2QY9A

Structure of the ng+1 construct of the e. coli srp receptor ftsy
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
300
structure length
300
Chain Sequence
FARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein ftsY
publication title The E. coli SRP-receptor FTSY contains an essential and autonomous membrane-binding amphipathic helix
rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 115
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2qy9A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qy9A02
2PLFA 1OFHA 1XTIA 1W4RA 1ZNXA 3CW2A 3MWJA 5FL7A 3ZVMA 4KSCA 1TEXA 4QHYA 1A2KC 3DMNA 3N2EA 1AGRA 4LX0A 4RZ3A 3AVQA 1Q57A 4CEJA 4A9AA 4LV5B 1XU4A 3NTUA 4XTCS 4AG6A 1QHNA 4FMCF 4YMTA 4OHZA 4XOIA 1ZUIA 4L4UA 2QBYA 1JXOA 5JWOA 3GQBA 4F92B 1W0JA 2FSGA 4HLUA 1TF7A 4M9XA 1YR6A 2FFBA 4IDOA 2JJ2A 3KZ1E 2D06A 5CK4A 2ZREA 3SYLA 2PZEA 4D82A 3CM0A 2J0QA 4NH0A 3QNUA 5L3SB 3AVUA 2WOOA 4NONA 3FE2A 2H1LA 2NMVA 2QT1A 5E4FA 4HUTA 4ZDKA 5EUMA 1P7CA 2VHTA 3B9PA 2ZRHA 1X1SA 1GL6A 4BFWA 1AA9A 3QPVA 3EXAA 1BMFD 1H65A 2W58A 5JRJA 1GAJA 1G41A 2R6CA 3CLVA 1YRAA 2R9VA 4W5HA 3EPKA 1GFIA 4HDOB 3BERA 5KSZA 3IUYA 4R98A 3RS7A 1U8AA 3H84A 4FINA 5BYJA 4KFRA 1EXMA 2ATXA 2ZETA 3EA5A 4UQOA 3THYB 2J46A 3DMDA 1PUJA 4FW9A 4MQBA 3PEUA 1T8UA 1QHHA 3CRVA 4E03A 2H18A 3AKYA 2H92A 3AQ4A 2ZSBA 3WYAA 4IFBA 2RGCA 4M9ZA 3Q85A 3PV0A 4GZLA 4IDPA 3A1TA 4PSAA 4MKHA 3TLXA 4LK2A 5AJWA 2BCJQ 2G1KA 2KE5A 2C96A 4GMXA 4D81A 1IBRA 1KDTA 2WJHA 4DLZA 2DWQA 1YVDA 2FSFA 4G5RA 3NH6A 1UBCA 3L82B 4TT3A 3LAWA 2QP3A 4Z1MA 2EW1A 4ZKEA 3DOEA 3NDBB 2PJZA 5FBQB 3UMFA 1QF9A 4DC9A 2UVQA 1CIPA 3QXXA 3GLGB 3B13B 3FMOB 2X2EA 2BEJA 3QOFA 3THOA 4MDFA 4Q21A 3TUJC 4M1YA 1ZM7A 1JECA 4LYJA 1NY5A 3SR0A 2ZE5A 4LC0A 4B47A 1WRBA 2HEIA 1XTRA 1G7TA 5H70A 1KSJA 4OHVA 5DE3A 3RRNA 3I92A 4HEJA 2VSOA 1XP8A 3A4NA 2EFHB 1SVIA 1KI9A 4Q1AA 3E1SA 5IDVA 2KI5A 3TSOA 4PSKA 1KZ7B 2FU5C 5FTKA 3SJAA 3ZZTA 1IN8A 3NKVA 1KHTA 2EFEB 5LBIA 1NVUQ 1OT3A 3TQCA 1P3JA 4B48A 4DLTA 3AUYA 1ESMA 3U7EB 4F38A 2Q9CA 3QBTA 1N2CE 2VTKA 4Q1CA 1ZIPA 1BMFA 3QKRA 1DAHA 3BWDD 2GZDA 2JJ1D 1XDBA 5KSYA 5G41A 1JBKA 5JMTA 4Q4HA 3NHAA 2IYTA 2QA5A 2REOA 1OJLA 1AKEA 2WMNB 1MABB 4PR0A 4BLPA 3GJ8A 3WRYC 4DDTA 2CK3D 2XEXA 3EPJA 4BFYA 4CEHB 2OZEA 1E2GA 1G64A 1YQTA 1KI2A 2J0VA 3CR7A 3NC1C 4FI3C 2OCBA 1PLLA 3I61A 2HUPA 3ZLJA 621PA 4GI7A 2ZI9A 2EYQA 3LNCA 2WVJA 3KJEA 4LUCA 4MUAA 3LBHA 4BEBA 3W3AA 1QRAA 4PC2A 3U3OA 2JLUA 5SZKB 1Q44A 3I72A 3CX8A 1KZGB 8OHMA 4TZ0A 4WBSA 2Q3FA 1G5RA 2ZS7A 4MGIR 4B2PA 1JNYA 3FKQA 1RRPA 2BOVA 4JJKA 3THXA 1CR0A 4W5WA 5CM9C 2CE2X 2PCLA 3SJCA 1J2JA 2VSFA 3U5ZB 4A92A 4QGAA 1S96A 3SOPA 1NN3A 5L3QA 3CNOA 3W5IA 4RSGA 1AGPA 1W4BA 1XZQA 2FN4A 3GD7A 3GJ0A 3DKVA 1KIMA 1M6NA 3T1QA 2YOHA 1XD9A 2EWVA 5FOVA 2VL7A 4KAXA 4AYWA 3EZ6A 3M4YA 4PZLA 3B8HA 2J9RA 4M1SA 4NYJQ 4DLSA 1PVOA 4US0R 3QG1A 1VG8A 1UDXA 4TL9A 1W7AA 1OH5A 4MDEA 4IJMA 1X8JA 1KJYA 2REXB 2DFLA 4U5XA 5FI1B 4PAOA 6Q21A 1ZNWA 3LVRE 3CUEF 2NO7A 3I8XA 3W3ZB 4LJYA 3QKTA 2WJVA 3HR7A 1KDPA 4JLBA 4DLXA 1M7BA 2VHCA 2DWOA 1OKKD 3B82A 1Y63A 4OQMA 5KU1A 3P26A 1AK2A 2NO6A 4NCKA 1BO6A 3BH6A 2JJ1A 4GP6A 4PANA 4UXIA 2BIFA 3SEAA 2GK6A 4M22A 2WWYA 2ZJ8A 3EIEA 2VO1A 2CVFA 2ORVA 1D6JA 4F91B 2ODNA 2QU8A 4QXAA 4ARZB 2BBWA 4O0MA 3TW4A 2XTZA 4HAWA 3LY5A 2JIZD 3QQ5A 2CK3A 4BFZA 4NYJR 4DVGA 1WBDA 2QSYA 1CTQA 4HUQA 1JI0A 1G3RA 1JQLB 3AKEA 4EAQA 3A1UA 4LYFA 2PJRA 1P9NA 1P4SA 2QY9A 2BBTA 4OI2A 4M4SA 2C2HA 4DHEA 5KUTA 4B3BA 4PC3A 4D4KA 1Z6AA 2CCJA 5E7MA 1DO2A 3OAAD 3I73A 3HP1A 2QM7A 3CO5A 3BFXA 3SYKA 4PO8A 2ZR0A 1MO4A 1HQYE 3TH5A 3F8TA 3SJZA 1ZW6A 3RS0A 3AM1A 2AD1A 5KSOA 1TL7C 5FTNA 3PEWA 1CLUA 3L8ZA 4BZPA 4D0NA 4A0HA 5SZHB 3RRMA 1LS1A 2Z4RA 4URXR 4ZPXA 1ZM3A 5K8TA 1VPLA 1XF9A 1TAGA 4JZKA 4WZBE 2QI9C 1A7JA 5E95A 4QC2A 3VX4A 5JWHA 1CKEA 3WMFA 2C9CA 5CIQA 3WNBA 5LD2B 3C5HA 3KB2A 2DY1A 2OAP1 2ZM5A 4TMVA 4DCUA 3GLHE 4BFTA 5FPYA 4D2IA 3I8SA 3V00A 3U6KA 1UBFA 3AB3A 3SFVA 1OH6A 4RD3A 1W4CA 2O8FB 2IUSA 1ZU5A 1E2MA 2WSSA 4W9MC 2JLVA 2WSMA 2V54A 1N5LA 3MWYW 1Q3TA 3FOZA 3KJIA 2IXGA 2O8DB 2ZUDA 5KSPA 1EWRA 3IO3A 5KPDA 3IGFA 1OKKA 1N6PA 2OLJA 3VTKA 3K9GA 3KQNA 1CULC 4WOPA 5JI3E 1OB2A 3ZQJA 4UNRA 2CL6X 5BQ5A 1NN0A 1ZCAA 3VX3A 2ZS8A 3MCAA 4P4UA 3QE0A 4GBMA 1XXHB 1BS1A 1JEEA 4QBHA 2EFGA 2X77A 2RKOA 2HXSA 3HYTA 2FGJA 1EX6A 3DZ8A 2JIZA 3T5DA 3BOSA 1T3SA 4HATA 2FFQA 5DLQC 3C5CA 4OJQA 3AF0A 5DYIA 3SE0A 1JQJC 1UKYA 1Q21A 5EE5B 1G7RA 3ECCA 1QBKC 2OAQ1 5JZVA 5GADl 4Q7JB 1ZC4A 3R8CA 1W1WA 3LO5A 1TNDA 1YKSA 4MYHA 3OAAA 1KOFA 2NZJA 2O0JA 4IDNA 1Q20A 4DXAA 1SVSA 1WCV1 4HZUB 1XFAA 4L9SA 4CF7A 2VYFA 2VA8A 1D8TA 3LBIA 3B1ZA 1J8MF 4C0KA 2I4IA 4ACBA 1D9ZA 4ZV4A 2VBCA 2ZAMA 4MRSA 5HPYB 3R20A 4WZAE 3QXCA 1KKLA 4I4LA 4QJ4A 3E2IA 4TLDA 1E2HA 3WMEA 2JLZA 1KI4A 4D4JA 4D26A 2JGNA 5IRCD 1LNZA 1W36B 4B33A 3KTAA 2QRNA 4RKEA 2OXCA 4TL7A 2GJSA 2W0SA 4DT1B 1TF2A 1SHKA 5JJIA 2GF9A 1KNQA 3NEJA 4AYTA 4RZ2A 2F1IA 3ZVRA 2KB0A 1G6HA 2PCJA 4D25A 1ZIOA 1TQ4A 3CBQA 4JVLA 3GLFA 3U44A 4Z54A 2A5JA 4G01B 4ESHA 1E96A 3GEEA 4BWYA 4LOAA 3KKPA 3U2QA 2AKYA 3AH8A 4WXPA 1ETUA 1KK0A 1NNEA 3ZDQA 1G3IA 1U99A 2WKRA 4YMSA 1KJWA 4NKRA 5JJKA 3TAUA 4IKEA 4M1MA 2GBLC 3LX8A 5A0FA 3LBNA 4M21A 5FOSA 4LBZA 2A5FA 1FQKA 1VYTA 3DEFA 3QKSB 4NCIA 1WB9A 1C4OA 1RRCA 3K53A 1JEDA 3IIMA 3P4YA 1KAOA 4DSOA 4DB4A 5K8UA 1EK0A 1EFUA 1KO7A 4DWJA 4QHTA 3AKDA 3RSLA 4MKIA 3P27A 3CPJB 4HAXA 1SVOA 1NSFA 4JLKA 4PHGA 3TK1A 4DIEA 1U98A 3GJXC 4WAUA 4AY2A 4RKFA 4TTPA 3GP8A 2LKDA 4AWXA 4V0NA 2EU8A 1QZXA 2ZU6A 2HCBA 1GKUB 3QI2A 3LVQE 4LBWA 4TMZA 1LB1B 2X2FA 1DG3A 5HCNA 1K5GA 2O8BA 4P0TA 4V0OA 1S9DA 4HI0E 4HLUC 4L16A 1E3MA 5BN4A 1RC8A 1UJ2A 1Z6TA 2ZAOA 3QG5A 2ZJOA 3N70A 4C0LA 3GLFE 3GPLA 1HUQA 3EIQA 4JLJA 4URYR 4GL2A 4PQRA 2Q9AA 3BH0A 4NBSA 5EXXA 1E2EA 5FI0B 3EPLA 2FEMA 2C78A 1OFUX 4URWR 3MUFA 2P65A 3IPYA 1TU4A 2F55A 4UNNA 2ZSDA 1CEEA 1JPNA 2JA1A 3AUXA 1FFHA 5G3YA 3ZIAD 3I62A 4MUBA 1N6NA 5HKKD 4C0HA 1Z8FA 2CDNA 4D80A 4H1UA 1Z0IA 1R10A 3IILA 4IOJA 1AS3A 3RS4A 2WZQA 3VR2A 1EG7A 1LFDB 2CJWA 1UEJA 1XTQA 3P32A 4QG7A 2NGRA 1E9CA 4Y0VA 2WBLC 4WIAA 1AQYA 1HT1E 2ZITA 2R6DA 3AEZA 1JR3A 1W4AA 3QXHA 3RDPA 1QHYA 4BLTA 2VH5R 1MKYA 2FA9A 2WIBA 3TNFA 4C4PA 4IHQA 5J4YA 1XX6A 4A4DA 1P2VA 1NY6A 2ZJAA 1NN5A 3E70C 1TQ6A 1VDZA 1XPRA 3ZVNA 2A9KA 2FPKA 1J70A 4FCVA 1K6MA 2J3EA 1NLZA 2GJKA 2RAPA 3I1FA 1I2DA 3DM9B 4JLDA 2GXQA 1ZM4A 4Z8XA 4XWOA 5HZKA 1CJTC 4P33A 1R5OA 1H8HD 4Q1BA 1E94E 1DS6A 1NG1A 4G5QA 4PFSA 3ZVLA 2NTYC 2XB4A 1CXZA 2IYXA 2ZSEA 1DAIA 2QP9X 2RGAA 4CT5A 4QNMA 2BMFA 5L3RA 1E2PA 4MYTA 1RW4A 2IBMA 1X6VA 5CDFA 5JCPA 1Z22A 1E98A 1ZD9A 1G3MA 3G0HA 2QUZA 3MAAC 3LRPA 1AM4D 4R7ZA 1ESNA 3GLIE 3OE7D 1JALA 2A30A 1LF5A 3BC1A 4ZIRA 2DPXA 5AR1A 2O0HA 4QOSA 4I99A 4GNKA 3NBYC 2PZGA 2ZI5A 4PHHA 1WGWA 1DAFA 3MLEA 4G1UC 4EJSB 2XTNA 1JR3E 5IK2A 3T34A 1CRPA 5J4LA 4HSEA 2C95A 3FDIA 1L8QA 3PCRB 4Q7LA 2IWHA 4BFXA 3HYRA 3QEOA 5CJ2A 4KLZA 2C5LA 1RRGA 5ELXA 4TQAA 2JATA 4B2LA 2J87A 1D2MA 2ZROA 3NBFA 4Q9JA 2ZRDA 1XPOA 5HKKA 1TX4B 1XJQA 2BHRA 2RGBA 3KJGA 1KY3A 5JJLA 2P67A 5AUNB 3ICQB 2UKDA 1IJFA 3VMFA 5EE9A 1HV8A 5FOTA 3L43A 1Q1EA 4NYIQ 4US1R 5F3WB 2QAGB 4TZ6A 2QMEA 4NE2A 4MYUA 2XJ9A 2QTFA 2Z83A 4YDHB 4FXPA 3UWOA 4O3MA 2B8TA 5FR2A 1D2EA 1SKYE 4YDSA 4AIIA 4M2LA 1GRNA 4FIDA 4KJZA 5AWFC 4EDHA 4I1VA 1IY2A 1ZINA 5AJYA 4M0LA 1G21E 2CCKA 3LQQA 3LLMA 2ZYVX 2KBFA 1BH2A 3OIYA 3G5UA 2PX3A 1RJ9A 1LV7A 1G17A 3OEHD 4FMDB 3GJ5A 1RPZA 1E79D 1H8HA 2YWFA 4DLUA 2ZYWX 1HTWA 4MH0R 5EXSA 5FPKA 1U0HC 4N1AA 1G5PA 1ZUNB 4KVAA 2WJYA 1LVGA 3A4MA 4M1WA 1AZTA 4ZCLA 3IQWA 1U8YA 1WF3A 2BMDA 4IRUB 5GJCA 2J0UB 3VFDA 2CHQA 1Z0JA 3EWAA 2IS2A 1NI3A 4NYIR 3GLGA 2ORIA 2ZRFA 2ZJYA 3Q3JB 4NL4H 3R7WB 1H8ED 2GEVA 2ZI4A 3CB4A 2O8CA 3MSXA 1U90A 1KI6B 1YR9A 3PG5A 3P4XA 4TL6A 3OE7A 4RZUA 4BQSA 5G53C 4NCNA 2W2TA 4IVQA 1CS4C 1UDWA 3A1WA 5DHAA 1QHXA 1G4AE 2LWIA 3NEYA 4FN5A 1XEFA 2R65A 2JLYA 2GJAA 1G291 5H68A 2BEKA 1HH4A 2GBLA 1CJVC 2FV8A 2IHYA 1N0VC 2QGNA 3CRQA 3MMPA 4B6EA 2FMXA 1KSFX 4Q4AB 4JVMA 3RRZA 1Q12A 1T0JB 5E3HA 1W5TA 1M1YE 2OBLA 3U4QB 3H0KA 4MITA 3FWYA 1Z28A 1QHSA 1GKIA 2WTUA 3A6PC 4TL8A 1CU1A 2KBEA 1NVWQ 1W36C 2WKQA 1WXQA 4S2EA 4NP6A 2IS1A 1P2TA 3CF0A 4JKIA 2AR7A 4URZR 4KBFA 4Q7KA 2QPTA 3UWKA 1NP6A 4C7OB 2GKSA 3PJRA 3QIAA 2W2XA 4QL3A 3VU9A 1T3LA 3PITA 2WAXA 2D74A 3EZ9A 4LBVA 4EQ6B 2FPLA 4AK9A 3AF3A 2A3RA 3OEEA 2GRJA 3ZQ6A 1IN5A 4J0QA 2GCPA 3AF4A 3IPXA 2ZPTX 4II7A 1BOFA 3THWB 1VCNA 2WWXA 3M0EA 2J45A 1A82A 3KUDA 2XJ4A 2GXUA 2W2VA 2IYQA 1E79A 4QBFA 4DDVA 1GIAA 4WA7A 1XD2B 2FGKA 2JASA 3W6PA 3FTQA 4GMDA 2JAQA 3UG7A 1I2MA 2CXXA 1NSTA 4E22A 5KPJA 4GFDA 1EFTA 2ZRNA 2YHSA 3BJIC 1OV4A 4LZZA 1BKDR 3REFA 1H8EA 5JBQA 1X1RA 2GXAA 3OF5A 2N1BA 3B2EA 2BM1A 1UM8A 2BV3A 3B1XA 2IYRA 1KTVA 1Z47A 2FNAA 2MSEB 1VIYA 2HJVA 4K8OA 4PXAA 1NMXA 4I1UA 1NJFA 4JT2A 3Q5EA 1UEIA 1ZYUA 1TEVA 2WMOB 1K8RA 2A7QA 1O87A 4TMTA 3K9NA 1UADA 4LJ7A 5EXTA 2F9LA 3RRYA 3ZZ0A 1SXJB 3L2OB 3GFPA 1XCGB 3H4MA 5KDLA 2FZLA 1P61B 3VR4A 2NPFA 5DYGA 4BLRA 1VG9B 1GNPA 1G16A 3K1JA 1IN4A 1GM5A 4IEEA 3PUVA 3K70B 2PX0A 5G3ZA 5AUOB 3L0PA 4LRWA 1CR2A 1HYQA 1L4YA 3A1VA 2P5SA 1JAIA 1RFLA 1G19A 1GKYA 5IF9A 1X86B 421PA 2ZRGA 1P62B 3SFZA 4L8GA 4KLNA 3C4JA 3U7HB 5B30A 1UKEA 1FX0A 4QNRA 4PC6A 4IXNA 2F43A 4M53A 1Z63A 3GEIA 1COWD 2W6JD 4QHSA 2AWOA 1DADA 2A78A 1GRRA 3A8TA 3NXSA 4JSTA 4XD7D 2YZ2A 4ABYA 5JSZB 3RWOA 1ZMXA 2DHRA 5CYPA 2V1XA 3NDPA 2BJWA 2CCGA 4XWAA 2FFAA 1OIXA 3EARA 3MG9A 1GVNB 3NWJA 3AVXA 1Q0UA 4IFEA 3BIFA 5DGXA 4M8NE 4DLRA 1GUAA 3FYHA 4ITRC 3DHWC 5EP2A 1CJKC 3C15C 1QG4A 4D0GA 5F9FA 1Y3AA 4HLDA 3DL0A 1UPTA 1OE0A 1ZM9A 1W36D 2ZRKA 5EE3A 1NRJB 3LD9A 1ZJ6A 2DFKB 1ZCBA 2G3YA 4N0EA 4A0GA 2MSDB 4US2R 3AF2A 1HE1C 4POAA 4PHTA 3AVPA 1X8KA 2ZVQX 2V1UA 1G8FA 3ZS9A 2AX4A 5TARA 1NG9A 1AJEA 1NVVQ 3BE4A 4HLCA 1PV4A 4RD0A 3B1YA 3RWMB 1E6CA 2ZE7A 1GL9B 3EAQA 3CRW1 2O8DA 2V3CC 3Q72A 4GDFA 1TPZA 3BRWD 1GITA 3K9HA 1OF1A 3CKLA 5H1YA 3IQXA 3VAAA 5G40A 4AKEA 4ZKDA 4C0AC 4CRWB 4CEJB 2GZHA 3SU8A 2ZR7A 3LV8A 4R9UC 3MWLA 3AVOA 2Q3HA 4ZI2A 3TVDA 4OKSA 3TW8B 2QROA 1LS6A 3K9LA 4DSUA 2QBYB 4P32A 3QVUA 1XXHA 1DAMA 1CJUC 3H1TA 4PQYA 4BEJA 4NZYA 1XB2A 5DISB 5FL3A 2QAGC 3PQCA 3LQRA 4KSBA 1GDDA 4UNPA 2OEPA 1YZGA 2VQSA 1R0XA 3D3QA 3EW9A 5DIFA 4ZDIA 4D4LA 2VEDA 2D4HA 2XTMA 4R71A 1Q3HA 721PA 4HLQB 1NVVR 4Q9HA 1M7GA 5KOYA 4WZ6A 4HB4A 5HTKA 1COWA 2ECKA 2IA5A 2W6JA 4Q9LA 1RZ3A 1XJCA 1Z0DA 3U3KA 2QAJA 1NMYA 2VIIA 3OZXA 4XD7A 1AS2A 4HZUA 4KBGA 3RS2A 1Z6GA 1IJEA 1P73A 4LBYA 4ZDJA 3IDQA 4YLGA 1DVRA 1R0YA 5HCIA 2I3BA 1IXRC 5E7JA 4D4MA 3VKWA 2A2ZA 1DAEA 4YQFA 1IY0A 1U0JA 4M1OA 1R5NA 1VHLA 2OUKA 2Z43A 3DO6A 3PXGA 2IWRA 3ND9A 1NF3A 1QHHB 2C99A 1US8B 3PUZA 3RANA 3F3YA 4Z8YA 4QJ5A 5L3VA 2WOJA 3AV0B 4LDJA 2IUUA 1KSGA 4QGHA 3JVUA 2AXNA 2CHGA 1XPUA 4G5GA 4LJ4A 4RFSA 4PQFA 3W6OA 2XAUA 1SZPA 3TR0A 1S3GA 3SN6A 1G7SA 2ERYA 4CEIA 4C0BA 3JVVA 5EZ6B 1R0WA 1YRBA 1DBSA 3JZMA 4DCTA 3RNLA 2OM2A 2DB3A 1XZPA 1E0AA 4FD2A 2BDTA 1YR8A 3UG6A 1YU9A 3EPHA 1EX7A 1Z3IX 1YZNA 2G0TA 1PUIA 3ZJYA 1I4LD 3QY0A 5BN5A 1E99A 2OSBA 3IIJA 4BZXA 1FP6A 3FB4A 3HPRA 2IYYA 3R9XA 3RLFA 1WBBA 1E2JA 2ZE8A 1DOAA 4Q18A 5TVKA 2QQ0A 1Z2AA 1IONA 4KYUA 2P6NA 3LXRA 2XZLA 2RGGA 4GOJA 3PR1A 4IDHA 3SJBA 2ZS9A 1EFRD 2CLCX 3A37A 1DTSA 4P4SB 2QZ4A 5IT5A 1II9A 1ODFA 1XRJA 3ZH9B 2YINC 1EWQA 2FX3A 2ORWA 3ND8A 2IHBA 5FH9A 2IC5A 2EQBA 1XMSA 3Q8XB 4P4TA 1S8FA 2BMJA 4KODA 1FQJA 4C2UA 2ASEA 4TYWA 2J59A 2R62A 2VHJA 3FFAA 2FPMA 2AK3A 2IW3A 3C7KA 3KX2A 3QKRB 3UATA 2C9YA 2KWIA 5FTJA 1IY1A 1RYFA 1M8PA 2B7CA 4EPXA 3QJYA 5HE8A 4B2IA 4PAMA 3IBGA 3WY9A 2YC2C 2QN6A 5CK5A 4L9WA 2HDNB 1QVAA 2DFTA 2XITA 4DB2A 1N0UA 1XMIA 1HA3A 2F3TA 4GSYA 1FL9A 4UXHA 4BFUA 4CEIB 2P5TB 3VKGA 4M1KA 1T9HA 2I1QA 1G1MA 1B23P 2DBYA 3LW8A 4HB3A 1BYIA 2EVWX 1E1QD 1E2DA 5HE9A 4JL5A 5KNDA 2J7PD 5C46F 2GA8A 1U94A 3U7GA 3OHMA 2NG1A 3UMSA 3J81k 4TTQA 2OCYC 4E09A 3LFUA 4S35A 1IXZA 2GCOB 5GVRA 1W46A 3K0EA 1DAGA 2FG5A 5J5CA 4OI1A 3TMKA 3B85A 4N0DA 5AJZA 3ADKA 2ZUBA 5ANRB 5JS7A 5C4GB 3REGA 4YMUA 1E2LA 4QFMA 2H17A 2GDJA 1KDOA 1SXJC 3QPWA 3VR5A 3R9WA 1TQ2A 1PLKA 4M9QA 2OESA 1Z08A 4MKFA 2P6RA 4LJAA 3CNNA 3NH9A 3RSOA 3K0FA 4H1VA 3KUCA 1II8B 3DPUA 3OIWA 4YONB 4XJXA 5A5GA 1XMJA 3TSWA 3AP2A 2LKCA 4HAZA 4TLAA 3SC3A 4KU4A 4YMVA 2AXPA 3QF4A 1KK3A 3Q9LA 4IOLA 2RMKA 2WWWA 4RCZA 3Q7PA 3CZPA 2BMEA 1EFRA 4URVR 2GVDC 3OIVA 1BIFA 3P20A 5DH9A 5DNYB 1JPJA 2G1JA 2G77B 2O8EB 2F1HA 3KXIA 1XWIA 1R7RA 2QM8A 3D6TB 4U02A 3TKLA 4URUR 4A8JB 1NBMD 1N6IA 4TTRA 5FFMA 3T1VA 2Q0HA 5CIWA 2WV9A 4DZZA 4XH9B 4W5JA 1RYHA 1EFHA 4Q47A 1X8LA 3GLHB 3IO5A 4PX9A 4RD6A 1FNMA 4NHOA 1PZNA 2R44A 4KYIB 4B44A 2P3SA 5K8IA 4KVGA 2BKEA 1KGDA 2ZRIA 5C4MA 2IF0A 3VNVA 1FNNA 1OH7A 4C2TA 2QT0A 2VSXA 4DLVA 1SGWA 1N6KA 2EYUA 3IHLA 2AFHE 3AP1A 3QXJA 1N5JA 4PPGA 3NBXX 2QEQA 1E1QA 3WYGA 3ZD7A 4EPYA 1TUIA 3X1XA 2J7PA 3FMIA 4V02A 1Q1ZA 1GOTA 4Q03A 2QAGA 2KJQA 4MRNA 1DO0A 4F4IA 2FH5B 5AK0A 5JHGB 2HF8A 4W7SA 3B1VA 1AZSC 3NHBA 3SBEA 4BUJA 3K0CA 2WWGA 2GXSA 4TMKA 5D3MA 2IEYA 2B92A 2V8OA 1XEXA 4MGKR 1HY3A 1RIFA 3X1WA 4Q1DA 2Q9BA 4Q9KA 4UJ5A 1QHGA 3KB1A 2X19A 3WMGA 1XBTA 5M04A 1DAKA 5EQTA 4BECA 1OXTA 3GJ6A 4MGZR 4EPRA 3VKHA 3NG1A 4DRZA 3PFIA 2D2FA 2F1RA 3CRMA 4LCBA 3EWSA 3FGNA 1OIVA 2ZSFA 3VHXA 2MMCA 3RAPR 1IM2A 4LV6A 2OLKA 1N25A 2GTPA 1WMSA 3IBYA 5H8WA 1OYYA 2WPDD 2XNSA 4V0KA 3BS4A 2LCFA 4WW0A 2GEUA 2V6JA 3R7WA 2QE7D 4B34A 2IUTA 4RD4A 2YKGA 4JYBA 3ETLA 5FBWB 4ESVA 3FVQA 4Z51A 4HAYA 1G5TA 1NBMA 4I1OA 3AVWA 1IXSB 1EESA 2JLRA 2VP6A 1R5BA 4QRHA 3GFOA 3KJHA 4G5OA 4GT1A 4LJ5A 2HYIC 2ODBA 2WHXA 5FR1A 3WHLA 2NPIA 4YXWD 2HYDA 2TMKA 2ODEA 4PO1A 2BCGY 2YOGA 1Z0AA 1A2BA 1OSNA 1SXJD 1FW6A 4DLWA 4Q4AA 3K09C 3KL4A 4IDQA 4NU0A 4A2WA 1S9HA 1A5TA 2PMKA 3U4QA 4B71A 3TVTA 1Z07A 4UJ3A 4Q4JB 4JKYA 3K70D 4CGZA 1SKQA 2PH1A 2ZR9A 1JXMA 1SVMA 2ZI6A 3W6NA 3FHTA 1ZC3A 4Q1FA 4QGFA 5HR5A 2NO0A 3L8YA 1LF0A 4C7OA 4EPTA 1AN0A 4BASA 3CZQA 3H86A 4BFVA 3TRFA 2RGEA 2D7CA 1XCMA 2F1JA 1T5IA 3PUXA 1M74A 5AJVB 821PA 2YOFA 3FPAA 1U2RA 3HWSA 3QPUA 3CWQA 4I81A 4KV9A 2XSZD 3KTAB 4JL8A 2WICA 3CH4B 3THWA 2OV2A 1T3HA 3V4FA 1NBME 3MJRA 5L3SA 4ZCMA 4CIDA 1KO4A 4LHXA 5JS8A 2MSCB 5LPNA 4TLCA 1W0KD 3AVYA 4OQNA 3QENA 1X3SA 3GLFB 1P60A 3AKCA 2VP9A 3ZIAA 4QM6A 5E7IA 2JEOA 2YWEA 3U7FB 1FTSA 2P2LA 2UZ3A 4HAUA 3RS3A 4IEIA 1R2QA 4TLEA 3BGWA 2WPDA 3RC3A 2XNDD 4IW3B 3FMFA 2FSHA 1OIWA 2QE7A 5LD2C 3MWKA 2QMOA 5EE1A 1YR7A 3W34A 2X8AA 1SHZA 2RGNC 4HAVA 2NQ2C 2G9NA 4JLAA 4XVUA 2ATVA 3THYA 2RCNA 2R6FA 5KNCA 2NO9A 3D31A 2YNMA 1DG1G 2VHUA 5TMPA 2H8KA 4XSGA 4V03A 3B9QA 1AQUA 5CDFE 2VRWA 3RC8A 1ZU4A 1XJ0A 1R8SA 4YXWA 3SHWA 1C9KA 2CL0X 4DSNA 3ADDA 1SXJA 5B57C 1XMVA 1Z0KA 1MO6A 3MJHA 2HT6A 1FMLA 4A0RA 5KHOC 4QGGA 5B64A 5KTYA 2C03A 3CWZA 521PA 2E9SA 3KKOA 1WQ1R 4E5UA 2CE7A 2HCJB 1NJGA 3HU3A 2O8BB 2FFHA 2RHMA 1WDTA 2ANBA 1E9RA 2HJGA 4XVQA 2OHFA 1HT2E 3WBKA 2D7DA 1RE0A 5KNBA 2K5UA 3WP1B 2H7VA 4AC9A 2QSZA 2AK2A 1SVLA 1OXVA 2JJ2D 5EP4A 4BRWA 3O8CA 5FBVB 4DCSA 5F98A 1MT0A 2YYZA 3MFYA 1YZUA 3C41J 3M1IA 1XCPA 3TJZA 4LPSA 4JSYA 2G0NA 3WP0A 2ZXUA 5BN3A 4C0SA 3SZRA 2GVZC 3H2YA 4MA4A 4F93B 2XSZA 3GLIB 2F9MA 3UPUA 3HU2A 3IKJA 2QTHA 3SHFA 5EJEA 3W9YA 4AD8A 4RFVA 3AP3A 2NO1A 5JSZA 4GRAA 3E5HA 3O8RA 4BE7B 2SHKA 2IXFA 1W0KA 2QL6A 4JJZA 4B74A 5CITA 4FMDF 3OIUA 3RHFA 2H57A 3Q7QA 4FMCB 4LJ6A 1T6NA 2RH5A 3T12A 2BVNA 4GOKA 4OQXA 4EPVA 5EP1A 5IHPA 3F5FA 2D3WA 1XEWX 5B2ZA 2XNDA 1YE8A 3CH5A 3B1WA 4TYPA 4MRPA 2YC4C 1LTQA 1MABA 3VQTA 3DOFA 1HE8B 3CPHA 4LI0A 2Q21A 3S1AB 3DM5A 1F2UB 4OI0A 3N5CA 4CEHA 2H5EA 2HV8A 4TWZA 3QSYA 3I5YA 3WXMA 1E4YA 3GLGE 2V7QD 5DI3B 1SKYB 1JB1A 2VF7A 4NMMA 3NIBA 4NTZA 4G0NA 2ZE6A 4TT3D 1ZD8A 5DI9A 4Z1MD 4LYAA 3TIFA 4ILEA 5FUVA 4CW7A 3OEHA 2W00A 2D2EA 2CEAA 2ODWA 2OCPA 4FCTA 2OFOA 4DCNA 1F60A 1NLFA 4KI0A 1RRFA 2VLIA 2CNWD 1YZTA 2REBA 5JWRA 5FTLA 4KFSA 2OILA 2HT1A 2ZUCA 2IYUA 2V9PA 4ZIRB 1KI7A 4KFTA 3IIKA 3EC1A 1M2OB 2GWHA 2WKPA 5AJXA 2QMUA 4JS0A 4TLBA 3EZFA 3KQHA 1C1YA 2J0SA 4QKQA 3LX5A 5P21A 3QVVA 1AS0A 1RVDA 2A5YB 3CX7A 2VP0A 1XTKA 4OK3A 4XVRA 4DKXA 4LGMA 1Z83A 1NMZA 1JJVA 1Z2CA 5EE0A 3L0IB 1E2QA 1VCIA 5BWMA 3X1DA 2ZRAA 1HQCA 2P6UA 5CB8A 3BB3A 3VHLB 1NN1A 1U81A 3B60A 4B76A 1OPXA 3SBDA 1KMHB 4LHWA 3C14C 5C18A 1ZVQA 5TY0A 1XD8A 1E9BA 2OCAA 3CONA 4AKHA 4RJLA 4L5BA 4Q48A 3U3JA 3K09A 3LA6A 2B6HA 3CF2A 2ZU0C 1R8QA 2ERXA 4TYQA 1F2TB 4TMWA 4OQLA 4PPNA 5CB6A 4QM7A 1FOEB 1RKBA 4L15A 3UANA 3KQUA 1E9FA 1US8A 3OESA 4ARZA 4JBXA 4FWTA 1P2UA 4LWZA 1IN7A 2WWFA 1R4AA 1EFCA 3BBPA 2IYWA 2GJ9A 2L0XA 1RJ9B 2QNRA 4UNSA 5EZ5A 4Y0AA 5L8VA 3AF1A 2BBOA 2JLXA 1ZBDA 3R9IA 2YWHA 2BWJA 3MRSA 1JAHA 1KO5A 1KSHA 4OBEA 2WJJA 3T06B 1VG0B 4KITB 2V7QA 4XTRA 4ZDWA 1II0A 4BLSA 2AN9A 3HR8A 4JVSB 4KHZA 4B3DA 1GSIA 1GNRA 2E1RA 1FZQA 3GEHA 1S0UA 1N6LA 2ZRLA 2C04A 4CYMA 4WXRA 3IEUA 3SYNA 4F7WA 4JL6A 3BD9A 2XXAB 1Z06A 1CRQA 2B8WA 1E0KA 3T35A 4RCYA 1P72A 1P6XA 3F0TA 5FPSA 4G5SA 2ZTSA 5FPHA 5JECA 2O8CB 2CNWA 3HPQA 4TSFD 4RY2A 2HF9A 1E9DA 4NCJA 1ZNYA 1G8YA 2QMHA 2G88A 3X2SA 1N0WA 2J7KA 2NIPA 3LWNA 5EUQB 1KI3A 2VP2A 1CJMA 2NOAA 4A82A 2V6IA 2EWWA 3GFTA 2QTVB 3ZS8A 4DEYA 4P4SA 1E2IA 2XZOA 2FJUA 1FPMA 1IHUA 1VYUA 2VPPA 1PLJA 2DYKA 4RZXA 2RGNA 2VP5A 1MV5A 3K0AB 4UXJA 3B78A 1IOZA 1M34E 3NC0C 2JLSA 4Q7MB 4WVFA 5GVSA 1E2NA 3QUSA 4NPHA 2O8FA 4EJSC 1ONBA 3CF6R 3IHWA 4LY6A 2GHIA 4AURA 4EFLA 3RS5A 1P2SA 2R2AA 5FUYA 3CNLA 5FBLB 1L2TA 3TSZA 4DIDA 4XIGS 3PENA 1J7KA 1S3SA 3VU9B 1CF4A 3OFND 2RB4A 1T5LA 3K8YA 4PAQA 2IL1A 2ZEJA 4IXMA 2FOLA 1G7CA 1YJ5A 2IT1A 2OXRA 3DKPA 4HDQB 2C77A 2ZJ5A 2PZFA 1G3UA 1UAAA 3GJ3A 2CLDX 1VCOA 3TAHA 3EX7C 2N46A 1GG2A 4JIMA 3JZAA 1F3OA 3QF7A 4A36A 2ANCA 1MO5A 4TQ9A 2ZYTX 1SULA 1J99A 1Q1QA 3K0CC 4OL0A 2GCOA 3BAFA 2QRZA 3TE6A 4HDCA 1JJ7A 1G20E 4A6PA 2GAAA 4E07A 4HYYA 1ZUHA 2QENA 3W8RA 1XTJA 1CP2A 3ICEA 4EKDA 3WNCA 4PO9A 2Y8EA 4JYCA 4K81B 4OHYA 1P75A 4HZIA 1TMKA 5KYKA 4RD2A 4DSTA 1OXSC 4Q4LA 4B32A 1II8A 4QJ3A 2RHDA 4PC1A 1R6BX 4TSFA 4A0FA 4CZ2A 1W49A 3FMPB 2OFXA 2WAYA 3ASZA 1G8PA 4ACAA 1VKJA 3LH5A 1DELA 2DR3A 2YJTD 4TYYA 1UBGA 1MH1A 1W2GA 3AVVA 1KO1A 3KXKA 4ASUD 1TUEA 4DT1A 2R6GA 2WSSD 2G83A 1LW7A 2WJIA 3K0SA 3WYFA 5F2EA 5CLLA 2OBMA 4CDGA 2O8EA 3AVTA 5FTMA 4LYHA 1GL7A 4Q5IA 1XXHE 2FDCA 4MKGA 1E2KA 4A8JA 4EPWA 2CHVA 2QPAA 4OYHA 2ZRJA 5TV2A 1NL3A 2IX3A 1KJZA 4LV8B 2PBRA 1KK2A 2QPOA 3GLHA 1OFIA 3QEJA 1U9IC 3EZ2A 2PT7A 4R2IA 2G6BA 1DE0A 1E32A 1N6OA 3ADBA 1TTTA 5CM8B 4DDWA 4GP7A 2AD5A 2ZRPA 3QKSA 1IQPA 2IK8A 4JLMA 3O47A 2C98A 3OFNA 3FKSD 2ZYUX 1UKZA 2YWGA 1I4TD 3RVBA 2O0KA 3QBVA 2Z5FA 4B75A 2DCUA 1FX0B 1Q1BA 1V5WA 2F43B 2OT3B 1DARA 2Z4SA 5FOWA 2FE4A 4Q1EA 4X8HA 1S1MA 2IS4A 2NZ8A 2QG6A 3W8NA 1VTKA 5BXQC 4JT4A 5D3QA 1P9WA 4TN1A 3KFVA 4YMWA 1KK1A 1Z29A 5J40A 1EGAA 1N5KA 2W83A 3FHOA 5JEEA 4K46A 4UNQA 1ANKA 1BYUA 1ZD1A 4AKGA 4V0MA 4OHXA 1S2MA 2O52A 3T61A 5K8LA 3A1SA 4GZMA 5FUWA 1E69A 2IEZA 5DO9A 1U0LA 3DZDA 3LLUA 4G3XA 4Q66C 4Q4HB 1FTNA 4KXFB 4RVCA 4HB2A 1L7VC 1NLYA 1TADA 3CR8A 3KQKA 1QVRA 2ZQ5A 1AKYA 2ZJ2A 3PUWA 1ELOA 2ZI7A 4JLVA 3IEVA 3WNDA 3A4LA 4BPBA 2ZVPX 3BFVA 2QP4A 4PZZA 5A4JA 1G4UR 3A36A 2PLRA 1KMQA 1KY2A 1G6OA 4O2RA 2XGJA 4ASUA 3D7MA 4BLOA 2WM9B 4PPQA 4GOXA 3SS8A 3UKDA 4C9BA 5TB5A 2JCSA 4LHYA 2GCNA 4O25A 5EXPA 3HDTA 4D6PA 3T5GA 5HZHA 4AKIA 1XNJA 3THXB 3ZZUA 1GTVA 4C30A 2FF7A 2N42A 1Z6YA 5L3QB 3I32A 1E9AA 2OG2A 4XWKA 1WA5A 4DCVA 3BK7A 221PA 1E0SA 1VYVA 2CBZA 4A2PA 1KO8A 1P9RA 1ZP6A 4AYXA 1F5NA 4Q00A 3GMTA 4YC7A 1M7HA 2F6RA 4V0ME 1DPFA 1E9EA 3B5JA 3FKSA 3BXZA 2HLDD 1VCMA 2FEOA 1NVXQ 1QDEA 5C2JB 1XTSA 4QBGB 1UFQA 1S1CA 4B3XA 3K70C 4Q4JA 3R8FA 5CLQA 3CX6A 4LJ8A 1OW3B 4B73A 1GZSA 2PEZA 5DSZA 3KKNA 3D8BA 3ADCA 2GNOA 2Q3MA 3FHCB 3PUYA 4TQUS 3GCGA 2GJ8A 4AI6A 4XSHA 5FOXA 4EFMA 3NBZC 5DN6D 4MRVA 3ONWA 2OBNA 3UIEA 2BKUA 4C3ZA 1OLOA 4U7DA 4Q19A 5KO2A 4ZI3A 2C8VA 3BFKA 2PEYA 3X1ZA 4F4CA 4Q02A 2XZPA 5GJWC 3U61B 5BYKA 4GPTA 5DHFA 4PHFA 2ZJBA 2B7BA 4PZYA 4EJSA 3DDCA 3MGCA 5LB2A 2EFCB 3W90A 2BBSA 2GAOA 1HURA 4LSGA 1OXXK 2I1VB 4LHVA 4C0JA 3U6BA 3ASYA 2DWPA 4RFSB 3GJ4A 4C0QC 4HUQB 5LB4A 3KKQA 3VR1A 1G8HA 2OE2A 1W44A 1JR3D 2ZRMA 3A58B 3T1OA 4ON9A 1QG2A 5FUXA 4OQFA 4TMXA 1HEIA 3NVAA 2YVUA 4OK6A 2GESA 1OXUA 3B7GA 4HB0A 2XX3A 1F48A 2DFNA 4QBIA 4MYCA 1MR3F 3VNUA 2GZAA 1D5CA 4FCWA 3U3RA 3RABA 2H16A 2IF2A 2AKAB 3WBJA 3CRRA 5KDDA 3SI7A 2F7SA 1YZKA 4BZQA 4B35A 2FSIA 3BB4A 4LHZA 4NDZA 1FMJA 2Q6TA 5AUQA 5KDOA 3G82C 1CBUA 4JBWA 4M9SA 4KFUA 4EIWA 3V9PA 2QQEA 2QORA 4JBYA 4LC1A 1T0HB 3UXMA 3EC2A 1Q22A 2HLDA 1LY1A 2PL3A 2GETA 4DEXA 3PVSA 5J4HA 2UZIR 2J1LA 2A5DA 2WJGA 4NYMQ 4B43A 3EG5A 1O3YA 5SZIA 2VP4A 4PPFA 3U60B 2A5GA 3TBKA 2ZI3A 4A2QA 5JFGA 3SQXA 2WWHA 1XEWY 2J0UA 2CVHA 3TR5A 1T91A 4BLQA 2WIAA 4BRUA 1GILA 1UF9A 1N6RA 1JR6A 1VMAA 2E87A 2IYVA 4A15A 1SVWA 2CMKA 4IVRA 1E0JA 2FWRA 3C16C 5DN6A 5IK2D 1KI6A 2GF0A 2IXEA 1NIPA 5UKDA 4IOKA 2PT5A 2ZANA 4DUGD 1AIPA 2Z0MA 3EIHA 5FOUA 1WE2A 1TU3A 2BM0A 1QHIA 3GLIA 4I1SA 1KKMA 1U9IA 1Z0FA 1U8ZA 4IVPA 1W5SA 4PTLA 5FPTA 1FP7A 3EZ7A 2ZRCA 1TQDA 5JCZA 3RYTC 2JDID 4NYMR 4V0LA 1GWNA 2B21A 4AG5A 3BB1A 2ONJA 1E9SA 1G18A 1OHHD 4A6XA 4B3GA 2BC9A 4M1TA 5BW8A 3O8DA 5JRZA 1YZQA 2JLQA 5C1BA 3LDAA 3N2IA 5J4VA 3PEYA 4OK5A 1J90A 2FZ4A 4R2HA 3S1AA 1J8YF 2JLWA 1F2UA 1S4QA 3K0FB 2VHQA 4ERNA 1FUKA 2R6AA 4EUNA 3TGPA 1L4UA 2CL7X 1Z5ZA 3WRXC 4EQ6A 1D2NA 1YZLA 2CLSA 3O8BA 4FWIB 3MD0A 5AUPB 5DI3A 3X1YA 3QF4B 2XB2A 3I5XA 1N5IA 2QGZA 2X1VA 2JJ8A 3TUZC 4UKDA 4BGDA 4NCHA 3HU1A 4BFSA 3BORA 1GRQA 3U44B 4B3CA 3T1TA 1IAQA 2GK7A 5CJPA 3QKUA 3WHKA 4EFNA 1XD2A 1B0UA 2XOKD 2ONKA 1NIJA 1A4RA 4KO8A 3V4RA 1G9XA 4MGYR 2V55B 1OYWA 3W5JA 1D9XA 1E1RD 5SZJA 3FFBA 3SQWA 2D62A 4D0LB 4P3YA 2IYSA 3LXXA 3KKMA 2OO7A 2MMGA 4JLPA 2VF8A 1GNQA 1W47A 1OFTA 4CT4B 3ZYCA 1Z6XA 1G3QA 3BH7A 4DUGA 2W6ID 2ZRBA 4PC7A 1KI8A 3P1JA 1OB5A 4KCGA 1KNXA 1IN6A 2GILA 4JLNA 1CR4A 3M6AA 3CIOA 3GJ7A 2YV5A 5J4KA 4FMBB 1N3BA 2PMDA 3AGQA 4OHWA 1KMHA 4JVNA 5FL7D 4DJTA 5JLJA 3VR6A 5CYOA 1UKVY 3PIRA 3ZD6A 2JDIA 3B6EA 3Q5DA 5GJVC 1DEKA 5JEDA 4LPKA 2AL7A 3PEVA 3KDSE 2IS6A 3UMRA 2W0MA 2Z6VA 2AHOA 1N6HA 1OHHA 1V43A 4LJ9A 1T4GA 4Q01A 1F2TA 2IYZA 5D3MB 4B6FA 2R8RA 4RD1A 1XEXB 3OEED 3TQFA 1ZM2A 2EFDB 4JMPA 4OI4A 1W0JD 2AWNA 5J47A 5F9HA 2HXYA 1MRNA 5EP3A 3EASA 4P31A 3HJNA 4X8LA 3SNHA 5JI2E 1E2FA 4JLOA 5JHHB 1VIAA 2OFWA 3ZGXA 1SVKA 5B58C 4Q9IA 2GEDA 3C8UA 2BJVA 2C9OA 1T8TA 2RGXA 4PSVA 3DVLA 4OJKA 4ZO4A 2ZJZA 1R0ZA 2F3RA 5TDHA 5LDDC 1W48A 4DLYA 2XXAA 4U00A 2CJWB 3SDZA 1I4DD 1K5DA 1VHTA 1ZNZA 4IOMA 1OH8A 1CR1A 3AGPA 1W2HA 3LW7A 2AFIE 121PA 4ZCIA 1P5ZB 2IYLD 2O5VA 4O2LA 1KAGA 5FBRB 4DDUA 3U3MA 1FUUA 2XOKA 1MOZA 3VR3A 3EA0A 1TF5A 5GJBA 1NKSA 1SQ5A 1E4VA 5TXGA 3KQLA 1SXJE 2RGDA 1KDRA 3I3SR 1E1RA 1MRSA 1PJRA 2J5XA 4A1FA 1YHNA 4TYNA 4X8OA 4B3FX 4CVNA 1VG1A 2J41A 1VECA 2WWIA 3KXLA 2KSQA 3KFXA 4X8MA 3UK6A 3T15A 1ZRHA 2P0EA 4MRRA 4F4JA 1GP2A 4N3NA 4A8JC 2W6IA 1UBEA 3K0AA 1F6BA 2ZSAA 3TUIC 1A1VA 1ZAKA 1NKTA 2ZIAA 3CPEA 4H9GA 2V4ZA 1G8GA 1KYIA 1WP9A 1MO3A 4DBLC 3L0SA 3L0OA 1KI1A 3QXSA 3I4LA
chains in the Genus database with same CATH superfamily
1OFHA 2PNOA 3CW2A 2Y0CA 2ZYDA 4LWPA 5ELMA 4W5OA 3IJPA 5J2UA 3NS7A 4IDOA 2ZREA 2PZEA 1ICEA 2WUWE 3JALB 4ZDKA 4F2GA 3KR9A 2XKAA 2OXIA 5I51A 3OQIB 5E4JA 3TCKA 4CBVA 3SP1A 2R9VA 2XNJA 4UDYX 3P0HA 1BX3A 4IM7A 2OCKA 1FRFS 3L7BA 2GN6A 2VK8A 4FYMA 3DD5A 4WADA 5CHYA 1N2CA 1FFSA 1UPCA 2EKPA 3A1TA 1KMIY 3HFSA 1WWPA 3LY7A 1MO2A 5E6SB 3VH4A 3V5YA 3ESQA 2Z6AA 1SUEA 3CUYA 2H2FA 4DQDA 3DEAA 4RK0A 3T4UA 1W0CA 2QQGA 1MJGM 3MGKA 2G80A 2FU5C 4UHFA 3SBOA 2FZCA 1KHTA 4TTJA 4CN9A 1DRVA 2VTKA 3OJCA 2J3LA 3T7SA 2EBUA 1QQ6A 4GGOA 5KMGB 3AQIA 2AEFA 2IW1A 2OCBA 3E23A 2Q7XA 3VZBA 3IA2A 1GNLA 5EXEA 5HJ2A 1LTKA 4TV9A 3L1VA 3MC1A 4CU5A 1YIOA 3KEMA 4X54A 5E3IA 4RSGA 2YYAA 3GJ0A 5CX1A 1QANA 2DC1A 3HCRA 3N2KA 1RHKA 2VATA 4L7VA 5FI1B 1NNSA 6Q21A 3LVRE 4JTCB 3RIHA 4BKUA 2VHCA 4MPDA 1S7ZA 1J00A 5KU1A 5HUQA 5K3BA 4DADA 1BO6A 3WL3A 2BTQB 3IP7A 1QWSA 1GKKA 2CVFA 2YXEA 5JVEA 2JIZD 4F2PA 1D1SA 4LOJA 4EB8A 5KUTA 1CQZA 1BW9B 4EF5A 3VNAA 3DFMA 3RRMA 5AQ1A 1F0KA 4URXR 2NSGA 3LMKA 5E95A 1KXJA 2ZLBA 4DBLE 1CZHA 1EB8A 3W0LB 1ZIXA 2PSJA 3VC7A 3CN9A 5HS6A 1UJNA 4IIEA 5BQPA 1N6PA 2DFDA 3D6JA 3L6CA 3LXMA 4KE7A 4HGNA 3HY4A 4FSXA 5BQ5A 1XVTA 3ZGLA 1UMBB 5KOIA 1OZHA 2AQHA 3DDUA 1G7RA 4BMXA 4JYPA 1N92A 1QKJA 3RI3A 4R2JA 4INJA 4F97A 1YACA 1GXSB 3R20A 3IPAA 4KYVA 4GUAA 1QK3A 3WMEA 1ZVVA 4B33A 2DFPA 5D2CA 4OGGA 1O77A 1ZHHA 3G2MA 4AUMA 3A1FA 4IEFB 4CUKA 3GLFA 4NJMB 2KLHA 4NOLA 3OKAA 2ABWA 4NKRA 1UAYA 3IKTA 3G59A 2HR1A 1XKTA 3QKSB 1XTPA 4YLEA 1XRRA 4HJXA 2P9YA 1EFUA 3UHPA 3FOPA 2H4XA 1F06A 1MJFA 2I4LA 3QOXA 1ESZA 4PYNA 2A92A 1K97A 2OK8A 1K5GA 5AW6A 4P0TA 5A71A 2FLWA 3GMDA 4EJFA 4HI0E 1UJ2A 4CIPA 4Q3KA 3PFWO 4GL2A 3BH0A 4ZEVA 4J6EA 2C78A 5BORA 1Q15A 4R1UA 5JZBA 4CIHA 1YVIA 1GZ5A 1SC9A 1Z0IA 1Q0GA 1GT6A 1T9KA 4BVFA 2WBLC 1KQ3A 2R6DA 4N4WA 2FE1A 1Q0TA 3U0BA 5J2TB 1OCZC 1C7EA 2AFHB 2WYIA 4AS1A 4OIRF 5HMMA 5HSGA 1CJTC 1UK9A 3HI4A 3X1KA 5BR1A 2HMWA 1R5OA 1YS7A 1RWBA 1KZ9A 3WGNA 2IYXA 1DAIA 2QP9X 4CMIB 2BMFA 5L3RA 4MYTA 2HHAA 4TTSA 4XIFA 1X6VA 2LW7A 4ZQCB 2WIJA 3L4EA 2C3UA 1TC2A 4NV3A 2ZYGA 2DP4E 1LF5A 1NJ5A 2JHFA 3NBYC 2E1PA 4NZ9A 4G1UC 4B3SB 1IVSA 1FFGA 2XTNA 4TUYB 1OQCA 4OJNA 2C5LA 2I6XA 1L5RA 4DXWA 1XJQA 8LDHA 3DVSX 1HK7A 1D0XA 4K1XA 2ECQA 2GPTA 2WTEA 1ZEJA 2BFBB 1IY2A 4B4UA 1K9VF 5A7FA 1RI1A 4S04A 3VDMA 2ZYWX 4EY8A 3KLPX 4QUEA 5G4KA 3EWAA 2JAWA 3H5VA 4CKBB 2KS6A 1GTJ1 3DLPX 3PG5A 4I1OB 1KOJA 3DTYA 1E3QA 5LYYA 4UTPA 2ETSA 1UBRS 3HB5X 4MV6A 2RHHA 1FBNA 2GBLA 4MVWA 2V59A 1N0VC 1EWKA 1RXUA 2IKQA 4JODA 5I9IA 1M1YE 2OBLA 4BV2A 3KHUA 4JAVC 1B73A 1Q1NA 2P1ZA 1NXXA 4HWSA 2E89A 3TLGA 4X60A 2VOEA 3UWKA 3C5EA 2UZ1B 5JS2A 3TZKA 4FFMA 2NYUA 4JHLA 1RXWA 4Z7QB 1EXDA 4J0QA 2OO5A 3ROZA 1MTZA 3GYGA 4MLZA 5LLDA 4YVFA 1RM5A 3CXRA 3R0ZA 4RUKA 3VKFA 2YHSA 2QRHA 3BJIC 1BKDR 2VWGA 2GXAA 1YR3A 1T9CA 3B1XA 2HREA 4ES6A 2QX8A 2CNDA 3ROQA 4B7CA 7ADHA 4IZ6A 1R9MA 3DBHB 1EWTA 4LXHA 4OYYA 3BF8A 3WLNA 4HNAA 3HVUA 2FTKE 2YV1A 1H7IA 3GP5A 4G0QA 4RDXA 1DJNA 1U7ZA 1FX0A 2Z3VA 3SZMA 4IZOA 2A78A 3A8TA 4YJHA 2ZUFA 4GMHA 1H6DA 2NUAB 5IKPA 4DY6A 4PR9A 2GR9A 4A0GA 3KG2A 4HY3A 3EVFA 3C98A 4P1ZA 3ZS9A 2FN8A 2D6FA 5JS1A 4QE3A 1B16A 1Z4NA 4CQNA 3CU5A 4N12A 1TU0A 4FOLA 4PBRA 2C20A 1W5EA 3EE6A 3PNBA 2XSEA 1Z4IA 5JSUA 2X6QA 1E5XA 4RAOA 4L5JA 2D4HA 1C1XB 4R71A 1Q3HA 2O1WA 4RVFA 4GIBA 5A5EA 3CVUA 2O2YA 1M7GA 3F8SA 3WLMA 1JIXA 3ITKA 4XD7A 3TECE 3V1UA 2IU6A 1IJEA 1MIHA 1KKUA 1RHJA 3VKWA 5JXGA 2IWRA 3IDOA 1KSGA 1BWRA 1NVKA 2Q99A 5EPUA 1ZOLA 3RYIB 1ZJYA 3QW2A 5IZCC 4R51A 1NU8A 3TR0A 5SYAA 5K0SA 2MSWA 1Y3FE 3AERA 1VQ1A 2ETXA 4RIEA 5JYCA 2DR0A 3PT5A 1G2PA 1E99A 5TS3A 1N2XA 1XP5A 4KYUA 5B1BC 1FU8A 3C1UA 2RGGA 1Y1LA 1EFRD 1X74A 3DJNB 4HPWA 1Z3CA 3SVZA 1TQHA 4AUNA 3FIJA 2IHBA 4OOFA 4RPCA 4LJSA 1AMNA 3RBXA 3FFAA 4UE2A 3P9PA 5JTUA 2C9YA 1EGHA 5AW7A 1M8PA 5CHEA 4HH4A 2WYUA 1FSSA 1PFUA 1Z4JA 5JZSA 5CDHA 2GUGA 3PGKA 2YASA 3G2OA 1XU7A 2OKGA 4NOKA 5K3CA 4U7HA 4F4UA 2AOWA 3NDJA 3ZV5A 3D6MA 4LVUA 3V55A 1KVRA 4M9QA 4BZZA 4NNPA 3KUCA 3M9WA 2PMCA 3B3JA 2PD4A 2Y76A 2AEMA 3OPVA 1G8JA 1ODSA 3OIVA 5CPBA 4U02A 3IAFA 2L6GA 3G4ZA 3IP9A 2PYDA 2H7OA 3OPXA 1I5NA 5HHTA 3E9NA 4CQMA 1GCAA 1THTA 4UPVA 4DLVA 1PWHA 4HGYA 2GEBA 1FMFA 2QEQA 3ZD7A 2J7PA 4J03A 2UXCB 1NV9A 1JQAA 2Q7OE 2OZLB 3KQWA 1ATIA 4FFPA 3X1WA 2B4YA 4R0VA 2I62A 1DMRA 3QX7A 1E3JA 4UE6A 3HBNA 4M36A 4BECA 3FOWA 1YA6A 3HJCA 1MAAA 3HJRA 4LCBA 1OIVA 1TM3E 4AU1A 3IAEA 4UTRA 2JJMA 1PDVA 5H3LA 2HSZA 4MV4A 3FWNA 3TIGA 2QE7D 3RAEC 4CBEA 4G81A 5LN1A 3W5UA 2HQBA 5C8VA 3MGAA 2H54A 1CNEA 5DTQA 3W05A 5CVTA 2OGZA 4UD2A 2A86A 2GK4A 3CEPB 5A6SB 4DPLA 5EZSA 2UZ4A 3AC0A 1QP8A 3OZCA 5KNBD 1TLFA 4NC3A 5KYVA 3WK5A 3RGWS 4D42A 5CAEB 4ESEA 1VL0A 3HABA 4NF2A 3K31A 1HZJA 1HT3A 5U4QA 4CF3A 3SLRA 3TKYA 4RC9A 5T3UA 4CIDA 2WSIA 4HDKA 3E4CA 4Q6BA 2P2SA 5E7IA 3H2IA 2FR0A 2TMYA 3O2NA 1R2QA 3PUJA 4D9CA 2B1QA 4CKYA 1NC3A 4BO0A 4OD0A 3TVYA 2R6FA 3D31A 2GBGA 1DG1G 3GHYA 4EA8A 3ADDA 3TMYA 1Z23A 4Q9AA 5I8WA 3A6FA 2CE7A 1ML3A 2FFHA 3NFYA 2GN0A 4HVCA 4TKUB 4F6CA 4AC9A 2JGKA 1PBNA 1UUFA 1Y8QB 3A9SA 4WLVA 1JJBA 2W6OA 4YRGA 3ITFA 4M83A 5I8ZA 3V80A 4OP3A 4JRZA 2OEXA 3SZRA 3GJZA 3H2YA 5FULA 2R8EA 1IRXA 1NVTA 3RRXA 3IKJA 3W9YA 1IPHA 3O55A 1P81A 4LJ6A 3IVMA 4HFFB 1VLJA 4WKOA 4DC1A 5JDCC 3KZMA 3T1NA 2OVFA 4XCXA 5F1PA 2CZQA 1L4FA 3HCNA 3T7EA 4LTNA 1E4YA 1I8TA 4LF9B 3LZDA 5IKMA 1JQ5A 5DI9A 1J4AA 1G21B 1JWAB 2OCPA 3E7PA 2FW0A 5LWQA 3TEFA 3AHEA 1XQ9A 5B4TA 3WKDA 2J0SA 5P21A 1NYQA 3ZCTA 1V55C 5I5EA 1F6WA 3CX7A 1XTBA 1Z83A 3T9BA 3FJYA 2NUTB 4I9UA 3D64A 2ZUVA 1YDFA 4GVPA 5CIYA 1G0NA 3BAZA 4L15A 1C5KA 2WP8J 2RONA 2O2JA 2GJ9A 4OBBA 1RJ9B 4ULVA 2XQIA 4Y0AA 2BZ1A 4OBEA 1JAHA 1APCA 1XAHA 2E5FA 3R0JA 2FPGA 4CLXA 4AL1A 4WXRA 4Y67A 4QFCA 1EQ1A 2RI1A 2CNWA 5CU7A 2DX7A 4Y6LA 2NV0A 3GFTA 3ZS8A 1JKJA 3HN6A 4DCPA 4HFMA 5E8JA 3ZJTA 3A1DA 2GHIA 3NJRA 4N39A 4K9MA 3EAFA 3HCWA 2QRQA 3O8OB 3LHFA 1T5LA 2JFOA 4HKTA 1O95A 1RS0A 1MG5A 3EX7C 1I2ZA 1GG2A 1CDZA 2NWQA 2EF0A 1NZEA 2OV3A 3VJMA 1MV8A 1C7FA 4GI2A 2XMRA 1BFDA 5CP8A 1T43A 4NBKA 2Y8EA 1JQEA 2PUVA 5AI5A 1YB6A 3GDOA 1IM8A 4F5ZA 4LE0A 2FZGA 1IEXA 3PP8A 1USWA 1TEHA 4DT1A 1D4OA 1XWFA 3A6ZA 3BHNA 3JAMA 3CWCA 2ZRJA 2DGDA 3K1AB 4NBLA 4LRTB 4GVXA 4P80A 4O2AA 3SHVA 5F4ZA 2ZBFA 2HS5A 1JR2A 3O47A 4ESOA 5KNBH 2O0KA 4FOOA 1Q1BA 4PK4A 3EYAA 4U8HA 4RABA 3W8NA 4XQ1A 4B6PA 1NULA 1QTRA 1PEYA 3QP9A 3E3OA 1SIBE 3RC2A 5F1OA 1V0JA 3BIOA 2CL5A 4PSCA 5IN5A 4Q4DA 2OC9A 4Q66C 1STOA 3K0BA 2ZJFA 4KXFB 4MB0A 1AKYA 2KNHA 1RJGA 3A4LA 5BURA 1W1UA 4LGCA 4B6IA 2Y93A 5TB5A 4DR6B 2H11A 4O25A 4FT2A 3ZZUA 2QZJA 3OA2A 2OG2A 2QWXA 4I50F 2CBZA 4KRXA 3FKSA 3LIIA 1KEWA 4N6GA 1QRSA 1BKSB 1GZSA 1XVIA 4QXOA 2BUCA 3I9OA 3NBZC 4G8BA 4NXNB 4MUXA 1WOLA 4WCDA 3C8ZA 3PFBA 1ZDMA 3K1YA 1WU7A 5JDIC 3NAMA 1HURA 1WR8A 3T6BA 2Z56A 2D5LA 4IGAA 2WSYB 1RQ7A 5J3JA 4XEFA 2ENWA 5FUXA 2QV7A 4QBIA 5LA6F 1MR3F 1SYQA 3KH2A 4D0SA 3M1AA 5AW1A 3W5SA 1VPTA 3T9DA 2HMZA 1PZHA 4M9SA 4KFUA 2QQEA 5CNIA 4YQYA 4BX9A 3ZHSA 4DS3A 5TQ0A 4LC1A 3AI3A 3UXMA 2EIXA 1Q22A 2ZDGA 1QGED 4ETIA 2QVGA 1JL3A 3U60B 4R8SA 2A0UA 3MBKA 3ZNQA 3IXLA 2E87A 3C16C 1KI6A 2GF0A 5UKDA 2PT5A 4L6RA 2VWQA 4P98A 3VR6D 2F1KA 3QU4A 2B21A 4U5EE 1HG0A 2ONJA 4B3GA 2E37A 4M1TA 3O8DA 5JRZA 2DBZA 3AINA 1E86A 3IEKA 4XE5A 1F2UA 4N7RA 3HVRA 1V45E 5AKGA 1Z5ZA 2N75A 3DEIA 3TIXB 3I5XA 3KXPA 2IELA 2ONZA 3OZFA 4UU8A 3T1TA 3F9IA 1Z62A 5K0ZA 2D62A 1V9LA 3KT3A 1H4VB 1VE3A 5BT9A 1D03A 1SU6A 2PQ6A 5CPFA 1PL6A 4H1HA 5ER9A 4PLVA 2IIPA 1RQNA 2EJVA 4QYMA 5ICEA 3B3FA 5DXAA 1NUTA 1GG5A 2ISSD 4DDKA 1XCOA 2JDIA 1KHHA 4YMGA 4KDEA 4RD1A 5WRFA 2AWNA 1DZIA 1Y89A 5IJ9B 4TXMA 3MBOA 4JLOA 4BKOA 1VIAA 3ZGXA 4W9NC 3N24A 3EQ2A 1QO7A 4TWRA 2F3RA 4ZGBA 1WZCA 4DLYA 3RGGA 4XGNA 1IDOA 1VRVA 1KRHA 4HADA 2OB1A 4DM7A 3LX6A 4JELA 5FWDA 4G4SO 2HMQA 5TXGA 3KQLA 1EVEA 3MB8A 3CZ9A 4MW2A 2H4JA 5F1YA 4OA5A 4P86A 1NP3A 2VTBB 4I66A 2L18A 1MEJA 1YIAA 5L0GA 3I4LA 4Y30A 1XTIA 1W4RA 3H2VA 3MWJA 4GBJA 1F2DA 1TEXA 5FYQA 1EXVA 2P78A 2C2WA 5LP6B 1NE2A 4UMDA 1AMOA 3S0XA 1YR6A 1A9XB 1T0IA 1V1MA 1I5EA 2WOOA 4M46A 4HUTA 5D5HA 8AT1A 3B9PA 1F0PA 3D7NA 1L1QA 1E8DA 2PSEA 2QI9F 3WIDA 3NDIA 2X6TA 1HPLA 5BYJA 1NLUA 1N2JA 1HF3A 3B20A 1PUJA 3YASA 1QYRA 3ML1A 1TA4A 4PLHA 4ZT3A 3WYAA 4CM5A 3IP8A 4LY3A 4MVJD 4JJEA 4WBNA 3DOEA 1A4IA 5E2IA 3GLGB 4EGFA 1Z45A 5KQMA 3LBYA 2Q1XA 3SR0A 3O9MA 3KT6A 2AQKA 4RZQA 3RRNA 3U17A 1DAPA 1GADO 5TMEA 1A96A 4CN8A 3SJAA 3OIFA 3ZZTA 3KEOA 1NVUQ 4OHBA 4ROSA 1YONA 3K0KA 3H05A 3M4ZA 2ZKIA 1XDBA 1COZA 3AFIA 5KSYA 2WYWA 1SQFA 1MABB 3CUVA 2J0VA 1I4WA 1CETA 621PA 2QVLA 3D3NA 4UC0A 2F8TA 1XWJA 3I72A 3K35A 4WBSA 1QQ5A 4JJKA 4Q1VA 4S1OA 3HNLA 2QUAA 4EF4A 4R69A 2A14A 4Q39A 3S1SA 2DUMA 1JG6A 5D6OA 3LBFA 4PZLA 1GGVA 3KUKA 4NYJQ 4IIVA 4WGZA 1DNPA 6ADHA 3D3KA 5H16A 1JAXA 3LY9A 2EEZA 1OKKD 1Y63A 2WINI 4EJ6A 1TJ5A 4GP6A 1X38A 3KYJB 3VR6H 3ENVA 3A05A 1XTVA 3R5TA 3T5CA 2WNSA 2NU9A 1QVXA 4L75A 1R50A 3AKEA 4FE7A 3O4JA 1W93A 1KU2A 1KYYA 3BFXA 1U4OA 4PO8A 2P2DA 3R09A 2D00A 3OCVA 1Z15A 4KBLA 5AKYA 4A0HA 3BTVA 1EVJA 4YJ2F 3ZU5A 4FCCA 1XF9A 3K73O 3TQIA 5LD2B 3C5HA 3OSUA 5A4KA 1E63A 4HWRA 3INYA 5EUBA 2IUSA 4JP5A 2HM7A 4Q3NA 4AP9A 4TZTA 2IQIA 4QATA 2H7CA 5IM5A 1ODKA 4N48A 5KWJA 1OA0A 1VHDA 3HTXA 1F7UA 1KEUA 3HYTA 1RQGA 3T5DA 2WUEA 5DLQC 4CV0A 1JQJC 1UKYA 5C4IA 1JHOA 3FHJA 1TZ2A 1YK1A 2NZJA 4UEJA 5FLXA 4CF7A 4GSLA 2WG2A 3FUCA 1QU3A 2BFDB 3BE5A 1D2CA 2OZVA 3RWBA 1TO6A 4RHXA 4JY7A 4NZNA 3NMUF 1PHPA 4B3IA 1WPGA 1E4OA 3U44A 3NOVA 4EX7A 3DMTA 2QVZX 1HRDA 1YE5A 1VJRA 3P0JA 1JYFA 2PO7A 5IUNC 5LDHA 3P4YA 4ML3A 3CN7A 3SIWA 1TT5B 5LMUB 4ED9A 1LKXA 1UBTS 1E60A 5BSRA 1YL6A 4CM1A 3MWDA 5JXWA 4EHFA 5AM1A 2HCBA 1H6GA 4RDAA 3HJHA 4PSUA 3EXHA 1KAHA 2HFKA 4N0MA 4C0LA 2ZXRA 3FTCA 3PFGA 2GZ2A 1YQDA 3FF4A 3K1IA 2IBFA 4HQKA 4Z1OA 2MT9A 5G3YA 4BQRA 4HYTA 1JHUA 1UDBA 3SXKA 3IILA 2WZQA 1THGA 4BNIA 2CV1A 4Y0VA 4KXXA 1UC5B 5I7OA 3AEZA 3QI7A 3HJTA 3G8DA 4LS3A 3H1EA 2PGDA 4JJFA 1VHJA 3B0UX 1KF0A 2C5AA 1FLNA 1XWWA 4OLBA 1FA9A 1LV8A 4CLOA 4JLDA 1PL7A 4P33A 3C3JA 4G5QA 5EOVA 3SXYA 5KTNA 1QFMA 4UPEA 5CDFA 5KJFA 5DM2A 2EX1A 1G3MA 4M9RA 3BXPA 2Q9UA 5EWMA 2FEPA 4BMPB 4GNKA 4OUDB 4EJSB 1A9SA 3HYRA 2PX4A 5EHQA 4TQAA 5ELXA 1VI5A 2ZTVA 5B6PA 3VPFA 1W6UA 4FDLA 5EE9A 2UUHA 4V2UA 1K27A 3UWOA 2R4QA 4F5WA 3LQQA 3VDXA 2DE0X 1BHO1 3MSCA 3GJ5A 1E79D 2EFYA 4N8SA 1C3JA 4JE9A 4ZO6A 3VFDA 4OGFA 4IGFA 2EC5A 3QWBA 3HR4A 3A11A 4KQ2A 3K0HA 5JTTA 3TW6A 5AVOA 2EBHX 4ARUA 1HLGA 1PQYA 1G4AE 3VHRA 2AG5A 2OQRA 2Q3BA 1KEEA 2JLYA 2BEKA 3G0DA 2IXOA 1HORA 5JIBA 1T0JB 3VR4D 3ICVA 3TDKA 3O94A 2P75A 3FWYA 1UZMA 4FGZA 1NVWQ 3UH0A 2V45A 2P0NA 4MDYA 4Q7KA 4NZOA 3OQNA 5JNWA 3RSGA 3PJRA 2CDBA 3QIAA 1A0OA 1T3LA 3EBPA 1TCUA 4LBVA 3AEQA 2GYUA 1H2FA 3TIVA 1HGXA 3KUDA 3NWEA 3KR1A 4GLLA 1GIAA 5AKZA 5HSWA 1JSCA 5A6JA 3OG9A 4LZZA 4AZ3A 4MARA 3G9ZA 1C9JA 2VPZA 1DAOA 1T1RA 2J67A 2FNAA 4HFNA 4Z9YA 3OD1A 2I2WA 4L76A 3G1UA 1QFZA 2AMFA 1LWNA 2NPFA 4E0IA 3U7QB 1I4ZA 3K5PA 2CUNA 5M29A 4XIJA 4OPMA 4GXTA 1IN1A 3F7TA 4LRWA 3NUZA 3CBGA 1G19A 3R7NA 3MRTA 5L7WA 4B0OA 3OZRA 7ABPA 1KYQA 2IXBA 2V96A 5JSZB 3RWOA 3PC4A 4XWAA 5K3DA 3BIFA 3DP9A 4MYRA 3JYHA 3DBRA 3NHSA 3WNQA 3LJKA 1AUQA 3A9CA 4F4HA 3T3PB 3TXAA 4EI9A 5C3UA 4BV3A 1NVDA 4N0PA 2PFGA 2XB9A 4OU5A 1AJEA 4N6NA 3ZHYA 3TQSA 3RWMB 5DYYA 4B81A 3FVYA 2P7IA 5F33A 3LV8A 4ZI2A 3A26A 3OPNA 2K87A 2YXBA 3NBQA 3G2PA 1WPXA 1IULA 3PC6A 3PQCA 3LQRA 1GDDA 2W90A 1J24A 4RJJA 1I9CA 1NVVR 3L93A 1RLTA 4IDFA 1BHJA 3U3KA 2IXDA 1NJ2A 4KBGA 3LCUA 3KKKA 1KIFA 3RS2A 3GHHA 5FOQA 1LPOA 4ND2A 4I4TF 4AZ0A 3UN1A 2B34A 3DO6A 4F4DA 3ZJVA 2QD2A 4INZA 2F64A 2R00A 3KR0A 2AH5A 1LC0A 3FOAA 5THQA 1NI4B 3C7JA 3UMJA 1R0WA 1NF8A 2VNSA 2G0TA 4LHEA 4A1OA 4S1NA 1H9TA 4X20A 4KH1A 1NVGA 4IDHA 1AQLA 2P1AA 1V8DA 3Q8XB 4KODA 2R62A 1HFEL 3WSWA 4PE5B 3WY9A 3IBGA 2A9OA 2AQIA 4QU5A 4HGQA 4M1KA 5EZYA 4IL5A 1SUCA 2AWYA 2RI6A 1GS9A 5JO0A 4HX2A 1IB0A 4QI0A 4U6SA 3NQ41 3BYZA 4YMUA 5CLFA 1JDVA 4RWZA 3T1HB 4XJXA 4UTZA 4YJ3A 4X61A 4A5OA 5CLGA 3CZ5A 3CZPA 1A4XA 4RV9A 1WUJS 4CG0A 2ZJ1A 3TNJA 1Z2OX 3IP1A 1D4AA 1NX6A 3KXIA 4P81A 3ANNA 1NBMD 5LQKA 3VR4H 1P7VA 1MIOB 3U0CA 3ZXSA 3WHNA 2BGJA 1VTMP 5CD1A 1QIMA 2XOEA 5HM8A 3WYGA 2NU6A 3L1KA 4F4IA 2P27A 3DVAB 1BCRB 1K0UA 1MENA 4LW8A 2KJGA 1X7HA 1U8UA 4X6LA 2V8OA 3IL2A 2G1AA 2QZ9A 3CZMA 4LDQA 2R1VB 4X7BA 2DBQA 4PGHA 1WCIB 5KHAA 2FRDC 5C34B 2R25A 1YQGA 4QLAA 4FDVA 4GXNA 3IEPA 3HACA 2VYCA 5IP5A 4MS3A 4WW0A 1NFQA 2FEKA 2CNKA 4G5XA 1ZK3A 3ZCQA 1A9ZA 1J2EA 1PT6A 3GLKA 2H1OA 3TRHA 1KZHA 1QH8A 1IDN1 3L18A 4N3CA 1ECFA 3RW0A 3KQYA 4MK4A 5KC9A 2A1UA 3BPSA 6CHYA 1JXMA 1KE2A 1EVLA 3NRJA 3Q7RA 2QHXA 2YXLA 4X84A 3NTOA 4BFVA 3MD9A 1A3CA 1C50A 4WY8A 3UJ6A 4D8XA 1Z8HA 4D4NA 3P97A 2VAPA 2XLDA 1V41E 1Q7GA 5I8PA 1ZW1A 3R6TA 2VP9A 4QM6A 1SU4A 3JSXA 1RM4A 3RS3A 4C7BA 4HNGA 3QV2A 2W8BB 4IIGA 1YA7O 1H1DA 4X3PA 4NABA 5EE1A 4DMGA 5EMNA 2NQ2C 1E1MA 3MJTA 3BXGA 2IX9A 2WABA 1JG2A 4MS1A 3GRZA 4REOA 1SXJA 2FP3A 3MJHA 1GGNA 4U5FE 5CCBA 5COMA 4PG8A 1KZ4A 2O8BB 1YI1A 1WDTA 2ANBA 1TTQB 3WBKA 4AJ1A 2R7LA 3ZX5A 2WZDA 4GDMA 2NYRA 1G5QA 3R77A 4X44A 4GRAA 4LNHA 1JKIA 2SHKA 5U9CA 4PLZA 4OD5A 4ZAFA 4QDTA 2XVZA 2H57A 3DFZA 3NKFA 4C43A 3OF3A 1YE8A 3ETHA 4KQGA 1D2GA 3LECA 3E7FA 2RAFA 1M67A 3HGTA 3T9CA 2ZP1A 3KJNA 2YJNA 3A3KA 1KJQA 5LIRA 4CIAA 4FWBA 2V7QD 4M3NA 5A6BA 4S24A 2GZRA 5LJIA 4LACB 1CDEA 1PZEA 4MV1A 2Z8ZA 2C2YA 3KT0A 4DOZA 2YIVX 5AI8A 3TW8A 2V9PA 4GP9A 4OSEA 2QLFA 3M83A 1YVUA 2MR5A 2P2NA 1D1PA 1E9VA 1VSBA 5FLKA 1M56C 1A76A 1Y7TA 1ADBA 2BFEA 1M6WA 2EL9A 1H23A 1XD8A 3L0ZA 4ARCA 3K09A 3LA6A 3R40A 4QASA 2R4TA 1XRLA 5T4HA 3DXXA 1W30A 1ORHA 2XE8A 5L8VA 1ZBDA 4KXWA 2YWHA 3MRSA 2WAMA 3T06B 2Z57A 4BLSA 1CUAA 4OTZA 1GNRA 2Y1FA 1S0UA 1XLTA 4FR0A 4H4KC 4YGYA 2J5RA 3DBOB 3AL2A 4UNIA 3L7KA 3LNRA 2PUJA 3IVXA 4AUEA 1E2IA 1FPMA 1RAAA 4TZKA 2RGNA 2VP5A 2B98A 2YWDA 1T8PA 1DLIA 1GYPA 1O8CA 3S1LA 1OZ0A 1R4NA 2Z9BA 1A1SA 2KQUA 4ZVSA 1GPJA 4Z86A 3GNSA 4WL0A 2VCCA 1D07A 1DXOA 2VDJA 5BNTA 4NBWA 3VNRA 2NQ8A 2EG9A 3LOUA 4IXTA 4UVGA 1EK2A 1BWQA 1H2BA 1YQEA 4JIMA 3JZAA 2ZT6A 1FFEA 4JXZA 2FWJA 1J99A 1JJ7A 1N9GB 1FFYA 3VXKA 4JQZA 5J1TB 2SCUB 5F2OA 3O8QB 1C8KA 4HZIA 4UUQA 1IIRA 3LYHA 2PZ8A 1Q16A 4A0FA 2E5LB 4CZ2A 1OOEA 4JJ4A 5KJ6A 3G0GA 1UBKS 4HGRA 1PTJA 2JH3A 1W2GA 1QQBA 1T4MA 1DBWA 2OBBA 2OHHA 3BWXA 1EDBA 2IH2A 1VIMA 3LSTA 3OZGA 2IX3A 2AI2A 2A6HF 1NR5A 3EZ2A 1BG6A 1EFDN 5HUJA 1ORRA 2ZRPA 1FJHA 3ETJA 3G2QA 4GKKB 3PGA1 1N1GA 4KAAA 1QQ3A 2CNBA 4HVTA 5ES4B 1T9GR 5I7HA 4LG1A 3A1EA 2B8NA 1E69A 2IEZA 4ALJA 4G3XA 3ZXUB 1N4AA 4ZCRA 2Q4BA 1AKUA 4UEQA 3IEVA 4FOPA 1TJ4A 3H5TA 3IE1A 5BQXA 4RA9A 1FJGB 5K4HA 3UJNA 5CYFA 3JZFA 3IV9A 3UNXA 1D0YA 2QT9A 2P0AA 1N8TA 2GMWA 7REQA 4I1MA 4D6YA 2V74B 3BQNB 4HEA6 3VAYA 2IDZA 1DPFA 4KIUA 4EG3A 3QYAA 3GRRA 1XTSA 3OM0A 2C5EA 3JYNA 2J4FA 3JYQA 3PUYA 1K0FA 1MF7A 2J5BA 4B3JA 3CG4A 4KX5A 4CDVA 4ZI3A 3BFKA 1GV0A 1E6LA 5DHFA 2W2OA 2C00A 3AIMA 2QMYA 1VXRA 1JBEA 1WX1A 3NWBA 3PLNA 3WRYA 3QLJA 1V1RB 4FHDA 1P4GA 3MQ2A 3BIJA 3O03A 4J0CA 3B7GA 3I1IA 1QIIA 3ZNOA 1P0QA 2MJLA 3ZCXA 3R6DA 4ENWA 1M72A 2CJYA 4EYGA 4PNPA 5HDQA 3RFXA 1CBUA 3FUWA 1M8JA 4OHMA 3EQLF 4C3OB 2QORA 1KQFA 4DEXA 1DUVG 3PVSA 3L41A 3EG5A 5SZIA 2J4CA 1T1IA 3TNDA 2CVHA 1EE9A 4ZU1X 1RTTA 1TAQA 4NV1A 4CIVA 3AQCA 1XR3A 2FWRA 1MRZA 1NIPA 4W1SA 3ZV7A 5DOZA 2O19A 1PDOA 3I05A 4LISA 3JPWA 4I3MA 2YMLA 2VJMB 3MCUA 1OHHD 3VU3A 1AF7A 2JLQA 4C6RA 2WM8A 5IDWA 3CSSA 3TGPA 2FQ1A 2MSKA 5DPMA 3H1AA 3MD0A 5AUPB 4CM4A 2XB2A 4AP5A 2Z8YA 2P3OA 4MQ9F 5HKBA 1NWCA 2JFZA 4NCHA 3IAHA 13PKA 1NW7A 1GRQA 3IQ5A 5CTJA 1MMNA 1B0UA 2ID8A 4PG6A 1EM6A 3ZW8A 3R3WA 2WUGA 4AT1A 2YRXA 3GRCA 5AVYA 5LZ2A 4E4YA 2EHJA 3ZLTA 1FFWA 4JB0A 2PMDA 1LE2A 3AUUA 3Q3HA 4GXRA 4E1VA 5JNVA 2QL9A 4CCAA 3UMRA 2WAAA 3TLKA 3W7AA 1B43A 5D3MB 3SSAA 5F9HA 1PG5A 2HXYA 4GR9A 2VRCA 1E2FA 1M1UA 2QG9A 4WOKA 3EGWA 3FBTA 3AY3A 1SKBA 3K3PA 5ES3A 4ZTUB 1T8TA 5DWDA 4L57A 1Q77A 4J3JA 2WA2A 5E3JA 4DNOA 3PNQA 1W2HA 3E18A 1V3QE 4PJJA 1P5ZB 3FJOA 3EY9A 3UICA 5GJBA 3GZ4A 4MV7A 1BDHA 4X8OA 4A8HA 1S01A 1WETA 5K0TA 1OGJA 2HK9A 2XDWA 3WFIA 1EEHA 2M64A 1G8GA 1KGSA 2PLFA 3LPDA 3QVOA 2ECPA 4RZ3A 1I6WA 1QP4A 2GO1A 1PV1A 4WI1A 3FW1A 1K7FB 3FOEC 1DUIA 4TV8A 5EK0A 2D06A 4D82A 3CM0A 1CYDA 1YASA 3AVUA 5E4FA 2Y92A 1X7WA 1X1SA 2RGYA 3HEMA 4P9NA 2WF9A 4FFNA 2I2AA 3WLLA 3CLVA 2YMMA 2XPCA 1GFIA 3C4VA 1P2GA 4DW8A 4J4TA 1L5HA 1O6FA 3O4GA 4PYLA 3PX3A 5E3AA 1QSGA 5FIUA 5GONB 4M37A 2REQA 3W3AD 2ZSBA 4CFYA 2DU8A 1P18A 4HMPA 3AHDA 3G1TA 1YQQA 4D81A 3QBDA 2FXIA 1YVDA 1N3YA 4ZKEA 2UVQA 3ZCSA 4MDFA 1V7CA 3LTEA 2ZDHA 1CGOA 1ISIA 2WD9A 4ISBA 4Q7CA 1XXLA 1M2VB 3DE4X 3CEXA 2LD6A 3JQ8B 5TEVA 1MZPA 4P83A 4CTJA 5DXFA 4DLTA 1IUNA 2QQ5A 4MWZA 1ZIPA 2R7WA 2PR2A 5G41A 3WK9A 1O3UA 2REOA 2AMLA 2WMNB 4BNDB 4C29A 4BLPA 1PD0A 4BFYA 4K9KA 4CEIA 1SURA 2CSXA 3LNCA 5F73A 2JLUA 1U0EA 5BWLA 4PW0A 1G5RA 2NV2B 1EH5A 4MGIR 1AT1A 3PX2A 1LPEA 3ZH2A 5LMZA 5CM9C 5KQPA 3LPAA 3SOPA 1NN3A 3K4HA 4H60A 1PK8A 3HA5A 4R1LA 1M6NA 3T6JA 4ND8B 2YOHA 1KY4A 3JWHA 1OBOA 1KP2A 1O5IA 3C18A 2WU4A 4RACA 3O0TA 1CUCA 3RYCA 3L49A 1A9YA 3KZOA 2XM4A 4B82A 4CS7A 4YRKA 5CFNA 3MAJA 2CVZA 3CMMA 1UKCA 2A58A 2XTZA 2O3UA 1TA9A 4BFZA 2FX5A 3QZCA 4DWVA 1JQLB 4AL4A 3FRJA 2HIAA 3AM1A 1IMOA 2I5PO 4QJBA 1VLSA 3TEMA 3KPHA 2FPPB 1VCHA 2P3LA 1HXHA 1CKEA 2OYSA 2ZM5A 4L4XA 1P0PA 2JD3A 2GH1A 5IVHA 1OH6A 3C2QA 2E0IA 4F2DA 5EIHA 3EXIB 2OD9A 3E9RA 2RBGA 2CJXA 5KPDA 5H02A 3UAYA 3H2HA 3D02A 1TMYA 3H2SA 4JLSA 2X42A 4H0FA 4P4UA 3AY6A 1P0CA 2RKOA 5E9WA 3DZ8A 3CLHA 5HA5A 2JGJA 4OINF 2G4LA 4RMGA 1PK7A 4NENB 3EDQA 1SWVA 1KR2A 3JQFC 4WKGA 4QQFA 2O0JA 4MQFA 2OKUA 1HW2A 5SY4A 4RXMA 2VJLA 1H9CA 1IHYA 4ZV4A 1GGEA 3NATA 4JEAA 4FE4A 1QLEC 3KPWA 3DF9A 3D2CA 3H3XA 1M6VB 2EKBA 2R1TB 5I7UA 3NEJA 4AYTA 5EGNA 4ZCPA 3UWSA 4D25A 4KQWA 3U40A 4OLJA 2I2BA 3WGMA 4XM0A 3QUCA 5L45A 1C0LA 3PGMA 3B36A 2H2WA 1UJ6A 1C4OA 3STUA 3UKJA 2XNKA 4IYJA 2WU1A 1Z17A 1E3EA 1WW2A 4IDBA