2QY9A

Structure of the ng+1 construct of the e. coli srp receptor ftsy
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
300
structure length
300
Chain Sequence
FARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E. coli SRP-receptor FTSY contains an essential and autonomous membrane-binding amphipathic helix
rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords Cell division protein ftsY
total genus 115
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2qy9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qy9A02
2PL3A 121PA 4Q9JA 4F7WA 2ZSEA 3BFXA 4QBFA 2PZEA 3UMRA 4C9BA 1EGAA 3QKTA 4BLTA 3TMKA 1HTWA 2OT3B 2F43B 1T8TA 1T91A 4A92A 4I1OA 1HT2E 3ZZ0A 2ZROA 2NMVA 5FPKA 1O87A 1FP6A 5E4FA 1PLLA 6Q21A 1PZNA 4LOAA 2IA5A 5G3ZA 5E3HA 2IK8A 1HEIA 1B23P 3TSWA 3LNCA 2XZPA 4CEJB 4A0FA 3LWNA 4Q1DA 4B47A 1OIXA 4CGZA 3VNUA 1Q3TA 4IVPA 4L9SA 2YZ2A 5HZHA 2ZJZA 5E7MA 4QHYA 1E9RA 1E32A 1P9WA 2ZI6A 4CEHB 2IYTA 3PENA 3CIOA 4BFSA 3MSXA 2ZYUX 3WBJA 1A1VA 1N3BA 2W6ID 1T6NA 3MWYW 4LY6A 2P0EA 3TQCA 3U6BA 1S9DA 2XB4A 1DOAA 2OXRA 1AKYA 2GZHA 2QGZA 3CR7A 3EIQA 3QVUA 1E79D 1N6NA 2ZRMA 4M53A 3KQHA 1E96A 2ODBA 1RZ3A 4NYMQ 3W5JA 4LJ7A 1P73A 1ZINA 3OEHD 2F1RA 2N46A 5FBLB 2HT1A 5CIQA 1EXMA 1G7CA 1X6VA 2GDJA 2GETA 5P21A 2QP9X 1P7CA 1T9HA 4HZUB 4EJSC 2YV5A 2Z4SA 3SOPA 2QUZA 1V5WA 4BFYA 1XMJA 4QJ4A 4A2WA 4YQFA 2IS4A 1NN1A 4F4JA 1X3SA 2OESA 4TYPA 2ZU0C 1CTQA 2ZANA 4ABYA 4AY2A 4KITB 2R2AA 2YWGA 4A1FA 2QP3A 5JFGA 3KUDA 3THWB 2AL7A 2YWFA 3DMDA 4F92B 3FPAA 5JHGB 2OAQ1 3AF2A 4TLDA 4DT1B 4L9WA 4M1YA 2JEOA 2RGNC 1YZTA 2GBLA 4DCUA 2F7SA 2G83A 3ZH9B 2FPLA 1UJ2A 2JLQA 2WV9A 3EPKA 3LVRE 2DHRA 2ZUDA 4U7DA 2J45A 4P4UA 1M7HA 3RLFA 3RS4A 2ODWA 3EA0A 2VH5R 4EUNA 2P5SA 1PV4A 1E2HA 2JLVA 4NKRA 2O8EB 1P2VA 1ODFA 1DEKA 4L16A 3QXCA 3GLFE 5GJWC 2BEJA 3ZDQA 5FTJA 4I99A 5DI9A 2XJ4A 2WWFA 2WAYA 5G40A 1D2EA 3FOZA 1ZNZA 3CRVA 3NHAA 4GZMA 1S3SA 3QF4A 5D3MA 1AS0A 4MITA 1FL9A 2ONKA 4AIIA 3VX4A 1I4TD 1OIVA 3B78A 2BIFA 2ZJ5A 5L3SA 5CK4A 1U0HC 2ZJYA 3GFOA 1RKBA 4K46A 5FI0B 1IXRC 2GAOA 5L3QB 1FPMA 3CPHA 3L0PA 1YZNA 4RZ2A 4EPWA 3TKLA 4WAUA 1SZPA 4JS0A 4HLCA 3SI7A 2YKGA 3SYNA 4ITRC 1FX0A 5IRCD 4M0LA 4CT5A 4PR0A 4TT3A 1GNQA 2QEQA 2VRWA 3U3RA 1Q1EA 1Z07A 3NH9A 2FSFA 2ZRJA 3CWZA 3K0CA 1LB1B 4YONB 3U3KA 3ZZTA 4C0KA 5AUNB 2TMKA 4IDPA 1X8LA 3HJNA 2KJQA 4RFSB 1KJZA 1NMYA 2CXXA 3RHFA 5JEDA 4JLMA 1NY5A 2RHMA 3L82B 1N0WA 2PT5A 5CJPA 2WOOA 2AKYA 3QG1A 1WDTA 5L8VA 2QE7A 4B35A 4FMCB 3FMOB 3BERA 1FMLA 1NKSA 2YC2C 4HB2A 1UM8A 3T06B 5HE9A 1XNJA 4C30A 3P4YA 4URVR 3NG1A 2BMJA 4Q21A 2GK7A 1L2TA 3CWQA 2ANBA 5LD2B 1Z6XA 3CF6R 1TU4A 5LBIA 2E1RA 221PA 2ZI3A 4M1KA 2FF7A 1C4OA 4JVLA 1GM5A 1ZM4A 3RWOA 3A1VA 4RD2A 2FFHA 1EFUA 2WJGA 4H1VA 4TQUS 2ZUCA 1E2FA 1KDTA 4PO9A 4EFLA 4EFNA 4ESHA 1N5IA 2BWJA 1M2OB 4YDHB 2Q9CA 2GF0A 4D2IA 2WMOB 3EPJA 3OE7D 2KBEA 1F48A 1JECA 5EE0A 1WXQA 4JJZA 4G5RA 1D2MA 2GJSA 4M8NE 3THXA 1W7AA 1YR7A 3A4NA 3OEED 2YC4C 4FIDA 2QMEA 2HF9A 5AR1A 4TL6A 1N6HA 4M2LA 1NLZA 1HE8B 3M0EA 1E79A 1SQ5A 1OB2A 2BOVA 2W6JD 2B7CA 1ZP6A 2BHRA 3G0HA 3SJBA 1KDOA 1AQUA 2QTFA 4O2LA 2D7CA 4Q4LA 5TVKA 3D3QA 1Q44A 2ZRPA 4LHWA 4JSTA 2IWHA 4UJ3A 3KFXA 3WRYC 1NNEA 2QI9C 4C4PA 2PX3A 3CB4A 1IN5A 3SHFA 2HDNB 5DHAA 2C9CA 2H1LA 4E03A 4FMDB 2JGNA 3KXLA 4NZYA 1TF5A 5HR5A 3Q7PA 4RKFA 3A4LA 1S1CA 2FWRA 2W0MA 4Q48A 3W90A 1L4UA 1SHKA 4TMWA 1SVLA 1COWD 3WNBA 2P6UA 4F4CA 2IXFA 2A78A 4PANA 5FPYA 3WRXC 3ETLA 3I72A 4QBGB 1U8YA 4MRRA 3RAPR 5JLJA 5G53C 1XJ0A 2XITA 2DFKB 2JJ1A 3H86A 1TUEA 1XD2A 3AUXA 3WHLA 2BBSA 3T5GA 2AHOA 1ZM2A 3TE6A 1YVDA 1EG7A 4HAUA 3Q5EA 1G5TA 1CR0A 1KZGB 2QT1A 4EJSA 4RSGA 1W1WA 1P61B 5DN6A 1TTTA 1ZJ6A 1KJWA 1G41A 2B8WA 4W5JA 2WWXA 3NTUA 5JJKA 4MGZR 2PLFA 1RVDA 4EJSB 1FNNA 2H92A 4DDWA 4WXPA 3PEYA 4ZDIA 5C4GB 1R5OA 1WCV1 1G7SA 1A7JA 5AJYA 1R0XA 3KXIA 1IN4A 2ZJ2A 5JCZA 4M22A 4B33A 4XTRA 2RGNA 3DMNA 2LKDA 1CJMA 2DPXA 4GT1A 2QU8A 1RRFA 3H1TA 1US8B 2AR7A 3BH0A 4DB4A 4QM7A 3DZ8A 5TY0A 2HLDA 3B85A 4FCVA 3DM5A 3WNCA 4WOPA 2W2TA 2NO7A 2ZYTX 4U5XA 4URZR 521PA 4DKXA 4LJ8A 3JVUA 1X8JA 4AD8A 2YJTD 4JBWA 3R8CA 2BJVA 3IO3A 3LX5A 4D82A 2DB3A 4TTQA 1U8ZA 3UIEA 3ICEA 5KSYA 3JVVA 3C7KA 1TAGA 3MG9A 5AK0A 5TXGA 1Q0UA 2ZYVX 2EW1A 2AD1A 5J5CA 4PQRA 4Q19A 1W0JD 4Q4HA 5KDLA 3TW4A 1F2UB 4PO1A 1LS6A 4JKYA 2GK6A 2O8BB 3C15C 4P4SB 1A82A 3MJHA 3NWJA 4C0SA 3DEFA 3A36A 3ASZA 3FYHA 4QFMA 4DT1A 1R6BX 2AWNA 1J2JA 5FUWA 1ZBDA 1W0KD 2PX0A 3H2YA 1U2RA 5TB5A 4NH0A 2EFGA 4AC9A 1FTNA 1GL7A 3K0CC 3AKCA 3VHXA 4BLQA 3F3YA 4NU0A 4LZZA 3I8SA 5KDOA 1LS1A 4JLNA 5DE3A 4FINA 4B6EA 1P60A 4OHVA 1U8AA 1E4VA 1ZVQA 3LX8A 3S1AB 1R0ZA 1MV5A 1NBMA 2OBMA 2VBCA 5FTMA 5FL7A 1G5RA 3PVSA 3Q5DA 5TMPA 1F2UA 2ZSBA 4DCVA 4KVGA 3PUZA 4GP7A 2QE7D 4JL8A 4P4SA 2YWHA 2Z43A 1AS3A 1FP7A 4DLRA 2HUPA 2DCUA 4HUTA 2XB2A 5BXQC 1JEDA 1WQ1R 3LAWA 2ZRHA 4D4JA 4DJTA 3CF0A 4V0MA 4EQ6B 1E1QA 4LX0A 4OJQA 2BM1A 3GJ8A 4ERNA 4N0DA 5DIFA 2GHIA 4TLCA 4G5SA 3T34A 1QDEA 4D0LB 2MSEB 5B2ZA 3R9IA 1S1MA 5E95A 1T0HB 2NOAA 2IF0A 3AVOA 5F9FA 4Q02A 2J0UA 4TWZA 2QY9A 1CU1A 4Q4JB 4DSUA 1XTKA 1G64A 4PPGA 5EP1A 3U61B 1QZXA 4W9MC 3QSYA 1E2JA 2GKSA 2CMKA 4JYBA 4M1SA 821PA 2WWIA 2NG1A 4HLQB 4X8MA 4YMVA 2BKUA 4AG6A 2MSCB 4XJXA 1KI6A 1SVWA 3TSZA 3IGFA 5LPNA 3ND8A 2V9PA 2OBLA 4A4DA 4IOJA 4JT2A 1GP2A 3HPRA 4LV8B 4GDFA 2Q21A 3IEVA 2J7PA 2VF7A 4QXAA 2CL0X 2XNSA 2RKOA 3BH7A 4M9QA 1KAOA 2EFEB 1A5TA 1QHXA 2ZREA 1UBFA 2P3SA 3B9PA 3V00A 1G5PA 4CZ2A 3NEJA 2CK3D 2DR3A 2J5XA 5JBQA 1XBTA 4XVUA 3VHLB 3W3ZB 4PHTA 1FZQA 3VMFA 3REFA 3B5JA 4JIMA 2BMEA 2PEZA 2HLDD 1FQJA 1W5SA 3HR7A 5TDHA 1I4DD 3KQKA 1OFUX 5SZHB 1CJKC 4EPRA 2EWVA 4ZDWA 2IYLD 3D7MA 3K8YA 1MO4A 2PJZA 4KSCA 2R62A 621PA 1R10A 1GILA 1YQTA 2A30A 3VQTA 4B75A 3U5ZB 4MKFA 2E87A 1KGDA 2RGAA 1YRAA 3CH4B 4LI0A 3MRSA 2JJ8A 4KCGA 1RRPA 4MKHA 1H8ED 3L0SA 3EASA 4IVRA 4TLEA 4IOLA 1VCOA 4D25A 1TEXA 2A5JA 2EWWA 2J7KA 2UKDA 3QE0A 4LYHA 4OJKA 3ZVLA 2JLXA 4A0HA 4BLPA 1XMSA 4CF7A 1G7TA 2RB4A 4DEYA 1D6JA 1MOZA 1OV4A 4JZKA 2H7VA 2H8KA 2J0VA 2ZRFA 2B8TA 4BE7B 1E2KA 4KLZA 1RRCA 1JPJA 4BLSA 1XD8A 3O8CA 3O8DA 2IYSA 2B21A 1GKYA 2G9NA 2K5UA 1E98A 3GFTA 2V4ZA 2HXYA 3PEVA 2FGJA 5DI3B 1WMSA 3A1UA 1VCIA 1GUAA 3ZVMA 1XPRA 3OIYA 2SHKA 3TK1A 4ZIRB 3GP8A 2P5TB 2ZI7A 2JLRA 1UBEA 4DLYA 4TLBA 5F2EA 3K0FA 2X2FA 2WIBA 5HZKA 3GLFA 3THYA 4CEIA 1Q1QA 1ZNWA 1ZC3A 3NVAA 2GZAA 3VNVA 1G4AE 5KNBA 3SFZA 1N6OA 4JT4A 4MYTA 2UVQA 3DKVA 1IAQA 2ZRIA 3QVVA 4PC7A 4BQSA 4RVCA 4LDJA 1K5DA 4DCNA 2IX3A 4Q9IA 4DLXA 2YVUA 1MKYA 4MRPA 3DPUA 2XNDD 3B1ZA 4CIDA 1W36C 1R8QA 1G8GA 2CE7A 2XNDA 1W48A 3WYAA 1AGPA 1QF9A 1A4RA 1Z5ZA 4R2HA 2VSXA 1E4YA 4P32A 1DS6A 4C3ZA 5KHOC 2O8CA 2F9MA 2D62A 1QHIA 4DC9A 1IQPA 2XSZD 4L4UA 4DVGA 5J4YA 3RWMB 3VTKA 3A8TA 3QBVA 2IXEA 2CL7X 4JLKA 4MGYR 3I61A 2BC9A 2CE2X 4XSHA 3HR8A 5CJ2A 1VYTA 3NBZC 1E9CA 3UANA 2F1JA 2IYZA 4B74A 2Z4RA 3RNLA 5FI1B 2ZJAA 4OQMA 3CKLA 3M4YA 3Q72A 3QOFA 2QBYA 1RJ9A 3I92A 5FOWA 3M6AA 3TAUA 3K0EA 3IPXA 1JALA 3FMIA 4FCTA 1N2CE 2QSYA 2HCBA 1N0UA 3FKSA 3TVTA 2XEXA 3BAFA 3SHWA 3B1XA 2GCNA 1M34E 1OH8A 1AZSC 5GADl 3Q3JB 3PUWA 3FHCB 1DTSA 3FKSD 1KK2A 4M1OA 4W5WA 1CLUA 4N0EA 2WJVA 1G3MA 4NCJA 1R8SA 5EP2A 3UXMA 3K70D 3A1WA 1NKTA 4Q9HA 3NC1C 4Q1BA 2UZ3A 1JNYA 3QXJA 2ZAOA 1SVKA 2NIPA 2VA8A 3KKNA 4UJ5A 4OI1A 3FE2A 3K0AB 4IDHA 2Z5FA 3KJEA 3K0AA 2QBYB 1Z08A 1GL6A 2O0JA 4NCIA 2ZVPX 2VLIA 2IWRA 1AGRA 1H65A 1KTVA 1PVOA 4XVRA 1QHHB 2MSDB 4RZXA 1E2MA 2WWGA 4EDHA 5C1BA 1E2QA 1DAHA 1KI3A 2CEAA 2VP6A 2IYRA 3ZS9A 1TQDA 2FE4A 1IY0A 1KMQA 4DDTA 2QL6A 1Z63A 2JDIA 3NBFA 1Q3HA 1GFIA 4B2IA 1KK3A 4FWIB 1EFRA 1CEEA 3U4QB 1XFAA 5IDVA 2H16A 4WXRA 4RKEA 2I4IA 5DISB 4C0HA 2RGXA 1CJUC 4KYUA 4HAVA 1DG1G 3B1VA 1NJFA 2NPIA 2QQ0A 1E94E 3T12A 1XTIA 5JMTA 5F3WB 4BASA 3IIKA 3PXGA 2BVNA 2Q3FA 1EWQA 4JKIA 3AVWA 4LBVA 3IQXA 3GJ6A 2BBWA 3GEHA 1ZIOA 5DI3A 4GL2A 2GVZC 1F6BA 2F43A 3ZYCA 2V6JA 2V7QA 1LW7A 4IRUB 3SYLA 2WIAA 1OB5A 4PXAA 1M8PA 1NVUQ 4NYJQ 1G3UA 3IQWA 1OH5A 4NE2A 3EG5A 4D0GA 2GNOA 4LRWA 3CX7A 3EXAA 3F5FA 1SXJD 1DAKA 3EZFA 2R44A 4Q01A 2ZPTX 5FOSA 4BEJA 1YZKA 5KNDA 3A37A 4PPQA 5M04A 3RC8A 2FOLA 1GVNB 3AGQA 1LV7A 2KWIA 3MMPA 2O0KA 4R71A 1H8EA 1S4QA 1P2TA 2WAXA 4RD4A 1MT0A 1Z0AA 1GAJA 2ZRCA 4BFXA 1OE0A 2WKQA 3AB3A 3WMGA 2QN6A 3ADKA 1DO2A 4QJ5A 1CBUA 2J59A 2ZTSA 3GD7A 4A8JA 2ZIAA 3KJGA 3PITA 3TUZC 4UQOA 4POAA 3CR8A 3K0FB 3Q8XB 1VG1A 4Q4AB 5FFMA 1Z0FA 2A9KA 2JLYA 4UXJA 4E22A 5TARA 4AURA 3IHWA 2WBLC 1GL9B 2FX3A 3QKSA 4B43A 2ZEJA 4XWAA 1VCMA 2EYUA 2G0NA 4DSNA 4FXPA 2KBFA 1Q22A 1Z2AA 2FH5B 2GRJA 4DIEA 5FL3A 2ZSDA 2AWOA 4G3XA 1VG0B 3R20A 3LV8A 1E1RD 4IOMA 3B7GA 4LSGA 3OFNA 3SBEA 1VYVA 4RCYA 3TQFA 2A5FA 4MGKR 5E7IA 1DAGA 1ZC4A 1N0VC 1Z6AA 2WVJA 3QXXA 2GEUA 5F98A 5AUPB 1S3GA 1XD9A 5JS7A 2VHTA 4Q18A 3A4MA 2PCLA 3VKWA 2XTMA 3U7EB 1KJYA 2NGRA 4F38A 4YXWD 2IHYA 3FMFA 5CDFA 2OXCA 3SJZA 5A5GA 3KQLA 3T1OA 3ADBA 3DOFA 5CM8B 1ESMA 4TN1A 3BWDD 2ZAMA 3EIEA 4CDGA 1U81A 2LWIA 3GLIE 2R6DA 4E5UA 2QZ4A 1E9DA 4C0AC 3CZQA 3KKQA 3QKRB 4TYWA 4BFUA 1C1YA 1Z0KA 3IBGA 1IN7A 1X1RA 2QM8A 3FHTA 2ZU6A 4KXFB 1II8B 1U9IC 1CRPA 3UK6A 1G6OA 4KVAA 4LJYA 2IYQA 3ND9A 1NG1A 3IIMA 4G1UC 5FPSA 5HPYB 5CIWA 4IXMA 3Q7QA 1GNRA 3I5YA 4F91B 4BECA 4JLJA 4KFUA 3EC2A 2NO0A 4ZDKA 3OEEA 4QKQA 1EFCA 3DO6A 4XD7D 3MUFA 3K70B 3UWOA 1CKEA 2PH1A 4PSKA 2VSOA 3GQBA 1X8KA 1KSHA 2REOA 1ZD9A 1ZU5A 2HXSA 4HB0A 5CLQA 1FUKA 2GXSA 3U6KA 1U0JA 3T15A 2PMKA 2PZGA 4PQYA 1N6LA 1NY6A 1XX6A 1GITA 2B7BA 3TSOA 4KFRA 4KJZA 4XSGA 1Q12A 1HQCA 4GP6A 2WTUA 1TL7C 3PIRA 4CYMA 2FV8A 4US1R 1YR6A 2BEKA 4R2IA 5FTNA 1KHTA 2F55A 3HU1A 2Z0MA 3AF1A 3LW7A 4A6XA 5HCIA 4NCHA 1UKEA 2QQEA 1UKZA 2OM2A 4EQ6A 2V8OA 3QKUA 3R7WA 3NEYA 3LXRA 4GI7A 3U7FB 4DCSA 1NBME 2ZVQX 2CDNA 4MYCA 5L3RA 3TVDA 1OJLA 4L15A 4MUAA 2AK3A 4PSAA 3AP1A 2EFDB 2WPDD 3P1JA 1ZMXA 2I3BA 2LKCA 1EESA 3CM0A 4TMXA 4LHVA 4C7OB 1JAHA 1G3RA 2W0SA 1XP8A 4KI0A 3ZIAA 5J4HA 4HAZA 4RCZA 1P72A 5SZJA 4KHZA 1PLJA 4DRZA 4JBYA 5EP4A 2OG2A 2VHUA 4FMCF 3KKMA 3L8YA 4NP6A 4A6PA 2HYIC 2EFHB 1XXHE 2D4HA 3GLHB 3GLGB 2R65A 2J0QA 2CHVA 2C9OA 1NF3A 3KTAB 4OQLA 4IDNA 4DZZA 1AJEA 4LWZA 2FPKA 4PZYA 4PZLA 4ZI2A 2MMGA 2AFIE 2DYKA 4GNKA 1NLFA 1GWNA 3IILA 1W4BA 3D6TB 4C0JA 1LY1A 1J90A 1SVSA 2C9YA 4ON9A 1T4GA 3EPHA 4FMDF 4ZO4A 1T0JB 5IHPA 4O25A 2DWQA 3LFUA 1MABB 3NBXX 4A36A 1I4LD 5CK5A 5FOXA 3X1WA 4A8JC 2GESA 1XZQA 2NTYC 3AUYA 2F6RA 1NJGA 1NN0A 2WMNB 1KI8A 3X1DA 2RGCA 1BOFA 1GDDA 4DHEA 3SQXA 4PX9A 3R9XA 1D5CA 1HE1C 4GMDA 1SULA 3SDZA 4PPFA 4WVFA 4OQFA 3CNOA 2GXQA 3K9NA 4PSVA 3K9HA 3VR6A 5JI2E 2NZ8A 3FWYA 2XZOA 5CM9C 1UEJA 4L5BA 2GEVA 4TMTA 3F0TA 2Y8EA 4JVMA 3B60A 3T35A 1XEWX 4NYIQ 4QGFA 3K9GA 3QKSB 4TMVA 1GRQA 2IEYA 1QVAA 1NI3A 1S9HA 2DWOA 1U0LA 3BB3A 2XAUA 1F3OA 3BH6A 4M9SA 5KYKA 1OYWA 1KI4A 1XEXB 1XCPA 3VR4A 3D31A 3R8FA 1E2EA 1E2DA 2G88A 2ZUBA 4OHZA 1G17A 1AA9A 2HT6A 3UG7A 1WBBA 3CF2A 2J1LA 2VSFA 1WRBA 4CW7A 1W4CA 4GFDA 2WICA 5CB6A 1OH7A 1IHUA 4M9XA 5JEEA 4RD1A 3L0IB 4LJ6A 2OSBA 3UPUA 1OH6A 2R6GA 2RGEA 3FFBA 4TZ6A 1J7KA 5KNCA 3SFVA 4II7A 3O8BA 4IDOA 3SC3A 4HUQB 5FR1A 3HU3A 3KJIA 4DLUA 2B6HA 4G01B 4M1MA 4NDZA 3THYB 4NYJR 4TT3D 3S1AA 3KB1A 1H8HA 2RMKA 2ORWA 4H1UA 3I4LA 3GCGA 2QNRA 3U44A 1U9IA 2ZE6A 3EAQA 2PCJA 3W3AA 5UKDA 3TUIC 4AKEA 3G82C 3AF0A 5EE1A 1HY3A 1W4RA 4TYYA 1TQ4A 1Z83A 5KOYA 2G1KA 3VKGA 4URYR 1WBDA 2ZJ8A 4A0GA 3I1FA 1AIPA 1KDRA 3Q85A 1F60A 1XRJA 3O47A 4KLNA 4TL9A 4QGHA 1W46A 2YYZA 1E1QD 2XX3A 3WNDA 5CLLA 3V4RA 3HWSA 4AWXA 4IJMA 4OI4A 4GOXA 3AVUA 2H5EA 3EZ9A 3BJIC 2OFOA 3T1TA 3SS8A 2J41A 3PUXA 1N6KA 4MRSA 2FPMA 3GJ5A 4V02A 1G19A 2IYVA 2GXUA 1Z6TA 5JS8A 2ZRKA 1WB9A 2H57A 4RZUA 3F8TA 5KDDA 1E2IA 3MWKA 1IJFA 2ORIA 4WW0A 1N5LA 1CR4A 3BIFA 2J87A 3GMTA 4YMSA 2PJRA 1SXJE 4IEEA 4BZPA 2V3CC 3KFVA 4LC1A 1NIJA 3TRFA 5AWFC 2HJGA 2QM7A 4M1TA 3QF7A 4TSFD 1FX0B 1CJVC 3K9LA 3PG5A 4N3NA 5JSZB 4ZDJA 2B92A 4B2PA 2QRNA 5BYJA 4QHSA 1MH1A 4DLTA 2F3TA 3SQWA 4D26A 1W4AA 1NMXA 4DDVA 1JQLB 1E2NA 1IY1A 4UNRA 3CBQA 2AD5A 4YC7A 1KO5A 1TF2A 4FN5A 3OZXA 3LLUA 4B71A 2ZRNA 4OHXA 5EE3A 3ADCA 1S2MA 3SNHA 1XTQA 4MH0R 4YDSA 4YMTA 1RC8A 1FW6A 3EARA 4BWYA 4JLVA 3CPEA 2ZSFA 2ZS7A 3AM1A 5B58C 1LTQA 2QPOA 4WA7A 2WSSD 1Z29A 2IL1A 3PV0A 4Q7JB 1RFLA 4Z1MA 4B76A 1E6CA 3QEJA 5KSOA 1MO5A 2F1IA 2FZ4A 4NONA 2FEOA 4NMMA 3EZ7A 3NDPA 1RE0A 1KKLA 2OCAA 1LVGA 2A3RA 4Z8XA 3EC1A 3Q9LA 1U90A 2JLUA 1GZSA 2JATA 1NSFA 4RD6A 4D4LA 4BFZA 2EYQA 3C41J 2XGJA 1T3LA 1UAAA 4ZKEA 2G6BA 1PLKA 3LD9A 2Q9AA 1OLOA 4E09A 1Q1BA 3OEHA 5HTKA 4Q5IA 1HYQA 4JLOA 4C7OA 4KO8A 4DCTA 3EW9A 1QHYA 3VFDA 1P4SA 1AK2A 1J70A 1SXJA 2W2XA 4X8OA 4EAQA 3VR5A 3BC1A 3OHMA 1R5NA 2C8VA 3QEOA 4H9GA 1BMFA 3RRMA 1UDWA 1HH4A 2O0HA 1GKIA 2C5LA 4GZLA 4TQAA 1XTRA 2PZFA 5FR2A 2IUSA 5DSZA 2QSZA 4MUBA 2JIZA 3V4FA 5H8WA 4O0MA 1Z3IX 3RS3A 4V0KA 5C46F 3TLXA 1MRNA 1VMAA 3AVYA 3ADDA 3M1IA 2AN9A 5BW8A 2WWYA 4C0LA 5DLQC 1P2UA 3ZJYA 5KUTA 3MFYA 3AKEA 5AUOB 2ORVA 5AJVB 5ELXA 4Q66C 2WJHA 4P0TA 2GJ9A 5C2JB 3QPUA 2C04A 2FFAA 2IHBA 2RGBA 1L4YA 4A8JB 2O8CB 3LXXA 1EWRA 4BRWA 2RH5A 4OI0A 3RS2A 3HPQA 1I2MA 4HZUA 4Q47A 2X2EA 3TR5A 3BRWD 1CRQA 4EPYA 4HSEA 3QPVA 3TIFA 1OHHD 5GJVC 3I62A 3CX6A 1JAIA 4B3XA 1LF0A 5DGXA 1G9XA 1G8HA 5EXPA 4RY2A 1SVMA 4MYUA 2ZRGA 2IBMA 2LCFA 4PAMA 4HLDA 1Z0DA 1GOTA 3C16C 3TAHA 3MWLA 5K8UA 3CRW1 3B2EA 4V0ME 1JI0A 3ZD7A 1NSTA 4DLWA 3ZQJA 1J8YF 2AXNA 4OBEA 4URWR 3RDPA 5E7JA 3REGA 3U44B 3DHWC 2ZS9A 3IEUA 4ZIRA 2WKRA 4B2LA 1F2TA 4NBSA 4HDOB 4LCBA 5IK2A 2ZRAA 3JZMA 4LUCA 2FFBA 1U98A 4UXIA 5EUMA 1D2NA 2QAGB 1CF4A 1ESNA 5K8IA 2F3RA 2OEPA 1OKKD 1Z47A 1TU3A 4PPNA 4LHYA 2O8BA 3BFVA 2WWWA 4PC1A 4JJKA 3ZLJA 1LNZA 2QMUA 3NH6A 2QGNA 3GJ4A 4JL5A 4URUR 3WP1B 1OHHA 1W49A 1UDXA 1ZD8A 1NIPA 2D2EA 4EKDA 4QC2A 1J99A 2NO6A 2QPTA 3K1JA 3SR0A 1YU9A 1EFRD 1JJVA 2ATVA 3IKJA 1VYUA 4PAOA 3RSLA 3TUJC 2IS1A 4JVNA 4B34A 3ECCA 5J4VA 1EFTA 3KKOA 1E0SA 1UBGA 3X1ZA 4D4KA 4Q9LA 4KBGA 3QY0A 4TL8A 4BFTA 5H1YA 5ANRB 2JCSA 2QAGA 2ZE5A 4KSBA 1OXTA 1TF7A 2FN4A 4P33A 1R7RA 3ZVNA 2XOKA 3L43A 3K70C 3E5HA 1XMIA 4P4TA 1W47A 3U3MA 4PTLA 4D0NA 4K8OA 2FGKA 4OK5A 4C0QC 5KPDA 3GLIA 4QHTA 1P62B 4D4MA 1NVXQ 4XOIA 1E9EA 5EJEA 3K0SA 3FB4A 1P6XA 3CONA 3C5CA 1B0UA 4PC2A 2ZXUA 2CVHA 2CLDX 2FA9A 3L0OA 2P67A 5HCNA 3N2EA 4BEBA 4I1SA 1KK0A 2R6FA 4Q00A 2J7PD 2FU5C 2ZJOA 3GEIA 3AVTA 4CVNA 3L2OB 2QTHA 2VPPA 5AUQA 1ZAKA 4U00A 1BYIA 1XCGB 3KKPA 2C99A 3HYRA 1TNDA 4WBSA 1A2KC 4P31A 3LDAA 1KZ7B 5KPJA 1DELA 1D8TA 1P5ZB 2FMXA 3EZ2A 2OCYC 2EFCB 4PO8A 3C8UA 3QUSA 4JMPA 4KBFA 1NN5A 4UXHA 2FSHA 2QAJA 1JJ7A 2KI5A 1SKYE 1UKVY 5LB2A 1XDBA 3EWAA 2BBOA 3P4XA 3RC3A 2ATXA 4D80A 3NHBA 3CRRA 2RGGA 1SXJC 1R5BA 1VECA 4HB3A 4IOKA 2VHJA 3QXSA 5FTLA 3A1TA 1YE8A 2WKPA 3ZIAD 1OFIA 5FTKA 3VR1A 3K09C 2ZYWX 3HU2A 1P2SA 4XWOA 2OFXA 1NN3A 2OV2A 1E69A 1K8RA 2OLKA 3QNUA 2ODEA 1IN8A 1NP6A 3G5UA 3RSOA 1ZUIA 1N6IA 3NXSA 3SJAA 4FCWA 2CL6X 1VKJA 4WZBE 3WYGA 1BYUA 4CEJA 1AZTA 1G291 4ZCIA 4US0R 1OW3B 1XMVA 1P9RA 1VDZA 1YRBA 4I1UA 4JYCA 3W8NA 3I32A 1ZNXA 2OHFA 1VPLA 3RRZA 2JASA 1DPFA 2CK3A 1ZU4A 2CLSA 3BXZA 3OIUA 4NL4H 4BLOA 2IC5A 2YINC 1XXHA 3P20A 4JLDA 2ZJBA 1Q21A 1KSFX 1X1SA 1US8A 2Q0HA 3H84A 2NQ2C 2FSGA 4Y0AA 5DHFA 3PJRA 5F9HA 3W6PA 1BS1A 4Q1CA 2EVWX 3BFKA 4HAXA 3RVBA 4HAWA 1KSJA 1NL3A 2GXAA 1U94A 1YZUA 3B8HA 2YOFA 2VP5A 3QF4B 4LPSA 1U99A 5BYKA 1AQYA 3EX7C 5JHHB 1L7VC 1W0JA 3UMSA 1QRAA 1ZCBA 4Q4HB 4ACBA 1TMKA 3DDCA 2OBNA 4MQBA 2W00A 1JXMA 2VP4A 1II8A 4I1VA 5BN5A 4AKIA 3MLEA 4QGGA 2X77A 3BK7A 1EK0A 2NZJA 3WBKA 1LFDB 5EZ6B 2JJ2D 4ESVA 3NC0C 4X8HA 2V1UA 3DM9B 1IXZA 1E9AA 2I1VB 4KV9A 5IF9A 1JBKA 1IJEA 4Q4AA 3ZS8A 1E0AA 2REBA 3OIWA 4P3YA 4OK3A 1YR9A 4DSTA 4LBZA 1HV8A 2VP9A 4FD2A 4CT4B 4HYYA 3U2QA 4JLAA 3AF4A 1HURA 1DAIA 5IT5A 2Q9BA 3A58B 4XD7A 1RYHA 3FTQA 2GJAA 3IDQA 1BH2A 1CP2A 4XH9B 1YHNA 1KKMA 4B44A 2BBTA 5L3VA 2GA8A 4BZQA 4V0LA 3U7GA 3LO5A 1TX4B 2ZI4A 4Q7MB 3B9QA 3FVQA 1OFHA 4K81B 5JWHA 1VHTA 2QENA 2WSMA 4V0NA 1KI6B 1KI7A 5FUXA 2QAGC 2VIIA 1QG4A 1QBKC 3I73A 3WMEA 4G5GA 2ASEA 5DO9A 3LLMA 1PJRA 2IEZA 1W0KA 3BS4A 5DYIA 2N42A 3MCAA 3AVQA 3B1YA 3FFAA 3PQCA 3U7HB 3AH8A 2VEDA 2XOKD 4YMUA 1FOEB 4GOKA 5IK2D 1DVRA 1OYYA 1VG8A 4OQNA 1E0JA 1T3HA 2WJYA 2AX4A 5FH9A 2CHGA 1RYFA 1M74A 1M7GA 2A5YB 2FFQA 4IVQA 1YJ5A 3QG5A 4PQFA 1XB2A 4RD3A 2BCGY 4IHQA 4PC3A 1Z22A 4BRUA 3BGWA 3QPWA 1KYIA 4GPTA 4DUGD 5EUQB 1OT3A 3H0KA 2W6JA 2QROA 1ZM9A 2F1HA 3C14C 1DE0A 1Z6GA 1VCNA 2BMFA 5CYOA 3FHOA 1XEWY 3U4QA 2CCJA 3AVVA 2IYXA 4DLZA 2DY1A 2R9VA 1IONA 4A2QA 4BGDA 2JJ1D 5FOTA 5JI3E 3B1WA 3FDIA 3UWKA 4QM6A 5B57C 2D06A 3W8RA 2OE2A 2V55B 4MDFA 2ZETA 1XTSA 1Z2CA 1QHNA 2RAPA 5B30A 4DB2A 1JR6A 1J8MF 2EU8A 2PBRA 4NYIR 3WYFA 3N70A 4FWTA 2JA1A 5KSZA 1WP9A 1CXZA 2V7QD 3SBDA 2IS6A 2G0TA 1XPUA 4NPHA 1TUIA 2OFWA 2O8FB 2KB0A 4LJ9A 3B6EA 3K09A 4OI2A 3FMPB 1Z28A 3KXKA 4Z1MD 2OCBA 4Q7LA 4LGMA 721PA 1E2LA 1D9XA 3SN6A 4F93B 3I8XA 5FUYA 3ZVRA 1TEVA 1AN0A 1Y3AA 4PAQA 1ZM3A 1E1RA 4O3MA 2DWPA 3NKVA 1OSNA 3CRQA 2H18A 1R2QA 3LQRA 5AJXA 4ARZA 2UZIR 3TR0A 3LQQA 3RRNA 1UFQA 4HLUA 5EE9A 4QJ3A 1UF9A 4G0NA 1DADA 2ECKA 2ODNA 3GJ3A 3GFPA 3C5HA 1ZRHA 1E9SA 5HKKD 4N1AA 4TTRA 2DFTA 3U3OA 4XWKA 1IM2A 2Q6TA 4OL0A 4PHHA 5BN4A 3UMFA 3OAAD 5JRJA 1ELOA 3I5XA 3OESA 4Z51A 4KAXA 2P6NA 4GRAA 2VP2A 1WA5A 2AXPA 2GCPA 1D9ZA 2BV3A 1WGWA 3E70C 2QMHA 3CZPA 4DXAA 2G3YA 4B48A 5G3YA 2GVDC 4I4LA 5GJBA 3V9PA 2R6AA 4LJ5A 3VR3A 5KU1A 3GLGE 1Q57A 1NMZA 4TL7A 3PUVA 4KYIB 4D6PA 4WIAA 1F5NA 1G7RA 1SVIA 3SE0A 4IKEA 1OXSC 4JBXA 1VTKA 5EXSA 2QG6A 4NCNA 3VX3A 4PHFA 1E2GA 4Y0VA 3ZGXA 2OLJA 3OFND 4MA4A 5EQTA 1UPTA 2QP4A 4RFVA 1NVVR 3W34A 3ASYA 4MGIR 5LDDC 1G4UR 4OYHA 3KQNA 1ONBA 3B13B 4OK6A 4D81A 2GILA 4OKSA 2YOHA 2ZRBA 4JLPA 2JLZA 1MO6A 3QJYA 2V6IA 3AGPA 4JLBA 4YMWA 3U3JA 3R9WA 1TQ6A 2HYDA 4IFBA 4EFMA 1XPOA 5J47A 2GF9A 3LRPA 3AF3A 4AKHA 1FQKA 1JB1A 1XF9A 3TH5A 2J0SA 4PZZA 4B3DA 1E99A 4IFEA 1DARA 1XJQA 2GWHA 4DDUA 2J0UB 2JJ2A 2RGDA 3D8BA 2L0XA 2IUTA 4M1WA 1RJ9B 2RHDA 4KFSA 2OO7A 1KI9A 4Q4JA 2D74A 4QBIA 4LK2A 2VF8A 4TMZA 4AK9A 3HDTA 2WHXA 2V54A 1G3IA 2X19A 1DBSA 1G16A 1Z06A 4U02A 4ZPXA 5SZKB 5JCPA 1GKUB 1YZQA 3N5CA 4YXWA 3DZDA 2FEMA 1N5JA 3GPLA 2W83A 3KX2A 5JWRA 3FKQA 2GJ8A 5LD2C 3GJ0A 3MJRA 2ZI9A 2DBYA 2ZM5A 4Q1AA 2FJUA 4M21A 2OZEA 1AS2A 4QL3A 3THOA 4AYXA 1ZUNB 2YOGA 5TV2A 3LY5A 2Z6VA 2VHQA 3EZ6A 3IIJA 3ZQ6A 4DUGA 2ZRDA 2OUKA 4HI0E 2BCJQ 2ANCA 3MD0A 2VP0A 2VYFA 1G6HA 3CRMA 3IO5A 3SZRA 1KY2A 4QNRA 3W6OA 2WOJA 3X2SA 1KAGA 1ZYUA 3QQ5A 1FTSA 4PC6A 3IUYA 4LYJA 1E0KA 3OE7A 4KU4A 1OXUA 2O8DB 4AYTA 1G8YA 3IBYA 4FW9A 1JR3E 5FBQB 2AK2A 4JVSB 1XU4A 2P2LA 4Z8YA 421PA 3VR2A 4B3CA 4A0RA 1NG9A 2HCJB 2PMDA 2JLSA 5J4KA 3SU8A 1AKEA 4ZCMA 4S2EA 3DVLA 2A5DA 5LB4A 4HAYA 1HT1E 1GTVA 2P65A 3RANA 1DG3A 1SXJB 1G3QA 1JQJC 1OF1A 5AJWA 1II9A 3GLHE 1DO0A 4OHYA 4US2R 1W44A 1LF5A 1N6RA 1BIFA 5FPHA 1E9FA 1G8PA 1XEFA 2C78A 4MKIA 2JDID 1S0UA 3J81k 3R7WB 3DL0A 5JJLA 1MR3F 2W6IA 1R0YA 1YZLA 3TBKA 1OXVA 2J3EA 4UNPA 2C2HA 2FZLA 4LJAA 4LHZA 1YR8A 3A6PC 1S8FA 1YKSA 4UNNA 5KSPA 2XTZA 4R9UC 1QG2A 1XD2B 3H4MA 1IY2A 4QOSA 1SVOA 1NRJB 1E2PA 1FMJA 2VHCA 2FSIA 3SJCA 4TTPA 1TPZA 3BBPA 5EP3A 2GZDA 3CH5A 1CR2A 3QENA 4YLGA 4B3BA 4GOJA 4GMXA 1OIWA 2I1QA 4EIWA 4A9AA 1FUUA 2CHQA 3AEZA 4X8LA 3RABA 1NLYA 4B73A 4ZV4A 2D7DA 1DAMA 2QT0A 3HP1A 1QVRA 1JPNA 2OAP1 4DEXA 1YZGA 5FBRB 3GEEA 5J40A 1PUJA 4I81A 1P9NA 1ANKA 4ILEA 1BMFD 1KO1A 1RRGA 4HLUC 2OILA 5D3QA 5FBVB 2RCNA 2Q3HA 1C9KA 3WHKA 2ZR7A 1R4AA 1GNPA 1E3MA 2BDTA 1M1YE 1JR3A 2O8EA 2WJJA 4BUJA 3TGPA 3LVQE 3LA6A 4HATA 5SZIA 1VIAA 3AKDA 4M9ZA 1R0WA 5BN3A 3TW8B 4MRVA 3AQ4A 2O8FA 1T3SA 1EX7A 2D3WA 3MWJA 2X1VA 2FDCA 2HEIA 2R8RA 3GLHA 1EX6A 1VHLA 2CBZA 4NTZA 3CO5A 1KDPA 4RJLA 1W36D 3OAAA 2R6CA 1XCMA 4Q1FA 3JZAA 3CLVA 4JSYA 2GTPA 2XSZA 5J4LA 2ZI5A 2XTNA 1CJTC 1KOFA 3CNLA 2ZQ5A 4G5QA 3I3SR 1O3YA 3LH5A 1ZNYA 2GCOA 2VQSA 4R98A 2HV8A 1Z6YA 1MRSA 1VIYA 5BQ5A 3AP3A 4LYFA 5CB8A 2ONJA 4J0QA 2FNAA 2WWHA 3AKYA 1G20E 4MRNA 1RW4A 3P26A 5B64A 1FFHA 2QA5A 4EPVA 2IYWA 1IBRA 4RFSA 2ZITA 8OHMA 1GSIA 4PHGA 2E9SA 4A82A 3OF5A 3IPYA 4V03A 1G21E 1GG2A 2BJWA 1NBMD 2GJKA 4HDQB 1IXSB 4C2UA 5GVSA 1WF3A 2XXAB 4CRWB 2CJWA 2NO1A 1ZW6A 2BKEA 1QHGA 5EXTA 4Q7KA 3PEUA 4UNSA 2QTVB 3AVPA 3P32A 4Q03A 4LJ4A 1SHZA 2IUUA 1IOZA 3CX8A 2N1BA 4MYHA 2Z83A 1XTJA 3X1XA 1N6PA 4QNMA 2WZQA 4WZ6A 4BPBA 4BZXA 4TYNA 5C4MA 2C95A 3N2IA 1NVVQ 4W7SA 4XVQA 2REXB 3EIHA 3OIVA 4LPKA 1AM4D 1KO7A 4OQXA 3KQUA 3K53A 3WXMA 2WPDA 3LBIA 3KUCA 3SEAA 3EPLA 2YWEA 3SYKA 1GRRA 3VKHA 3A1SA 3KJHA 4ACAA 4PFSA 2IXGA 1BO6A 2KSQA 2J9RA 4L8GA 2A5GA 1G8FA 4EPTA 2ZSAA 2BMDA 4QRHA 3RRYA 2EQBA 4HEJA 3W5IA 1OFTA 5JRZA 3GJXC 3PCRB 3UATA 3VU9A 4DSOA 4DLSA 2W58A 2ERXA 1T5IA 4MDEA 3AV0B 4HDCA 3ZZUA 1JEEA 2ZR9A 3VU9B 3ICQB 1UADA 2FG5A 5HE8A 5JZVA 2C96A 4JL6A 1TADA 1QHSA 5DNYB 4LBYA 3IHLA 1PUIA 1CR1A 1HQYE 4DBLC 2ZR0A 3LW8A 2PLRA 2A2ZA 1M6NA 1MABA 5CYPA 2NO9A 1ZIPA 5K8TA 4NYMR 3KB2A 5KTYA 2G1JA 1T5LA 4UNQA 4RZ3A 1N25A 4B6FA 1K5GA 1QHHA 2IS2A 3KZ1E 1Z0JA 5AJZA 5A0FA 2ZE7A 1HA3A 2OCPA 3GLFB 3KTAA 2CCGA 1NVWQ 2CVFA 1W5TA 5GJCA 2XZLA 2XJ9A 1HUQA 5JSZA 1ETUA 4ZCLA 1KNQA 4IDQA 1JXOA 5H70A 3T1VA 1XJCA 1RIFA 1ZD1A 3PUYA 3NDBB 3CPJB 4QBHA 4GBMA 4ZKDA 5A4JA 4DIDA 4F4IA 2JIZD 2BM0A 3AP2A 4V0OA 4NCKA 4ARZB 1Q1ZA 4TMKA 4AG5A 3HYTA 2IT1A 1KK1A 3NBYC 5FUVA 1S96A 1EFHA 2ZRLA 5H68A 2GEDA 4URXR 4IEIA 4QGAA 4TQ9A 4CEHA 2QRZA 1W2HA 2VTKA 1DAFA 3W9YA 2CNWD 2WM9B 3UG6A 5DN6D 2IW3A 4XTCS 2X8AA 1XXHB 1KSGA 2QMOA 3BORA 2C03A 3BD9A 4FMBB 2C98A 5FOVA 2AKAB 1Z8FA 4HZIA 1WE2A 4TYQA 1E9BA 1KMHA 4KFTA 2CCKA 5K8LA 4CEIB 1VG9B 3GLGA 5JJIA 5CITA 2CLCX 2G77B 3QBTA 3T5DA 1UKYA 2CJWB 2XXAA 4AI6A 3C4JA 1KMHB 1KI1A 1W36B 4UKDA 5L3QA 5GVRA 2ERYA 3B82A 2O5VA 2JAQA 5G41A 4AYWA 2YHSA 3LBNA 5L3SB 4A2PA 2QPAA 1XWIA 2Q3MA 1W2GA 1KY3A 2DFNA 2H17A 2HJVA 1JR3D 2CNWA 2IYYA 1CULC 2GBLC 3KL4A 4RD0A 1SKQA 2GCOB 3E1SA 4HUQA 3RS7A 3E2IA 4IXNA 3RS0A 3P27A 4Q1EA 3FGNA 1OXXK 4FI3C 4M4SA 2VO1A 3WY9A 3PEWA 1OKKA 5FL7D 4DWJA 1N5KA 1CS4C 3NIBA 2F9LA 4TZ0A 4IW3B 4E07A 5JECA 4KODA 3MGCA 1SGWA 1BKDR 1T8UA 5FPTA 2W2VA 1XEXA 4LYAA 1H8HD 3ONWA 2KE5A 2C77A 3BOSA 3QIAA 4LV6A 1A2BA 3THWA 3RYTC 4LC0A 5FBWB 2MMCA 2J46A 1ZCAA 4C0BA 3LBHA 1MO3A 5DH9A 2GAAA 1G18A 4W5HA 2DFLA 3WMFA 2IF2A 4LBWA 1CIPA 4LV5B 1X86B 2QORA 4LHXA 5HKKA 4TLAA 2IYUA 1M7BA 1P75A 1DAEA 3TNFA 1Z0IA 1I2DA 3QI2A 4G5OA 4NHOA 4MKGA 2JLWA 4B3GA 3U60B 5EZ5A 2V1XA 1K6MA 3EA5A 4Q9KA 4A15A 5CDFE 1ZM7A 4XIGS 3RS5A 1IN6A 1II0A 5D3MB 5DYGA 5EXXA 3TJZA 2P6RA 4AKGA 2AFHE 4B32A 2A7QA 1L8QA 1ZUHA 3ZD6A 1SKYB 2ZS8A 1GRNA 1GIAA 2YNMA 3GLIB 1KNXA 4DLVA 4S35A 1V43A 4QG7A 3O8RA 2D2FA 4GSYA 1UBCA 3PR1A 4BFWA 4OHWA 5C18A 1XZPA 1Y63A 2PT7A 3DKPA 1G1MA 4C2TA 3QKRA 1KO4A 5EE5B 3L8ZA 1Q20A 3PFIA 3DOEA 3X1YA 4HB4A 4B3FX 4EPXA 5FOUA 4ZI3A 3CUEF 4O2RA 4Z54A 4TSFA 1F2TB 1COWA 1KO8A 2PEYA 2O8DA 1TQ2A 1P3JA 5KO2A 2WJIA 3GJ7A 4BFVA 1FNMA 4WZAE 1OPXA 1KI2A 5JWOA 3CNNA 3CW2A 5BWMA 3W6NA 4ASUD 3T1QA 3QXHA 3EWSA 3UKDA 3T61A 4BLRA 3BB1A 2O52A 1RPZA 3MAAC 2ZE8A 3BE4A 3BB4A 2HF8A 2NPFA 2WSSA 3VAAA 2VL7A 1UEIA 4R7ZA 4ASUA 3AVXA 3THXB 3WP0A 3KDSE 1KIMA
chains in the Genus database with same CATH superfamily
4OF4A 3ZHRA 4Q9JA 4BB5A 4DDMA 2D2VA 3BFXA 3QJ5A 1B43A 5IAJA 2XUQA 4GDMA 1EGAA 3UMRA 4BLTA 3TMKA 5D91A 4JLSA 3Q7RA 1Z2PX 3HLKA 3EGXB 1L3IA 1T91A 1T8TA 2MINA 4WNCA 1GG8A 1D6SA 4I1OA 1I5EA 5LQNA 2POCA 3DAHA 4G0OA 4AN1A 1FP6A 1ZJ5A 3V3KA 5I4CA 1UBMS 1Y98A 1PLLA 4ISCA 5JZBA 3ZV3A 4R3NA 4X65B 2HNBA 2IK8A 2OMKA 3C8HA 4RHEA 1QC5B 2UVDA 1Q7BA 5KYXA 2H4FA 3M6WA 4FYJA 1CJCA 4P2GA 5FLKA 3LU1A 3V8BA 1B23P 2R7LA 4IUDS 1Q50A 4Y98A 1JMWA 4N5DA 1V9LA 4QXOA 4LZAA 1OIXA 4B47A 1W52X 4CGZA 4WWHA 3DT8A 3VO8A 3UC5A 3HDHA 2ZJZA 1CPQA 2VQ6A 4RCVA 1P9WA 8MHTA 2O6HA 4GQAA 4HOYA 2FG7C 4I3MA 3K1TA 3MBKA 2O1SA 4BFSA 1ZHZA 3A3KA 5LC1A 3D4IA 1NXVA 1KZ4A 5TE9A 4I08A 3LPCA 1WSAA 1Z2EA 2OXRA 2ZXRA 3EIQA 4MWCA 3E9MA 2OKGA 5DHSA 5CA1F 5GZ3A 3G68A 4U39A 2JEZA 2ODBA 3US6A 4KE8A 4LJ7A 1V26A 5AKHA 4IILA 5CIQA 1JHYA 1T6BY 1EVQA 4IHJA 5A5VA 4UUPA 2QSUA 1B68A 1JX6A 4HZUB 1T9HA 2Z4SA 4L9RA 4S1NA 3IQIX 4CJOA 1B8PA 1MQ8B 3ML1A 4QTUB 1MZPA 2QV0A 1WDWB 2JD0A 3HZZA 3OM1A 2IS4A 3EG9A 5ERXA 1SF8A 1OPRA 3RD5A 1YS1X 2AFIA 2ZU0C 3MLGA 1CTQA 1LBIA 1YJQA 1LEHA 2ZANA 4J49A 3TRKA 4JCZA 3AFOA 4RF2A 4A1FA 2PL5A 3ZW8A 4D9KA 2VZ9A 3ITFA 4LF6B 3K0KA 3PA6A 5JHGB 3U7GA 4M8KA 3HZOA 1BW9A 5DQTA 1TT5A 2JEOA 2RGNC 4DCUA 2GMWA 1HDEA 4JROA 1UJ2A 1K4KA 4NQRA 3G9XA 3ZSUA 1JA0A 3DHVA 1PNTA 2DHRA 2Q6LA 2UDPA 4Y9UA 3PIDA 3VR0A 3K8ZA 3S40A 5KQPA 1M7HA 1VOTA 1XRQA 2O1XA 2CXOA 2IODA 2VH5R 3L8DA 5KTSA 1E2HA 1U3GA 1CC1S 3CSUA 4JP2A 4QPZA 4Q12A 3TQTA 2Q7XA 1DEKA 2QLBA 2XODA 4G81A 1YA7O 3GJRA 5GJWC 5CBPA 1CQIB 1JG1A 3KS9A 1JLRA 4HGYA 5FTJA 4UBOA 2O3JA 2B4QA 2NZVG 5LUBA 3T5PA 1XQ1A 1ZNZA 1N2ZA 5K8VA 3NJRA 4MITA 5EA2A 4AY3A 4QTTB 2AMYA 3VVLA 1I4TD 1KEPA 1OIVA 2ZBUA 4D79A 4P9FA 4R9SA 3P19A 2BIFA 2Y77A 3UANA 3IR6A 4E6EA 1FW8A 4R32A 1U0HC 3GFOA 5L3SA 1CLEA 1RKBA 3GEGA 3IRVA 4MVYA 3RQSA 2GCIA 3VYTB 1YBFA 1QG6A 2GAOA 2X58A 3N0TA 1T5SA 1ZGGA 1SIBE 3BTOA 3M3HA 3Q2IA 4ZICA 4QUDA 3UNGC 4CS9A 4RZ2A 1GFWA 5LWHA 5CA1A 1YAHA 3DL4A 3DZHA 1OLUA 4W99A 4WAUA 1N9GB 1CFZA 4JS0A 4DA8A 2PGAA 1IK6A 2FQYA 3R5FA 2JFGA 1NBEA 1O03A 2VDLB 2WKWA 3GP3A 4M0LA 1WTCA 4BPMA 2VF2A 3GL9A 4ALLA 1Q1EA 1ZK3A 1OAOC 3JWIA 4YONB 2D1RA 5F35A 4C07A 4NOMA 5I7UA 2TMKA 4IKPA 4IDPA 1E63A 1QB7A 2W2QA 4LVCA 3TR6A 1UC4B 3OZAA 1JKJB 5JEDA 5ED4A 4HQOA 3B5IA 5A7HA 4OFBA 1L4BA 1NY5A 3A1DA 5K20A 1O95C 3JARA 1N0WA 3DE0X 2PT5A 3ICCA 4EGCB 5CJPA 1QO0D 1QQBA 3C8ZA 3RQIA 2VP3A 3HJTA 3UJ9A 1F14A 2Y1CA 2E55A 2CW5A 2IIBA 3OX1A 4XJSA 4BFCA 2MR5A 4B35A 3T9BA 3MLAA 3FMOB 2YYSA 1YK1A 2YC2C 2ZXEA 3EQZA 4QYWA 4W6QA 1YVEI 1AKUA 1L6RA 5FEMA 4C4AA 4ZEVA 1TUGA 2BMJA 4Q21A 2GK7A 2E82A 3DXXA 3U4DA 3VNBA 5LA6B 5T6MA 3W5HA 2E1RA 5E6SB 1XPJA 1TUBA 221PA 2WG2A 4M1KA 4DBZA 3BSFA 1IY9A 3VSBA 2YN4A 2EHDA 4XB2A 3A1VA 4ARVA 4NK4A 3RIEA 1O3UA 4W8HA 4PJNA 3WO1A 1N5DA 4ISBA 2X13A 3T6JA 1N5IA 3KQQA 1SNYA 1M2OB 3JWGA 2B4KA 2G5TA 1IBCA 1MTOA 4YJDA 1ONPA 3EPJA 4Y9RA 2KBEA 1C9NA 4JB3A 1F48A 4FZ3A 2BGWA 2JRLA 1P44A 2GS9A 2P1DA 3B6ZA 3HCAA 4EELA 4EEKA 3J7AC 3H99A 3F47A 3QELB 4ZGWA 3M7IA 3A0RB 1MQSA 5EQDA 3ADOA 5A6KA 3A4NA 1U0NA 5K0GA 1PBNA 4FIDA 4ER5A 3ZDEA 4OOEA 2PKWA 5B7NA 4E0IA 1NLZA 2JGFA 1CFJA 3M0EA 1OB2A 1SQ5A 2B7CA 2BHRA 1TD9A 2ZUUA 3GRYA 2PQ0A 5IAEA 3UK2A 1BCSA 2O0MA 1ZN9A 4GYYA 2XVZA 4CQMA 3AT1A 3GRFA 3HA3A 4B87A 1K0FA 4UCFA 3SM3A 1KRWA 3O95A 1B6GA 4YJKA 2P9GA 2QD4A 3BRCA 5JALA 1VJ1A 3WRYC 1NNEA 2GQ0A 3JASA 1KYTA 4KAAA 2CB0A 3UHAA 5DHAA 4FMDB 4PACA 2A0XA 1NXPA 4L8VA 3BMXA 4X94A 4N4AA 4B8WA 4RKFA 2X0RA 1S1CA 2W0MA 3VZBA 3AY0A 4GBED 4D4IA 3JD1A 2NU9B 4G8BA 5LZ5A 1J20A 3KZKA 3UJCA 2P6UA 4B45A 4F4CA 2BR3A 2A78A 4PANA 2OHOA 4J07A 3PNLA 4KQJA 2P78A 3G5MA 4B4UA 1WTAA 1U8YA 3O4FA 4F9TA 3RFFA 4RY0A 2AOTB 3UAVA 4PVCA 2AR9A 4RK5A 1TUEA 3PDIA 1EHYA 1S01A 3O6VA 3V34A 3YASA 3EZLA 4HMPA 1CYEA 1EG7A 3Q5EA 1N78A 1AKMA 1KZGB 2CL5A 3NXKA 3PXAA 5DN6A 2FQWA 1TCCA 4EO4A 2JZNA 2B8WA 4W5JA 1EYZA 1Z62A 3AO0B 3D64A 1DKLA 1VL0A 4KXMA 1C29B 4LWQA 2WFLA 5LYJF 4R51A 2J9XB 4I50A 4XEHA 3RWBA 1FTQA 2GEKA 4HYTA 2NUTA 5JSYA 3W1VA 4XLLA 4EJSB 1EEXB 2M64A 2ZYHA 3JYOA 3M83A 4WXPA 3E9NA 1R5OA 4DMGA 2K7ZA 3WKCA 3GOQA 3ER9A 2G62A 4ZYWA 1IN4A 1U0SY 1VM6A 1DRVA 1X38A 2ZJ2A 3IKLA 1F6WA 3HXLA 3DMNA 4MWBA 2JFUA 2YVKA 5EIWA 3SYRA 3HV2A 3H1TA 4QDUA 1PEAA 1US8B 3GWLA 4AECA 3DZ8A 4QM7A 1VL8A 5L0FA 2ARKA 2X0IA 1WDLA 2AF3C 3OZCA 2OGUA 3H8WA 1TCVA 3I01A 3OU2A 4JTAB 3TQOA 1AZLA 1BDJA 1BFUA 3JVUA 1QPZA 4PFPA 1RAEA 1X8JA 3R8CA 4F72A 1TE2A 1FVOA 1SCIA 2H7CA 3BVPA 3OOHA 1F5SA 3FOBA 3Q4GA 4BP1A 4D82A 4P98A 4Y2QA 5LP1A 1U8ZA 1NU8A 2W8BB 3L4SO 5F7ZA 3TS1A 3UIEA 2Q2VA 3MTDA 3ZDYB 3ZE1B 4POOA 4YX9A 2IQ5A 3C7KA 3NT2A 1TQ8A 3NHLA 1V47A 2P6OA 3QMWA 4G4JA 1F8UA 3KDPA 5AK0A 1QYVA 2F8MA 2G07A 5TXGA 2C7OA 1GNVA 2EW1A 4ROTA 2AD1A 5J5CA 1PJCA 4N3BA 3EPPA 4PQRA 4U1RA 4QXMA 4PO1A 3VR5D 2AWYA 4QSHA 4HQ6A 2BGKA 1U9YA 4KWHA 1BJRE 1UQUA 4UU8A 2HXGA 3E9RA 5CPFA 4CQLB 4TV9A 1N34B 2FUKA 2NV6A 3CZMA 3MJHA 4C0SA 3NWJA 3PC6A 2P7VA 4D3FA 3A36A 4EGAA 2EP5A 4ERXA 2QTLA 3FYHA 2UYCA 3H65A 4NMXB 2AWNA 1R6AA 1WEHA 4NTBA 3TD2A 3E7FA 2PX0A 1BQEA 3HG7A 2EFGA 1C7EA 1DGQA 2JGEA 1FTNA 1GL7A 4BLQA 2I2CA 3VHXA 3F3YA 3WB9A 5C8DA 1DFGA 4DMLA 4S05A 4WEQA 4LZZA 4LDAA 4R3UC 1GZ6A 1E4VA 3M1CB 3LX8A 1VLVA 4E5SA 2FPWA 1D1TA 1D03A 1CQPA 3ANTA 1A50B 3EQLF 3OCUA 1NPYA 3FHJA 4XCQA 2ZSBA 2FRVA 3WQHA 1W59A 2A1TR 4DCVA 4TV9F 4X7RA 1XF1A 3PUZA 4JL8A 1YR2A 2IYEA 4DW8A 4YV2A 2YWHA 3N6VA 1AS3A 1N9KA 1OFGA 2VQEB 2OEVA 2M1XA 2VCHA 2Z2IA 4HUTA 2XB2A 3AHFA 1JEDA 4J32B 1EZ4A 3ZK8A 1D0VA 3LAWA 2ZRHA 3HBLA 1FDOA 4FDUA 4GXRA 3INYA 3LQ1A 4HDRA 1VRVA 3DC2A 3Q2KA 4UZSA 5IX8A 1ZI8A 1CY8A 1U3FA 3IUNA 4IZ6A 2IHJA 4A27A 2GDZA 3QVMA 2I1LA 2XM0A 5DIFA 2GHIA 3T34A 1QDEA 3HRHA 2JFPA 1Z0SA 2N9UA 1CQJB 1AQIA 3NHUA 1OGIA 5CMLA 2JBAA 5E95A 5F9FA 1FFXB 2IGTA 2IF0A 2ZWIA 4CIYA 2EJVA 4QXRA 3DXYA 3HDYA 2QY9A 4TWZA 4AJOA 3IDAA 2XGOA 1HDOA 3PXEA 5L4NA 1P6UA 4R6WA 1XTKA 1ZHHA 2HSDA 5EP1A 4DTCA 1U7OA 3RK4A 3ETHA 1M5RA 5AW0A 4GRDA 1MC5A 2CMKA 2YV2A 1PVDA 2HSJA 2OHVA 1AF4A 2BGUA 2PX5A 3AC0A 4UZFA 821PA 4AS1A 4KR7A 1DJNA 1L3CA 4X8MA 4K87A 3WGQA 1M10A 4N41A 2XIQA 5ITZA 4E21A 2HMYB 2JFWA 3RUFA 5JS2A 3D4LA 3SE7A 2QVCA 4I1YA 3SC2A 3X2EA 1DOZA 2R25B 3GLVA 2DCMA 1U3WA 3ND8A 4XARA 1Y5MA 1LE2A 3AHGA 4XTKA 1IPEA 4IDFA 4MV3A 4QU9A 3X43A 3QVOA 4EJMA 4M0KA 4LV8B 1GP2A 3IFSA 2V97A 3IEVA 3VUFA 3FYUB 4YAUA 1YV9A 1J25A 2CL0X 4XEFA 2XKAA 4H1HA 4G0ZA 2JK0A 3T52A 4B6OA 2QYSA 2CSXA 5C34B 1JDUA 3G2QA 2EFEB 2OOKA 4PY2A 3ZH2A 3G8CA 2ZREA 1UBFA 3H8SA 4LRSB 3V00A 3P5BA 1XZCA 3DJUB 3TOMA 4Q93A 4ANFA 2XLBA 1CERA 2CK3D 1XAGA 1FRNA 4V0SA 1MVOA 2NU8A 2PPVA 1NNLA 1NC3A 1XLUA 3G4XA 3TTWA 4C6RA 4ZQHA 1XBTA 2JI9A 4FSXA 4B2YA 2CHEA 3VHLB 4E7SA 3FNGA 5KOJA 5A1JA 4JIMA 2E5WA 2PEZA 2GCEA 2C2OA 1ZQ9A 2HLDD 3OT1B 3ELDA 4ZVLA 1O58A 5GWXA 3QEMB 1UBTS 4MWGA 1I4DD 2PKQO 3CNEA 4I19A 2PKRA 3D0RA 3H19A 4OATA 1DB3A 1CJKC 1NV9A 4FE7A 4EPRA 2GFIA 3D7MA 4J2OA 2R00A 3GW8A 2P9EA 3IQEA 1FC0A 1YQTA 3UK7A 5L7TA 1NZFA 3H04A 4BU1A 3R9XB 1JNXX 1EZ1A 2A30A 1SUBA 4B75A 2C84A 5EIBD 4ZLCA 2OQVA 1ADYA 5K0CA 5KOHB 2XL4A 2RGAA 1FAPB 2G63A 2JJ8A 4MW4A 3K6BA 1RRPA 2GUWA 4JXXA 1I3CA 4MQLA 1KETA 1UJ5A 5DCYA 1GCIA 1ST6A 1TEXA 2A5JA 2EWWA 4W8PA 1UOQA 2J7KA 3AETA 3GUUA 4HUJA 4LSMA 3SZMA 4M7RA 1T8YA 2RSEB 2A0BA 4NBUA 4YT5A 4UU7A 3ZNOA 4DEYA 2E85A 2H7VA 2XCTB 2QVBA 3C8DA 3QVGA 4BE7B 4F3RA 5THKA 1XD8A 2SBTA 3O8DA 4IFIA 2B21A 3BE5A 3R41A 4OAQA 3KK0A 2G9NA 1OI4A 3GFTA 1Y81A 3PEVA 1WUYA 1NE7A 2FGJA 2O2SA 3LF1A 3A1UA 4G07A 2ZBQA 1M3SA 4L85A 5DI3B 3VHXB 1MX3A 1VCIA 1NMEA 3MPOA 3PLRA 3ZVMA 4YHBA 4KXYA 1BXRB 1NOIA 3PFNA 2FUEA 1Y6RA 3GP8A 2ZI7A 1QQ6A 3MMXA 3FLBA 5F2EA 2JI6A 5HZKA 3THYA 4FZRA 4Y30A 4CEIA 2QN1A 1X7ZB 1ZC3A 3F3KA 3K1IC 1DMRA 4D99A 5JOQA 1WETA 2JIBA 1CY7A 1BWRA 1G4AE 4WI1A 1BZYA 3ZI4A 2CJFA 2OOSA 1QH1A 4N40A 2ZRIA 4PC7A 2DE0X 3UWDA 4RVCA 1OTYA 1I1NA 3DMRA 4PIPA 3IBSA 3QX8A 4HD8A 1QLHA 4DVZA 2B36A 2BI7A 4Q9IA 1MKYA 4DLXA 1N92A 2XNDD 1QLWA 3IPAA 1JKXA 2CE7A 4G1VA 4PFQA 5A2QA 1W48A 3O93A 3TTYA 3VO9A 2YXLA 3S2SA 4IS3A 4DQLA 1A4RA 4KSYA 5KHOC 5BWLA 3RH3A 1AHPA 1DS6A 2C8JA 3I5QA 3IOEA 3LDHA 5LXTA 4J90A 3OLYA 3ETGA 5KUTA 1C50A 4DVGA 5C37A 2DBRA 3A8TA 3LCRA 3PHBE 4MGYR 3ROMA 5J58A 3I61A 4RH1A 1W96A 1O5IA 2P4EA 3G2LA 5CU7A 4Z6KA 2A84A 1TQHA 3FAPB 4EMTA 1J0XO 4FS3A 1JAXA 4I2NA 1E9CA 1ZK4A 2YASA 2F1JA 5EGYA 1XZFA 2R60A 3CLRD 3KEMA 1Y9JA 3NVDA 4IIXA 1C9EA 2Z4RA 4KPUA 3VOSA 2BTQA 5FI1B 2FEWB 3M81A 2ZJAA 2P0YA 2X8JA 2ZAGA 4W1PA 1Q0SA 2B4TO 3QOFA 3UQYS 3BWYA 3K0EA 3UJ8A 3ERCA 3CZCA 4PS0A 1FX1A 5DBHX 1DOHA 2NU6A 2OLEA 2QSYA 5IH7A 1N0UA 1RYNA 4IJVA 5JV5A 2WG0A 3BAFA 5HGJA 3CH6A 3JCZA 3UJHA 1G55A 4RWEA 4RTKA 1BGVA 4YVFA 1GPH1 1CEXA 2ZDHA 5DNDA 1JLLB 1AZSC 2IEAA 2Q0SA 5GADl 4F11A 3CVWA 1P7VA 4LGVA 4Y6RA 3M1LA 2XE6A 3STXA 1KK2A 1GQYA 4M1OA 4BNFA 4K0RA 4R9NA 3DVRX 3H42B 4U5QA 2DRIA 5LBUA 3VPBA 2PUWA 4M99A 2H7BA 1T25A 2QJFA 4Q9HA 4K6OA 3NC1C 3B9RA 5EJIA 1OX5A 2J9YB 3R5TA 4Q1BA 2O2IA 3CH7A 4DJFC 4DM7A 4LZPA 5JY6A 1DXQA 1OUMA 4GKBA 2VNJA 3UHOA 3KKNA 1V9CA 1LLDA 3CMMA 4PYMA 1CUBA 3FE2A 3GRPA 3KJEA 3IMEA 3K0AA 1TZJA 4M8LA 2BM9A 4NCIA 2Z3ZA 1M83A 1VCHA 1AGRA 2GBFA 4OGGA 1V5GA 1ZA2A 4UBMA 3VPSA 1UMCA 4G36A 2P9QA 3TRDA 1CDEA 3RC7A 1E2QA 1J8VA 5F23A 1KI3A 2CEAA 2V7TA 1U2DA 2IYRA 1KWKA 1ZH2A 2G5PA 1QCDA 1Z6ZA 1TQDA 5D1NA 3ZS9A 2AUNA 1KMQA 4OUDA 4OLBA 2QL6A 3MK31 4QXPA 1RI2A 2Y1LA 3NBFA 3N5KA 4QKQA 1U28C 1ZD4A 4J1SA 4RK4A 3T8YA 3O10A 3DEZA 2I8LA 1RDFA 1I1HA 2BEVA 3BL8A 3JXEA 1XFAA 2VYCA 3U4QB 4WXRA 1DZIA 2KYHA 4LC9A 4RKEA 3RUDA 3TZBA 5EKSA 4BMYA 3MVEA 2RGXA 4B7AA 4AXBA 2P11A 1V5EA 3B1VA 3QEBZ 3UMMA 1LBSA 2H7OA 1J2TA 2GGSA 1VJRA 3M4NA 4MW5A 5F5HA 5JMTA 1QFXA 5F3WB 1GTL1 3PXGA 1BXGB 4U9DA 1MMGA 2IY9A 4IH4A 3SXUA 4M83A 3AVWA 4LBVA 1V1JA 2ESRA 1RC1A 4MV6A 2QTTA 4FT4A 2I33A 1CUSA 4I6JA 1TMYA 3LCMA 5K0FA 3EIXA 4RTOA 5DI3A 3P0FA 4FONA 1Q11A 3KC2A 3T0GA 1D0SA 1GYQA 1X1CA 2GVZC 4RA9B 3LLIA 3WDLA 2UZ1B 1BXRA 3HKEA 3T3IA 4B6GA 2IPNA 2G09A 4HFNA 5ECYA 3SYLA 2WIAA 2OMEA 3LOUA 5T41A 5EINA 1NVUQ 3VDNB 3RHSA 4DVYP 4OXYA 1NR1A 4JR2A 1G3UA 4X60A 1D2HA 3IQWA 1OH5A 3O2SB 4BX2A 5KQSA 4DG5A 2F9FA 1TZMA 3EXAA 3BAZA 2LUOA 1F8YA 1DAKA 3F5FA 2R44A 1HZZC 1J2RA 2ZPTX 3OX2A 4N03A 4Q01A 3FX2A 1HDXA 2AW5A 1DBVO 5IJ9A 5DRTA 4BQNA 4E70A 4IO0A 4QJIA 1GVNB 4NS4A 2GAQA 3EQ9A 3WWZA 5LSAA 2XCLA 2ZT6A 3RIMA 4LDPA 2CYCA 4EG8A 5JAOA 4MW8A 2HWYA 4M86A 2QTCA 4RIEA 1GAJA 2ZRCA 3LBYA 3G8AA 3TBHA 3ISVA 2AZ4A 4MIEA 4XDZA 1HE5A 4I14A 4BQEA 1ZI9A 5BR1A 2WJ6A 5IAAA 1TAUA 1HI9A 3DKKA 4FJ1A 3V7WA 1Y4AE 4FAPB 4Y2PA 1I14A 3STTA 2IU4A 2FKAA 1D1QA 3PFBA 3UO8B 3A9TA 3GD7A 3GV0A 4P83A 1GR0A 3WBBA 4FJ2A 4A8JA 5A3QA 1J2YA 1HFWA 4CG2A 5AVVA 1PWXA 1VG1A 2F3QA 2VPIA 3MWEB 3SFTA 2ZUEA 3CNHA 4QFCA 3EH2A 1XCLA 4NXNB 3S44A 1YS7A 2WBLC 1XVIA 2CD7A 2YDYA 2H2GA 5BN3B 4E2XA 2FX3A 3OP1A 3E82A 1K86A 2R4UA 3IOYA 1Y8RB 4B43A 2EYUA 2G0NA 3QWBA 4L57A 2AFHB 4DSNA 1IVSA 1A4XA 1Q22A 1UFVA 3AUFA 4IICA 3PHF2 4G3XA 4YCBA 2D7JA 1Y9EA 4CMEC 4XJTA 4CLRA 1D2GA 4IOMA 3ZXXA 2GPSA 2WY2D 5EGSA 5AM3A 1V4VA 2EKDA 4JX9A 4MLDA 4RCYA 2FN3A 2BZ0A 3O2QB 5B7GA 2Q49A 1CIVA 3OUTA 4AVYA 5AVSA 1V35A 4UD2A 2OHJA 1M75A 2WVJA 1Z6AA 3M33A 3QXXA 4JX8A 4ZRNA 5F1YA 3WZLA 5JT1A 2UUAB 5F98A 2HPVA 4F2WA 2NVUA 2PCLA 4XX1A 3FCXA 3MJFA 4ZOLA 2XGSA 4E5YA 2ACKA 2F67A 4J0JA 4KN8A 5E1BA 4YXWD 2VCAA 3BQ9A 4JIOA 3KLBA 5A5GA 1Z34A 4WN3A 4WASA 1VLLA 3GGJA 3W78A 2EP8A 4J8PA 1YS6A 2X1HA 3K73O 2AEFA 1RQPA 3BWDD 3L1JA 4K28A 2H4ZA 1MXHA 4OQPA 4KIWA 5U1PA 4F1WA 3GAZA 1DQSA 2QZPA 5JJCA 4EVIA 2CWDA 1J49A 1PZHA 1UJ6A 2R6DA 2XR1A 3KOOA 4FOLA 4I55A 4RVHA 4E5UA 2P4HX 5AVWA 3QKRB 4KN9S 3PYLA 1Z7EA 2V3VA 3D5TA 3DFUA 2CFRA 5HG0A 1X1RA 3NWEA 1RXYA 1X1TA 3GYGA 2WF7A 2ZU6A 3IQFA 1QE0A 3ETNA 3EVFA 3GGCA 3IUSA 3K31A 4YT8A 3L8EA 3L6UA 1DNPA 4KIUA 4WOJA 1EDEA 2X42A 1G6OA 3LX6A 2PWBA 3EVEA 4P84A 2J9UA 2DETA 1NSYA 4AJIA 2ZBFA 1NG1A 1BMTA 1RNLA 4G1UC 4K26A 1M6WA 1XRRA 4KKXB 2OCKA 4FHGA 4F91B 3E7PA 3OP4A 1K9VF 3QFCA 4OHOA 3OE1A 4JRZA 3DXJF 2IH4A 1WTYA 4S1WA 5I8ZA 2IZOA 4XUDA 3MT0A 4PGFA 4JQOA 5C31A 1LPAB 1NUTA 3R5SA 5GOTA 1XZGA 4G0HA 1JL3A 3W79A 4Z5XA 1QGUB 3O8QB 2RJ3A 7AT1A 2IOFK 4UTRA 2YN2A 3ITEA 3V2HA 2HXSA 4EMUA 2X41A 2AN3A 2GXSA 1LI5A 5C0OE 3GUVA 4O4HF 4DPMA 3BMNA 3U6KA 2R05A 4KX5A 4X6XA 1H3NA 2E3JA 2PMKA 3SKVA 1AH2A 4MYDA 4YFVA 5E2BA 1R4MB 1N6LA 1Z6QA 5L45A 3IQ5A 2YRWA 2B7BA 2D6FA 1XL0A 4XSGA 5DM60 2R9RB 3BD8A 3FCSB 3TAXA 4C3OB 2GWWA 1E83A 4O63O 1F1BA 4US1R 3EZNA 3EGXA 2BEKA 5HF6A 4A6XA 1XTPA 4EQ6A 5EIAA 3QKUA 1ORYA 5AK3A 2AUTA 5DOVA 4MQMA 2IE8A 1V55C 3WGKA 4TV8F 1DIOB 1G5IA 4INPA 1NVAA 1F4PA 1J4AA 1AKWA 1S2OA 1UZMA 2DFVA 2WU3A 4WADA 3TVDA 5IKEA 2CDBA 2AK3A 2NO4A 4FDMA 2R1UA 1GGMA 2VAWA 2WPDD 4YPFA 3P1JA 4FYYA 5FIUA 5H3HA 3N2GA 4LVUA 1XMXA 3MM4A 4R5HA 3V1NA 3VYSB 1XLVA 1G5HA 1SUIA 1WHSB 4LHVA 5AKIA 1JAHA 1QF7A 2PX4A 1AKNA 4N8EA 5FWDA 3TJMA 3O55A 5J4HA 4HAZA 1VBFA 3LWDA 5SZJA 1FRQA 3S29A 4QI2A 1PLJA 3GZ4A 4IP0A 4JBYA 4BCDA 3D6JA 2VHUA 4O3FA 2E4XA 5KCZA 4G0UA 1FVHA 3DTTA 4NP6A 1LQUA 1WZEA 5TC4A 1YARO 1RACA 1XXHE 3NDIA 4XM2A 1K7FB 3GLGB 3R0XA 3IB6A 2PA0A 4UM9D 4HF7A 3C1AA 5EUCA 4OQLA 1AJEA 1ND6A 4DZZA 4LWZA 5EWMB 1QBGA 2WZDA 3F90A 4ZI2A 2MMGA 3SKYA 2AFIE 3V1UA 2V6GA 1BQ4A 4PFJA 1JG6A 4TXNA 4C03A 1XRNA 1ADFA 1SK8A 3D6TB 2JI8A 4FFMA 4MUNA 1H9GA 2W70A 2LW7A 4OX9Y 3PDUA 4D46A 2C9YA 4GW3A 1Z36A 2RK6A 3AJ9A 3MZ0A 5IHPA 1GRVA 2ES4A 1X7GA 1MABB 1DT3A 2AOUB 1I4LD 4I5EA 2JANA 4RZQA 3DMTC 3X1WA 1DX6A 4B6RA 1QGAA 1XZQA 1MAWA 2JHAA 3B6KA 4PLVA 3X1DA 1I7LA 4TKLA 3QPBA 2B0HA 2VQ3A 4UQPA 1USKA 1GDDA 4OLFA 4DHEA 3SQXA 4DR4B 3DOCA 4PX9A 1D5CA 5LIRA 1HE1C 4YP6A 1SULA 4PPFA 4F3KA 1KMCA 2PE5A 4OL9A 2HMUA 4PSVA 4WLOA 3A6GA 2XUFA 5DGDA 1GPLA 2YMLA 3ANSA 3NB0A 5B1DA 3V97A 3VR6A 4CKBB 3ZX4A 5CM9C 3LPDA 3NBQA 4OQDA 2RB5A 1UEJA 2BFPA 2BY4A 3LUGA 4YGXB 3KZOA 2LIVA 4A6DA 2NSHA 4WBNA 3KAKA 4PYRA 2Y0CA 4NYIQ 4QGFA 4R1TA 2WZFA 4NY1A 3GP5A 3BHNA 3I37X 2IEYA 4HH3C 3RRFA 2FUCA 3VJMA 5I7RA 4D4HA 1ZQ1A 4X20B 4D8UA 1S9HA 1SKAA 1TDJA 3G0CA 3BB3A 4RXTA 5I7AA 1F3OA 4IIYA 3UMVA 5KYKA 3RVZA 2HEGA 2SICE 1PS9A 3PMRA 1KI4A 1WABA 3TSZA 1Q1NA 1JHMA 1E2DA 4IGAA 2KX7A 3UG7A 3NWPA 3R6LA 4UCQA 3CF2A 4GC9A 2VSFA 1WB6A 1W4CA 2FCRA 2X5NA 4G4IA 5TPZA 1BX0A 3I6QA 4M9XA 5BOVA 3D59A 3T9AA 1QO0A 1CE8A 2WJZB 3C98A 4FZVA 4YV7A 1KZ9A 4ALJA 1RLIA 3UPUA 2UZ4A 3LFHA 4N0PA 4PO3X 3UWMA 4F8YA 2R6GA 3WAGA 5FUQA 1E1KA 1OH6A 4II7A 3SC3A 4HUQB 3GX1A 4INOA 4BVHA 1JG7A 2WB2A 3D2LA 5CFLA 3TINA 4IDAA 4CLRB 4ZFNA 4DLKA 1XZAA 2PRSA 1XHEA 3MFNA 4URFA 5JXWA 3BXGA 1Z2NX 1H1TA 1ML3A 1PZMA 3DPIA 3S1AA 1GR1A 1YR1A 1DIGA 1H8HA 2Z58A 3I1YA 3PSAA 2RMKA 4EMSA 1MJNA 4JBGA 4WK0B 2C4NA 4YEDA 3LYUA 4M49A 2W45A 2PCJA 2OCCC 1WZNA 1OILA 3LHKA 1NSGB 4AKEA 3OQMA 3G82C 3U9MA 5EE1A 4H6WA 3IA7A 1HY3A 1W4RA 3AYZB 1ECJA 4OHKA 1TQ4A 5E38A 3QLUA 4DG8A 4YRBA 3LT0A 1YZCA 5LQDA 2GHQA 4MVJI 5FNZA 3ABIA 3I1FA 1A7EA 3CLRC 3Q85A 1T1SA 1JDVA 3F9IA 3O47A 4KLNA 1ZL0A 4Q37A 5DM1A 5LA6A 4E31A 4CXMA 4DV2B 2VH3A 1AXEA 1E1QD 1GCUA 1WW2A 5GONF 5CLLA 4BY9E 4AWXA 3WIVA 4H7HA 4IJMA 4N7BA 1V3VA 3AVUA 3BFJA 3EZ9A 2OFOA 4D41A 1KVTA 2YV4A 5BPFA 4PZ9A 4MV7A 1Q6YA 1N6KA 1IWBB 1Q7GA 1K3TA 1XA4A 5KYUB 1Z6TA 5JS8A 3LNRA 5IARA 1WB9A 2NXWA 3MTGA 1C9YA 5JSKA 4CNBA 2JHFA 1GPDG 1B42A 1Z4OA 2HK7A 1IJFA 4NHEA 1INLA 4WW0A 5BQFA 4CL0A 3B89A 3BIFA 1CR4A 3JALA 3PNKA 4G5HA 3L7IA 1POWA 2WSBA 3UV3A 4EB6B 3IHTA 4IIVA 1Y4DE 2HSZA 3ZNPA 4IEEA 5IWCA 3KFVA 2WTNA 5K2OA 1Z23A 5AWFC 5E1OA 4TWIA 1GPNA 2GPTA 3ZHSA 3OY7A 5CB0A 4P7FA 3O3MB 3VU1A 1T0UA 1ZNQO 4RXUA 4ZYUA 5IDXA 3OZSA 2ZPUA 5TVGA 1DPGA 1AGYA 3S6JA 1G98A 1XTZA 1QDUA 1EE1A 4N3NA 4ZT3A 3U7QB 1YRHA 1EGQA 1QGYA 3VVCA 5JSZB 4OHCA 4YK5A 2JLAA 1SBZA 9GPBA 3NMJA 2F3TA 4AWBA 1NMXA 3Q9SA 4EQZA 5ESXA 1VKRA 3M9XA 1E2NA 2CKMA 2OV3A 3UZUA 3EJ6A 4YRSA 2BJHA 3RUEA 1ECFA 2RC6A 4TGLA 5KIAA 2MSLA 1TW2A 1ISSA 1PQUA 4YLEA 9ATCA 3OZXA 1Y1PA 1NQXA 4NNPA 4ZAWA 1S2MA 1XU9A 2PMCA 1P2GA 2Q7RA 1N2CB 3BD6A 1RC8A 4ND7A 5TQ0A 3KKLA 5LLTA 3EARA 4BWYA 3RAFC 3CPEA 2XGMA 4M0EA 3WFZA 4UPDA 4EW6A 4JEAA 4N9WA 6ABPA 2ORED 3BTVA 4R81A 2XDQA 1W88A 3F4BA 3NRJA 3RSSA 1NDQA 4Z1MA 4B76A 1E6CA 3QEJA 3R6WA 4V1CA 1RAGA 1BQ3A 2FZ4A 5IC4A 1C0EA 2FEOA 2WD9A 1AUPA 1HMDA 4HV4A 3AEQA 3L7MA 4YI3A 5B1HA 1TA0A 1Y1RA 1TJ4A 2Q07A 3EY4A 4XCXA 2FZ5A 1TYZA 4RULA 3M2PA 2JK1A 4KPFC 1DDGA 3OLWA 3SC4A 3PUHA 4AAYA 5CDHA 3RF7A 2V7WA 2GLUA 3Q7TA 2XT6A 3CZAA 2RD2A 3B70A 2QTMA 5CFQA 4C4ZA 1PJ3A 4J9VA 4IQ4A 2VDMB 2EYQA 2W7TA 3C41J 3ZHXA 4C4SA 1JGTA 1IBKB 4LQLA 5DCWA 4ZKEA 2G6BA 1U04A 5J2UF 3O39A 2C4UA 3VZRA 4UU1A 2YLDA 3AYXB 1OT5A 5HTKA 4C88A 4Q5IA 1UK9A 2G5GX 2HC9A 4JLOA 5GV7A 3GORA 3I4CA 3ZIUA 4HK4A 4CMBA 3VFDA 1P4SA 2W2XA 1QK4A 2IHKA 1K2VN 1EQUA 3MXTA 3EXHA 1XG5A 1UZUA 3BC1A 3DOHA 2R8ZA 1NU6A 4QICA 4K03A 1GKIA 2C5LA 3GDWA 3QIVA 4ZVMA 5AVUA 4LGYA 1AQJA 1MEOA 1Z5WA 2HHCA 4QOJA 3H9UA 1AEPA 3VPHA 1V7PC 2JIZA 1XNHA 4MUBA 3M34A 3I28A 3PIIA 4GMGA 3RTDA 1Z3IX 5F5NA 3WMXA 1YF3A 4V0KA 2EJUA 1ZDMA 5GONB 2BI8A 4V0QA 5C46F 1LWNA 2BT4A 3OCYA 1Y8RA 3OZVA 3DMGA 4XUCA 4KIJA 3OC6A 5JTUA 2AX3A 1MAAA 1JIKA 2RARA 5EJAA 1KP2A 3E9ZA 4C0LA 2OV8A 4OIFA 2WWYA 1IIBA 1V11B 3G02A 2V0GA 2WNIA 3EEQA 1VGQA 3GRUA 3BA1A 1U3VA 4C7XA 1ZL2A 2IHBA 3OPYI 1I24A 4UC0A 1L4YA 2BFOA 2WUGA 1A7AA 2YV1A 3DCIA 3LXXA 2O8CB 2GBIA 4BRWA 5LQSA 2QMQA 1NTOA 1MMNA 4KIGA 5HOEA 1Z7BA 1Q7RA 3D1LA 1I2MA 3HPQA 4JWTA 3O3NB 4QTXA 3EGVA 4J16A 3TR5A 3B0PA 1CRQA 4PX5A 4UDYX 3UAWA 1JIJA 2AJTA 3GVXA 4YCNA 3ORQA 3P2MA 3NT5A 2IXOA 1FJXA 4G7OF 1QVWA 2VAXA 4ZQFA 3I62A 5JDIA 3V2GA 1G8HA 3U1BA 3LUBA 2VDWB 1YI0A 1SVMA 1JFSA 5HK8A 1PFUA 3ISTA 2V7EA 3TM4A 4B17A 1S02A 4XXHA 5LKAA 1R12A 1GOTA 4HDNB 1E4EB 1Q2XA 1M1NB 2CFTA 3A28A 3LLCA 2OGWA 3VH3A 1JDZA 1QWOA 4H27A 4HDMB 2ZW9A 3WL6A 5K8UA 2CMGA 4U4AA 3L7BA 2W6QA 4DLWA 2GSWA 2AXNA 1N3YA 4URWR 4DR5B 4Y1GA 5ALQA 3ZNQA 1X2EA 1J06A 3ACDA 3WJ7A 4WFQA 1KY4A 4W9NA