3KMIA

Crystal structure of putative membrane protein from clostridium difficile 630
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
172
structure length
172
Chain Sequence
NIHKIHEVQKKLQEEVSIVLIDIADIIVNPKKENGYSRDLYTLNSLIDSSISETYDNINNTLLSDTRFFLEHMDIIKSQRDILENLYSYVSQLNSTPPQAHILSAFIHKIGYTEFEAETGNLLLEELKRLMISMKNQPLPVDRTEFENRAILFLCLTELKQFLVNRKHAQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Putative membrane protein COG4129
publication title Crystal structure of putative membrane protein from Clostridium difficile 630
rcsb
source organism Clostridium difficile
total genus 68
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11728 ArAE_1_C Putative aromatic acid exporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kmiA00
3KMIA
chains in the Genus database with same CATH superfamily
1V55C 4CX9A 4YL3A 1NFNA 3FVYA 3KPHA 3V5XA 1NU7D 3HLZA 2JD3A 4J7YA 4PJLA 5HV9A 2YL0A 2J0XA 2KW3C 5COMA 5JRAA 1JPJA 5T3TA 1JMWA 2H7BA 4W8KA 3JYHA 2WZGA 2KGOA 1OKKA 2M4EA 1FMWA 2IXPA 1NBBA 2R05A 3L34A 3S29A 4MW3A 1SYQA 2YEVA 2R25A 3AGTA 3OA1A 5T3WA 1KTMA 1ZHWA 4O6YA 1I4ZA 4MVSA 1D1CA 2WZLA 3EGXB 1M6TA 1OKKD 3TJ5A 4N06A 5B1AC 2YL1A 1TKNA 4X0RA 3T6JA 2QUPA 4LERA 4AE4B 5A6BD 4BJ5C 3IQCA 3JZ0A 5BQIA 4BPMA 1JAFA 3QW0A 3SXKA 3Q6MA 4OIQF 2A6HF 1ZVZA 2MHRA 5E3CA 1WASA 3E9VA 3I4UA 2DGJA 2G62A 4OD4A 2DYRC 2BC5A 3IQTA 4BJ5A 3MLGA 2HS5A 4E7SA 4IB4A 1YZCA 2X0CA 4JZAA 3W8IA 2R7UA 2NG1A 2WVNA 1TFKB 2YQYA 2Z15A 4JTCB 4CS9A 3B0VC 2A1DD 2VB6A 5JVEA 1TWCA 1OCCC 5T1DB 1FAPB 5KYNA 4MVOA 4U5BE 3KKBA 2EINC 2AWCA 1ST6A 3R2PA 4C3DA 3C7JA 1ZZPA 3FHDA 5JP7A 5BUOA 4CDAA 5KYWB 2AU5A 3A11A 3LS0A 1S7ZA 1HE1A 3WHNA 3DZAA 1MMAA 4XLPF 3DMDA 5A6AA 3K6BA 2VH3A 4N4WA 3U3FA 5DLJA 4JKVA 3SXMA 3JT1A 1M2VB 2XLWA 1AEPA 1A41A 2P6VA 2Y3HA 4KC9A 2A68F 2PX0A 2UUIA 4Q5SF 2VASA 4N6CA 5CIVA 3DXJF 3K1IC 2HUJA 3RF3A 3SP1A 5JSLA 3PHF2 5JLIA 1D1BA 4PFPA 2EIJC 4CDVA 3ZC4A 1OXKA 2UUHA 3GEEA 3NMKA 4U9EA 4XLNF 4QI0A 3SZRA 3RQEA 5L0CA 1IW7F 2XLHA 1VTMP 5JT4A 3FDQA 1OR2A 1L7CA 1SZIA 1YVIA 2NUTB 3GWNA 5DS4A 1OCZC 2Q4FA 4GQHA 4JCHA 4ONSA 4O6NA 1ZU5A 1M57C 4PJMA 2AVKA 3UNGC 3MYIA 2YVKA 3BRJA 4G0HA 3ZIBA 5B3SC 1E85A 1W2WA 1WOLA 4LLCA 5F28E 4BJ1A 3GEIA 3JSZA 1T5OA 2JPUA 3SEOA 3L1MA 1MNEA 1HE9A 3JCUQ 2EIKC 3UGPA 2VCCA 4ZLDA 2YWAA 3CZ6A 1J8YF 2Q9AA 3ATPA 1QLEC 4EKWA 1YYXA 2GDCA 1GQAA 4YT5A 3S84A 3U2LA 4UDVA 3IQ6A 3ZTZA 1CPQA 1G5ZA 2B0HA 3B9QA 4MVMA 3M1CB 3V5YA 5AC5A 5E2QA 1BBHA 1XZQA 3EFOB 1NLXA 5KYYA 3Q7LA 2R7SA 1SMYF 3HJCA 1E84A 1DOWA 4YWQA 1VYIA 4I44A 4W8PA 2ZXPA 2CCYA 3AQBA 1ZW3A 4XPYA 5EHHA 1EI7A 2IYLD 4J32B 2EILC 4OIRF 1LI5A 2E87A 1VYKA 1HW2A 2EPOA 3GM3A 3EPVA 4JRZA 1BDJB 3I5QA 2XL8A 4O79A 2KYHA 3DI5A 3LUTB 4JC7A 4CBEA 1V4AA 3ABLC 3O10A 4PK4A 4EUKB 3KH2A 2QTVA 4IGGA 2R03A 3IHUA 2W4BA 3M15A 4EBKA 4EBBA 3PDMP 2OQMA 3RFYA 3US6A 5DQZA 3C63A 1UFBA 1WN0A 2P1AA 4J30B 2GFHA 3RH3A 1YARO 1YAUO 4JW1A 3RW0A 2QE9A 3JRMO 2I15A 1MMGA 1QPUA 4MW8A 3L0IA 4DRJB 2XS8A 2DB4A 3LLKA 4NTFA 3K1HA 1Q0FA 4LACB 3Q7GA 3AG1C 1BZ4A 5TJ5E 4OIPF 4ULWA 1UG7A 1QQ3A 2H7OA 3EHNA 1APCA 4KBLA 4BEJA 1CGME 1ORSC 3GODA 1M56C 2DI3A 3EZHA 2J9WA 2P61A 4IAOA 3CEXA 1HY5A 3H2UA 1GM5A 1XWJA 1NSGB 1ZHYA 3NRHA 4DJ9A 3EG9B 2LSEA 3SXZA 1A0BA 1C17M 3UGOA 3Q6NA 3QW1A 2F22A 2NSGA 1R4TA 3GM2A 3FAJA 2YKZA 5CI8A 3ZSUA 4G78A 3GANA 4H54A 4CSAC 2LCHA 1FFHA 3L8JA 2ASRA 3C8GB 3C8ZA 3MYFA 4RD9A 1AVOB 5F5FA 2HFIA 4LDQA 3X1OA 2NPUA 3W2VA 2PP4A 1RMVA 3EGDA 4LDKA 1U6HA 5L0HA 1JRAA 4CSAA 5COGA 4ER9A 5IY5C 4CIHA 2GA0A 3WG7C 2R7VA 1RKEB 3RKOF 1VMAA 5AC4A 2L6GA 1V74B 1S05A 1E86A 2EPNA 5JS5A 3F47A 1VLTA 1E2XA 1MNDA 3AG3C 1MMDA 1O3UA 1DOVA 1Q0MA 2YLDA 3AGUA 3EQLF 3JYYA 3M4CA 2OJED 4NTAA 3VM6A 2WL8A 2W45A 4DOZA 2FAPB 3NDBB 3HNKA 3GM1A 3NYJA 3EH1A 4C3BA 2KQ9A 1OCRC 4PJJA 4BEMJ 2M64A 1QZXA 1SF8A 2PX3A 3G4ZA 3DM5A 1B68A 1Q0GA 3HKKA 4MVRA 3OWTA 3ZWIA 4DRIB 2Y3DA 4EBJA 2B0JA 5DS6A 3NYLA 5L0IA 2HZ8A 2WVOA 2GWWA 5EK0A 4YT8A 4MVZA 2P0NA 4P9TA 4XEFA 3MBGA 3EGDB 4GYTA 3QTHA 4KNVA 5D92A 3TK0A 5DQTA 4I3MA 3S9OA 2D5RB 4E7ZA 1ZW2A 2J7PA 3K7DA 3NKEA 3KYJA 2A0UA 4XPXA 2LD6A 2WVQA 4E17A 1FMVA 1LE4A 1CPRA 1LE2A 1LKXA 4PFOA 3LS1A 2J7PD 2R02A 1VOMA 3I5PA 2XLOA 2Y3BA 1LS1A 4NTBA 1A7EA 2DYSC 4WGYA 3T6GB 1WATA 4AL0A 4XWJA 5L0DA 4CS7A 1YA9A 5L0JA 1LS4A 3FXHA 3NG1A 4FX5A 1J8MF 4JIOA 3AQCA 3RVYA 2YRFA 2L9JA 2XS1A 2NUPA 3ITFA 3G50A 2R7OA 2R7RA 1EQ1A 1BR1A 1PD1A 3FOOA 4P6IC 4XEKA 4XQ1A 3HTKC 3AG2C 2XL4A 3DE8A 4XEVA 2OJQA 3ZQYA 1CGOA 3SXYA 4BJTA 2R7WA 1NG1A 2HV7A 3HNLA 4JCZA 4CJOA 2CNWA 3BEHA 4MVUA 1BR4A 3H65A 1Z7Qc 4HFFB 1QKRA 1NZEA 1Z5ZA 3AG4C 3CAXA 2CNWD 1QSPA 3LNRA 3AOUA 2XLDA 1H7IA 2HMQA 1O87A 3NYMA 4Z9IA 2H7VC 2OKUA 3VF0A 2XM4A 3U9JA 1FTSA 2G3VA 3SNHA 3U0CA 2WZFA 1LI7A 2Q9CA 4AL1A 1TWGA 3N0TA 5E33A 4XTKA 1OCOC 2A0BA 4G7OF 2XRHA 1GGQA 4A4AA 2YLGA 2J46A 2LFFA 2EPLX 3UMHA 5L0FA 1G4WR 2PBEA 1ZHZA 1OR3A 3FMSA 1FNTc 4Q7CA 1HMDA 2H8AA 3O55A 4CJGA 4GEHA 2V3CC 3B0UX 2HSBA 4DVYP 4HEAJ 2NUPB 4IWBA 2OG2A 3K33A 3N2ZB 4YN0B 1HMOA 2Q00A 3UMKA 4ANJA 1RCPA 3F46A 2Q7RA 2Y3GA 5KYXA 3W2WA 2I8BA 2QY9A 4RBNA 4MS2A 4CS8A 2VC9A 1WWPA 2BL2A 3NKDA 1PD0A 4OD5A 4E18A 3U3BA 4IARA 2AP3A 5L3QA 1T9KA 3CSKA 2W9YA 4ZLCA 4B6IA 3DAGA 1C02A 2J9VA 3N24A 3W8HA 4AX2A 2AWYA 4A2NB 2FFHA 1LM3B 3S28A 2HKVA 4AK9A 1LIHA 3K66A 3B0PA 2IM8A 4C7OA 1PCXA 3WODF 2Q9BA 1ZYRF 1D0YA 1T6IA 2KNHA 3NMIA 4Z9HA 3ZVRA 5KYYB 2ZXRA 3RVZA 1SR2A 2IBFA 1FR0A 3T9OA 4F4BA 1TWHA 3DWWA 3MX3A 3S27A 3KL4A 2HJMA 4BG0A 2LK4A 2KC3A 3QMKA 3WAQA 4E0HA 1RJ9A 4YT2A 3KMIA 1TWAA 2J0WA 3UR3C 4JEAA 1OW8A 4H4KC 4NY3A 4WGZA 1D0XA 1VB5A 1EKYA 3GORA 5FZTA 5COFA 5DVWA 1M2OA 1ORJA 1K40A 1H6GA 1Z6AA 2R7XA 1OQCA 3QVZA 5JUAA 5F5HA 4YT4A 3IPMO 4U5HA 1AUEA 2OOCA 3M79A 4IJJA 4CS9C 4DRHB 4WABA 4FAPB 1EA8A 3DE9A 1OW6A 4Q4ZF 2Y69C 3NMJA 2EPMX 3G4XA 2WB7A 4M63A 3EH2A 3EZIA 2ZPAA 3O39A 4C7OB 3DJUB 4U5DE 4YJWA 2L6FA 2R7TA 4G7HF 3LESA 2L81A 2XSEA 3T4RA 4MQ9F 1QVXA 2JX0A 4N6HA 1O5HA 2YZSA 1ZHTA 2LP4A 4JE9A 4MTFA 4EIYA 5B3IA 5KYWA 1N1CA 2C04A 4OIOF 1I4YA 1JR8A 3B71A 2IOQA 4MTGA 4ULVA 3U2MA 1JOGA 1RJ9B 3ASNC 4CDYA 1NU9C 3RQGA 5E3AA 1Z3IX 4MTOA 3OEOA 5HSWA 5A6BA 3C18A 1M2VA 4HFKB 2LQGA 1OW7A 3ZTMA 4CIPA 2XLEA 2L6HA 4U5CE 1U89A 2L7AA 4EWCA 3S90A 2IXNA 3PCVA 3GWLA 4U5GA 1LPEA 1G8XA 3FOPA 3QZCA 2LIGA 3W4YA 2OEVA 4P9FA 3QVYA 1YYJA 3E70C 2RSEB 1LVKA 2LFDA 2MYSA 2QNLA 3HNIA 2XM0A 4JTAB 2J9BA 3IEEA 3ECSA 3O6XA 2NUTA 1ZU4A 3TOLA 3MFNA 3A9CA 3M4BA 3U8PA 2C03A 2IXMA 3POVA 2O9XA 3KYIA 2J45A 2XLVA 1ORYA 5GPGB 4BJ6C 1RXQA 2EPKX 1E83A 3J06A 2GAQA 2J8WA 3ASOC 5A6KA 5FCLA 1BR2A 1U0BB 1H9TA 3UMIA 1YZAA 4NQFA 1WGWA 2Q3TA 3C62A 3JRTA 2RD9A 3H2VA 2CYDA 3TJ6A 4BJ6A 2XXAA 2CDQA 1JPNA 3DKAA 256BA 1OXBA 4EHPA 4JVSA 1ZHXA 2D4UA 4DBRA 2MWQA 1NFOA 3EFOA 4QI2A 1K04A 3LEOA 4JURI 1Z63A 4U5FE 3RIPA 1MMNA 1H9GA 1K05A 2VCAA 2IXOA 5A69A 2KJGA 2XL6A 3ABMC 4FESA 1V54C 1MQVA 2KSFA 4FWVA 4NC3A 1YA7O 3DAFA 2A69F 2PFDA 4JEBA 1Z23A 3K1IA 3V5ZA 4DVZA 4LDRA 3TULA 4O7GA 1HW1A 3DJNB 3U8VA 2PF4E 1TR2A 4C3EA 2J9UA 2OCCC 2XLMA 3RYLA 2VCBA 1F1MA 4I1OB 2ICWG 1C03A 3B29A 5KYUA 3AJMA 3U5SA 4DXWA 4G7ZF 4KI2A 2HMZA 2OU6A 1T6UA 1TFOB 3ZQVA 4CS8C 4YK5A 3LEVA 2YHSA 3LAYA 2XXAB 4MNDA 3VYWA 4U9DA 1A7VA 1T01A 3DD7A 3LJBA 2HV6A 4IAQA 4PJNA 2A6EF 1R5ID 1Q0KA 3LNMB 4U5EE 2Y39A 1Y6DA 2YLIA 4OINF 1GS9A 1G4US 2CW0F 3L8IA 3T6BA 2KK1A 2ZXWC 4J7TA 2TMVP 4JTDB 2HSQA 5L3VA 1VLSA 1IZMA 3EJNA 1YLMA 1FFTC 4NCQA 4K1OA 3TOMA 2G3KA 3ZDLA 4KNWA 2V26A 5D91A 1KU2A 1WTYA 2PNOA 3FAPB 4WJ0A 1TQGA 2ZD9A 3HNJA 1KNYA 2R9RB 3VRCA 3X2QC 4D4NA 1YJGA 3EG9A 4PACA 3U9MA 2YL7A 3CQZA 4R32A 2P7VA 1YDIA 5AGFA 4I1MA 4YL1A 4DBQA 2NSFA 3EHMA 1Y4CA 3R7CA 4JJFA 3C8GA 5KYUB 3LLIA 4JJGA 4E0IA 4YL0A 4K7BA 3RQFA 1XZPA 2W4MA 3C8GD 5CI9A 4HE8D 5A6JA 2EIMC 4XPWA 4K0DA 3ABKC 4QDLA 1A7DA 2YL3A 1L3PA 3EGXA 3GEHA 1PV3A 4L6RA 4PR9A 3V7OA 3JTLO 1I5NA 3PMRA 5B1BC 5KYXB 3VAYA 5DS5A 2CGEA 1RKEA 2QLAA 2HJ3A 4AE4A 1CGNA 1D0ZA 4RDAA 5BQGA 2BE5F 2FGYA 2R7QA 3S0XA 5EGYA 2ETSA 3TD7A 1RKCA 5L0GA 2OEXA 3ZG1A 2ZXOA 4LLEA 3SYNA 2X51A 1T6QA 3DM9B 3IQ5A 3JSEO 4O6MA 4IRUA 1Q0DA 4MVQA 1VK5A 5BQHA 3TQOA 5K0IA 1D1AA 4D4XA 4Z9JA
chains in the Genus database with same CATH topology
1V55C 3FVYA 1NU7D 3HLZA 2JD3A 4PJLA 2J0XA 2KW3C 1JPJA 5T3TA 4W8KA 2H7BA 3JYHA 2WZGA 2KGOA 1OKKA 2M4EA 1FMWA 2IXPA 3L34A 3RH3A 3S29A 5BUOA 2YEVA 3OA1A 5T3WA 1ZHWA 4O6YA 1D1CA 2WZLA 3EGXB 1OKKD 4N06A 5B1AC 1TKNA 4X0RA 3T6JA 4LERA 4AE4B 4BJ5C 3Q6MA 4OIQF 2A6HF 5E3CA 3E9VA 3I4UA 2DGJA 2G62A 4OD4A 2DYRC 4BJ5A 3MLGA 4E7SA 4JZAA 3W8IA 2R7UA 2NG1A 2WVNA 2Z15A 4CS9A 3B0VC 2A1DD 2VB6A 1TWCA 1OCCC 5T1DB 5KYNA 4U5BE 3KKBA 2EINC 1ST6A 4C3DA 3FHDA 5KYWB 3LS0A 1S7ZA 3DZAA 1MMAA 4XLPF 3DMDA 3K6BA 2VH3A 5DLJA 3JT1A 1M2VB 2P6VA 2Y3HA 4KC9A 2A68F 2PX0A 4Q5SF 2VASA 3PHF2 3DXJF 3K1IC 3SP1A 1D1BA 4PFPA 2EIJC 3ZC4A 4XLNF 3SZRA 4QI0A 1IW7F 3FDQA 1SZIA 2NUTB 5DS4A 1OCZC 4JCHA 4O6NA 1ZU5A 1M57C 4PJMA 3UNGC 4G0HA 3ZIBA 5B3SC 1W2WA 4LLCA 4BJ1A 3JSZA 3SEOA 1MNEA 3JCUQ 3UGPA 2EIKC 4ZLDA 3CZ6A 1J8YF 2Q9AA 1QLEC 4YT5A 3B9QA 3M1CB 5E2QA 3EFOB 5KYYA 3Q7LA 1SMYF 3HJCA 4YWQA 1VYIA 4I44A 2ZXPA 3AQBA 5EHHA 2IYLD 4J32B 2EILC 4OIRF 2E87A 1VYKA 3EPVA 3I5QA 4O79A 4CBEA 3ABLC 4PK4A 3KH2A 2QTVA 2W4BA 4EBBA 3RFYA 5DQZA 4J30B 2GFHA 4JW1A 1MMGA 3L0IA 3LLKA 3K1HA 4LACB 3Q7GA 3AG1C 4OIPF 4ULWA 2H7OA 3EHNA 4KBLA 4BEJA 3GODA 1M56C 3EZHA 2J9WA 4IAOA 1ZHYA 3NRHA 3EG9B 2LSEA 3UGOA 3Q6NA 3ZSUA 3FAJA 5CI8A 3GANA 4CSAC 1FFHA 4RD9A 5F5FA 3X1OA 3W2VA 2PP4A 3EGDA 4CSAA 5IY5C 4CIHA 3WG7C 2R7VA 3RKOF 1VMAA 3F47A 1MNDA 3AG3C 1MMDA 4CS9C 3EQLF 4DOZA 2WL8A 2W45A 3NDBB 3NYJA 3EH1A 4C3BA 2KQ9A 1OCRC 4PJJA 1QZXA 1SF8A 2PX3A 3DM5A 5DS6A 3OWTA 2Y3DA 2B0JA 3NYLA 2WVOA 4YT8A 3EGDB 4GYTA 4KNVA 5D92A 5DQTA 4I3MA 2D5RB 4E7ZA 2J7PA 3K7DA 3NKEA 2WVQA 1FMVA 4PFOA 1LKXA 3LS1A 2J7PD 1VOMA 3I5PA 2Y3BA 1LS1A 2DYSC 4XWJA 4CS7A 3NG1A 4FX5A 1J8MF 3AQCA 2L9JA 3ITFA 2NUPA 2R7RA 2R7OA 1BR1A 1PD1A 4P6IC 3HTKC 3AG2C 2XL4A 4BJTA 2R7WA 1NG1A 2HV7A 2CNWA 1BR4A 3H65A 4HFFB 1NZEA 3AG4C 1Z5ZA 2CNWD 3NYMA 3LNRA 1O87A 2H7VC 1FTSA 2G3VA 3SNHA 2WZFA 2Q9CA 1TWGA 3N0TA 5E33A 4XTKA 1OCOC 4G7OF 2XRHA 2J46A 3UMHA 1ZHZA 4Q7CA 4GEHA 2V3CC 3B0UX 4DVYP 4HEAJ 2NUPB 4IWBA 2OG2A 3K33A 3N2ZB 4YN0B 3UMKA 4ANJA 3F46A 2Y3GA 5KYXA 3W2WA 2I8BA 2QY9A 4RBNA 4CS8A 3NKDA 1PD0A 4OD5A 5L3QA 3CSKA 2W9YA 4ZLCA 4B6IA 3DAGA 2J9VA 3N24A 3W8HA 4AX2A 4A2NB 2FFHA 3S28A 4AK9A 3K66A 3B0PA 4C7OA 1PCXA 3WODF 2Q9BA 1ZYRF 1D0YA 2KNHA 3ZVRA 5KYYB 2ZXRA 4F4BA 1TWHA 3MX3A 3S27A 3KL4A 4BG0A 3QMKA 1RJ9A 4YT2A 3KMIA 1TWAA 2J0WA 3UR3C 4H4KC 4NY3A 1D0XA 5DVWA 1M2OA 1Z6AA 2R7XA 5F5HA 4YT4A 4U5HA 4IJJA 4Q4ZF 2Y69C 2WB7A 4M63A 3EH2A 3EZIA 2ZPAA 3O39A 4C7OB 3DJUB 4U5DE 4YJWA 2R7TA 4G7HF 3LESA 2L81A 2XSEA 3T4RA 4MQ9F 1O5HA 2YZSA 1ZHTA 5KYWA 1N1CA 2C04A 4OIOF 2IOQA 1RJ9B 3ASNC 1NU9C 5E3AA 1Z3IX 5HSWA 3OEOA 1M2VA 4HFKB 4U5CE 4EWCA 2IXNA 4U5GA 1G8XA 3QZCA 3E70C 1LVKA 2MYSA 5L3VA 2R7SA 3IEEA 3O6XA 3ECSA 2NUTA 1ZU4A 2C03A 2IXMA 3POVA 2O9XA 2J45A 4BJ6C 3ASOC 5FCLA 1BR2A 3UMIA 1WGWA 2Q3TA 3JRTA 2XXAA 4BJ6A 2CDQA 1JPNA 4JVSA 1ZHXA 4DBRA 2MWQA 3EFOA 4QI2A 4JURI 1Z63A 4U5FE 3RIPA 1MMNA 2IXOA 2KJGA 4FESA 3ABMC 1V54C 4FWVA 3DAFA 2A69F 2PFDA 1Z23A 4DVZA 4O7GA 3DJNB 2PF4E 1TR2A 4C3EA 2J9UA 2OCCC 3RYLA 4I1OB 5KYUA 4KI2A 4G7ZF 4CS8C 3LEVA 2YHSA 3LAYA 2XXAB 4MNDA 3VYWA 3LJBA 3DD7A 2HV6A 4PJNA 2A6EF 4U5EE 2Y39A 4OINF 2CW0F 3T6BA 2ZXWC 1IZMA 3EJNA 1FFTC 2G3KA 4KNWA 2V26A 5D91A 1KU2A 4WJ0A 3X2QC 3EG9A 3CQZA 2P7VA 4I1MA 4DBQA 3EHMA 5KYUB 4JJFA 3LLIA 4JJGA 4K7BA 2W4MA 5CI9A 4HE8D 2EIMC 4K0DA 3ABKC 4QDLA 3V7OA 3EGXA 3PMRA 5DS5A 5B1BC 5KYXB 3VAYA 2CGEA 4AE4A 1D0ZA 4RDAA 2BE5F 2FGYA 2R7QA 3S0XA 5EGYA 3TD7A 3ZG1A 2ZXOA 4LLEA 3SYNA 2X51A 3DM9B 4O6MA 4IRUA 1VK5A 1D1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMI A; 
#chains in the Genus database with same CATH topology
 1V55 C;  4CX9 A;  4YL3 A;  1NFN A;  3FVY A;  3KPH A;  3V5X A;  1NU7 D;  3HLZ A;  2JD3 A;  4J7Y A;  4PJL A;  5HV9 A;  2YL0 A;  2J0X A;  2KW3 C;  5COM A;  5JRA A;  1JPJ A;  5T3T A;  1JMW A;  2H7B A;  4W8K A;  3JYH A;  2WZG A;  2KGO A;  1OKK A;  2M4E A;  1FMW A;  2IXP A;  1NBB A;  2R05 A;  3L34 A;  3S29 A;  4MW3 A;  1SYQ A;  2YEV A;  2R25 A;  3AGT A;  3OA1 A;  5T3W A;  1KTM A;  1ZHW A;  4O6Y A;  1I4Z A;  4MVS A;  1D1C A;  2WZL A;  3EGX B;  1M6T A;  1OKK D;  3TJ5 A;  4N06 A;  5B1A C;  2YL1 A;  1TKN A;  4X0R A;  3T6J A;  2QUP A;  4LER A;  4AE4 B;  5A6B D;  4BJ5 C;  3IQC A;  3JZ0 A;  5BQI A;  4BPM A;  1JAF A;  3QW0 A;  3SXK A;  3Q6M A;  4OIQ F;  2A6H F;  1ZVZ A;  2MHR A;  5E3C A;  1WAS A;  3E9V A;  3I4U A;  2DGJ A;  2G62 A;  4OD4 A;  2DYR C;  2BC5 A;  3IQT A;  4BJ5 A;  3MLG A;  2HS5 A;  4E7S A;  4IB4 A;  1YZC A;  2X0C A;  4JZA A;  3W8I A;  2R7U A;  2NG1 A;  2WVN A;  1TFK B;  2YQY A;  2Z15 A;  4JTC B;  4CS9 A;  3B0V C;  2A1D D;  2VB6 A;  5JVE A;  1TWC A;  1OCC C;  5T1D B;  1FAP B;  5KYN A;  4MVO A;  4U5B E;  3KKB A;  2EIN C;  2AWC A;  1ST6 A;  3R2P A;  4C3D A;  3C7J A;  1ZZP A;  3FHD A;  5JP7 A;  5BUO A;  4CDA A;  5KYW B;  2AU5 A;  3A11 A;  3LS0 A;  1S7Z A;  1HE1 A;  3WHN A;  3DZA A;  1MMA A;  4XLP F;  3DMD A;  5A6A A;  3K6B A;  2VH3 A;  4N4W A;  3U3F A;  5DLJ A;  4JKV A;  3SXM A;  3JT1 A;  1M2V B;  2XLW A;  1AEP A;  1A41 A;  2P6V A;  2Y3H A;  4KC9 A;  2A68 F;  2PX0 A;  2UUI A;  4Q5S F;  2VAS A;  4N6C A;  5CIV A;  3DXJ F;  3K1I C;  2HUJ A;  3RF3 A;  3SP1 A;  5JSL A;  3PHF 2;  5JLI A;  1D1B A;  4PFP A;  2EIJ C;  4CDV A;  3ZC4 A;  1OXK A;  2UUH A;  3GEE A;  3NMK A;  4U9E A;  4XLN F;  4QI0 A;  3SZR A;  3RQE A;  5L0C A;  1IW7 F;  2XLH A;  1VTM P;  5JT4 A;  3FDQ A;  1OR2 A;  1L7C A;  1SZI A;  1YVI A;  2NUT B;  3GWN A;  5DS4 A;  1OCZ C;  2Q4F A;  4GQH A;  4JCH A;  4ONS A;  4O6N A;  1ZU5 A;  1M57 C;  4PJM A;  2AVK A;  3UNG C;  3MYI A;  2YVK A;  3BRJ A;  4G0H A;  3ZIB A;  5B3S C;  1E85 A;  1W2W A;  1WOL A;  4LLC A;  5F28 E;  4BJ1 A;  3GEI A;  3JSZ A;  1T5O A;  2JPU A;  3SEO A;  3L1M A;  1MNE A;  1HE9 A;  3JCU Q;  2EIK C;  3UGP A;  2VCC A;  4ZLD A;  2YWA A;  3CZ6 A;  1J8Y F;  2Q9A A;  3ATP A;  1QLE C;  4EKW A;  1YYX A;  2GDC A;  1GQA A;  4YT5 A;  3S84 A;  3U2L A;  4UDV A;  3IQ6 A;  3ZTZ A;  1CPQ A;  1G5Z A;  2B0H A;  3B9Q A;  4MVM A;  3M1C B;  3V5Y A;  5AC5 A;  5E2Q A;  1BBH A;  1XZQ A;  3EFO B;  1NLX A;  5KYY A;  3Q7L A;  2R7S A;  1SMY F;  3HJC A;  1E84 A;  1DOW A;  4YWQ A;  1VYI A;  4I44 A;  4W8P A;  2ZXP A;  2CCY A;  3AQB A;  1ZW3 A;  4XPY A;  5EHH A;  1EI7 A;  2IYL D;  4J32 B;  2EIL C;  4OIR F;  1LI5 A;  2E87 A;  1VYK A;  1HW2 A;  2EPO A;  3GM3 A;  3EPV A;  4JRZ A;  1BDJ B;  3I5Q A;  2XL8 A;  4O79 A;  2KYH A;  3DI5 A;  3LUT B;  4JC7 A;  4CBE A;  1V4A A;  3ABL C;  3O10 A;  4PK4 A;  4EUK B;  3KH2 A;  2QTV A;  4IGG A;  2R03 A;  3IHU A;  2W4B A;  3M15 A;  4EBK A;  4EBB A;  3PDM P;  2OQM A;  3RFY A;  3US6 A;  5DQZ A;  3C63 A;  1UFB A;  1WN0 A;  2P1A A;  4J30 B;  2GFH A;  3RH3 A;  1YAR O;  1YAU O;  4JW1 A;  3RW0 A;  2QE9 A;  3JRM O;  2I15 A;  1MMG A;  1QPU A;  4MW8 A;  3L0I A;  4DRJ B;  2XS8 A;  2DB4 A;  3LLK A;  4NTF A;  3K1H A;  1Q0F A;  4LAC B;  3Q7G A;  3AG1 C;  1BZ4 A;  5TJ5 E;  4OIP F;  4ULW A;  1UG7 A;  1QQ3 A;  2H7O A;  3EHN A;  1APC A;  4KBL A;  4BEJ A;  1CGM E;  1ORS C;  3GOD A;  1M56 C;  2DI3 A;  3EZH A;  2J9W A;  2P61 A;  4IAO A;  3CEX A;  1HY5 A;  3H2U A;  1GM5 A;  1XWJ A;  1NSG B;  1ZHY A;  3NRH A;  4DJ9 A;  3EG9 B;  2LSE A;  3SXZ A;  1A0B A;  1C17 M;  3UGO A;  3Q6N A;  3QW1 A;  2F22 A;  2NSG A;  1R4T A;  3GM2 A;  3FAJ A;  2YKZ A;  5CI8 A;  3ZSU A;  4G78 A;  3GAN A;  4H54 A;  4CSA C;  2LCH A;  1FFH A;  3L8J A;  2ASR A;  3C8G B;  3C8Z A;  3MYF A;  4RD9 A;  1AVO B;  5F5F A;  2HFI A;  4LDQ A;  3X1O A;  2NPU A;  3W2V A;  2PP4 A;  1RMV A;  3EGD A;  4LDK A;  1U6H A;  5L0H A;  1JRA A;  4CSA A;  5COG A;  4ER9 A;  5IY5 C;  4CIH A;  2GA0 A;  3WG7 C;  2R7V A;  1RKE B;  3RKO F;  1VMA A;  5AC4 A;  2L6G A;  1V74 B;  1S05 A;  1E86 A;  2EPN A;  5JS5 A;  3F47 A;  1VLT A;  1E2X A;  1MND A;  3AG3 C;  1MMD A;  1O3U A;  1DOV A;  1Q0M A;  2YLD A;  3AGU A;  3EQL F;  3JYY A;  3M4C A;  2OJE D;  4NTA A;  3VM6 A;  2WL8 A;  2W45 A;  4DOZ A;  2FAP B;  3NDB B;  3HNK A;  3GM1 A;  3NYJ A;  3EH1 A;  4C3B A;  2KQ9 A;  1OCR C;  4PJJ A;  4BEM J;  2M64 A;  1QZX A;  1SF8 A;  2PX3 A;  3G4Z A;  3DM5 A;  1B68 A;  1Q0G A;  3HKK A;  4MVR A;  3OWT A;  3ZWI A;  4DRI B;  2Y3D A;  4EBJ A;  2B0J A;  5DS6 A;  3NYL A;  5L0I A;  2HZ8 A;  2WVO A;  2GWW A;  5EK0 A;  4YT8 A;  4MVZ A;  2P0N A;  4P9T A;  4XEF A;  3MBG A;  3EGD B;  4GYT A;  3QTH A;  4KNV A;  5D92 A;  3TK0 A;  5DQT A;  4I3M A;  3S9O A;  2D5R B;  4E7Z A;  1ZW2 A;  2J7P A;  3K7D A;  3NKE A;  3KYJ A;  2A0U A;  4XPX A;  2LD6 A;  2WVQ A;  4E17 A;  1FMV A;  1LE4 A;  1CPR A;  1LE2 A;  1LKX A;  4PFO A;  3LS1 A;  2J7P D;  2R02 A;  1VOM A;  3I5P A;  2XLO A;  2Y3B A;  1LS1 A;  4NTB A;  1A7E A;  2DYS C;  4WGY A;  3T6G B;  1WAT A;  4AL0 A;  4XWJ A;  5L0D A;  4CS7 A;  1YA9 A;  5L0J A;  1LS4 A;  3FXH A;  3NG1 A;  4FX5 A;  1J8M F;  4JIO A;  3AQC A;  3RVY A;  2YRF A;  2L9J A;  2XS1 A;  2NUP A;  3ITF A;  3G50 A;  2R7O A;  2R7R A;  1EQ1 A;  1BR1 A;  1PD1 A;  3FOO A;  4P6I C;  4XEK A;  4XQ1 A;  3HTK C;  3AG2 C;  2XL4 A;  3DE8 A;  4XEV A;  2OJQ A;  3ZQY A;  1CGO A;  3SXY A;  4BJT A;  2R7W A;  1NG1 A;  2HV7 A;  3HNL A;  4JCZ A;  4CJO A;  2CNW A;  3BEH A;  4MVU A;  1BR4 A;  3H65 A;  1Z7Q c;  4HFF B;  1QKR A;  1NZE A;  1Z5Z A;  3AG4 C;  3CAX A;  2CNW D;  1QSP A;  3LNR A;  3AOU A;  2XLD A;  1H7I A;  2HMQ A;  1O87 A;  3NYM A;  4Z9I A;  2H7V C;  2OKU A;  3VF0 A;  2XM4 A;  3U9J A;  1FTS A;  2G3V A;  3SNH A;  3U0C A;  2WZF A;  1LI7 A;  2Q9C A;  4AL1 A;  1TWG A;  3N0T A;  5E33 A;  4XTK A;  1OCO C;  2A0B A;  4G7O F;  2XRH A;  1GGQ A;  4A4A A;  2YLG A;  2J46 A;  2LFF A;  2EPL X;  3UMH A;  5L0F A;  1G4W R;  2PBE A;  1ZHZ A;  1OR3 A;  3FMS A;  1FNT c;  4Q7C A;  1HMD A;  2H8A A;  3O55 A;  4CJG A;  4GEH A;  2V3C C;  3B0U X;  2HSB A;  4DVY P;  4HEA J;  2NUP B;  4IWB A;  2OG2 A;  3K33 A;  3N2Z B;  4YN0 B;  1HMO A;  2Q00 A;  3UMK A;  4ANJ A;  1RCP A;  3F46 A;  2Q7R A;  2Y3G A;  5KYX A;  3W2W A;  2I8B A;  2QY9 A;  4RBN A;  4MS2 A;  4CS8 A;  2VC9 A;  1WWP A;  2BL2 A;  3NKD A;  1PD0 A;  4OD5 A;  4E18 A;  3U3B A;  4IAR A;  2AP3 A;  5L3Q A;  1T9K A;  3CSK A;  2W9Y A;  4ZLC A;  4B6I A;  3DAG A;  1C02 A;  2J9V A;  3N24 A;  3W8H A;  4AX2 A;  2AWY A;  4A2N B;  2FFH A;  1LM3 B;  3S28 A;  2HKV A;  4AK9 A;  1LIH A;  3K66 A;  3B0P A;  2IM8 A;  4C7O A;  1PCX A;  3WOD F;  2Q9B A;  1ZYR F;  1D0Y A;  1T6I A;  2KNH A;  3NMI A;  4Z9H A;  3ZVR A;  5KYY B;  2ZXR A;  3RVZ A;  1SR2 A;  2IBF A;  1FR0 A;  3T9O A;  4F4B A;  1TWH A;  3DWW A;  3MX3 A;  3S27 A;  3KL4 A;  2HJM A;  4BG0 A;  2LK4 A;  2KC3 A;  3QMK A;  3WAQ A;  4E0H A;  1RJ9 A;  4YT2 A;  3KMI A;  1TWA A;  2J0W A;  3UR3 C;  4JEA A;  1OW8 A;  4H4K C;  4NY3 A;  4WGZ A;  1D0X A;  1VB5 A;  1EKY A;  3GOR A;  5FZT A;  5COF A;  5DVW A;  1M2O A;  1ORJ A;  1K40 A;  1H6G A;  1Z6A A;  2R7X A;  1OQC A;  3QVZ A;  5JUA A;  5F5H A;  4YT4 A;  3IPM O;  4U5H A;  1AUE A;  2OOC A;  3M79 A;  4IJJ A;  4CS9 C;  4DRH B;  4WAB A;  4FAP B;  1EA8 A;  3DE9 A;  1OW6 A;  4Q4Z F;  2Y69 C;  3NMJ A;  2EPM X;  3G4X A;  2WB7 A;  4M63 A;  3EH2 A;  3EZI A;  2ZPA A;  3O39 A;  4C7O B;  3DJU B;  4U5D E;  4YJW A;  2L6F A;  2R7T A;  4G7H F;  3LES A;  2L81 A;  2XSE A;  3T4R A;  4MQ9 F;  1QVX A;  2JX0 A;  4N6H A;  1O5H A;  2YZS A;  1ZHT A;  2LP4 A;  4JE9 A;  4MTF A;  4EIY A;  5B3I A;  5KYW A;  1N1C A;  2C04 A;  4OIO F;  1I4Y A;  1JR8 A;  3B71 A;  2IOQ A;  4MTG A;  4ULV A;  3U2M A;  1JOG A;  1RJ9 B;  3ASN C;  4CDY A;  1NU9 C;  3RQG A;  5E3A A;  1Z3I X;  4MTO A;  3OEO A;  5HSW A;  5A6B A;  3C18 A;  1M2V A;  4HFK B;  2LQG A;  1OW7 A;  3ZTM A;  4CIP A;  2XLE A;  2L6H A;  4U5C E;  1U89 A;  2L7A A;  4EWC A;  3S90 A;  2IXN A;  3PCV A;  3GWL A;  4U5G A;  1LPE A;  1G8X A;  3FOP A;  3QZC A;  2LIG A;  3W4Y A;  2OEV A;  4P9F A;  3QVY A;  1YYJ A;  3E70 C;  2RSE B;  1LVK A;  2LFD A;  2MYS A;  2QNL A;  3HNI A;  2XM0 A;  4JTA B;  2J9B A;  3IEE A;  3ECS A;  3O6X A;  2NUT A;  1ZU4 A;  3TOL A;  3MFN A;  3A9C A;  3M4B A;  3U8P A;  2C03 A;  2IXM A;  3POV A;  2O9X A;  3KYI A;  2J45 A;  2XLV A;  1ORY A;  5GPG B;  4BJ6 C;  1RXQ A;  2EPK X;  1E83 A;  3J06 A;  2GAQ A;  2J8W A;  3ASO C;  5A6K A;  5FCL A;  1BR2 A;  1U0B B;  1H9T A;  3UMI A;  1YZA A;  4NQF A;  1WGW A;  2Q3T A;  3C62 A;  3JRT A;  2RD9 A;  3H2V A;  2CYD A;  3TJ6 A;  4BJ6 A;  2XXA A;  2CDQ A;  1JPN A;  3DKA A;  256B A;  1OXB A;  4EHP A;  4JVS A;  1ZHX A;  2D4U A;  4DBR A;  2MWQ A;  1NFO A;  3EFO A;  4QI2 A;  1K04 A;  3LEO A;  4JUR I;  1Z63 A;  4U5F E;  3RIP A;  1MMN A;  1H9G A;  1K05 A;  2VCA A;  2IXO A;  5A69 A;  2KJG A;  2XL6 A;  3ABM C;  4FES A;  1V54 C;  1MQV A;  2KSF A;  4FWV A;  4NC3 A;  1YA7 O;  3DAF A;  2A69 F;  2PFD A;  4JEB A;  1Z23 A;  3K1I A;  3V5Z A;  4DVZ A;  4LDR A;  3TUL A;  4O7G A;  1HW1 A;  3DJN B;  3U8V A;  2PF4 E;  1TR2 A;  4C3E A;  2J9U A;  2OCC C;  2XLM A;  3RYL A;  2VCB A;  1F1M A;  4I1O B;  2ICW G;  1C03 A;  3B29 A;  5KYU A;  3AJM A;  3U5S A;  4DXW A;  4G7Z F;  4KI2 A;  2HMZ A;  2OU6 A;  1T6U A;  1TFO B;  3ZQV A;  4CS8 C;  4YK5 A;  3LEV A;  2YHS A;  3LAY A;  2XXA B;  4MND A;  3VYW A;  4U9D A;  1A7V A;  1T01 A;  3DD7 A;  3LJB A;  2HV6 A;  4IAQ A;  4PJN A;  2A6E F;  1R5I D;  1Q0K A;  3LNM B;  4U5E E;  2Y39 A;  1Y6D A;  2YLI A;  4OIN F;  1GS9 A;  1G4U S;  2CW0 F;  3L8I A;  3T6B A;  2KK1 A;  2ZXW C;  4J7T A;  2TMV P;  4JTD B;  2HSQ A;  5L3V A;  1VLS A;  1IZM A;  3EJN A;  1YLM A;  1FFT C;  4NCQ A;  4K1O A;  3TOM A;  2G3K A;  3ZDL A;  4KNW A;  2V26 A;  5D91 A;  1KU2 A;  1WTY A;  2PNO A;  3FAP B;  4WJ0 A;  1TQG A;  2ZD9 A;  3HNJ A;  1KNY A;  2R9R B;  3VRC A;  3X2Q C;  4D4N A;  1YJG A;  3EG9 A;  4PAC A;  3U9M A;  2YL7 A;  3CQZ A;  4R32 A;  2P7V A;  1YDI A;  5AGF A;  4I1M A;  4YL1 A;  4DBQ A;  2NSF A;  3EHM A;  1Y4C A;  3R7C A;  4JJF A;  3C8G A;  5KYU B;  3LLI A;  4JJG A;  4E0I A;  4YL0 A;  4K7B A;  3RQF A;  1XZP A;  2W4M A;  3C8G D;  5CI9 A;  4HE8 D;  5A6J A;  2EIM C;  4XPW A;  4K0D A;  3ABK C;  4QDL A;  1A7D A;  2YL3 A;  1L3P A;  3EGX A;  3GEH A;  1PV3 A;  4L6R A;  4PR9 A;  3V7O A;  3JTL O;  1I5N A;  3PMR A;  5B1B C;  5KYX B;  3VAY A;  5DS5 A;  2CGE A;  1RKE A;  2QLA A;  2HJ3 A;  4AE4 A;  1CGN A;  1D0Z A;  4RDA A;  5BQG A;  2BE5 F;  2FGY A;  2R7Q A;  3S0X A;  5EGY A;  2ETS A;  3TD7 A;  1RKC A;  5L0G A;  2OEX A;  3ZG1 A;  2ZXO A;  4LLE A;  3SYN A;  2X51 A;  1T6Q A;  3DM9 B;  3IQ5 A;  3JSE O;  4O6M A;  4IRU A;  1Q0D A;  4MVQ A;  1VK5 A;  5BQH A;  3TQO A;  5K0I A;  1D1A A;  4D4X A;  4Z9J A; 
#chains in the Genus database with same CATH homology
 1V55 C;  3FVY A;  1NU7 D;  3HLZ A;  2JD3 A;  4PJL A;  2J0X A;  2KW3 C;  1JPJ A;  5T3T A;  4W8K A;  2H7B A;  3JYH A;  2WZG A;  2KGO A;  1OKK A;  2M4E A;  1FMW A;  2IXP A;  3L34 A;  3RH3 A;  3S29 A;  5BUO A;  2YEV A;  3OA1 A;  5T3W A;  1ZHW A;  4O6Y A;  1D1C A;  2WZL A;  3EGX B;  1OKK D;  4N06 A;  5B1A C;  1TKN A;  4X0R A;  3T6J A;  4LER A;  4AE4 B;  4BJ5 C;  3Q6M A;  4OIQ F;  2A6H F;  5E3C A;  3E9V A;  3I4U A;  2DGJ A;  2G62 A;  4OD4 A;  2DYR C;  4BJ5 A;  3MLG A;  4E7S A;  4JZA A;  3W8I A;  2R7U A;  2NG1 A;  2WVN A;  2Z15 A;  4CS9 A;  3B0V C;  2A1D D;  2VB6 A;  1TWC A;  1OCC C;  5T1D B;  5KYN A;  4U5B E;  3KKB A;  2EIN C;  1ST6 A;  4C3D A;  3FHD A;  5KYW B;  3LS0 A;  1S7Z A;  3DZA A;  1MMA A;  4XLP F;  3DMD A;  3K6B A;  2VH3 A;  5DLJ A;  3JT1 A;  1M2V B;  2P6V A;  2Y3H A;  4KC9 A;  2A68 F;  2PX0 A;  4Q5S F;  2VAS A;  3PHF 2;  3DXJ F;  3K1I C;  3SP1 A;  1D1B A;  4PFP A;  2EIJ C;  3ZC4 A;  4XLN F;  3SZR A;  4QI0 A;  1IW7 F;  3FDQ A;  1SZI A;  2NUT B;  5DS4 A;  1OCZ C;  4JCH A;  4O6N A;  1ZU5 A;  1M57 C;  4PJM A;  3UNG C;  4G0H A;  3ZIB A;  5B3S C;  1W2W A;  4LLC A;  4BJ1 A;  3JSZ A;  3SEO A;  1MNE A;  3JCU Q;  3UGP A;  2EIK C;  4ZLD A;  3CZ6 A;  1J8Y F;  2Q9A A;  1QLE C;  4YT5 A;  3B9Q A;  3M1C B;  5E2Q A;  3EFO B;  5KYY A;  3Q7L A;  1SMY F;  3HJC A;  4YWQ A;  1VYI A;  4I44 A;  2ZXP A;  3AQB A;  5EHH A;  2IYL D;  4J32 B;  2EIL C;  4OIR F;  2E87 A;  1VYK A;  3EPV A;  3I5Q A;  4O79 A;  4CBE A;  3ABL C;  4PK4 A;  3KH2 A;  2QTV A;  2W4B A;  4EBB A;  3RFY A;  5DQZ A;  4J30 B;  2GFH A;  4JW1 A;  1MMG A;  3L0I A;  3LLK A;  3K1H A;  4LAC B;  3Q7G A;  3AG1 C;  4OIP F;  4ULW A;  2H7O A;  3EHN A;  4KBL A;  4BEJ A;  3GOD A;  1M56 C;  3EZH A;  2J9W A;  4IAO A;  1ZHY A;  3NRH A;  3EG9 B;  2LSE A;  3UGO A;  3Q6N A;  3ZSU A;  3FAJ A;  5CI8 A;  3GAN A;  4CSA C;  1FFH A;  4RD9 A;  5F5F A;  3X1O A;  3W2V A;  2PP4 A;  3EGD A;  4CSA A;  5IY5 C;  4CIH A;  3WG7 C;  2R7V A;  3RKO F;  1VMA A;  3F47 A;  1MND A;  3AG3 C;  1MMD A;  4CS9 C;  3EQL F;  4DOZ A;  2WL8 A;  2W45 A;  3NDB B;  3NYJ A;  3EH1 A;  4C3B A;  2KQ9 A;  1OCR C;  4PJJ A;  1QZX A;  1SF8 A;  2PX3 A;  3DM5 A;  5DS6 A;  3OWT A;  2Y3D A;  2B0J A;  3NYL A;  2WVO A;  4YT8 A;  3EGD B;  4GYT A;  4KNV A;  5D92 A;  5DQT A;  4I3M A;  2D5R B;  4E7Z A;  2J7P A;  3K7D A;  3NKE A;  2WVQ A;  1FMV A;  4PFO A;  1LKX A;  3LS1 A;  2J7P D;  1VOM A;  3I5P A;  2Y3B A;  1LS1 A;  2DYS C;  4XWJ A;  4CS7 A;  3NG1 A;  4FX5 A;  1J8M F;  3AQC A;  2L9J A;  3ITF A;  2NUP A;  2R7R A;  2R7O A;  1BR1 A;  1PD1 A;  4P6I C;  3HTK C;  3AG2 C;  2XL4 A;  4BJT A;  2R7W A;  1NG1 A;  2HV7 A;  2CNW A;  1BR4 A;  3H65 A;  4HFF B;  1NZE A;  3AG4 C;  1Z5Z A;  2CNW D;  3NYM A;  3LNR A;  1O87 A;  2H7V C;  1FTS A;  2G3V A;  3SNH A;  2WZF A;  2Q9C A;  1TWG A;  3N0T A;  5E33 A;  4XTK A;  1OCO C;  4G7O F;  2XRH A;  2J46 A;  3UMH A;  1ZHZ A;  4Q7C A;  4GEH A;  2V3C C;  3B0U X;  4DVY P;  4HEA J;  2NUP B;  4IWB A;  2OG2 A;  3K33 A;  3N2Z B;  4YN0 B;  3UMK A;  4ANJ A;  3F46 A;  2Y3G A;  5KYX A;  3W2W A;  2I8B A;  2QY9 A;  4RBN A;  4CS8 A;  3NKD A;  1PD0 A;  4OD5 A;  5L3Q A;  3CSK A;  2W9Y A;  4ZLC A;  4B6I A;  3DAG A;  2J9V A;  3N24 A;  3W8H A;  4AX2 A;  4A2N B;  2FFH A;  3S28 A;  4AK9 A;  3K66 A;  3B0P A;  4C7O A;  1PCX A;  3WOD F;  2Q9B A;  1ZYR F;  1D0Y A;  2KNH A;  3ZVR A;  5KYY B;  2ZXR A;  4F4B A;  1TWH A;  3MX3 A;  3S27 A;  3KL4 A;  4BG0 A;  3QMK A;  1RJ9 A;  4YT2 A;  3KMI A;  1TWA A;  2J0W A;  3UR3 C;  4H4K C;  4NY3 A;  1D0X A;  5DVW A;  1M2O A;  1Z6A A;  2R7X A;  5F5H A;  4YT4 A;  4U5H A;  4IJJ A;  4Q4Z F;  2Y69 C;  2WB7 A;  4M63 A;  3EH2 A;  3EZI A;  2ZPA A;  3O39 A;  4C7O B;  3DJU B;  4U5D E;  4YJW A;  2R7T A;  4G7H F;  3LES A;  2L81 A;  2XSE A;  3T4R A;  4MQ9 F;  1O5H A;  2YZS A;  1ZHT A;  5KYW A;  1N1C A;  2C04 A;  4OIO F;  2IOQ A;  1RJ9 B;  3ASN C;  1NU9 C;  5E3A A;  1Z3I X;  5HSW A;  3OEO A;  1M2V A;  4HFK B;  4U5C E;  4EWC A;  2IXN A;  4U5G A;  1G8X A;  3QZC A;  3E70 C;  1LVK A;  2MYS A;  5L3V A;  2R7S A;  3IEE A;  3O6X A;  3ECS A;  2NUT A;  1ZU4 A;  2C03 A;  2IXM A;  3POV A;  2O9X A;  2J45 A;  4BJ6 C;  3ASO C;  5FCL A;  1BR2 A;  3UMI A;  1WGW A;  2Q3T A;  3JRT A;  2XXA A;  4BJ6 A;  2CDQ A;  1JPN A;  4JVS A;  1ZHX A;  4DBR A;  2MWQ A;  3EFO A;  4QI2 A;  4JUR I;  1Z63 A;  4U5F E;  3RIP A;  1MMN A;  2IXO A;  2KJG A;  4FES A;  3ABM C;  1V54 C;  4FWV A;  3DAF A;  2A69 F;  2PFD A;  1Z23 A;  4DVZ A;  4O7G A;  3DJN B;  2PF4 E;  1TR2 A;  4C3E A;  2J9U A;  2OCC C;  3RYL A;  4I1O B;  5KYU A;  4KI2 A;  4G7Z F;  4CS8 C;  3LEV A;  2YHS A;  3LAY A;  2XXA B;  4MND A;  3VYW A;  3LJB A;  3DD7 A;  2HV6 A;  4PJN A;  2A6E F;  4U5E E;  2Y39 A;  4OIN F;  2CW0 F;  3T6B A;  2ZXW C;  1IZM A;  3EJN A;  1FFT C;  2G3K A;  4KNW A;  2V26 A;  5D91 A;  1KU2 A;  4WJ0 A;  3X2Q C;  3EG9 A;  3CQZ A;  2P7V A;  4I1M A;  4DBQ A;  3EHM A;  5KYU B;  4JJF A;  3LLI A;  4JJG A;  4K7B A;  2W4M A;  5CI9 A;  4HE8 D;  2EIM C;  4K0D A;  3ABK C;  4QDL A;  3V7O A;  3EGX A;  3PMR A;  5DS5 A;  5B1B C;  5KYX B;  3VAY A;  2CGE A;  4AE4 A;  1D0Z A;  4RDA A;  2BE5 F;  2FGY A;  2R7Q A;  3S0X A;  5EGY A;  3TD7 A;  3ZG1 A;  2ZXO A;  4LLE A;  3SYN A;  2X51 A;  3DM9 B;  4O6M A;  4IRU A;  1VK5 A;  1D1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...