3KMIA

Crystal structure of putative membrane protein from clostridium difficile 630
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
172
structure length
172
Chain Sequence
NIHKIHEVQKKLQEEVSIVLIDIADIIVNPKKENGYSRDLYTLNSLIDSSISETYDNINNTLLSDTRFFLEHMDIIKSQRDILENLYSYVSQLNSTPPQAHILSAFIHKIGYTEFEAETGNLLLEELKRLMISMKNQPLPVDRTEFENRAILFLCLTELKQFLVNRKHAQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative membrane protein from Clostridium difficile 630
rcsb
source organism Clostridium difficile
molecule tags Membrane protein
molecule keywords Putative membrane protein COG4129
total genus 68
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11728 ArAE_1_C Putative aromatic acid exporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kmiA00
3KMIA
chains in the Genus database with same CATH superfamily
4MTOA 1HW2A 5DS5A 1PD1A 3IQ5A 3Q6NA 1M56C 4JRZA 2P7VA 3EHMA 5L0GA 3RKOF 4CS8C 2KW3C 3G4XA 5JRAA 1OCRC 1BR4A 1RXQA 3OWTA 3IQTA 2LFFA 3VAYA 4K7BA 4LDQA 3LNRA 1WGWA 2DI3A 3JYHA 4U5GA 3UMHA 2XL6A 3K6BA 4NQFA 4ER9A 3U0CA 3JSEO 1HMDA 4I3MA 4OIRF 3AG1C 4XEKA 2HMQA 2PBEA 4XQ1A 2HV7A 2B0HA 1FTSA 5B1AC 4I1MA 4PJNA 3L0IA 3T6JA 3DM9B 1GQAA 3M4BA 2YRFA 3GEIA 3RF3A 4KNVA 3WHNA 1FMWA 3EQLF 3FVYA 4CIHA 2ZXPA 4D4XA 1C03A 4JTAB 2LFDA 3GANA 3RFYA 1O87A 3LNMB 2Q4FA 1RKEA 4JTCB 1ZHYA 1QLEC 1XWJA 2D4UA 3QW1A 5A6JA 1T9KA 3RVZA 2LD6A 2G3VA 4DVZA 3MYIA 1BR1A 2EPNA 2OJED 2PX3A 3SXKA 3UMIA 3EGXA 3NG1A 3X1OA 1V55C 4Q7CA 1E86A 1ORYA 3EPVA 3NKDA 3ZTMA 3DJNB 3C8GA 4JEAA 2A69F 4HEAJ 3A11A 2EIKC 1FAPB 1G4US 2HUJA 4JC7A 1AVOB 2EIJC 4XLPF 4P9FA 3LAYA 3L8IA 2NUPA 1R5ID 1M2VA 1QKRA 1Q0FA 3ZVRA 2QTVA 4C7OA 1ZU5A 2IYLD 3ASOC 4JIOA 4U5BE 3U2LA 3U3FA 2WZGA 4JJGA 4PJJA 3SYNA 1Y4CA 1V4AA 3LLKA 1VMAA 5KYYB 3G4ZA 1NU9C 1OKKD 2EILC 4QI0A 2A6EF 3AG4C 3KMIA 2AU5A 2YL1A 1K04A 1SZIA 1WN0A 2LIGA 3BRJA 5T3WA 3NKEA 1L3PA 3GM2A 1IZMA 4EHPA 1YZAA 4O6YA 4IJJA 3S0XA 3AG3C 1ORSC 1VTMP 1OXBA 2ZPAA 1ZW2A 3O55A 4JKVA 1QZXA 3EGDB 4U5FE 2M64A 3U9MA 3DWWA 1CGME 1VYIA 3S9OA 3ZC4A 4YT4A 5BQHA 5KYUB 3GODA 1VLTA 4U5CE 1EI7A 1JMWA 1LIHA 2E87A 2MHRA 4YN0B 3ZQYA 3ZTZA 3HNIA 2BL2A 3L34A 4MVOA 3J06A 4PR9A 2R7QA 1SYQA 2ZD9A 2WL8A 3QVZA 2I15A 2CDQA 1TQGA 3CQZA 5A69A 1YYJA 3H2VA 3K33A 3TOMA 4XEVA 3EH2A 1FFHA 3H65A 3PMRA 4CSAC 2L6GA 2Q7RA 1IW7F 1V54C 2J0WA 2WZLA 2UUHA 2YL3A 5JSLA 5JT4A 1T6UA 2XS8A 3EG9A 3HJCA 2NPUA 2P6VA 5JP7A 4KBLA 4KNWA 2RD9A 3VM6A 4O79A 2R03A 2JPUA 2J7PA 3ZDLA 1YJGA 4BJ1A 1FR0A 3DD7A 1JAFA 4ULVA 1M57C 2VB6A 4G78A 3SXYA 1N1CA 3SEOA 2AVKA 2WB7A 3TD7A 2XLWA 4EBBA 4O6NA 4PJLA 2MWQA 2Y39A 3EFOB 1LVKA 1HMOA 1MMNA 1OKKA 1ST6A 2J7PD 1O5HA 3M1CB 4L6RA 4MS2A 4Z9IA 3ZIBA 5KYYA 2EPOA 2EIMC 4G7OF 1Y6DA 2P0NA 2Q9BA 3AG2C 3ATPA 3KKBA 4IGGA 1JPNA 4CS9A 4Z9JA 3U9JA 1E84A 2L81A 4Z9HA 4ULWA 3U8PA 2GA0A 1A7EA 4O7GA 5B3SC 4FWVA 1M2VB 2YHSA 3ABMC 3DKAA 3MLGA 4QDLA 3U8VA 5IY5C 4XWJA 1RMVA 3HTKC 2HV6A 1ZHZA 2EPKX 1CPRA 3LS0A 4MTGA 4YJWA 4I44A 2XRHA 4YK5A 4H54A 4MVMA 2WVOA 2PNOA 5K0IA 3KPHA 4XPWA 5D92A 2KK1A 2J9VA 2Y3BA 1H9GA 3GEHA 3US6A 4HFFB 4D4NA 3PCVA 2IXOA 3GWLA 3NRHA 3TJ5A 2YLIA 2I8BA 3FXHA 2ICWG 1HY5A 3QMKA 5JS5A 256BA 5BQGA 1A7VA 1G8XA 4XLNF 3JT1A 4DBRA 1KTMA 2M4EA 5DLJA 1B68A 1T6IA 2DYSC 2RSEB 4BJ5C 4MVZA 1VLSA 2Y3HA 1GGQA 1SMYF 1EQ1A 1RKCA 3L8JA 5JVEA 2B0JA 4CDAA 4R32A 4CBEA 1HE9A 1I4ZA 4RDAA 1Z23A 2YL0A 3M79A 1CGOA 5AGFA 3VF0A 3F46A 3SXZA 4LERA 1TWCA 2NG1A 5COMA 5JLIA 1BDJB 3EG9B 3I4UA 1AUEA 1YAUO 3QVYA 3NYLA 1W2WA 2XSEA 4NCQA 5BUOA 1DOVA 3W8IA 2PF4E 2KC3A 2R9RB 2Y3DA 3RIPA 3RYLA 3S28A 5A6AA 3WAQA 4A4AA 2VASA 2XM4A 4K1OA 2XL8A 1F1MA 2TMVP 2VC9A 2OCCC 3ZWIA 3SXMA 5L0JA 3H2UA 2LSEA 3NMJA 5COGA 2R02A 1NLXA 3TJ6A 4GQHA 4MTFA 4EWCA 4DRHB 3FDQA 2R7VA 1T5OA 1I5NA 2QE9A 3B9QA 3N24A 2J9UA 2QUPA 4NTFA 4PFOA 3S27A 2YZSA 3K1IC 3O39A 1D1CA 4E18A 2CNWA 3S84A 5KYNA 1YA9A 3JZ0A 2YEVA 3ZSUA 4U9DA 1LI7A 2NUTA 1DOWA 1J8MF 2EPLX 3C62A 5F5FA 2R7RA 1GS9A 1ZHXA 5AC5A 3S90A 1QPUA 4YWQA 5D91A 1BR2A 4MW3A 3UGOA 2HZ8A 4CDYA 2ETSA 2PX0A 1EKYA 3E70C 4RBNA 2VCCA 4LLEA 3O10A 4JCZA 2CCYA 1GM5A 2FAPB 4DRJB 3R7CA 4JURI 3GM1A 4BG0A 2Y69C 3I5QA 1JOGA 5DQTA 3LLIA 2GFHA 1OW7A 5E2QA 3IEEA 1D1AA 2LP4A 3LESA 1Z5ZA 5AC4A 1OCCC 3EH1A 2ZXRA 1KU2A 4EIYA 3JTLO 1VYKA 2IXPA 3HLZA 3FAJA 4NY3A 2P61A 1LS1A 3S29A 3V5ZA 2UUIA 4GYTA 1LE2A 1MMGA 2IBFA 2NUTB 3NYJA 2F22A 4FX5A 5T1DB 5L3VA 2AP3A 2W4MA 4Q5SF 4IB4A 1LKXA 2A1DD 3A9CA 4JVSA 3RQGA 3W2VA 2R25A 4CIPA 4CDVA 3DAGA 5T3TA 2R7SA 2VCBA 1OW8A 1SF8A 1WOLA 1G4WR 1VOMA 1UG7A 1CGNA 2OOCA 2YLDA 2O9XA 3DJUB 3LS1A 4BPMA 2L6HA 3FOPA 3TULA 1A7DA 2NSGA 1XZPA 3FOOA 3IHUA 2VH3A 4C3EA 4JCHA 2L9JA 4UDVA 1TWAA 2XLEA 2OQMA 2C03A 1XZQA 2XLHA 4AX2A 1K05A 2DGJA 2DYRC 4IAQA 1S05A 3PDMP 3UGPA 3N2ZB 3U3BA 5KYXA 3OEOA 4NC3A 5E33A 3V5XA 1Z63A 1APCA 2YWAA 3NMKA 2OG2A 4CSAA 2DB4A 4YT5A 1PV3A 3ZQVA 3L1MA 3QZCA 5FZTA 2HKVA 2W45A 4YL1A 5GPGB 2EINC 3EHNA 1NZEA 2J0XA 1U0BB 3LUTB 5E3AA 1Q0KA 3T9OA 2HJ3A 3HNLA 2V3CC 3AGUA 3C8GB 2H7OA 3SNHA 3EJNA 1Z6AA 5CI8A 4G7HF 2XLMA 4IRUA 4J30B 3SZRA 3G50A 4IWBA 1TFKB 1Z7Qc 3DE8A 2KNHA 4DOZA 2IOQA 4YL0A 3UNGC 3N0TA 2L6FA 4JW1A 4DRIB 2KSFA 4C7OB 4F4BA 4QI2A 3LEVA 3AGTA 3BEHA 3TQOA 5A6BD 1OW6A 4YL3A 2AWCA 2NUPB 5TJ5E 1RCPA 4EBKA 2YL7A 4P6IC 4C3BA 2J9WA 4OD5A 4EKWA 1OQCA 4W8KA 1D0ZA 1YARO 1UFBA 1D1BA 2G62A 3LJBA 2XLDA 1Q0DA 3NYMA 5HSWA 2XLOA 4BJTA 2WVNA 3NDBB 2A68F 3EFOA 4E7ZA 1E2XA 4OD4A 4MVQA 3CAXA 2QY9A 3E9VA 5DS6A 2G3KA 4KI2A 3Q7GA 4EBJA 1AEPA 2OU6A 1A41A 2FFHA 5KYUA 3DMDA 3RQFA 3X2QC 3PHF2 2LK4A 1ZZPA 5L0FA 3M4CA 1A0BA 3K1IA 2Z15A 2HFIA 3JSZA 1ORJA 2W4BA 3F47A 1K40A 2CGEA 4HFKB 4XPYA 3W8HA 1ZHWA 2R7UA 1FFTC 2H7VC 3UR3C 3C8ZA 4U5EE 4J7YA 4ANJA 4NTAA 5DQZA 2H7BA 2V26A 2X0CA 3KH2A 1ZU4A 4U5DE 3W2WA 3KYIA 3FAPB 3HKKA 3IQ6A 5DVWA 4XPXA 1C02A 4AK9A 4E0HA 2IXMA 2JX0A 1LE4A 5F5HA 2ZXWC 2H8AA 4N6CA 3UMKA 4BEJA 4LACB 3T6GB 2AWYA 5EGYA 1D0YA 1H7IA 1E83A 3EZHA 4PACA 3JCUQ 2A0UA 4MVUA 4PFPA 5CIVA 2Q00A 3O6XA 3KL4A 4J7TA 4BJ5A 1OCOC 3JRMO 3I5PA 4BEMJ 4ZLDA 4ZLCA 2L7AA 3NMIA 2D5RB 3T4RA 4FESA 4MW8A 4CJGA 4LDKA 1JR8A 1NSGB 3ABKC 3MX3A 4JJFA 5F28E 4Q4ZF 2CW0F 2Q3TA 1H6GA 1T01A 1V74B 1TR2A 3C7JA 1C17M 4WABA 1U89A 1YVIA 3DZAA 1OCZC 2XS1A 1LPEA 1MMAA 3MBGA 4G7ZF 3T6BA 5COFA 3DM5A 3KYJA 3QTHA 3DXJF 4MQ9F 5KYWB 4O6MA 1WWPA 4XEFA 2ASRA 1PCXA 3M15A 3U2MA 5FCLA 1LM3B 4N6HA 1OR2A 5L3QA 3B0VC 2FGYA 1HE1A 2MYSA 3AQCA 2XM0A 4AE4B 3WG7C 2W9YA 4JEBA 4CJOA 2R7XA 3ECSA 3CZ6A 1QSPA 1YYXA 2J45A 3ABLC 3K7DA 4K0DA 4CS9C 2WZFA 1OXKA 1HW1A 5E3CA 3RH3A 4JZAA 2QNLA 4DXWA 5KYWA 2YVKA 3GM3A 1CPQA 1FMVA 4BJ6A 3B71A 2Q9CA 1I4YA 3IPMO 1NFNA 1EA8A 1NU7D 2R05A 2OEVA 3VYWA 4PJMA 1S7ZA 4AL0A 2XLVA 2A6HF 4H4KC 4N4WA 1JPJA 2LQGA 1NBBA 2X51A 3FMSA 4BJ6C 4DBQA 3POVA 4E0IA 1ZVZA 1NG1A 2C04A 2GAQA 2HMZA 3ASNC 3EGDA 4CS8A 2J9BA 2OEXA 3TOLA 3C18A 3HNJA 3GWNA 5B1BC 1KNYA 1U6HA 3CSKA 4CS7A 3AJMA 4EUKB 5B3IA 5A6BA 2BC5A 5EHHA 5JUAA 3FHDA 1Q0GA 3R2PA 1YA7O 3K1HA 4KC9A 4OIQF 2J46A 3GEEA 4DJ9A 2QLAA 2R7TA 4A2NB 3IQCA 4AE4A 3W4YA 3RQEA 2YKZA 5L0DA 2IM8A 4MVRA 1YLMA 3RVYA 2HSBA 4WGYA 5DS4A 4U5HA 2R7OA 4RD9A 4G0HA 2KGOA 3EZIA 2WVQA 4N06A 4CX9A 3V7OA 2HS5A 1YDIA 4WGZA 3TK0A 1Z3IX 2KJGA 1PD0A 2GWWA 3AQBA 2OKUA 3OA1A 3LEOA 2ZXOA 2YLGA 1R4TA 1QQ3A 4FAPB 3B29A 3B0PA 5L0IA 2A0BA 4X0RA 4E7SA 3V5YA 5HV9A 1TKNA 3WODF 2HSQA 2NSFA 2PFDA 1WTYA 3C63A 4C3DA 2XXAB 1NFOA 1M6TA 1JRAA 3Q7LA 2XXAA 3EGXB 3HNKA 4LLCA 4ONSA 3VRCA 1LS4A 1G5ZA 1MNEA 2XL4A 4P9TA 1O3UA 2PP4A 2HJMA 4DVYP 3C8GD 5A6KA 1Q0MA 1ZW3A 3AOUA 4JE9A 3DI5A 2J8WA 4IAOA 4JTDB 5L0HA 2Y3GA 1RKEB 2CNWD 3CEXA 2VCAA 4MNDA 1BBHA 4WJ0A 1ZHTA 2YQYA 4I1OB 1RJ9A 4E17A 1FNTc 1MNDA 4HE8D 1QVXA 1YZCA 1M2OA 5L0CA 3GORA 3Q6MA 1TWGA 1TWHA 5BQIA 2BE5F 4PK4A 1VB5A 2LCHA 4MVSA 4U9EA 1MMDA 5EK0A 4OIPF 4W8PA 3MFNA 3DAFA 1WATA 4GEHA 1OR3A 1TFOB 2GDCA 4M63A 1BZ4A 1SR2A 3RW0A 1VK5A 1D0XA 3SP1A 4AL1A 1E85A 5CI9A 3U5SA 1LI5A 3B0UX 3ITFA 2JD3A 2P1AA 4J32B 2R7WA 1H9TA 2KYHA 4YT2A 5KYXB 2EPMX 3JRTA 3ZG1A 1RJ9B 1L7CA 4LDRA 4OINF 4IARA 2KQ9A 4XTKA 3JYYA 2IXNA 2OJQA 4B6IA 3DE9A 2Q9AA 1MQVA 1T6QA 4YT8A 1J8YF 3K66A 4NTBA 4OIOF 1ZYRF 3QW0A 3MYFA 2CYDA 1WASA
chains in the Genus database with same CATH topology
5DS5A 1PD1A 3Q6NA 1M56C 2P7VA 3EHMA 3RKOF 4CS8C 2KW3C 1OCRC 1BR4A 3OWTA 3VAYA 4K7BA 3LNRA 1WGWA 3JYHA 4U5GA 3UMHA 3K6BA 4I3MA 4OIRF 3AG1C 2HV7A 1FTSA 5B1AC 4I1MA 4PJNA 3L0IA 3T6JA 3DM9B 4KNVA 1FMWA 3EQLF 3FVYA 4CIHA 2ZXPA 3GANA 3RFYA 1O87A 1ZHYA 1QLEC 2G3VA 4DVZA 1BR1A 2PX3A 3UMIA 3EGXA 3NG1A 1V55C 4Q7CA 3EPVA 3NKDA 3DJNB 2A69F 4HEAJ 2EIKC 2EIJC 4XLPF 3LAYA 2NUPA 1M2VA 3ZVRA 2QTVA 4C7OA 1ZU5A 2IYLD 3ASOC 4U5BE 2WZGA 4JJGA 4PJJA 3SYNA 3LLKA 1VMAA 5KYYB 1NU9C 1OKKD 2EILC 4QI0A 2A6EF 3AG4C 3KMIA 5T3WA 1SZIA 3NKEA 1IZMA 4O6YA 4IJJA 3S0XA 3AG3C 4U5FE 2ZPAA 1QZXA 3EGDB 1VYIA 3ZC4A 4YT4A 5KYUB 3GODA 4U5CE 2E87A 4YN0B 3L34A 2R7QA 2WL8A 2CDQA 3CQZA 3K33A 4CSAC 3PMRA 1FFHA 3EH2A 3H65A 1IW7F 1V54C 2J0WA 2WZLA 3HJCA 3EG9A 2P6VA 4KBLA 4KNWA 4O79A 2J7PA 3DD7A 1M57C 2VB6A 1N1CA 3SEOA 3TD7A 2WB7A 4EBBA 4O6NA 4PJLA 2MWQA 2Y39A 3EFOB 1LVKA 1MMNA 1OKKA 1ST6A 2J7PD 3M1CB 1O5HA 5KYYA 3ZIBA 2EIMC 4G7OF 2Q9BA 3AG2C 3KKBA 1JPNA 4CS9A 2L81A 4ULWA 4O7GA 4FWVA 1M2VB 2YHSA 3ABMC 3MLGA 4QDLA 5IY5C 4XWJA 3HTKC 2HV6A 1ZHZA 3X1OA 3LS0A 4YJWA 4I44A 2XRHA 2WVOA 5D92A 2J9VA 2Y3BA 4HFFB 2IXOA 3NRHA 2I8BA 3QMKA 1G8XA 4XLNF 4DBRA 3JT1A 2M4EA 5DLJA 2DYSC 4BJ5C 2Y3HA 1SMYF 2B0JA 4CBEA 4RDAA 1Z23A 3F46A 4LERA 1TWCA 2NG1A 3EG9B 3I4UA 3NYLA 1W2WA 2XSEA 5BUOA 3W8IA 2PF4E 3RIPA 2Y3DA 3RYLA 3S28A 2VASA 2OCCC 2LSEA 4EWCA 3FDQA 2R7VA 3B9QA 3N24A 2J9UA 4PFOA 3S27A 2YZSA 3K1IC 3O39A 1D1CA 2CNWA 5KYNA 2YEVA 3ZSUA 2NUTA 1J8MF 5F5FA 2R7RA 1ZHXA 4YWQA 5D91A 1BR2A 3UGOA 2PX0A 3E70C 4RBNA 4LLEA 4JURI 4BG0A 2Y69C 3I5QA 5DQTA 3LLIA 2GFHA 5E2QA 3IEEA 1D1AA 3LESA 1Z5ZA 1OCCC 3EH1A 2ZXRA 1KU2A 4OIQF 1VYKA 3HLZA 2IXPA 3FAJA 4NY3A 3S29A 1LS1A 4GYTA 1MMGA 2NUTB 3NYJA 5T1DB 4FX5A 5L3VA 2W4MA 4Q5SF 1LKXA 2A1DD 4JVSA 3W2VA 3DAGA 5T3TA 2R7SA 1SF8A 1VOMA 3DJUB 2O9XA 3LS1A 2VH3A 4C3EA 4JCHA 2L9JA 1TWAA 2C03A 4AX2A 2DGJA 2DYRC 3UGPA 3N2ZB 5KYXA 3OEOA 5E33A 1Z63A 2OG2A 4CSAA 4YT5A 3QZCA 2W45A 2EINC 3EHNA 1NZEA 2J0XA 5E3AA 2V3CC 2H7OA 3SNHA 3EJNA 1Z6AA 5CI8A 4G7HF 4IRUA 4J30B 3SZRA 4IWBA 2KNHA 4DOZA 2IOQA 3UNGC 3N0TA 4C7OB 4JW1A 4QI2A 4F4BA 3LEVA 2NUPB 4P6IC 4C3BA 2J9WA 4OD5A 4W8KA 1D0ZA 1D1BA 2G62A 3LJBA 3NYMA 5HSWA 4BJTA 2WVNA 3NDBB 2A68F 3EFOA 4E7ZA 4OD4A 2QY9A 3E9VA 5DS6A 2G3KA 4KI2A 3Q7GA 2FFHA 5KYUA 3DMDA 3X2QC 3PHF2 2Z15A 3JSZA 3F47A 2W4BA 2CGEA 4HFKB 3W8HA 1ZHWA 2R7UA 1FFTC 2H7VC 3UR3C 4U5EE 4ANJA 5DQZA 2H7BA 2V26A 3KH2A 1ZU4A 4U5DE 3W2WA 5DVWA 4AK9A 2IXMA 5F5HA 3UMKA 4BEJA 2ZXWC 4LACB 5EGYA 1D0YA 3EZHA 3JCUQ 4PFPA 3O6XA 3KL4A 4BJ5A 1OCOC 3I5PA 4ZLDA 4ZLCA 3T4RA 2D5RB 5B3SC 4FESA 3ABKC 3MX3A 4JJFA 4Q4ZF 2CW0F 2Q3TA 1TR2A 3DZAA 1OCZC 4G7ZF 1MMAA 3T6BA 3DM5A 4MQ9F 3DXJF 5KYWB 4O6MA 1PCXA 5FCLA 5L3QA 3B0VC 2MYSA 2FGYA 3AQCA 4AE4B 3WG7C 2W9YA 2R7XA 3ECSA 3CZ6A 2J45A 3ABLC 3K7DA 4K0DA 4CS9C 2WZFA 5E3CA 3RH3A 4JZAA 5KYWA 1FMVA 4BJ6A 2Q9CA 1NU7D 3VYWA 4PJMA 1S7ZA 4H4KC 2A6HF 1JPJA 2X51A 4DBQA 4BJ6C 3POVA 4CS8A 1NG1A 2C04A 3EGDA 3ASNC 4CS7A 5B1BC 3CSKA 5EHHA 3FHDA 3K1HA 4KC9A 2J46A 2R7TA 4A2NB 4AE4A 5DS4A 4U5HA 2R7OA 4RD9A 4G0HA 2KGOA 3EZIA 2WVQA 4N06A 3V7OA 1Z3IX 2KJGA 1PD0A 3AQBA 3OA1A 2ZXOA 3B0PA 4X0RA 4E7SA 1TKNA 3WODF 4C3DA 2XXAB 2PFDA 2XXAA 3Q7LA 3EGXB 4LLCA 2XL4A 1MNEA 2PP4A 4DVYP 4IAOA 2Y3GA 2CNWD 4MNDA 4WJ0A 1ZHTA 4I1OB 1RJ9A 1MNDA 4HE8D 1M2OA 3Q6MA 1TWGA 1TWHA 2BE5F 4PK4A 1MMDA 4OIPF 3DAFA 4GEHA 4BJ1A 4M63A 3SP1A 1VK5A 1D0XA 5CI9A 3B0UX 3ITFA 2JD3A 4J32B 2R7WA 4YT2A 5KYXB 3JRTA 3ZG1A 1RJ9B 4OINF 2KQ9A 4XTKA 2IXNA 4B6IA 2Q9AA 4YT8A 1J8YF 3K66A 4OIOF 1ZYRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMI A; 
#chains in the Genus database with same CATH topology
 4MTO A;  1HW2 A;  5DS5 A;  1PD1 A;  3IQ5 A;  3Q6N A;  1M56 C;  4JRZ A;  2P7V A;  3EHM A;  5L0G A;  3RKO F;  4CS8 C;  2KW3 C;  3G4X A;  5JRA A;  1OCR C;  1BR4 A;  1RXQ A;  3OWT A;  3IQT A;  2LFF A;  3VAY A;  4K7B A;  4LDQ A;  3LNR A;  1WGW A;  2DI3 A;  3JYH A;  4U5G A;  3UMH A;  2XL6 A;  3K6B A;  4NQF A;  4ER9 A;  3U0C A;  3JSE O;  1HMD A;  4I3M A;  4OIR F;  3AG1 C;  4XEK A;  2HMQ A;  2PBE A;  4XQ1 A;  2HV7 A;  2B0H A;  1FTS A;  5B1A C;  4I1M A;  4PJN A;  3L0I A;  3T6J A;  3DM9 B;  1GQA A;  3M4B A;  2YRF A;  3GEI A;  3RF3 A;  4KNV A;  3WHN A;  1FMW A;  3EQL F;  3FVY A;  4CIH A;  2ZXP A;  4D4X A;  1C03 A;  4JTA B;  2LFD A;  3GAN A;  3RFY A;  1O87 A;  3LNM B;  2Q4F A;  1RKE A;  4JTC B;  1ZHY A;  1QLE C;  1XWJ A;  2D4U A;  3QW1 A;  5A6J A;  1T9K A;  3RVZ A;  2LD6 A;  2G3V A;  4DVZ A;  3MYI A;  1BR1 A;  2EPN A;  2OJE D;  2PX3 A;  3SXK A;  3UMI A;  3EGX A;  3NG1 A;  3X1O A;  1V55 C;  4Q7C A;  1E86 A;  1ORY A;  3EPV A;  3NKD A;  3ZTM A;  3DJN B;  3C8G A;  4JEA A;  2A69 F;  4HEA J;  3A11 A;  2EIK C;  1FAP B;  1G4U S;  2HUJ A;  4JC7 A;  1AVO B;  2EIJ C;  4XLP F;  4P9F A;  3LAY A;  3L8I A;  2NUP A;  1R5I D;  1M2V A;  1QKR A;  1Q0F A;  3ZVR A;  2QTV A;  4C7O A;  1ZU5 A;  2IYL D;  3ASO C;  4JIO A;  4U5B E;  3U2L A;  3U3F A;  2WZG A;  4JJG A;  4PJJ A;  3SYN A;  1Y4C A;  1V4A A;  3LLK A;  1VMA A;  5KYY B;  3G4Z A;  1NU9 C;  1OKK D;  2EIL C;  4QI0 A;  2A6E F;  3AG4 C;  3KMI A;  2AU5 A;  2YL1 A;  1K04 A;  1SZI A;  1WN0 A;  2LIG A;  3BRJ A;  5T3W A;  3NKE A;  1L3P A;  3GM2 A;  1IZM A;  4EHP A;  1YZA A;  4O6Y A;  4IJJ A;  3S0X A;  3AG3 C;  1ORS C;  1VTM P;  1OXB A;  2ZPA A;  1ZW2 A;  3O55 A;  4JKV A;  1QZX A;  3EGD B;  4U5F E;  2M64 A;  3U9M A;  3DWW A;  1CGM E;  1VYI A;  3S9O A;  3ZC4 A;  4YT4 A;  5BQH A;  5KYU B;  3GOD A;  1VLT A;  4U5C E;  1EI7 A;  1JMW A;  1LIH A;  2E87 A;  2MHR A;  4YN0 B;  3ZQY A;  3ZTZ A;  3HNI A;  2BL2 A;  3L34 A;  4MVO A;  3J06 A;  4PR9 A;  2R7Q A;  1SYQ A;  2ZD9 A;  2WL8 A;  3QVZ A;  2I15 A;  2CDQ A;  1TQG A;  3CQZ A;  5A69 A;  1YYJ A;  3H2V A;  3K33 A;  3TOM A;  4XEV A;  3EH2 A;  1FFH A;  3H65 A;  3PMR A;  4CSA C;  2L6G A;  2Q7R A;  1IW7 F;  1V54 C;  2J0W A;  2WZL A;  2UUH A;  2YL3 A;  5JSL A;  5JT4 A;  1T6U A;  2XS8 A;  3EG9 A;  3HJC A;  2NPU A;  2P6V A;  5JP7 A;  4KBL A;  4KNW A;  2RD9 A;  3VM6 A;  4O79 A;  2R03 A;  2JPU A;  2J7P A;  3ZDL A;  1YJG A;  4BJ1 A;  1FR0 A;  3DD7 A;  1JAF A;  4ULV A;  1M57 C;  2VB6 A;  4G78 A;  3SXY A;  1N1C A;  3SEO A;  2AVK A;  2WB7 A;  3TD7 A;  2XLW A;  4EBB A;  4O6N A;  4PJL A;  2MWQ A;  2Y39 A;  3EFO B;  1LVK A;  1HMO A;  1MMN A;  1OKK A;  1ST6 A;  2J7P D;  1O5H A;  3M1C B;  4L6R A;  4MS2 A;  4Z9I A;  3ZIB A;  5KYY A;  2EPO A;  2EIM C;  4G7O F;  1Y6D A;  2P0N A;  2Q9B A;  3AG2 C;  3ATP A;  3KKB A;  4IGG A;  1JPN A;  4CS9 A;  4Z9J A;  3U9J A;  1E84 A;  2L81 A;  4Z9H A;  4ULW A;  3U8P A;  2GA0 A;  1A7E A;  4O7G A;  5B3S C;  4FWV A;  1M2V B;  2YHS A;  3ABM C;  3DKA A;  3MLG A;  4QDL A;  3U8V A;  5IY5 C;  4XWJ A;  1RMV A;  3HTK C;  2HV6 A;  1ZHZ A;  2EPK X;  1CPR A;  3LS0 A;  4MTG A;  4YJW A;  4I44 A;  2XRH A;  4YK5 A;  4H54 A;  4MVM A;  2WVO A;  2PNO A;  5K0I A;  3KPH A;  4XPW A;  5D92 A;  2KK1 A;  2J9V A;  2Y3B A;  1H9G A;  3GEH A;  3US6 A;  4HFF B;  4D4N A;  3PCV A;  2IXO A;  3GWL A;  3NRH A;  3TJ5 A;  2YLI A;  2I8B A;  3FXH A;  2ICW G;  1HY5 A;  3QMK A;  5JS5 A;  256B A;  5BQG A;  1A7V A;  1G8X A;  4XLN F;  3JT1 A;  4DBR A;  1KTM A;  2M4E A;  5DLJ A;  1B68 A;  1T6I A;  2DYS C;  2RSE B;  4BJ5 C;  4MVZ A;  1VLS A;  2Y3H A;  1GGQ A;  1SMY F;  1EQ1 A;  1RKC A;  3L8J A;  5JVE A;  2B0J A;  4CDA A;  4R32 A;  4CBE A;  1HE9 A;  1I4Z A;  4RDA A;  1Z23 A;  2YL0 A;  3M79 A;  1CGO A;  5AGF A;  3VF0 A;  3F46 A;  3SXZ A;  4LER A;  1TWC A;  2NG1 A;  5COM A;  5JLI A;  1BDJ B;  3EG9 B;  3I4U A;  1AUE A;  1YAU O;  3QVY A;  3NYL A;  1W2W A;  2XSE A;  4NCQ A;  5BUO A;  1DOV A;  3W8I A;  2PF4 E;  2KC3 A;  2R9R B;  2Y3D A;  3RIP A;  3RYL A;  3S28 A;  5A6A A;  3WAQ A;  4A4A A;  2VAS A;  2XM4 A;  4K1O A;  2XL8 A;  1F1M A;  2TMV P;  2VC9 A;  2OCC C;  3ZWI A;  3SXM A;  5L0J A;  3H2U A;  2LSE A;  3NMJ A;  5COG A;  2R02 A;  1NLX A;  3TJ6 A;  4GQH A;  4MTF A;  4EWC A;  4DRH B;  3FDQ A;  2R7V A;  1T5O A;  1I5N A;  2QE9 A;  3B9Q A;  3N24 A;  2J9U A;  2QUP A;  4NTF A;  4PFO A;  3S27 A;  2YZS A;  3K1I C;  3O39 A;  1D1C A;  4E18 A;  2CNW A;  3S84 A;  5KYN A;  1YA9 A;  3JZ0 A;  2YEV A;  3ZSU A;  4U9D A;  1LI7 A;  2NUT A;  1DOW A;  1J8M F;  2EPL X;  3C62 A;  5F5F A;  2R7R A;  1GS9 A;  1ZHX A;  5AC5 A;  3S90 A;  1QPU A;  4YWQ A;  5D91 A;  1BR2 A;  4MW3 A;  3UGO A;  2HZ8 A;  4CDY A;  2ETS A;  2PX0 A;  1EKY A;  3E70 C;  4RBN A;  2VCC A;  4LLE A;  3O10 A;  4JCZ A;  2CCY A;  1GM5 A;  2FAP B;  4DRJ B;  3R7C A;  4JUR I;  3GM1 A;  4BG0 A;  2Y69 C;  3I5Q A;  1JOG A;  5DQT A;  3LLI A;  2GFH A;  1OW7 A;  5E2Q A;  3IEE A;  1D1A A;  2LP4 A;  3LES A;  1Z5Z A;  5AC4 A;  1OCC C;  3EH1 A;  2ZXR A;  1KU2 A;  4EIY A;  3JTL O;  1VYK A;  2IXP A;  3HLZ A;  3FAJ A;  4NY3 A;  2P61 A;  1LS1 A;  3S29 A;  3V5Z A;  2UUI A;  4GYT A;  1LE2 A;  1MMG A;  2IBF A;  2NUT B;  3NYJ A;  2F22 A;  4FX5 A;  5T1D B;  5L3V A;  2AP3 A;  2W4M A;  4Q5S F;  4IB4 A;  1LKX A;  2A1D D;  3A9C A;  4JVS A;  3RQG A;  3W2V A;  2R25 A;  4CIP A;  4CDV A;  3DAG A;  5T3T A;  2R7S A;  2VCB A;  1OW8 A;  1SF8 A;  1WOL A;  1G4W R;  1VOM A;  1UG7 A;  1CGN A;  2OOC A;  2YLD A;  2O9X A;  3DJU B;  3LS1 A;  4BPM A;  2L6H A;  3FOP A;  3TUL A;  1A7D A;  2NSG A;  1XZP A;  3FOO A;  3IHU A;  2VH3 A;  4C3E A;  4JCH A;  2L9J A;  4UDV A;  1TWA A;  2XLE A;  2OQM A;  2C03 A;  1XZQ A;  2XLH A;  4AX2 A;  1K05 A;  2DGJ A;  2DYR C;  4IAQ A;  1S05 A;  3PDM P;  3UGP A;  3N2Z B;  3U3B A;  5KYX A;  3OEO A;  4NC3 A;  5E33 A;  3V5X A;  1Z63 A;  1APC A;  2YWA A;  3NMK A;  2OG2 A;  4CSA A;  2DB4 A;  4YT5 A;  1PV3 A;  3ZQV A;  3L1M A;  3QZC A;  5FZT A;  2HKV A;  2W45 A;  4YL1 A;  5GPG B;  2EIN C;  3EHN A;  1NZE A;  2J0X A;  1U0B B;  3LUT B;  5E3A A;  1Q0K A;  3T9O A;  2HJ3 A;  3HNL A;  2V3C C;  3AGU A;  3C8G B;  2H7O A;  3SNH A;  3EJN A;  1Z6A A;  5CI8 A;  4G7H F;  2XLM A;  4IRU A;  4J30 B;  3SZR A;  3G50 A;  4IWB A;  1TFK B;  1Z7Q c;  3DE8 A;  2KNH A;  4DOZ A;  2IOQ A;  4YL0 A;  3UNG C;  3N0T A;  2L6F A;  4JW1 A;  4DRI B;  2KSF A;  4C7O B;  4F4B A;  4QI2 A;  3LEV A;  3AGT A;  3BEH A;  3TQO A;  5A6B D;  1OW6 A;  4YL3 A;  2AWC A;  2NUP B;  5TJ5 E;  1RCP A;  4EBK A;  2YL7 A;  4P6I C;  4C3B A;  2J9W A;  4OD5 A;  4EKW A;  1OQC A;  4W8K A;  1D0Z A;  1YAR O;  1UFB A;  1D1B A;  2G62 A;  3LJB A;  2XLD A;  1Q0D A;  3NYM A;  5HSW A;  2XLO A;  4BJT A;  2WVN A;  3NDB B;  2A68 F;  3EFO A;  4E7Z A;  1E2X A;  4OD4 A;  4MVQ A;  3CAX A;  2QY9 A;  3E9V A;  5DS6 A;  2G3K A;  4KI2 A;  3Q7G A;  4EBJ A;  1AEP A;  2OU6 A;  1A41 A;  2FFH A;  5KYU A;  3DMD A;  3RQF A;  3X2Q C;  3PHF 2;  2LK4 A;  1ZZP A;  5L0F A;  3M4C A;  1A0B A;  3K1I A;  2Z15 A;  2HFI A;  3JSZ A;  1ORJ A;  2W4B A;  3F47 A;  1K40 A;  2CGE A;  4HFK B;  4XPY A;  3W8H A;  1ZHW A;  2R7U A;  1FFT C;  2H7V C;  3UR3 C;  3C8Z A;  4U5E E;  4J7Y A;  4ANJ A;  4NTA A;  5DQZ A;  2H7B A;  2V26 A;  2X0C A;  3KH2 A;  1ZU4 A;  4U5D E;  3W2W A;  3KYI A;  3FAP B;  3HKK A;  3IQ6 A;  5DVW A;  4XPX A;  1C02 A;  4AK9 A;  4E0H A;  2IXM A;  2JX0 A;  1LE4 A;  5F5H A;  2ZXW C;  2H8A A;  4N6C A;  3UMK A;  4BEJ A;  4LAC B;  3T6G B;  2AWY A;  5EGY A;  1D0Y A;  1H7I A;  1E83 A;  3EZH A;  4PAC A;  3JCU Q;  2A0U A;  4MVU A;  4PFP A;  5CIV A;  2Q00 A;  3O6X A;  3KL4 A;  4J7T A;  4BJ5 A;  1OCO C;  3JRM O;  3I5P A;  4BEM J;  4ZLD A;  4ZLC A;  2L7A A;  3NMI A;  2D5R B;  3T4R A;  4FES A;  4MW8 A;  4CJG A;  4LDK A;  1JR8 A;  1NSG B;  3ABK C;  3MX3 A;  4JJF A;  5F28 E;  4Q4Z F;  2CW0 F;  2Q3T A;  1H6G A;  1T01 A;  1V74 B;  1TR2 A;  3C7J A;  1C17 M;  4WAB A;  1U89 A;  1YVI A;  3DZA A;  1OCZ C;  2XS1 A;  1LPE A;  1MMA A;  3MBG A;  4G7Z F;  3T6B A;  5COF A;  3DM5 A;  3KYJ A;  3QTH A;  3DXJ F;  4MQ9 F;  5KYW B;  4O6M A;  1WWP A;  4XEF A;  2ASR A;  1PCX A;  3M15 A;  3U2M A;  5FCL A;  1LM3 B;  4N6H A;  1OR2 A;  5L3Q A;  3B0V C;  2FGY A;  1HE1 A;  2MYS A;  3AQC A;  2XM0 A;  4AE4 B;  3WG7 C;  2W9Y A;  4JEB A;  4CJO A;  2R7X A;  3ECS A;  3CZ6 A;  1QSP A;  1YYX A;  2J45 A;  3ABL C;  3K7D A;  4K0D A;  4CS9 C;  2WZF A;  1OXK A;  1HW1 A;  5E3C A;  3RH3 A;  4JZA A;  2QNL A;  4DXW A;  5KYW A;  2YVK A;  3GM3 A;  1CPQ A;  1FMV A;  4BJ6 A;  3B71 A;  2Q9C A;  1I4Y A;  3IPM O;  1NFN A;  1EA8 A;  1NU7 D;  2R05 A;  2OEV A;  3VYW A;  4PJM A;  1S7Z A;  4AL0 A;  2XLV A;  2A6H F;  4H4K C;  4N4W A;  1JPJ A;  2LQG A;  1NBB A;  2X51 A;  3FMS A;  4BJ6 C;  4DBQ A;  3POV A;  4E0I A;  1ZVZ A;  1NG1 A;  2C04 A;  2GAQ A;  2HMZ A;  3ASN C;  3EGD A;  4CS8 A;  2J9B A;  2OEX A;  3TOL A;  3C18 A;  3HNJ A;  3GWN A;  5B1B C;  1KNY A;  1U6H A;  3CSK A;  4CS7 A;  3AJM A;  4EUK B;  5B3I A;  5A6B A;  2BC5 A;  5EHH A;  5JUA A;  3FHD A;  1Q0G A;  3R2P A;  1YA7 O;  3K1H A;  4KC9 A;  4OIQ F;  2J46 A;  3GEE A;  4DJ9 A;  2QLA A;  2R7T A;  4A2N B;  3IQC A;  4AE4 A;  3W4Y A;  3RQE A;  2YKZ A;  5L0D A;  2IM8 A;  4MVR A;  1YLM A;  3RVY A;  2HSB A;  4WGY A;  5DS4 A;  4U5H A;  2R7O A;  4RD9 A;  4G0H A;  2KGO A;  3EZI A;  2WVQ A;  4N06 A;  4CX9 A;  3V7O A;  2HS5 A;  1YDI A;  4WGZ A;  3TK0 A;  1Z3I X;  2KJG A;  1PD0 A;  2GWW A;  3AQB A;  2OKU A;  3OA1 A;  3LEO A;  2ZXO A;  2YLG A;  1R4T A;  1QQ3 A;  4FAP B;  3B29 A;  3B0P A;  5L0I A;  2A0B A;  4X0R A;  4E7S A;  3V5Y A;  5HV9 A;  1TKN A;  3WOD F;  2HSQ A;  2NSF A;  2PFD A;  1WTY A;  3C63 A;  4C3D A;  2XXA B;  1NFO A;  1M6T A;  1JRA A;  3Q7L A;  2XXA A;  3EGX B;  3HNK A;  4LLC A;  4ONS A;  3VRC A;  1LS4 A;  1G5Z A;  1MNE A;  2XL4 A;  4P9T A;  1O3U A;  2PP4 A;  2HJM A;  4DVY P;  3C8G D;  5A6K A;  1Q0M A;  1ZW3 A;  3AOU A;  4JE9 A;  3DI5 A;  2J8W A;  4IAO A;  4JTD B;  5L0H A;  2Y3G A;  1RKE B;  2CNW D;  3CEX A;  2VCA A;  4MND A;  1BBH A;  4WJ0 A;  1ZHT A;  2YQY A;  4I1O B;  1RJ9 A;  4E17 A;  1FNT c;  1MND A;  4HE8 D;  1QVX A;  1YZC A;  1M2O A;  5L0C A;  3GOR A;  3Q6M A;  1TWG A;  1TWH A;  5BQI A;  2BE5 F;  4PK4 A;  1VB5 A;  2LCH A;  4MVS A;  4U9E A;  1MMD A;  5EK0 A;  4OIP F;  4W8P A;  3MFN A;  3DAF A;  1WAT A;  4GEH A;  1OR3 A;  1TFO B;  2GDC A;  4M63 A;  1BZ4 A;  1SR2 A;  3RW0 A;  1VK5 A;  1D0X A;  3SP1 A;  4AL1 A;  1E85 A;  5CI9 A;  3U5S A;  1LI5 A;  3B0U X;  3ITF A;  2JD3 A;  2P1A A;  4J32 B;  2R7W A;  1H9T A;  2KYH A;  4YT2 A;  5KYX B;  2EPM X;  3JRT A;  3ZG1 A;  1RJ9 B;  1L7C A;  4LDR A;  4OIN F;  4IAR A;  2KQ9 A;  4XTK A;  3JYY A;  2IXN A;  2OJQ A;  4B6I A;  3DE9 A;  2Q9A A;  1MQV A;  1T6Q A;  4YT8 A;  1J8Y F;  3K66 A;  4NTB A;  4OIO F;  1ZYR F;  3QW0 A;  3MYF A;  2CYD A;  1WAS A; 
#chains in the Genus database with same CATH homology
 5DS5 A;  1PD1 A;  3Q6N A;  1M56 C;  2P7V A;  3EHM A;  3RKO F;  4CS8 C;  2KW3 C;  1OCR C;  1BR4 A;  3OWT A;  3VAY A;  4K7B A;  3LNR A;  1WGW A;  3JYH A;  4U5G A;  3UMH A;  3K6B A;  4I3M A;  4OIR F;  3AG1 C;  2HV7 A;  1FTS A;  5B1A C;  4I1M A;  4PJN A;  3L0I A;  3T6J A;  3DM9 B;  4KNV A;  1FMW A;  3EQL F;  3FVY A;  4CIH A;  2ZXP A;  3GAN A;  3RFY A;  1O87 A;  1ZHY A;  1QLE C;  2G3V A;  4DVZ A;  1BR1 A;  2PX3 A;  3UMI A;  3EGX A;  3NG1 A;  1V55 C;  4Q7C A;  3EPV A;  3NKD A;  3DJN B;  2A69 F;  4HEA J;  2EIK C;  2EIJ C;  4XLP F;  3LAY A;  2NUP A;  1M2V A;  3ZVR A;  2QTV A;  4C7O A;  1ZU5 A;  2IYL D;  3ASO C;  4U5B E;  2WZG A;  4JJG A;  4PJJ A;  3SYN A;  3LLK A;  1VMA A;  5KYY B;  1NU9 C;  1OKK D;  2EIL C;  4QI0 A;  2A6E F;  3AG4 C;  3KMI A;  5T3W A;  1SZI A;  3NKE A;  1IZM A;  4O6Y A;  4IJJ A;  3S0X A;  3AG3 C;  4U5F E;  2ZPA A;  1QZX A;  3EGD B;  1VYI A;  3ZC4 A;  4YT4 A;  5KYU B;  3GOD A;  4U5C E;  2E87 A;  4YN0 B;  3L34 A;  2R7Q A;  2WL8 A;  2CDQ A;  3CQZ A;  3K33 A;  4CSA C;  3PMR A;  1FFH A;  3EH2 A;  3H65 A;  1IW7 F;  1V54 C;  2J0W A;  2WZL A;  3HJC A;  3EG9 A;  2P6V A;  4KBL A;  4KNW A;  4O79 A;  2J7P A;  3DD7 A;  1M57 C;  2VB6 A;  1N1C A;  3SEO A;  3TD7 A;  2WB7 A;  4EBB A;  4O6N A;  4PJL A;  2MWQ A;  2Y39 A;  3EFO B;  1LVK A;  1MMN A;  1OKK A;  1ST6 A;  2J7P D;  3M1C B;  1O5H A;  5KYY A;  3ZIB A;  2EIM C;  4G7O F;  2Q9B A;  3AG2 C;  3KKB A;  1JPN A;  4CS9 A;  2L81 A;  4ULW A;  4O7G A;  4FWV A;  1M2V B;  2YHS A;  3ABM C;  3MLG A;  4QDL A;  5IY5 C;  4XWJ A;  3HTK C;  2HV6 A;  1ZHZ A;  3X1O A;  3LS0 A;  4YJW A;  4I44 A;  2XRH A;  2WVO A;  5D92 A;  2J9V A;  2Y3B A;  4HFF B;  2IXO A;  3NRH A;  2I8B A;  3QMK A;  1G8X A;  4XLN F;  4DBR A;  3JT1 A;  2M4E A;  5DLJ A;  2DYS C;  4BJ5 C;  2Y3H A;  1SMY F;  2B0J A;  4CBE A;  4RDA A;  1Z23 A;  3F46 A;  4LER A;  1TWC A;  2NG1 A;  3EG9 B;  3I4U A;  3NYL A;  1W2W A;  2XSE A;  5BUO A;  3W8I A;  2PF4 E;  3RIP A;  2Y3D A;  3RYL A;  3S28 A;  2VAS A;  2OCC C;  2LSE A;  4EWC A;  3FDQ A;  2R7V A;  3B9Q A;  3N24 A;  2J9U A;  4PFO A;  3S27 A;  2YZS A;  3K1I C;  3O39 A;  1D1C A;  2CNW A;  5KYN A;  2YEV A;  3ZSU A;  2NUT A;  1J8M F;  5F5F A;  2R7R A;  1ZHX A;  4YWQ A;  5D91 A;  1BR2 A;  3UGO A;  2PX0 A;  3E70 C;  4RBN A;  4LLE A;  4JUR I;  4BG0 A;  2Y69 C;  3I5Q A;  5DQT A;  3LLI A;  2GFH A;  5E2Q A;  3IEE A;  1D1A A;  3LES A;  1Z5Z A;  1OCC C;  3EH1 A;  2ZXR A;  1KU2 A;  4OIQ F;  1VYK A;  3HLZ A;  2IXP A;  3FAJ A;  4NY3 A;  3S29 A;  1LS1 A;  4GYT A;  1MMG A;  2NUT B;  3NYJ A;  5T1D B;  4FX5 A;  5L3V A;  2W4M A;  4Q5S F;  1LKX A;  2A1D D;  4JVS A;  3W2V A;  3DAG A;  5T3T A;  2R7S A;  1SF8 A;  1VOM A;  3DJU B;  2O9X A;  3LS1 A;  2VH3 A;  4C3E A;  4JCH A;  2L9J A;  1TWA A;  2C03 A;  4AX2 A;  2DGJ A;  2DYR C;  3UGP A;  3N2Z B;  5KYX A;  3OEO A;  5E33 A;  1Z63 A;  2OG2 A;  4CSA A;  4YT5 A;  3QZC A;  2W45 A;  2EIN C;  3EHN A;  1NZE A;  2J0X A;  5E3A A;  2V3C C;  2H7O A;  3SNH A;  3EJN A;  1Z6A A;  5CI8 A;  4G7H F;  4IRU A;  4J30 B;  3SZR A;  4IWB A;  2KNH A;  4DOZ A;  2IOQ A;  3UNG C;  3N0T A;  4C7O B;  4JW1 A;  4QI2 A;  4F4B A;  3LEV A;  2NUP B;  4P6I C;  4C3B A;  2J9W A;  4OD5 A;  4W8K A;  1D0Z A;  1D1B A;  2G62 A;  3LJB A;  3NYM A;  5HSW A;  4BJT A;  2WVN A;  3NDB B;  2A68 F;  3EFO A;  4E7Z A;  4OD4 A;  2QY9 A;  3E9V A;  5DS6 A;  2G3K A;  4KI2 A;  3Q7G A;  2FFH A;  5KYU A;  3DMD A;  3X2Q C;  3PHF 2;  2Z15 A;  3JSZ A;  3F47 A;  2W4B A;  2CGE A;  4HFK B;  3W8H A;  1ZHW A;  2R7U A;  1FFT C;  2H7V C;  3UR3 C;  4U5E E;  4ANJ A;  5DQZ A;  2H7B A;  2V26 A;  3KH2 A;  1ZU4 A;  4U5D E;  3W2W A;  5DVW A;  4AK9 A;  2IXM A;  5F5H A;  3UMK A;  4BEJ A;  2ZXW C;  4LAC B;  5EGY A;  1D0Y A;  3EZH A;  3JCU Q;  4PFP A;  3O6X A;  3KL4 A;  4BJ5 A;  1OCO C;  3I5P A;  4ZLD A;  4ZLC A;  3T4R A;  2D5R B;  5B3S C;  4FES A;  3ABK C;  3MX3 A;  4JJF A;  4Q4Z F;  2CW0 F;  2Q3T A;  1TR2 A;  3DZA A;  1OCZ C;  4G7Z F;  1MMA A;  3T6B A;  3DM5 A;  4MQ9 F;  3DXJ F;  5KYW B;  4O6M A;  1PCX A;  5FCL A;  5L3Q A;  3B0V C;  2MYS A;  2FGY A;  3AQC A;  4AE4 B;  3WG7 C;  2W9Y A;  2R7X A;  3ECS A;  3CZ6 A;  2J45 A;  3ABL C;  3K7D A;  4K0D A;  4CS9 C;  2WZF A;  5E3C A;  3RH3 A;  4JZA A;  5KYW A;  1FMV A;  4BJ6 A;  2Q9C A;  1NU7 D;  3VYW A;  4PJM A;  1S7Z A;  4H4K C;  2A6H F;  1JPJ A;  2X51 A;  4DBQ A;  4BJ6 C;  3POV A;  4CS8 A;  1NG1 A;  2C04 A;  3EGD A;  3ASN C;  4CS7 A;  5B1B C;  3CSK A;  5EHH A;  3FHD A;  3K1H A;  4KC9 A;  2J46 A;  2R7T A;  4A2N B;  4AE4 A;  5DS4 A;  4U5H A;  2R7O A;  4RD9 A;  4G0H A;  2KGO A;  3EZI A;  2WVQ A;  4N06 A;  3V7O A;  1Z3I X;  2KJG A;  1PD0 A;  3AQB A;  3OA1 A;  2ZXO A;  3B0P A;  4X0R A;  4E7S A;  1TKN A;  3WOD F;  4C3D A;  2XXA B;  2PFD A;  2XXA A;  3Q7L A;  3EGX B;  4LLC A;  2XL4 A;  1MNE A;  2PP4 A;  4DVY P;  4IAO A;  2Y3G A;  2CNW D;  4MND A;  4WJ0 A;  1ZHT A;  4I1O B;  1RJ9 A;  1MND A;  4HE8 D;  1M2O A;  3Q6M A;  1TWG A;  1TWH A;  2BE5 F;  4PK4 A;  1MMD A;  4OIP F;  3DAF A;  4GEH A;  4BJ1 A;  4M63 A;  3SP1 A;  1VK5 A;  1D0X A;  5CI9 A;  3B0U X;  3ITF A;  2JD3 A;  4J32 B;  2R7W A;  4YT2 A;  5KYX B;  3JRT A;  3ZG1 A;  1RJ9 B;  4OIN F;  2KQ9 A;  4XTK A;  2IXN A;  4B6I A;  2Q9A A;  4YT8 A;  1J8Y F;  3K66 A;  4OIO F;  1ZYR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...