8A 1JR3A 2REXB 3WHKA 2WWXA 4BFTA 4DCNA 4A0HA 3FKQA 3FHTA 2OBNA 2GTPA 4IVQA 3OIWA 4JLJA 3GLIA 3BRWD 3CRMA 1U0HC 2Q3HA 1HY3A 1YR9A 2DR3A 2IYSA 2ZU6A 4DLUA 3KQUA 5TARA 4IDNA 4MUBA 4C0KA 3L8YA 2ZRBA 3Q5EA 1GAJA 1IHUA 1YKSA 1CJKC 2VRWA 1A1VA 1J70A 2X77A 3T1VA 4LBYA 2JLWA 4LX0A 4DC9A 4PSAA 3K0SA 4R71A 1E2LA 1NN5A 3PEYA 1J8MF 3Q9LA 1Q12A 1E9DA 1QDEA 1U8YA 2BVNA 3R8CA 1E3MA 4RD4A 3A1TA 2QAGC 3KFXA 3ZIAA 5HKKA 1I2MA 3ZD7A 5DI3A 2J45A 5JEEA 3GLGE 1XCPA 1IAQA 4DUGA 2OUKA 2Z43A 3QF4B 3R7WA 3QKTA 4OL0A 1SVMA 4AKEA 1LVGA 3NH6A 3SU8A 5CJPA 1CKEA 2CJWB 4Q1EA 5E95A 5AWFC 1DAGA 2JJ1A 2JJ2D 3PG5A 4OHZA 3U7FB 3ZVRA 1OT3A 1Z07A 3I61A 4EUNA 4NP6A 1FUUA 1GIAA 3B1YA 3EARA 2ZJAA 2WMNB 4NCHA 3QY0A 2QTHA 2HF9A 2C9YA 2A3RA 2GBLA 4JKIA 3PR1A 3N5CA 3X2SA 4B76A 1J99A 1E1QD 3KQHA 4DZZA 1LV7A 3CF2A 2IYTA 1JXOA 3I72A 4R7ZA 1NSTA 2RGDA 5EP4A 3M0EA 4QKQA 2AFHE 3K0FA 4HLUC 1MABA 1VG9B 3SYLA 3ZZTA 1YZLA 3AB3A 4LWZA 1KSFX 3BAFA 3QVUA 3AVXA 1Q21A 2AFIE 5TMPA 5ELXA 4Q03A 2ECKA 3BORA 4DCSA 5EXXA 2VP6A 4DEXA 5FPHA 2MSDB 1LW7A 1OKKA 1SXJE 1IN7A 2AR7A 1NBME 1IY1A 2ZAOA 4LBWA 4A0RA 2A78A 2QGZA 1NBMD 4M1WA 5FTNA 2JLYA 1OYYA 2JASA 2Q0HA 3TNFA 2PEZA 3TUJC 1YR7A 1KK0A 2FU5C 4DLZA 2PH1A 4A0FA 1P7CA 4HB2A 5IT5A 2VHJA 3W3AA 5FPYA 4GOJA 2KWIA 1XXHB 4NONA 2ERYA 1OB5A 3U3KA 3A6PC 4LPSA 5KPDA 2WPDD 4V02A 1IN5A 3OHMA 3R9IA 2QAGB 1F48A 3B9PA 2ZRNA 3OAAD 4IXMA 4PC1A 2ZRGA 3RSLA 5E3HA 3VR6A 2NMVA 4KO8A 2XITA 4JT2A 3RSOA 3G0HA 5EP3A 4TL7A 1SHKA 2WWWA 2BHRA 2V6IA 2J1LA 4L15A 2OLJA 1TAGA 3CH4B 3H4MA 3VKGA 3C4JA 2FOLA 1HV8A 2JIZA 3T06B 3UPUA 2D62A 4KFTA 4CEIB 2ZQ5A 5FH9A 3MWYW 1G19A 4NYIQ 4YMUA 1KHTA 3TVTA 1N2CE 4AKHA 1P4SA 3RC3A 1G20E 1GTVA 3OIVA 5FI1B 721PA 4NDZA 3L0IB 1JI0A 2JLUA 2D3WA 2IYQA 3C8UA 4RD6A 5C46F 2NZJA 3FFBA 2Q9AA 2ZJ2A 4MYUA 2IYYA 4C3ZA 1JJ7A 1DOAA 2H7VA 2WKQA 2ZSFA 1ZNWA 2CVHA 2O8CB 1L4YA 4OHXA 1QHHB 2XX3A 1OLOA 1P9NA 2VF7A 1M8PA 2VYFA 1ZCBA 3JZAA 1J7KA 1KJYA 3AUYA 3RS2A 4YONB 1ETUA 2FEOA 1E98A 1GKUB 1P9WA 1T8UA 3QKSB 2LKDA 4JLKA 4PPQA 4ZI2A 2YZ2A 3OEEA 3RS4A 4TYPA 4X8HA 2OG2A 3MRSA 5CYOA 2GAOA 2PZGA 4NKRA 4Q21A 1RYHA 4AIIA 3EPHA 1TQ2A 2ZRAA 2GXSA 1RRCA 3ZYCA 4XD7D 4ERNA 2QMOA 1G5TA 4CZ2A 4PFSA 3H86A 3HYTA 4AK9A 2GJ8A 5EZ5A 3LNCA 2ZEJA 2R6AA 4HZUA 4L16A 3K0CA 1XMIA 4OBEA 3RABA 4CEHB 1UF9A 2QG6A 4LHVA 3LDAA 4RKFA 2O8BB 5LPNA 1E2IA 1II8A 1VMAA 1GP2A 1XTRA 4LJ5A 1AGRA 1CP2A 1I2DA 4D0GA 5CDFE 2OXCA 4B3FX 3P20A 5C1BA 3MG9A 1OIXA 2PMKA 2ZYUX 4RFSA 2F1HA 4EPWA 3AUXA 1IOZA 2QTFA 2XOKA 2J59A 4PC3A 5HZKA 4C7OA 3TUZC 2JA1A 1S8FA 3WRXC 1AS0A 1NMXA 2IYRA 2OESA 2Q3FA 4V0NA 3TJZA 2GZAA 3LQRA 3AGPA 4E07A 1XEXA 3IQXA 3A1UA 4MGIR 4FMCF 1Z47A 2ZYVX 3H1TA 4I4LA 1GSIA 1LF0A 3QQ5A 4GP7A 1D2EA 2J5XA 2IS1A 1CJMA 3EIHA 1T0HB 3GEIA 5JWHA 2W6ID 1Z5ZA 4URUR 1WB9A 3ZZUA 1GL6A 1KTVA 4M1OA 3PIRA 2FFHA 2WAYA 4TMKA 1UBCA 3R8FA 2GK6A 4EPRA 1NSFA 1E2HA 4A0GA 4TYYA 4W5HA 1NN1A 4B47A 5J4YA 4KYUA 1G291 1VTKA 2PBRA 5L3RA 4DHEA 4DB2A 2D06A 4HUQB 2EFCB 4BZPA 3LW7A 4PR0A 1D9XA 2GXQA 1TNDA 2BBSA 1ZM2A 3RNLA 1Z0KA 4AG6A 4N1AA 1Z83A 4ZO4A 4J0QA 3IPYA 2OT3B 2FJUA 2P3SA 2ZRKA 3EAQA 3PITA 1XCMA 2Q3MA 1WGWA 5B30A 3WNCA 1IN4A 2NO7A 1U9IC 1KMHA 3D7MA 3AP1A 1IN6A 4WXRA 2GXUA 2GA8A 4FD2A 4QXAA 5GADl 2XNDA 1E0SA 5LB2A 2IWHA 2QE7A 4G0NA 4JLDA 2ZRMA 2ZYTX 3C5HA 3U6BA 1W1WA 3AVOA 4LZZA 4V0MA 1KDTA 1C4OA 5J5CA 1AKEA 3EZ2A 3UKDA 1P75A 2NTYC 4BLRA 4D6PA 2BMEA 3WMGA 3KXKA 3TK1A 3GJ8A 4FCWA 1EFRD 3NDPA 4DEYA 1E1RA 3U4QA 2VPPA 3L2OB 5DN6D 3QUSA 3NC1C 3SJAA 2CK3D 4FMDB 3TR5A 2V1XA 2VEDA 3EZFA 3OE7A 2XNSA 4DJTA 5AUNB 3NC0C 3ZVLA 2XTNA 4YXWA 4UNRA 5M04A 1ZC4A 4ZV4A 1E99A 5FBQB 1RJ9B 1DAMA 1NVUQ 4P0TA 4D4LA 3NBYC 1ZIPA 2C78A 2P0EA 4DB4A 1IBRA 1WDTA 3REFA 2OCPA 2XB2A 3UMFA 5GJCA 2WWGA 4DLSA 5L8VA 1W7AA 5JCZA 3GLHB 4XJXA 1T3HA 3CNOA 5L3VA 1N5LA 1I4TD 3RWMB 1UKEA 2VHUA 2IW3A 3DM9B 1HH4A 4TYNA 1M34E 2FSHA 4Q4HA 3MLEA 2ASEA 4M1MA 4YMVA 1E2PA 2B7BA 2G3YA 4QOSA 5GJVC 4B6FA 821PA 1RVDA 4JLOA 1BYUA 4TTQA 2VO1A 4DXAA 1ESNA 4LJ9A 3BOSA 1UEIA 3QPUA 5FTLA 1G8GA 1KYIA 2WIBA 2V55B 3KZ1E 4TL9A 1UJ2A 1HTWA 1KI9A 1NY6A 2RGGA 2UZ3A 3CBQA 2G77B 3R9XA 4LI0A 5TV2A 1RKBA 1TUIA 3I92A 3ZIAD 5HKKD 3F5FA 1P2TA 2OBLA 3PV0A 1OH5A 2B8TA 4DUGD 2ZS9A 2ZE6A 1KI6B 2YWHA 3EIQA 4XOIA 3GD7A 1F2TB 4E03A 1XTJA 1IY2A 3QEJA 1ZU5A 3B9QA 4PSKA 3VKWA 2AD1A 4EDHA 2VP4A 4BQSA 2IS6A 4AYXA 3U44B 1W5SA 2JDIA 4PAMA 4Q7KA 1OF1A 4Q01A 2JJ1D 3TVDA 1G3IA 1R4AA 1Z08A 3GLGA 2O8FB 1ZM4A 5G41A 2CVFA 1M7HA 2PLFA 2G6BA 4Z54A 4RVCA 4B3GA 4MRNA 4UNPA 1JNYA 4W5JA 1JEDA 3Q3JB 3PVSA 1GRNA 1NP6A 1M7BA 3LBIA 3U60B 1UAAA 4A92A 4HAUA 3CW2A 1OW3B 3LBNA 4ESVA 3CRVA 3KTAA 2ZRPA 4ZDWA 3GFPA 4A1FA 1HURA 1FQKA 2PMDA 4JYCA 5DHAA 5FL3A 1N6IA 2P67A 5K8TA 1Z3IX 5DE3A 1IXRC 4CEJA 2AK2A 2WAXA 1OE0A 4RD3A 4RKEA 3LVQE 3RWOA 1E1QA 1G6HA 4Q4AA 4IHQA 4H1UA 2IS2A 1W4RA 1ZUIA 4IFBA 3KJIA 1CBUA 1Z6XA 3EPJA 2AL7A 4DT1B 5IRCD 4XH9B 4FMDF 1QHNA 1D2NA 1WF3A 1PUIA 4G1UC 2XAUA 4GMDA 1EWRA 1OKKD 4PTLA 2KB0A 2ZI5A 1N5KA 3ECCA 1K5DA 2VH5R 4LCBA 5CJ2A 4EQ6B 1NLZA 1DEKA 1JAIA 1NMZA 3SQWA 3KB1A 1DADA 4ZPXA 4Q1CA 2PZFA 1LB1B 2R62A 1SXJA 2RGCA 2ZE8A 2A5JA 3EA0A 4TTPA 4Q9LA 3KQLA 1NBMA 5C4MA 3A1WA 2QQEA 4KYIB 1AIPA 3VR4A 3D3QA 2XZPA 4C4PA 1X3SA 3ND8A 4XWKA 4WA7A 4QC2A 4KVGA 2GEVA 4OI4A 2DYKA 1N3BA 1F2UA 5FOTA 3AQ4A 4QGHA 2OO7A 3W5IA 4Q9HA 2B8WA 4BZQA 3V00A 4NL4H 1DS6A 1ZAKA 2YOGA 2A5FA 2WWHA 3O8RA 1DAKA 1R5BA 2JIZD 1Z6YA 3REGA 1EWQA 2IWRA 3A4LA 4M1YA 3FHOA 3IKJA 5TB5A 1JQLB 3NEYA 1HQYE 1OFTA 1T5IA 2C99A 1E2KA 2KE5A 3NBZC 4DLWA 2OE2A 1XEFA 1VKJA 4RZXA 2GBLC 1LF5A 2H16A 2AK3A 4PO1A 4B75A 2ZUDA 2LCFA 4B33A 3X1XA 2PL3A 4OKSA 1XFAA 1NVVQ 3AGQA 3DOFA 3B7GA 5LDDC 2ZXUA 1ZUHA 1V43A 2MSEB 4ACBA 2D2EA 4D2IA 1KIMA 4HB3A 2BOVA 1FMJA 1KSHA 1JECA 1UM8A 5LB4A 4A2QA 3IEUA 2BV3A 5H68A 4CIDA 3AVPA 2FPKA 1GL7A 4KLZA 4N3NA 2VP2A 1T91A 5DNYB 1Q22A 1OXVA 2QROA 1BYIA 1WXQA 3OEED 5GVRA 1D6JA 2IYZA 1T4GA 1DTSA 5LD2B 3L82B 1ZCAA 5E7JA 2WKRA 3FFAA 2P2LA 2ZJZA 2K5UA 4JLAA 2VLIA 5AUPB 2ZE5A 4TSFA 4JMPA 3WBJA 1XEWX 1ZW6A 4UNSA 3QG5A 2EYUA 4KFUA 2GAAA 2W0MA 1QHIA 1P2UA 3NXSA 4NYMQ 3VR5A 5TDHA 3H84A 4TWZA 2IS4A 1GWNA 1G7CA 3VX3A 5DI3B 3MWLA 5FFMA 1HE8B 1P72A 1W0KA 2IBMA 4HAYA 4Q00A 3R7WB 3SE0A 5AR1A 3I5YA 3THYA 2B6HA 4HAXA 3ZZ0A 2ZI6A 3BH7A 4NMMA 2J0QA 1XD2B 2J0VA 4HB4A 2XOKD 2ZITA 1E0JA 2HV8A 3LAWA 4NYJR 5CDFA 3T1QA 1VCMA 1IJFA 4KSCA 3KQKA 4XTRA 2N42A 1VYVA 5JJKA 4RD0A 3KJHA 4Q1DA 4P4TA 2FN4A 3BWDD 3AVUA 2CLSA 4YDHB 3EWAA 4BPBA 2W00A 1MH1A 4Q7JB 5F3WB 1KI2A 3GJ7A 1E2QA 1CR1A 1LNZA 3SZRA 1NNEA 1WBBA 4DCUA 4IDHA 4AI6A 5FBWB 2BEJA 3N2EA 2HXSA 2FSFA 1NKSA 3FYHA 1U99A 3QG1A 5BW8A 5JCPA 2G88A 2F7SA 4M9ZA 3MCAA 1E9CA 1MABB 5B57C 3K70B 1G3MA 1NF3A 1GM5A 1Q44A 1T0JB 1ZYUA 4JT4A 4TT3A 1CR4A 4PX9A 3X1DA 3CNLA 3AV0B 2DWPA 2PEYA 4Q4JA 5EJEA 3BB3A 3EZ6A 1MO3A 2GWHA 1W4CA 2W2XA 2R9VA 1Z06A 1CJUC 1XWIA 5FTKA 4G5SA 2ZI9A 3TE6A 1E32A 4KU4A 2KSQA 2HDNB 1XB2A 4BFXA 2ONKA 4AY2A 1S1CA 1MO5A 4K8OA 2QI9C 4DVGA 4WW0A 1N6RA 2EFDB 2XNDD 3ZQ6A 2QE7D 4BGDA 3ICQB 2EWVA 4P4UA 5FOVA 4EFMA 5P21A 2ZAMA 3K0CC 4BEJA 4US0R 4PHHA 1QF9A 3PQCA 5KOYA 1ZMXA 5BYKA 2O5VA 2GVDC 3L43A 1FTSA 4F93B 4QM7A 4LHXA 4G3XA 1R0YA 1E1RD 3BFKA 1S96A 1VCIA 1WRBA 2GVZC 4YC7A 4U00A 5A5GA 1ODFA 3I32A 3OE7D 2ERXA 4O3MA 4Q1FA 4LV5B 4YXWD 2PCLA 1VIAA 3IEVA 2CL0X 3IQWA 4PANA 4AC9A 1Z0AA 2JLQA 2GK7A 4QL3A 2AN9A 2QZ4A 1T9HA 2FX3A 2ZSBA 1NMYA 4JZKA 4PPFA 5KSPA 4JLVA 1MO6A 3THWA 2MMGA 3U61B 2OAP1 1TF2A 3B8HA 1HT1E 1G16A 1XP8A 1WP9A 1RRPA 5EE5B 1KO4A 5EQTA 4URWR 1U94A 4M21A 2R44A 1K6MA 4PC6A 4JVNA 3T15A 3VU9B 2A9KA 4IEIA 4US2R 4TL6A 1FL9A 2PT7A 3IIJA 4L9WA 4P3YA 2P6RA 1ZJ6A 2GZHA 3AKDA 3SQXA 1XX6A 1YRAA 5AJVB 2FZLA 1M1YE 1NN3A 2A2ZA 5L3SB 3Q7QA 4RZ2A 4OQMA 3B78A 4DDVA 1E9SA 1KMQA 3PUVA 3UATA 1G8HA 2WWYA 3L0OA 3UMSA 5C2JB 1Q1ZA 1BS1A 1UBFA 3SI7A 3L0PA 1CU1A 4Q7LA 4QBHA 5B64A 2V7QA 2A30A 5HCIA 3NEJA 2R2AA 4YQFA 4LJ4A 1IN8A 3GQBA 2ZRCA 4EJSB 3GEEA 3TR0A 2RAPA 5K8UA 1J90A 1N6OA 3OF5A 1N6PA 2IF2A 4JIMA 4D81A 4TN1A 4FWIB 1IXZA 2ZR0A 3SYKA 2OEPA 2JDID 3GJ0A 4P4SA 4HZUB 1CR0A 5CLQA 3VX4A 4G01B 4XVUA 1HEIA 1AA9A 3E2IA 4Q1BA 4A15A 2QY9A 2VQSA 1ZVQA 3P26A 4LSGA 3WRYC 2BM1A 2ZSEA 2N1BA 1FW6A 3ZDQA 4BUJA 2OLKA 5JZVA 1SKYE 5CIWA 2Z4SA 2ZJ5A 3A1VA 3HR8A 4KODA 4OJQA 1G4UR 5KNDA 3NIBA 1GL9B 3KL4A 5BN3A 3B2EA 1ONBA 1BH2A 4QHYA 2C8VA 4BRWA 4MDFA 3RDPA 2ZRFA 3HDTA 4C7OB 4FW9A 4DKXA 4C2UA 3ADDA 2BWJA 2REOA 3S1AA 3KXIA 1W36D 1KO1A 3SJCA 2RMKA 4MH0R 4WAUA 2JLZA 4TLDA 2GILA 2I4IA 3GFOA 2GJSA 2W2TA 2R65A 3GMTA 1COWA 2WBLC 5FPSA 5IK2A 3U7HB 1G3RA 2A5DA 1SXJD 3GLFE 3DO6A 5A0FA 1E2GA 1BOFA 4RY2A 4ZIRA 2HLDA 5CK4A 4XTCS 4IXNA 4FWTA 3ZH9B 3K9HA 2O8DB 4FI3C 4TLCA 3X1WA 3IDQA 4MRPA 1FNNA 4QGGA 1US8A 3HR7A 4OK6A 1O3YA 2IHBA 2QSYA 1DG3A 1KMHB 2WWFA 1U98A 1OFHA 2HJVA 1YZTA 4XWAA 1KI1A 4O2LA 3CPHA 4NYIR 1G3UA 4HI0E 1W49A 3X1ZA 5KDOA 1MOZA 4V03A 2I1QA 2H8KA 4MRRA 2WTUA 4OK3A 4S35A 1U81A 1XZPA 1P9RA 2WJGA 4TMTA 1HE1C 3MGCA 4EAQA 2WHXA 4CVNA 1E79A 1EX7A 2JAQA 3BS4A 3IBGA 3DL0A 4JSTA 2GEDA 2ZANA 4PO8A 3TAUA 3EZ7A 3U4QB 4JJZA 1QG4A 4KBGA 1T5LA 4TQAA 4JVLA 1CTQA 3NBXX 3CKLA 2QNRA 4HZIA 1N5JA 2C95A 4M8NE 4HAVA 1H8HA 4LYJA 4PQYA 3KDSE 1E2NA 4RZUA 1U90A 2KBEA 3QVVA 4B74A 2R6DA 5JRJA 4NCKA 1SULA 5EUQB 4B44A 4M1SA 3LV8A 4BECA 4KCGA 2OSBA 4TMXA 2E9SA 1SVOA 3BBPA 1QVRA 3OEHA 4OQFA 3I5XA 4LOAA 2GCPA 2D4HA 3H2YA 1X1SA 3B1WA 5KO2A 1W36C 1GVNB 2G1JA 5FBLB 3VMFA 2IYVA 1OB2A 4A36A 4DSOA 4Q4HB 1UFQA 3EX7C 2D74A 2J0UA 4MKFA 2ODNA 4LPKA 3B6EA 3D6TB 2RHMA 1SXJC 1NJGA 4TSFD 3IILA 3A36A 1CIPA 2GZDA 1LS6A 1Q0UA 3RHFA 2IA5A 1YJ5A 2IUSA 5H70A 1OIWA 1GZSA 1VECA 4CDGA 2QP4A 1FMLA 1UDXA 1FNMA 4PZLA 3FWYA 4D25A 3LXXA 3CRRA 4PO9A 4Q9IA 4BZXA 4NBSA 2J3EA 3ND9A 1AZSC 3SR0A 2WM9B 4JBWA 4URXR 1E4YA 1LY1A 1W0KD 1Z22A 2CHVA 2O8EA 5FUXA 1T6NA 5JJLA 2W58A 3VR1A 2IYLD 4IJMA 1FZQA 5EE1A 2BBTA 3IGFA 1ZNXA 3K9GA 3BJIC 3GLGB 2IL1A 2OFWA 2OXRA 4YLGA 3K0AA 3P32A 4ZCMA 3VKHA 5A4JA 1A2BA 2XXAA 4ZDKA 3FOZA 2DHRA 3MUFA 1DELA 4POAA 4OI1A 5CM8B 3BB1A 3SNHA 4BE7B 2EW1A 3TAHA 5J4HA 1C1YA 2WIAA 4ARZA 4FXPA 4RCYA 4GRAA 4B2IA 3KTAB 4ZDJA 2F43A 2NO9A 2ZVQX 1OYWA 1KK3A 2IXFA 2QMHA 4CEJB 4M22A 1U2RA 3HPRA 5CK5A 2ZRIA 3CF0A 4C30A 2R8RA 4Q4AB 3WP1B 3AH8A 3OIUA 4TT3D 4PAQA 1VG0B 1RRGA 1EFTA 1Q1BA 2X2EA 4DIEA 3RC8A 1W44A 1XEWY 3KKMA 4DLTA 3HU3A 1BMFA 3HP1A 3PENA 1G8PA 1W47A 1X86B 4LYFA 1W36B 1XTIA 5F98A 2CHQA 2ZROA 4B2LA 2JLXA 1YE8A 2AXNA 2ZRDA 2ZSAA 3RRZA 2WJYA 1AKYA 4FINA 1W2GA 4OYHA 2LKCA 4FMBB 4OI0A 1U8ZA 1OHHD 2R6GA 2AX4A 1NN0A 1OPXA 3N70A 3RAPR 1ANKA 3VQTA 2WVJA 1VYTA 1YZGA 2QBYA 4TZ6A 2CL7X 1CXZA 4DSTA 2C04A 2YNMA 3OZXA 1NG1A 3EPLA 1TF7A 4F4CA 3T1TA 3L8ZA 1X1RA 4NCIA 5FOXA 4C2TA 2IEZA 4LYAA 2ZUCA 1RYFA 1JQJC 1A82A 2ORWA 1E9AA 1HT2E 2QM8A 4GMXA 4X8MA 3H0KA 1F2UB 2P5TB 2FWRA 5F9HA 1KY2A 4TMWA 2WJVA 2QP9X 4GT1A 1G5RA 5JJIA 3I4LA 2ZRHA 4ASUA 4UJ3A 1GNRA 2E87A 5SZJA 1NIPA 4MGYR 3PUXA 1F6BA 5KU1A 1A7JA 3ICEA 4Y0AA 1AK2A 1DAEA 3QXHA 1R0ZA 4UQOA 5K8IA 3PCRB 2ZJBA 2WJJA 4B71A 2CCGA 3KFVA 1TEXA 2VF8A 3KUCA 4HB0A 5ANRB 3EWSA 4KSBA 5KTYA 4CT5A 4CEIA 1HQCA 2YWGA 5AJXA 4LGMA 1ZNZA 4A8JA 1OXXK 1Z6TA 4LJYA 2G9NA 5HR5A 3QXJA 4DRZA 1G21E 3FMIA 4B3BA 4B6EA 2KI5A 4WZBE 2ATXA 3RRYA 1XBTA 1ESMA 1Q20A 2B7CA 3QXSA 2O52A 5J47A 1KI4A 3HJNA 3SHFA 3O8BA 2QPOA 1OH8A 5G3ZA 3G5UA 1GDDA 1DG1G 4BFWA 4IKEA 1QG2A 1R0XA 4A6XA 2P65A 4DIDA 2PJRA 2OCYC 4G5GA 2V7QD 1A5TA 1VHLA 4ZKEA 4URVR 2WICA 1WMSA 2ZVPX 1W4AA 2GF0A 3BH6A 5BXQC 1P60A 2QT0A 1G41A 2NG1A 1Z2AA 3D31A 5L3QA 4UXJA 2WSMA 2BKUA 5JHGB 4PPNA 4WOPA 2RGNA 3SFVA 2IYXA 1UKZA 3KUDA 4H9GA 5CLLA 4BLPA 2R6CA 1KAGA 4QM6A 2FFAA 2NQ2C 4QJ5A 3GJXC 3CZPA 221PA 2OCBA 5EE9A 4TMVA 1W4BA 1OFUX 1N0UA 4O25A 3ADCA 4WIAA 4F38A 3THYB 4OQXA 1QHYA 2V9PA 4R9UC 1N6KA 1S3SA 3KX2A 1G7RA 4HEJA 4TQ9A 1D5CA 1R2QA 2OILA 3IBYA 3MMPA 4OJKA 4XWOA 3VHLB 3KQNA 1CRQA 1FP7A 5CIQA 5EE3A 1P2VA 1Z29A 3QKRA 1G3QA 4NCJA 3LY5A 2BCGY 3AM1A 1W48A 1N6NA 2QT1A 1J2JA 2IXEA 2AWNA 4QNMA 2IX3A 2QAJA 2ZI3A 2ZJOA 1COWD 1PLJA 3NH9A 1S9DA 5IK2D 1EFUA 4OHYA 3UWKA 4I1VA 1JBKA 4KLNA 3GJ4A 3CX8A 5FI0B 4RFVA 2VSOA 2QL6A 5CB6A 2HLDD 2QN6A 3DOEA 4JLPA 4NCNA 1EFHA 1XD8A 5F2EA 1RW4A 2FGKA 3GLFA 3KXLA 4OHVA 4PHTA 5SZHB 3DVLA 4IRUB 4JS0A 4RSGA 3SYNA 2GCNA 1NJFA 3ZVMA 2D7DA 2RGAA 3PEVA 2ZYWX 4PHGA 4QG7A 2J0SA 4QJ3A 1CRPA 2HF8A 1GILA 3AP3A 4KHZA 4L9SA 2C9OA 1FTNA 2OAQ1 4H1VA 4IOMA 4MA4A 1TADA 3CWZA 2J46A 2VBCA 2ODBA 1KNQA 3QF7A 1KGDA 2WJIA 3AKYA 2RGEA 2WV9A 1ZD9A 5EXPA 1J8YF 1E79D 1N0WA 4IFEA 5JSZA 3LD9A 3QPVA 3W6NA 1QHSA 4JLMA 5DHFA 2ZJYA 2ZS8A 1CJTC 3THOA 3AP2A 1NVVR 1R7RA 4QGFA 5KNCA 1OFIA 4JBXA 2F1IA 2H92A 1ZIOA 1K8RA 4B3XA 2H5EA 1NG9A 4HLQB 2IHYA 3LLMA 4C0HA 3EASA 4MGZR 1H8HD 4I1OA 4Q18A 3J81k 4DDWA 3CR8A 4G5OA 3THXA 2QM7A 3QBVA 1LFDB 4MKIA 4PXAA 1Q3HA 3WBKA 2IC5A 2OCAA 1UDWA 1GKIA 4DCTA 3NTUA 5AJYA 3RS5A 3T61A 4QJ4A 3NVAA 1E2DA 3OEHD 4LYHA 1RJ9A 2DWQA 2OZEA 2GESA 3RLFA 4BFYA 2X8AA 1IM2A 1SVSA 2P6NA 1TTTA 1P6XA 3GLIB 5JWOA 4KAXA 2Z4RA 5FR2A 2XZOA 4DWJA 4GDFA 2UKDA 4GP6A 2PCJA 1XNJA 1ZBDA 2PLRA 4JKYA
chains in the Genus database with same CATH superfamily
3Q0IA 2ZCJA 4GMGA 1PJAA 4OQPA 1RWWA 3E9YA 2G9VA 3OOWA 3KQVA 2HA7A 3O6XA 3OIYA 2O2DA 2ZR9A 4WN3A 1GLGA 3T1OA 3SPXA 3H9QA 1SIOA 4W7SA 3T52A 3VNUA 2FFQA 1SBYA 2A4KA 4NOMA 5C81A 3HACA 5D3QA 2WOJA 3HDQA 4GBMA 4KC0A 4CU5A 4V0LA 3FVTA 1IPEA 1ZY2A 4UM9D 3UMVA 2PT5A 4DQVA 4EA8A 5AJTA 1OCZC 1B74A 1OIVA 1QJ4A 5EIBD 4FEYA 1G2OA 1TTHA 2CHUA 3MMXA 1D2HA 1EEXB 2F3QA 3UHJA 3OHPA 2HPVA 4WN9A 1RDFA 3K9WA 2XZLA 2GN8A 1EWTA 2OMEA 2ZIAA 2ISCA 4FUTA 5K0FA 1T9BA 5JUAA 1GKLA 1X8KA 1UC4B 1TQGA 4FYYA 1QZ3A 3QMPA 3OWHA 4PGMA 3C14C 4MRSA 2FPRA 3F5SA 4QTZA 1B41A 5AJUA 4RNCA 1XC7A 1O58A 4NWIA 5IX8A 4PZUA 2PX0A 4CSAC 5B3IA 3DKKA 2PQMA 4WZBA 3VBCA 2XMCA 2QUHA 3V42A 4Y7CA 3C74A 4XE5A 4GPTA 1QFMA 2VUTA 4RJJA 3R41A 4NY1A 5JZMA 1ISMA 3DMDA 1MCZA 3ZDAA 2O8EB 1OZ0A 2J3JA 5I8ZA 3AKEA 4L5BA 3R5SA 4TLAA 1YB1A 4GR5A 3O9VA 2XXAB 1XD2A 1DHTA 4ZDIA 3GF4A 3C43A 3QIAA 4WCFA 1YKGA 4HNHA 4E1AA 1J5XA 4KQIA 3GGPA 5HILA 3QBTA 4URZR 4BEMJ 4M7OA 4S2EA 3UMKA 1PZNA 1OXUA 5EGYA 1QTNA 3MT7A 4DV3B 3O0DA 4CG3A 2WIKA 4EKDA 4D02A 6PFKA 2VXOA 4OHWA 4KMSA 4OOEA 3ZK8A 3S2EA 5I7VA 4J3NA 3QLVA 3IHLA 1JIJA 1QIGA 2OAEA 5AXAA 2FLVA 3PD0A 4C7XA 5ALEA 2XLVA 1MC4A 2QI9F 1A7UA 4F2PA 4L85A 4KQFA 1W0JA 3IJPA 2FR8A 3JVUA 1SOAA 4PZPA 1N3LA 3ITFA 3N2GA 2EWWA 2XCUA 3ZXUB 1TL7C 1M74A 4GR4A 4CUJA 4AD8A 2VK1A 2QNIA 3STHA 4XFKA 1QVZA 1K92A 4B32A 3TRFA 2R5WA 4AKIA 1QNLA 3TG8A 1RQ2A 2QJFA 4DSZA 3CLUC 2Q9BA 1L1QA 4LZJA 3FTCA 2FZKA 2QTLA 3PHIA 4J76A 1ODSA 3HADA 4PAOA 3VZSA 3CO0S 4FFPA 5AJZA 4M1EA 2X58A 1P39A 3H65A 2C9ZA 4LY6A 4HEQA 4RDIA 4BO3A 4KC9A 5KDDA 1F3OA 3ROGA 2NZWA 4JWKA 2VDPB 3GNQA 1DIGA 1S3GA 1Z2CA 3RKSA 3VPGA 1KI7A 3JV7A 2IXMA 2AQKA 4WJ0A 4ISBA 1L7DA 4N0EA 1N25A 4GXNA 3RASA 4MYRA 4JIGA 4GI1A 5GJWC 3P4UA 1Z5GA 2HJGA 1ZH6A 2EP7A 2PG3A 4ZGBA 1R4MB 1RAEA 1QGOA 5IARA 4EMSA 5A4MS 3B1VA 4F97A 1V16B 3EGCA 1TU4A 1XDBA 3JZDA 8OHMA 3Q0EA 2UXBB 5KNBD 2BTQA 1MAVA 3BK7A 4NY3A 4WERA 3GUZA 2JCSA 1PWZA 3EXIA 1NXWA 2C2XA 1S2MA 4R32A 1I6WA 2A14A 1OXTA 1XPUA 4JI7B 5DEOA 1R9GA 5AKJA 1C0LA 3ICCA 2XA9A 4H7EA 4Z9JA 1JKXA 2OCLA 3DPSA 2UUPA 3OC0A 2HA5A 4CHGA 3PJDA 3BERA 4J0IA 2Y0BA 3VH3A 1SUDA 5BMVF 4ZVVA 4OHCA 1CUGA 3T7EA 1AS3A 3L4SO 2FUG1 4EG7A 3RUEA 3VYSB 3SKXA 1T8SA 3ZGXA 1JKIA 1WMFA 1R4NA 4TYWA 4KVAA 3GCGA 5KYTA 2J8WA 3H5TA 4PHCA 3GUHA 4QWMA 4INJA 2XB6A 2ZBEA 3WC4A 1JQDA 2J7KA 1NY5A 2FFBA 5LD2C 2R3SA 3DW3X 4A9AA 5FBVB 4KQ2A 3K9NA 5IEJA 4OXYA 3EAGA 4MTLA 3GODA 1G1MA 5DP1A 3VJMA 1ABEA 4N48A 1PG2A 2NU7B 4UUMA 4BO8A 4C6TA 1XP5A 2HRDA 1ZU4A 5B7NA 1NVMB 4QYTA 4GQBA 3FPEA 3QJYA 3SC4A 1H1DA 1ILWA 2UYYA 5L0GA 3U9SA 2Y93A 1S89A 2HXYA 2YHSA 2FG5A 1L3PA 3RO7A 3R3SA 4R2IA 2V54A 3ACDA 3JZIA 5EG5A 1SY7A 2PGIA 1F0KA 4MKGA 2QENA 1SBIA 3GFVA 1KI6A 4U2FA 4B3RB 3ZQJA 3GFQA 4RHTA 5C7LO 4B2PA 5BN3B 3NI2A 3A14A 1C9KA 2C9BA 4FUQA 1UJBA 3OHSX 1Q7GA 3T7DA 5CA0B 4W5QA 4F9GA 3T35A 2SKCA 3C3AA 3JAKA 4GW3A 2M1XA 3HUEA 2BHTA 1GZDA 1GCIA 1W73A 3RAGA 5F1OA 3CCFA 4MQBA 2ODQA 3AFNA 3B1XA 2XDQB 1ACJA 5EGSA 2H2HA 3MJ4A 4Y3UA 3ZBUA 2OHIA 3T5TA 3BJMA 2EKLA 1H4QA 3IOCA 3W7VA 2EBUA 3VXKA 1KJWA 1MAHA 3KYJA 3BH0A 2OJQA 3DNMA 5F1YA 4CIWA 3DMPA 1A9RA 1DBQA 4NPHA 3EVEA 3QLUC 9ATCA 1D0IA 1CVIA 2FOIA 3N6RA 4HOYA 2F3RA 2PLNA 5EJ4A 4O0MA 2IW1A 2GNOA 5BR4A 1L6IA 5JJBA 1P7PA 3GLIA 2QXTA 3HO6A 3CRMA 2IYSA 2QYTA 1Q6YA 1ISGA 3Q5EA 2VRWA 3E22B 5CVEA 4LX0A 4R71A 3I9V1 1U8YA 1E3MA 1K04A 2B8EA 2QAGC 3KFXA 3ZIAA 4ZJPA 5KKAA 1Q0LA 3IKTA 1Y8AA 2OUKA 1Q2UA 1G1AA 2ZT5A 1P2BA 4ZJYA 5C3UA 2JJ1A 2JJ2D 4XOUA 3WOHA 4TSRA 3RVSA 1HEUA 3S2YA 1U7OA 4Q1VA 1J99A 1SMKA 3LF2A 1J0DA 2QYSA 2G5CA 2AFHE 5CVJA 3WWDA 1YZLA 2B36A 4H77A 1D03A 3TEMA 1TZKA 5FPHA 1IN7A 1PFGA 5CFPA 2IXBA 3QEKA 4M1WA 1CZNA 4M38A 4LG1A 3UJAA 3SLRA 4BO5A 2PH1A 1YS6A 5IT5A 5LFAA 4Y98A 2WPDD 4KIGA 2QAGB 3IV9A 2XT0A 1GSAA 4UHFA 3T06B 1Z6PA 4ZXPA 5J2UF 2FN7A 2EDCA 3OICA 1HDOA 1P4JA 4NS4A 1TO2E 3G5AA 3E4DA 3D54D 2IU4A 1ZNWA 4OHXA 3V2IA 5DYYA 3DWIA 2V0CA 1E6EA 3OCCA 3GGGA 3IDFA 4LF6B 2G17A 5JC8A 2C2YA 3I5UA 4JXZA 1E7MA 2UUHA 2CBXA 1AH2A 4KXNA 4HL6A 2GPJA 4U7HA 2EIKC 2ZKLA 5WRFA 3GVIA 2RKWA 1KYQA 3EVTA 1MC8A 3ANYB 1VMAA 1MAAA 2XOKA 4YUXA 3TUZC 1YB7A 4E07A 3HBJA 4EHBA 1I1QB 4XM0A 1YVIA 1P9LA 1T0HB 2I87A 4URUR 3ZZUA 4B6OA 3L1IA 2BP7A 3M4CA 1NN1A 1Y6QA 1OLXA 4H08A 3I9MA 3C3JA 5ALHA 2P30A 3IPMO 1LSOA 4KQJA 1TTQB 4J9UE 2VEOA 3AR4A 4U5DE 4IDAA 4KYTA 3OT1B 3D7MA 3OU7A 2GA8A 1QX3A 2C3YA 2IWHA 4JLDA 1KEEA 2HREA 1O97D 1P75A 2NTYC 3ELBA 3KVRA 4CG0A 3TX2A 1ZC4A 2A57A 3HQ4O 4ZV4A 4OG2A 3TFOA 2GAFA 4GPBA 3PQ8A 5DWDA 4O2AB 5JCZA 4XJXA 1T3HA 2P3QA 4R2WA 2VHUA 2CKMA 2ASEA 5EYPA 1H9AA 5FTLA 2BGKA 3KUUA 2VNKA 1WLYA 2WIJA 3E15A 2V9ZA 3HVJA 3R9XA 1RKBA 2WTMA 2EX4A 1OH5A 4E14A 3BXOA 3VKWA 2DQZA 4BQSA 1NMEA 1T5HX 4HVLA 2JEZA 3GM2A 5CTJA 3RS9A 2JBAB 4MJXA 3P8ZA 4CIXA 3TXXA 3LBNA 3CRVA 1TM7E 1L5QA 3NHKA 1HURA 3ZHOA 2FW6A 4Q4AA 1JVNA 4RPHA 4XWYA 1DJNA 1CBUA 2XKBA 1XZFA 2AL7A 3UHFA 4DT1B 2SCUA 3RU7A 4D8TA 2HSDA 3IMGA 5DP2A 1DEKA 3EEOA 1SXJA 4LVCA 3W06A 3CJRA 4KYIB 1V2GA 3C7CB 8LDHA 2W11A 4GGOA 5G1PA 2B8WA 1EBUA 4NDAA 3M1CB 4DN6A 3HUUA 5JTTA 2QR2A 1T1SA 1IJBA 3SC2B 2I67A 1GN8A 4NFSA 3VC7A 3O26A 2X5NA 1FS6A 4HWSA 1HF3A 5A4DA 3ILHA 1HX7A 1KIMA 2VK4A 5CVTA 2NV2B 3AVPA 4KLZA 4Y2JA 2ZXRA 5GVRA 4DPKA 1DTSA 2ENUA 1ZCAA 3K1IA 1HTTA 4AY4A 3ZTTA 1WX1A 4UNSA 3QG5A 2J3LA 4XSVA 1KU6A 4MUMA 1P2UA 2ZZMA 4MKZA 2HMUA 1RKVA 4UAUA 4AFNA 4N54A 4OIQF 4NYJR 2QF7A 3G9ZA 1KVUA 1IJFA 5TEWA 5BY2A 4GKVA 1IM5A 4U7TB 4BPBA 3VNAA 2EGHA 4JP8A 3GU3A 1H2HA 3QG1A 3TIVA 2W2MA 1PTJC 2YHIA 3JVDA 4QELA 2PUAA 5EN4A 2R1TA 5KJ1A 4TSKA 4CQLA 2IXAA 3R7NA 5IASA 4B6IA 4E7ZA 3FRIA 5HVNA 4JU9A 4FDUA 4WXMA 4IIFA 4UPVA 2W90A 3F71A 4JB2A 2OM6A 1QK5A 4ZCQA 5AH0A 1DMRA 3CHYA 3PWSA 2QZ4A 3CVWA 3GARA 2FX3A 2HDWA 1CQXA 5HJ2A 2G4VA 4WNAA 1DOVA 2V5AA 2XTJA 2ZW9A 2P6RA 3AHJA 1G5ZA 1HRKA 4R81A 1G8HA 4K9OA 3KT0A 3HDHA 1JEYA 3GQBA 2QX7A 1J90A 3II6X 2XCRB 1VE3A 1EHCA 4HDAA 1KWGA 3KSRA 3PT9A 1OX4B 1C80A 3I0MA 3WDMA 1OLUB 2BL4A 4YUVA 3FOPA 2Y99A 1I5RA 1GFWA 3IDSA 1NULA 1E7QA 4C2UA 5AVTA 1DC8A 1P1CA 3LQ1A 2CLMB 5LMUB 4FHCA 1COWA 1SQ0A 3H2SA 5EIAA 1ZD2P 3WRWA 1I2ZA 4FI3C 3UW1A 2WD8A 2XBMA 3K2EA 2EL9A 4P83A 2FMFA 3H5RA 1U98A 1OFHA 2P27A 5IUJC 4YJDA 2HEGA 1DX4A 2HBRA 3OZWA 1XZPA 2WJGA 2I29A 1E79A 2JAQA 4KQ9A 3IQFA 3RYHB 3AM4A 1QLWA 1QG4A 4KBGA 3TTYA 4BBPA 3WGYA 4NV3A 1ONNA 2PFSA 5AW9A 4BEWA 5KKNB 1E6UA 2OHOA 3LCRA 3CMMA 4UASA 3PFCA 4CBEA 5EKDA 1GDHA 3Q9NA 2NTNA 3QE4A 1WBJB 3CVJA 3I23A 3HGQA 1OBFO 5JNUA 4J4BA 2BEUB 4Y6RA 2J3EA 3O84A 3INNA 1YDIA 4UTXA 4JBWA 2OO5C 1EJ2A 4U2KA 1Z26A 4N7BA 2WDPA 4YDRA 5EWLA 1IHXA 2PGXA 1QKKA 1IZ7A 1H5QA 1RLUA 2FLKA 4RLQA 2WR8A 1GT91 1ZCZA 3LRTA 4YK7A 1FDIA 1TT7A 1NASA 5DBIA 5CK5A 1HG0A 2NVUB 5C5CA 2XY4A 4MVRA 5DM0A 1EFTA 2UZ1A 3DBHB 3HU3A 5EIHA 2QRVA 2IH5A 4FFSA 2DHQA 2ZROA 5CMLA 2CFTA 1NN0A 2UYGA 1XV5A 2YTZA 3FGZA 3BRSA 3KXPA 5BV1A 5BQIA 4HT3B 5F1KA 4LERA 2UUCB 4GGMX 2QOEA 1NVAA 5TRTA 4LE2A 3EJ6A 2Q8PA 1GNRA 1I14A 1QWOA 1BJRE 4HCJA 2Q28A 4GUDA 2QLTA 2VF8A 2FUNB 4MQ5A 3AEQB 4LGMA 4BNXA 1OD6A 5HR5A 3M15A 1VKNA 4KH0A 1JMWA 2YMPA 3U4AA 1A5BB 3IR7A 4JCHA 2QPOA 1GDDA 4MEJA 5I3ZA 3OTIA 4QIHA 2P6MA 2OCYC 4LE1A 3DVAB 1WMSA 3E7DA 4HTFB 2OEXA 3D3EA 1G41A 4UCFA 5JUWA 3JASA 4IGFA 5ECGC 4D3XA 1V47A 4DDHA 2R6CA 2EIMC 2CYAA 3K1HA 3H9JA 1OFUX 2AJ8A 4X1OA 5KJFA 5KNDD 3MMPA 1V26A 2BUCA 4ARSA 1HT3A 1BEEA 3FCCA 1YJAA 1FE8A 1BH6A 3DMRA 2QT1A 2AWNA 3SF0A 3O74A 3NONA 1H93A 1OZHA 3NBMA 2WP0A 5A0VA 4JOSA 4NQZA 1LBQA 4J16A 4XDYA 3VC3A 2HCRA 3SYNA 4RZQA 3O4RA 2D7DA 1E1CA 1LGYA 1UWLA 5EZYF 4WY5A 2ODBA 4QT0A 2RGEA 4DE5A 1P74A 5EXPA 1M6WA 5CDUA 5K01A 3ILXA 4N6NA 3H9UA 2E4YA 2H5EA 4HDNB 1RKUA 2PVSA 1Q3HA 1UDWA 3NTUA 1JBEA 4E0IA 1I30A 1CQZA 1MMDA 1BOOA 2OENG 2DWQA 2C58A 1CJSA 2AVDA 1RJGA 1WP4A 2XZOA 1XNJA 3M1AA 2FA9A 3LKDA 4UKDA 4MKHA 1U3VA 3ASYA 1FCJA 3P9XA 1J22A 3DWWA 1P2GA 4QEDA 3BE4A 4ZCTA 2FI1A 5JLJA 4FC7A 3ASUA 2PF4E 1CC1S 5J4KA 1EP9A 1J8QA 1H4TA 3SVTA 3PHBE 3N7UA 1C1DA 3R76A 3SFZA 4FD3A 2W6CX 1E3LA 3L79A 2XB4A 4BL5A 5ALIA 2O8NA 3TPCA 3TLJA 4O5OA 2KQUA 1AGNA 1NXXA 1XZHA 2XT9A 1O3UA 4KV9A 1NIJA 4ACAA 3WIBA 3MWDB 1XVUA 3IO5A 2WJHA 4E6EA 1U2ZA 2Y1WA 1OHHA 1HZJA 3W8FA 3VZPA 4MYTA 1K2VN 3DMNA 4Y7DA 3GH3A 3QP9A 5E0KB 4ZYXA 3G7NA 1Z36A 3NVMB 4C1NA 1JG2A 1MIOB 3BQMB 4P31A 1T2DA 3K4HA 2DM6A 2XVYA 3RVLA 4DIOA 2C5LA 2D0IA 2DKFA 4IHJB 4N6GA 3GP3A 1WV1A 1O89A 2R4UA 2G04A 3FDXA 4XEKA 5FNVF 4B81A 2WWIA 3C3YA 3G8DA 3DBLA 2RHHA 3CURA 2QHXA 1EFCA 4F71A 1ZHFA 1M6NA 3BXZA 1GG2A 2PJZA 1YZKA 2OYSA 2IUTA 2WL8A 2VTKA 1PV4A 1O0CA 2LZ0A 2C5FA 2UUOA 4RVUA 4DMUB 2I66A 4JR1A 3V8NA 2ONJA 4BN5A 2GEKA 3A6HA 1YQTA 1G18A 2CXXA 3TBFA 1PJCA 4U7WA 4BVAA 3SHOA 2QS9A 2C57A 5E3IA 2P9EA 2QMEA 1KY4A 4DJFC 1L2TA 4ZOCA 2R1VA 4HXYA 2DFNA 1S0UA 5CT4A 4R8RA 4JE9A 2ANCA 3R74A 2I2AA 2PRSA 4IDEA 3OY2A 2K87A 3SDZA 1RAHA 3VNQA 4TLLB 2ZUEA 4OHMA 5C18A 4WUVA 3JCZA 4ES6A 3IUEA 5DU2A 4FJ2A 3VZQA 1P1FA 1TFUA 1A0BA 1PZGA 3EXAA 1K06A 1UDBA 1IXSB 5A05A 1JR2A 2PXCA 1PZEA 1N1GA 4MUAA 4ZEOA 4A6PA 3HCPA 5KWSA 3NUQA 2OHFA 5KWJA 1EAMA 3KLOA 4QYSA 1ZN7A 1XT6A 2YMLA 4MVSA 3TUIC 5B3JC 2GT1A 2BEVB 4KLAA 5SYMA 2E5FA 3OCZA 3W2HA 4INOA 1AQJA 4U6NA 3EGXB 4WACA 5HMMA 2HQRA 3OWXA 3GJ3A 3HN2A 1IN1A 3FRHA 2Y8EA 3NHFA 4F7DA 1YI1A 4EJSA 4D4NA 4GRDA 1ZVVA 5DLQC 3OPXA 1M8KA 5DNWA 3CG4A 1WW3A 3GNTA 2NYRA 1PZFA 4IXDA 2J48A 3QOWA 1UKVY 3RRNA 5A6BD 4EPXA 1R66A 2GJAA 4KE6A 1Z2PX 2QW1A 2C5AA 2Y2UA 2WTAA 2CJPA 4DCPA 4OKNA 4FYIA 2GZRA 1XZQA 4RMJA 2JI9A 4K6HA 1AHNA 2BEWA 3T5AA 3CRZA 1W46A 4MTOA 3AV3A 4FGZA 1DAOA 4M1KA 3GVHA 4N8SA 5JIBA 3SNKA 5DLEA 1WY7A 5ALUA 5TXGA 3W8HA 4S0ZA 2FPUA 4XDZA 4PLTA 2C07A 4CCYA 1UKAA 4LJ6A 1W1IA 2RSEB 3DE2X 2XTMA 4MV8A 4X1IB 4X66B 1SKAA 2WMDA 2YW9A 2XGGA 5EWJB 2PIAA 4WFJA 3O75A 5CX4A 2EQAA 2I99A 2XCLA 3Q72A 1KAOA 2A4MA 3VR2D 1JW9B 4TVKA 1XQ9A 1K86A 3O10A 1IC6A 2YBEA 3HL4A 5E9WA 5AUOB 2J7PD 4HEAJ 2FGYA 2WUVA 2R8ZA 5IH3A 3WYAA 3EDOA 3M6AA 5B5SA 5B1HA 2Q50A 5J4VA 4MMYB 1BCRB 4MUHA 1QCZA 5ALOA 5I47A 5B1YA 3L8GA 4Q4JB 3A4MA 2JPDA 4NJEA 2EATA 5E38A 2J0EA 3S1LA 1XMJA 1NXOA 3HMKA 1J6UA 4XFDA 5G0SA 3KETA 3MJHA 3O8CA 1OAKA 2ZIUB 4RHFA 4LOIA 2C88A 3OY7A 3KZNA 3TLEA 3JRXA 5H83A 4QTYA 2F55A 5DO9A 4GXRA 3MJRA 3TTXA 1Z3CA 5E7IA 2Q1TA 1LW6E 1FUIA 3OX1A 4F2HA 2BBWA 3CPSA 1XJ0A 3ZBQA 3FBWA 5DFAA 1PFYA 4L9RA 4L51A 3PEUA 3IAUA 3P0EA 2FRXA 4CLRA 2QRMA 5ISMA 4JCZA 3KPUA 4JVMA 4KDRA 4G4GA 3JWIA 2MYSA 3LDUA 1HNWB 2L0XA 3CO5A 1H3FA 5FUYA 5BW5A 2GA0A 4TXLA 3OESA 1Q7CA 4KMMA 1R5JA 2W7TA 1YGYA 4PZZA 3O93A 4JR2A 3D6UA 2BMAA 2NVOA 5KOJB 1PK9A 3F1LA 3HWRA 4GQAA 3CQZA 3BMOA 4P08A 2G83A 4PTZA 3G88A 2F90A 3EJWA 2I4NA 4YJ2B 3PNVA 3T3PB 4P3NA 1Z5WA 2XUIA 3DL7A 1FFHA 1RM5A 4O08A 4REOA 3ZHQA 2Q6OA 1WZEA 3TNYA 3AINA 1D0SA 1XNRB 2GPTA 4DLBA 4DV0B 2J3DA 5FA5A 3G4ZA 1SIWA 3K35A 2O5EA 5A9RA 4BX8A 1CUDA 3G0GA 4IRUA 1J4AA 3NCHA 4BV8A 4TUYF 4QDZA 1UWKA 4X95A 2WFLA 4PICA 1GPH1 3TECE 3GGCA 1WXHA 1NW5A 4BP3A 1V74B 4V0OA 3KWFA 1SG9A 3EZLA 2I7CA 1E4VA 1FX1A 2J5KA 1UPBA 4HFKB 3PJFA 2IK8A 3WHKA 4IO0A 4OUDB 5EHNA 1QCCA 1Q74A 1HY3A 3R5XA 1BR2A 1AV6A 4MUBA 4C0KA 2JIRA 3DJYA 3HDYA 1TZ2A 5EZQA 3NWPA 4CM9A 3BZUA 3PEYA 5K3FB 4MR8A 1KORA 2LQGA 3UUFA 1HWYA 3L0CA 1TKNA 4IQ8A 1P7VA 1WSWA 3PG5A 2X86A 4GC9A 1URPA 3DEAA 1EAYA 1F5SA 3LY9A 4RYDA 3C97A 3DE9A 1EE2A 1JU9A 4LRYA 4RHYA 5IUNC 4HLUC 1L6RA 4ZT2A 1MABA 1VG9B 2M2IA 2MSKA 1E4EB 3BSWA 3WGUA 2H3EA 1KR5A 3HSSA 1IHYA 4WQMA 1CF9A 1R0SA 4CS9A 1WKVA 2NADA 1BVRA 1KOLA 3MT8A 2P2DA 4JZYA 2FU5C 1NVEA 1P7CA 1AY0A 5AVJA 4D9JA 5KPDA 4V02A 3RJ5A 4UUQA 1W0CA 1HK7A 4K6FA 1DKNA 3UT0A 4EI2A 2FOLA 1W9MA 2CY0A 3QUTA 2AOUA 3ATPA 4RA9A 2XL6A 4ZI7B 3TRIA 1P4SA 3GZ4A 1R0LA 2EKDA 2JLUA 2ORYA 3D8HA 4LZPA 2CVHA 4H1HA 1QHHB 2OMKA 3LZ6A 5JVDF 1RS0A 1L5VA 3RADC 4BB5A 2BMWA 2FMKA 5CYOA 4Q93A 1VOTA 3UAVA 4OBEA 1OGYA 1YFZA 3LDAA 3EQ8A 3VO8A 2GERA 3HDVA 1II8A 2HMYB 3ONEA 1XTRA 4RK1A 4D8XA 4QBKA 1SVNA 1PNOA 4N7JA 3DOOA 4LXQA 2ZJ1A 1XA4A 2NX2A 3WRXC 3TJZA 2I2XB 2XUZA 1LF0A 3EIHA 1NLXA 3V55A 1Z5ZA 1WB9A 2FFHA 1TIPA 1AXRA 1WHSB 2GK6A 2QXUA 3VR3D 1NNUA 5K0IA 4IGEA 1J1ZA 3RNLA 3KHUA 1Y3HA 4RPCA 1X39A 1I33A 5BT8A 3GVXA 3PA6A 1I9CA 3P45A 4DQDA 2CD9A 5LLSA 4G8BA 1AKEA 1QG6A 3BMNA 4JXXA 2OSVA 1JRAA 3OJXA 3AUKA 4A0QA 2DBQA 3NC1C 1SRQA 1HLGA 4WL0A 4B1FA 4G09A 1JEAA 2J6CA 2WWGA 4GI2A 3SYTA 1N5LA 1E1NA 5C1IA 2D5AA 2HADA 2G5GX 2WI8A 3ZQ4A 3LYHA 1ESNA 4ZT3A 3JY6A 5ALGA 3PVCA 4TL9A 1Y5IA 4ZVSA 3BSYA 4BUZA 3RIHA 2Q00A 3EYAA 2VCYA 1WZ2A 2HWYA 3S55A 3E6AA 1N2XA 2HIAA 2JDIA 1HE1A 1TT5B 1YOBA 1E77A 3GLRA 1N6IA 1WG8A 4CEJA 3GUUA 5IEBA 5J3JA 1DDOA 3LVQE 4EIYA 1CD5A 3EDQA 2IBFA 2HOQA 2GCIA 3KJIA 4GPAA 2WHPB 4AU1A 1QX4A 1OKKD 1YXMA 2AFIA 3LQYA 3QPDA 4RDAA 1QGZA 1BG6A 2A5JA 3DOCA 4JJGA 2HZ8A 5C4MA 4MNDA 2B20A 4MVCA 3W3AD 5BMVA 3UMMA 3S5UA 1PG0A 2WPNA 5AKXA 2GEVA 3UMJA 4OIRF 4OI4A 2WWHA 3O8RA 1OYVA 3HLKA 4M1YA 2ONZA 3IKJA 1Z5OA 5TB5A 5F5NA 4TTIA 1LF5A 1C9YA 3NJ8A 1P80A 4C08A 1UMDB 3CKYA 2YVAA 3N8NA 3DOFA 4JHXA 4UBJA 3UGPA 1U7TA 1FMJA 5E3CA 1EM8B 3HVUA 1X15A 1AUOA 2OBYA 4B46A 1QCYA 2VQEB 1TCVA 1N77A 1RYNA 2JAUA 4U6QA 3L7DA 4K3VA 4S04A 3E35A 1XOIA 2X2OA 5DN9A 1E0DA 4H7HA 3ANTA 2ABWA 3RUDA 4BRZA 2HV8A 4JEHA 1SUSA 1Z39A 4EHKA 3QEBZ 1IBSA 2JIPA 2BSXA 3SC6A 4LTDA 1Y3DE 2FWMX 3T0GA 1T2FA 5DCYA 3W5SA 5JV5A 4AO7A 1Q7BA 4MP3A 4N82A 2YN0A 1GM5A 1YS7A 1W75A 2WD7A 2ID4A 3TQHA 1GEGA 3ZHUA 1MOQA 2JJMA 3I5AA 3FNEA 2WIGA 1NVTA 4OHBA 4K8OA 4ER9A 4YJ3B 4GYYA 4OEHA 1ESCA 4JOQA 2Q7XA 1JJBA 3M6MD 3MPUA 3GPBA 1QBGA 4HH4A 4WZZA 1T9HA 4XR4A 1RRPA 4R1QA 4JVNA 4GLLA 4I55B 4L9WA 2QTNA 1DEHA 1ZSYA 2G6TA 1M34A 3OJLA 3IE0A 3OP1A 3NEJA 2OYRA 1IN8A 4K26A 4JENA 2RAPA 1ZR2A 1SRRA 4LDZA 4LAFA 3U17A 4RFLA 2ZR0A 3SYKA 3AFOA 5DYWA 4UMDA 4W1PA 4WKGA 2H5IA 1YMVA 4BUJA 3MS7A 2P90A 2OLKA 3KT6A 2W8ZA 2O2ZA 1VPTA 4LVUA 4L74A 3LUDA 3NIBA 2CJYA 4I8IA 1PEDA 1THTA 1WPRA 2RAFA 3HDTA 4DKXA 2Z1NA 3T94A 1EUCA 3TNJA 1L5KA 2JLZA 3IJ5A 5EXEA 1PZXA 4G2TA 3CUWA 3GUCA 4OX9B 5LUAA 3GZJA 1G3RA 3I01A 1Z0UA 3KKBA 2OWEA 3MGKA 5CK4A 1X42A 1MIHA 2Q4RA 2ZCVA 3LYUA 4H7DA 4NF2A 1PL6A 1FNNA 3MFQA 2CF6A 2YZKA 3DWGA 3GCDA 1G3UA 3IL2A 2I1QA 3JQAA 4MGHA 3AF5A 3P9RA 3SHQA 1ZA2A 1EYZA 3PUIA 4HEHA 5AJHA 2BDUA 4R83A 1M56C 5DEIA 3TLZA 4B44A 4LF4B 3BBPA 1SWWA 2PZ8A 4E70A 4KXXA 4B79A 1PWHA 1YQGA 1NVBA 4NSNA 2TECE 3X0DA 1CYEA 4LPKA 1K6XA 8ATCA 1OI4A 1QANA 3C8DA 4JX9A 2PBEA 3A36A 3G2OA 3JXEA 2BFCB 3LPMA 1FMLA 1MQVA 3VR5D 4ZN6A 1WCIA 1G8SA 2Q6LA 4BMPB 1P17A 2I91A 5KWEA 3KALA 5TF4A 5FPPA 5J2UA 5JJLA 5BV7A 2B1RA 1ZHXA 3AJAA 5LSAA 2X9GA 2VDWB 1DUVG 1AQIA 4BE7B 3TAHA 2BJHA 1CUIA 3OG9A 5EMHA 1T5OA 3LPLA 4IJ6A 3TEFA 3HP1A 3PENA 2PQ6A 1Y6RA 4ZLDA 2ZUSA 2B78A 2DPHA 1N36B 1N33B 5CAEB 3OPYA 3UCEA 4FMBB 1A41A 3FN4A 1AURA 4D4IA 4DSTA 3AIKA 1XA0A 5FA6A 1DJLA 3U0BA 1K98A 2ZIZA 3HZOA 1LEHA 3H0KA 1EH5A 3NTQA 1RXSA 1LU9A 1SOUA 2VSNA 1U1EA 5K8IA 4E1VA 3EWSA 4KSBA 3DV2A 3NKLA 2FPOA 1FU4A 2Q5JA 4L6CA 4WZBE 3NR2A 2P35A 2I33A 1WDMA 3IKMB 1TZMA 3O8BA 2PJRA 3LLIA 4AAYA 4M8LA 3ODPA 2NZUG 3HUFA 2QVBA 1VHLA 4G41A 1UPXA 3PC8C 3IQGX 4C4AA 5JNLA 3MVEA 2YLGA 1U6JA 3KUDA 4H9GA 1JILA 1FLAA 1EQ1A 1D6NA 2G1PA 5AESA 1ST6A 3GCWA 4EEZA 3V8PA 4EH1A 1ZIDA 3THYB 2V9PA 1OAOC 1D1SA 1XSEA 1Z29A 4L02A 2YVQA 2PRKA 1TWCA 1ZD4A 4EI8A 1OWOA 2IXEA 4DNFA 1VJGA 4R1LA 3WQHA 2RD9A 2Q0SA 3UWKA 3FPCA 1OXKB 2LBPA 4RANA 1RW4A 4EHJA 1GHTA 3IMCA 2MTBA 1MXFA 2GK3A 3ZXYA 4CMIA 3OM8A 4PHGA 4QFDA 2H8AA 3BRJA 1CRPA 4OINF 4L9SA 1B26A 3WGIA 2XE8A 1H0HA 3W6NA 3DUFA 2XMGA 1F6DA 1RKQA 2A6EF 1TJ3A 4C0HA 2Q49A 3J81k 1JIQA 3AEKB 4Y1EA 3IELA 1MO2A 1E2DA 3EQZA 2FSUA 1A72A 1LS4A 3C87A 2R25B 2NQ8A 4A8HA 1DCTA 2QLMA 3ZTZA 1PBNA 4Y2QA 4CJOA 3EGVA 2CXUA 3EEBA 3U1BA 3WGGA 1QYRA 1F0NA 2LCIA 1IY0A 1E6LA 3IR5A 2DHDA 4Z4CA 4CS8A 2WF7A 4GBED 3FHJA 1Z16A 2H1LA 3ENQA 1OGJA 3OQ1A 3LCUA 4U4AA 1XTVA 4MP8A 2IP1A 4HGOA 3LLCA 4M0LA 1E2JA 4Z4EA 1AKUA 3PHJA 4MQEA 1UG7A 2IKSA 1BMFD 1CS4C 3I3OA 5FTMA 1AN9A 2B0HA 3VTAA 4HEA1 3T4EA 4PJMA 5B1EA 4DMCA 4YRRA 1S02A 5FPKA 4OQ4A 1E96A 3DHWC 5D8DA 1O95D 2NOAA 1KEWA 3V8QA 1US8B 4EHFA 4RPKA 1OX6A 2F8TA 2K7ZA 1G2IA 2HFJA 4YT5A 3KU1A 4R01A 3RIEA 2CNWD 2PFKA 3QE3A 5AVVA 1WCV1 2WG2A 1XD9A 3N3AC 2PH5A 5DIFA 1P61B 1BX1A 3QRWA 4HWOA 1VG1A 2C9DA 1I4WA 4B80A 3Q5DA 1LPBB 1DKLA 3KSAC 3HRKA 2QORA 1TCBA 1G21A 3RC1A 4LTNA 1TPZA 4G9GA 1OQCA 1C7JA 2C77A 1PJ2A 1ZP6A 3STXA 1AQYA 2W2VA 4IILA 4KITB 5AVKA 2GAJA 4G4SO 1G8XA 3GO4A 1E1LA 3ZWNA 4Q5IA 4FS3A 2PYZA 1ACMA 1WSAA 5EWMB 1N9GB 1DTWA 1QYCA 2AI2A 1Z2DA 1DX6A 1NRIA 1EFPA 4F2DA 2Y9MB 4QQKA 3KSMA 2A7QA 1UPFA 4PNZA 2JD1A 3F8SA 1IK6A 2PMWB 3A6JA 3EDCA 4HNAA 4LHWA 5DYGA 1VA5A 4PGFA 1BGVA 4TYMA 3PXCX 4ZZIA 4O7GA 5HTKA 5SICE 4ALKA 1ULTA 5H59A 1NPYA 2O57A 5BYBA 1C3EA 4AROA 4MWBA 5DBGA 1RHJA 3Q9UA 1RVV1 4ZOAA 2VRBA 1BN6A 2HSQA 1K0FA 3TLBA 2VWGA 3JQ7B 2XR1A 4BJ5C 1R0KA 3G8CA 2PKRA 4TVOA 2R00A 1Y0BA 2DT5A 5KJEA 2G9ZA 3GL9A 2Y05A 1SCNE 4J90A 5DGXA 1SCJA 1E5VA 4PVDA 1SGWA 2B9EA 2DJ5A 2M6SA 2XB9A 4PQGA 6NULA 4RA6A 4LXXA 3U80A 1P6UA 2HRZA 3CNNA 1U8FO 3P4XA 2QTVB 2ZIEA 3BFVA 4MUGA 4LV8B 2ETVA 4I2NA 2I3DA 4JB8A 1FMWA 3FNFA 3K96A 4E5KA 1DJMA 2A59A 5AW3A 3WFZA 3E1SA 3H11B 4GG1A 2Y69C 4OVKA 2DFKB 1Q7RA 3CLRC 1IB0A 1ZW3A 3MWGA 2HSGA 2ZS7A 4P6VF 2XDAA 1Y7LA 3EUFA 2PGJA 2ZYDA 3LNTA 2WJ6A 3U8PA 2Q2VA 3TLGA 1RFLA 1CIVA 3TTTA 1IUOA 1EGQA 4BKPA 3OFNA 5EKSA 2VJYA 3B6MA 3QW2A 1E20A 1MX3A 1Q95A 2ORIA 5IBRA 3T7SA 3PFIA 1II0A 4BWFB 1QR6A 4BLTA 1CLUA 2Q45A 3RREA 2P9GA 1P4HA 1H0KA 1JDTA 2VF2A 3ROMA 1T2EA 1J9GA 3RTGA 5KJCA 3QPBA 2I3BA 3IIKA 1THMA 1IZZA 3OLXA 4BLOA 4ZU6X 4FDVA 2LCQA 5KNLA 5HX7A 1BCSA 4EPYA 1Z7Qc 2H7CA 2O2HA 2H0QA 1J33A 3ETHA 5ALRA 5HJ7A 1J9EA 2RDMA 1IBMB 1EP1B 3H42B 3GLIE 1U8AA 2CCJA 3OZAA 1TC2A 3VPAA 3QXXA 3IKVA 3WKAA 5AK0A 1LV8A 2C5BA 1T2VA 1FDTA 5ER6A 3PSHA 5EE0A 1AKTA 3F6CA 5IDXA 4XSHA 4HO1X 2O4CA 4B09A 3WJ7A 3AF2A 4FKBA 3IVRA 1G7SA 1HA3A 3VV3A 3E8SA 1M5RA 3R7BA