3KMIA

Crystal structure of putative membrane protein from clostridium difficile 630
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
172
structure length
172
Chain Sequence
NIHKIHEVQKKLQEEVSIVLIDIADIIVNPKKENGYSRDLYTLNSLIDSSISETYDNINNTLLSDTRFFLEHMDIIKSQRDILENLYSYVSQLNSTPPQAHILSAFIHKIGYTEFEAETGNLLLEELKRLMISMKNQPLPVDRTEFENRAILFLCLTELKQFLVNRKHAQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative membrane protein COG4129
publication title Crystal structure of putative membrane protein from Clostridium difficile 630
rcsb
source organism Clostridium difficile
molecule tags Membrane protein
total genus 68
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11728 ArAE_1_C Putative aromatic acid exporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kmiA00
3KMIA
chains in the Genus database with same CATH superfamily
2PX0A 1QZXA 1NLXA 1U89A 1K40A 3FOOA 5JLIA 1YDIA 1IW7F 3KYIA 1RJ9B 3K33A 4AL0A 3ZC4A 2A0UA 4IB4A 5L0JA 3JRTA 1OW7A 2LCHA 2EIMC 4ZLCA 1LIHA 5A6JA 1NBBA 2D4UA 2HZ8A 1VTMP 2M64A 4BJ5C 1ZW2A 4FX5A 2OCCC 2VASA 3PCVA 3ZQYA 4M63A 1TKNA 3HNLA 1PD1A 4O6MA 3JYHA 3TULA 1I5NA 2LP4A 3ASOC 2DB4A 3SXYA 4DXWA 4EBJA 4N6CA 3N2ZB 3PDMP 3IQTA 4RBNA 4C3DA 4KI2A 3DZAA 1E2XA 2KNHA 3IQCA 5DQZA 4NTAA 2OEXA 1F1MA 5BUOA 4NC3A 2PNOA 4JTAB 3O55A 5JT4A 5L0IA 1HW2A 2Q9CA 4CJGA 3IHUA 3GANA 3ZDLA 2R7VA 2J8WA 1ZVZA 1O3UA 1T6QA 4ONSA 4IWBA 3Q6NA 4CBEA 3X1OA 1LS4A 3GEEA 4BEMJ 4JCHA 1MMAA 1PV3A 4MW8A 4JIOA 1YJGA 4XEFA 1A7DA 4P9FA 1D1CA 2VCBA 4MVZA 3U9MA 3LS1A 1NU9C 3U9JA 1CPQA 1D0ZA 1ZW3A 5BQHA 2KGOA 2R02A 2XLMA 2ZXRA 4EBBA 2WZGA 5KYNA 1LS1A 1MNEA 2L9JA 5DS4A 3RIPA 1H7IA 3JT1A 2R7OA 4MVOA 3T6GB 1D1BA 3TJ5A 2M4EA 2WB7A 1M56C 1OXBA 3E9VA 3WG7C 4XPXA 3AG3C 4O6NA 5K0IA 4BJ6A 3EGDB 4WABA 3AGUA 4ULWA 3B71A 4PJLA 3EGDA 1T6IA 3CSKA 4U5FE 4QDLA 2R9RB 3POVA 2L6FA 4E18A 3FXHA 2OJQA 1M57C 1S7ZA 1FNTc 3GODA 2GWWA 2C04A 5DQTA 5A6KA 4JJFA 3DJUB 2LFFA 3JTLO 5AC4A 4CIPA 3U2MA 3NMJA 1YYJA 1OQCA 3MX3A 2J0XA 3H2UA 2IOQA 3KPHA 4MVRA 2QE9A 3QVYA 1HMDA 3DWWA 1A7EA 1VLTA 2CW0F 2Y3GA 2QLAA 2ZXOA 4J7TA 3TOMA 5B1AC 4OD5A 2YHSA 1SR2A 4NTBA 3EJNA 4EWCA 1EKYA 1BR2A 1MNDA 3TOLA 1MMGA 3AG2C 1ORYA 2VH3A 4NY3A 2NSGA 3ZWIA 2XXAB 5T3WA 1K05A 4CDYA 5A6AA 1N1CA 5BQGA 2EIKC 2ASRA 1ZZPA 1Y6DA 4PACA 1BZ4A 3V7OA 3I5PA 3VM6A 4MVQA 1TFKB 3FHDA 3ZTMA 3C8ZA 2BE5F 2Q7RA 1JPJA 1JR8A 3T6JA 4CDVA 1E84A 1Q0KA 2QY9A 3DKAA 4KNVA 4LLEA 4EIYA 4XQ1A 4XPWA 3B0UX 3ZIBA 1SZIA 1MMDA 2FAPB 2ETSA 3SNHA 3U5SA 4U5CE 1I4ZA 3L8IA 2X0CA 1JOGA 1LVKA 2YKZA 1OCRC 2OOCA 4KC9A 3ZSUA 2B0JA 4WJ0A 3TD7A 1BR4A 3RVYA 1RMVA 1OKKA 5KYXB 2YZSA 4G78A 5HSWA 1PCXA 1NFNA 5KYXA 1E85A 4I44A 2OG2A 3WAQA 2Q00A 2J9WA 3DI5A 3IQ5A 4QI2A 4GEHA 4D4NA 2PX3A 4OIOF 2IXPA 3ZTZA 2LSEA 4ULVA 3DM9B 4PJMA 3SZRA 4AE4B 4AL1A 2NG1A 4IJJA 4YL3A 5FCLA 2R7RA 1Z6AA 2Y69C 4E7ZA 4YT4A 2J9BA 3C18A 4C3EA 2AWYA 4MTOA 1FFHA 2KK1A 3K6BA 3QTHA 3L34A 3V5XA 5DS6A 1K04A 4PFOA 4YN0B 3O39A 3FMSA 4RDAA 3HNKA 4XLNF 1RKCA 3O10A 2EIJC 3GWNA 5CI9A 4BJ6C 5B3SC 2R7SA 2J45A 1TR2A 3LNMB 4HEAJ 4E0IA 3E70C 4U5BE 3R2PA 2H7BA 4MTGA 1D0XA 4I3MA 1LM3B 2Y39A 1E86A 1OCOC 2GA0A 3AG4C 1OR3A 2WVOA 3IEEA 3LJBA 3UNGC 1JAFA 4G0HA 4BEJA 2L6HA 4ER9A 5BQIA 1J8MF 3W8HA 2FFHA 2A6HF 2CNWA 5A69A 5B1BC 3GM2A 5E2QA 1Z7Qc 3U3FA 3HJCA 3JRMO 3X2QC 1H6GA 3CAXA 4HFFB 4J7YA 3B29A 5DVWA 1T9KA 3ZQVA 4EHPA 1A41A 1R5ID 1UG7A 2OU6A 1VYKA 1QQ3A 1V4AA 4Q5SF 4LDKA 4X0RA 2HV7A 3DXJF 4O6YA 1FAPB 2XS1A 2KSFA 2NSFA 3KYJA 4J32B 1VB5A 2BL2A 3TJ6A 2OKUA 1TWAA 3JSZA 1LE2A 4MTFA 3OA1A 4OIRF 2XLOA 3G4XA 3FVYA 1LI5A 1LPEA 4Z9JA 3T4RA 3TQOA 2QNLA 4U9DA 1FTSA 1YYXA 3C62A 2IXNA 2LD6A 1WGWA 3WHNA 4K7BA 5F5HA 4U5DE 1Z5ZA 1M2OA 4YL0A 1I4YA 3RQFA 2IXOA 2HUJA 3NYJA 1ZHWA 2QTVA 3C8GB 5CIVA 3C8GA 5FZTA 5KYYB 3N0TA 1RXQA 5KYYA 1G5ZA 2YRFA 4XEKA 2W45A 2J7PA 3RVZA 2HFIA 2X51A 1U0BB 3LEVA 3LLKA 2KJGA 3HLZA 4XTKA 1TFOB 1RCPA 2XM4A 3W2VA 3AQCA 3EHNA 1YLMA 1G4WR 2ZD9A 4MQ9F 2PBEA 3RQEA 3L1MA 2Q4FA 4DRHB 4OIPF 1CPRA 3QMKA 4U5GA 2IBFA 2AVKA 3I4UA 3BRJA 3NMKA 2A1DD 2YLDA 1C02A 4DBQA 3K1IA 4OIQF 4H4KC 4U5HA 3B0PA 4H54A 2OQMA 3M4CA 4JTCB 4K0DA 3W8IA 5AC5A 1ORSC 3EZIA 2IYLD 4YT5A 1V54C 2XL8A 1Q0DA 3QW0A 3U2LA 4G7HF 1OKKD 1TWGA 2NPUA 4W8KA 1D0YA 5IY5C 1ZHXA 3GWLA 4ZLDA 4CS9A 5AGFA 1ZU4A 3ITFA 2GAQA 2KQ9A 3CZ6A 1YA9A 3EH1A 1LE4A 2LQGA 4Z9IA 1W2WA 2NUPB 2Q3TA 1CGNA 1OW8A 2XLVA 3NKDA 3AGTA 3Q6MA 2NUPA 4PK4A 1ZHTA 3ZVRA 5TJ5E 5JRAA 3PMRA 4U9EA 1O87A 3LLIA 5COFA 2XLWA 2IXMA 1T01A 3RF3A 2TMVP 3EQLF 3HTKC 4GYTA 4BJ1A 2R7XA 4KBLA 3EH2A 5E3AA 2W9YA 4PJJA 4IARA 4LDRA 4Q7CA 1WATA 4I1MA 5JS5A 1Z63A 1ORJA 1T6UA 2EPLX 2NUTA 1OR2A 3UGOA 2D5RB 1CGOA 1V74B 2PFDA 2YVKA 2EPMX 2EINC 2JD3A 2WVNA 1OCZC 1BBHA 1TWCA 1LKXA 2I8BA 3V5YA 3NRHA 3LS0A 3F46A 1Q0FA 2VC9A 3EPVA 3L8JA 1HY5A 4JEBA 4LLCA 1NFOA 1AUEA 5T3TA 1L7CA 3JSEO 4JRZA 3KL4A 4IAQA 3S27A 1A7VA 5L0GA 2Q9AA 5L3VA 3EZHA 3SXKA 2J46A 2GDCA 4JURI 2ZPAA 2CNWD 3LAYA 4JTDB 2G3VA 3EGXB 4AX2A 2HMZA 2CDQA 2XLHA 4BJTA 3Q7GA 3EGXA 1ZHZA 4JZAA 2JX0A 3LEOA 4E7SA 1B68A 4MS2A 3J06A 3MBGA 2YL7A 4I1OB 2PP4A 2E87A 4C3BA 1QLEC 2HJMA 1DOWA 4JC7A 2OJED 4XLPF 1MQVA 4IAOA 4FAPB 4QI0A 1QPUA 2BC5A 1EQ1A 3QZCA 2AU5A 2J9UA 4CIHA 4A2NB 1DOVA 1O5HA 1Z3IX 3CQZA 1YZCA 2V26A 4IGGA 1WTYA 2HS5A 2AWCA 2FGYA 2Z15A 3GORA 2WL8A 4MNDA 4B6IA 3A11A 5A6BA 2XL4A 3QW1A 1WWPA 1OW6A 1WN0A 1NU7D 1ST6A 3EHMA 3JYYA 3KMIA 3LESA 4LDQA 3K1IC 1VOMA 4LERA 4PR9A 2HSQA 3NYMA 3NG1A 5CI8A 3MFNA 2B0HA 2R03A 3RQGA 3VYWA 2KC3A 4MVUA 5L3QA 1UFBA 1Z23A 3AG1C 4JEAA 4GQHA 4BPMA 1YA7O 2ZXPA 3AOUA 3ASNC 3CEXA 3DE9A 3LNRA 4CS9C 4N4WA 3C8GD 5DLJA 1S05A 1HE9A 2W4MA 2MYSA 3R7CA 5JSLA 2Q9BA 3B0VC 1ZYRF 4JE9A 2A0BA 2J7PD 2XL6A 1T5OA 2DYRC 4G7OF 3F47A 2G62A 3NMIA 4E17A 2R7WA 4UDVA 3N24A 4DRJB 2R7UA 1FMWA 3UMIA 3ABMC 1NZEA 4A4AA 1SYQA 2A6EF 1G8XA 2XS8A 3SP1A 3SYNA 3US6A 2KW3C 1Q0MA 3RW0A 5L0HA 2R7TA 3ECSA 1M2VB 4XEVA 1PD0A 1XZPA 4DJ9A 2EPKX 2P0NA 1M2VA 2W4BA 3RKOF 1TQGA 5L0DA 2YEVA 1HE1A 1RJ9A 3MLGA 2WZLA 2A69F 3S28A 2LFDA 2YQYA 3UMHA 1NSGB 2XLDA 4EKWA 2IM8A 4CS8A 2R05A 3W2WA 1XWJA 3ZG1A 3FOPA 4ANJA 2Y3BA 5JVEA 2F22A 3A9CA 4YJWA 4JVSA 2L81A 4MVMA 4EUKB 2MHRA 3FDQA 4CSAA 4HFKB 3S0XA 2KYHA 3S90A 5HV9A 3DM5A 2Y3HA 1RKEB 3SXZA 3KH2A 5F28E 3GM1A 1RKEA 3UMKA 4Q4ZF 5D91A 4N6HA 4C7OB 1FFTC 5L0CA 3FAJA 3NDBB 1A0BA 2XLEA 2RD9A 4C7OA 2H7VC 3VAYA 1E83A 1EI7A 4MVSA 2OEVA 4YT2A 3S9OA 3L0IA 4Z9HA 1Y4CA 3C7JA 3IPMO 2CYDA 3GM3A 3LUTB 5EGYA 1VMAA 3U0CA 3M79A 4O7GA 4DOZA 4AK9A 1C17M 3ABLC 1YVIA 4K1OA 4FESA 1BR1A 2VB6A 4CX9A 2J9VA 4FWVA 2P6VA 1HMOA 4R32A 3T6BA 4JJGA 3DAFA 3WODF 1YARO 2ICWG 4DVYP 3HNJA 2UUHA 4DVZA 3U8PA 2CCYA 2VCCA 5EHHA 3H65A 2HV6A 5B3IA 1M6TA 4JCZA 3SEOA 3NYLA 1AVOB 1EA8A 1J8YF 5KYWB 3VF0A 2YL3A 1NG1A 1G4US 1QSPA 5KYWA 4EBKA 1GM5A 5F5FA 1Q0GA 1VLSA 2LK4A 2MWQA 2VCAA 2XRHA 3EFOB 3Q7LA 4O79A 4YWQA 1H9GA 3HKKA 3EFOA 1QKRA 2O9XA 4XPYA 5DS5A 2AP3A 3G50A 1GGQA 4NTFA 4IRUA 3AQBA 2L6GA 2L7AA 5GPGB 3MYFA 5T1DB 2NUTB 2H8AA 4CS7A 2EILC 1WOLA 3DAGA 2P1AA 5A6BD 3AJMA 3GEIA 3DE8A 2DYSC 2QUPA 4CJOA 3UR3C 2R7QA 4DRIB 4OINF 2HKVA 2DGJA 2LIGA 2HMQA 4G7ZF 3NKEA 3ABKC 1ZHYA 4P6IC 1C03A 4PFPA 4BJ5A 1XZQA 3K1HA 3DJNB 5E33A 2R25A 4F4BA 3UGPA 2XM0A 3BEHA 2HJ3A 2YL0A 3MYIA 2XXAA 2RSEB 3U8VA 3I5QA 5KYUB 1V55C 2I15A 3U3BA 2J0WA 4CS8C 3ATPA 5KYUA 5COGA 1GS9A 3W4YA 1WASA 2DI3A 3RFYA 5L0FA 4BG0A 3JZ0A 3M15A 3RYLA 3IQ6A 5JUAA 2H7OA 1OCCC 2GFHA 256BA 3FAPB 4CSAC 1JRAA 1CGME 2C03A 2A68F 5EK0A 4CDAA 1MMNA 1VYIA 3RH3A 1IZMA 4J30B 1BDJB 2YLIA 2G3KA 1TWHA 2P61A 4NQFA 1SMYF 1R4TA 2UUIA 4LACB 4NCQA 1HW1A 4JW1A 4YK5A 2WVQA 3V5ZA 1KTMA 3O6XA 2ZXWC 2P7VA 4RD9A 3HNIA 1ZU5A 4OD4A 2WZFA 3S84A 2JPUA 3B9QA 1GQAA 3DMDA 3JCUQ 3PHF2 2CGEA 2XSEA 3DD7A 1OXKA 4W8PA 1VK5A 1KNYA 2EPNA 2HSBA 4HE8D 5COMA 4E0HA 1JPNA 2YLGA 1LI7A 3SXMA 1U6HA 4P9TA 3M1CB 4XWJA 3M4BA 4AE4A 4MW3A 3QVZA 1AEPA 1JMWA 2EPOA 3OEOA 4U5EE 4WGYA 4PJNA 4DBRA 4WGZA 1KU2A 4YL1A 2YL1A 1H9TA 1YZAA 4KNWA 3TK0A 2PF4E 1APCA 1QVXA 4D4XA 3VRCA 5D92A 3C63A 2Y3DA 2YWAA 3S29A 1SF8A 3KKBA 4N06A 5E3CA 3H2VA 3T9OA 3EG9B 4L6RA 1L3PA 2V3CC 3GEHA 3G4ZA 1FMVA 1YAUO 3EG9A 1FR0A 4YT8A 3K7DA 3OWTA 1D1AA 3K66A 4JKVA 5JP7A
chains in the Genus database with same CATH topology
2PX0A 1QZXA 1IW7F 1RJ9B 3K33A 3ZC4A 3JRTA 2EIMC 4ZLCA 4BJ5C 4FX5A 2OCCC 2VASA 4M63A 1TKNA 1PD1A 4O6MA 3JYHA 3ASOC 3N2ZB 4RBNA 4C3DA 4KI2A 3DZAA 2KNHA 5DQZA 5BUOA 2Q9CA 3GANA 2R7VA 4CBEA 4IWBA 3Q6NA 3X1OA 4JCHA 1MMAA 1D1CA 3LS1A 1NU9C 1D0ZA 2KGOA 2ZXRA 4EBBA 2WZGA 5KYNA 1LS1A 1MNEA 2L9JA 5DS4A 3JT1A 2R7OA 1D1BA 2M4EA 2WB7A 1M56C 3E9VA 3WG7C 3AG3C 4O6NA 4BJ6A 3EGDB 4ULWA 4PJLA 3EGDA 3CSKA 4U5FE 4QDLA 3POVA 1M57C 1S7ZA 3GODA 2C04A 5DQTA 4JJFA 3DJUB 3MX3A 2J0XA 2IOQA 2CW0F 2Y3GA 2ZXOA 5B1AC 4OD5A 2YHSA 4EWCA 3EJNA 1BR2A 1MNDA 1MMGA 3AG2C 2VH3A 4NY3A 2XXAB 5T3WA 1N1CA 2EIKC 3V7OA 3I5PA 3FHDA 2BE5F 1JPJA 3T6JA 2QY9A 4KNVA 4LLEA 3B0UX 3ZIBA 1SZIA 1MMDA 3SNHA 4U5CE 1LVKA 1OCRC 4KC9A 3ZSUA 2B0JA 4WJ0A 3TD7A 1BR4A 1OKKA 5KYXB 2YZSA 5HSWA 1PCXA 5KYXA 4I44A 2OG2A 2J9WA 4QI2A 4GEHA 2PX3A 4OIOF 2IXPA 2LSEA 3DM9B 4PJMA 3SZRA 4AE4B 2NG1A 4IJJA 5FCLA 2R7RA 1Z6AA 2Y69C 4E7ZA 4YT4A 4C3EA 1FFHA 3K6BA 3L34A 5DS6A 4PFOA 4YN0B 3O39A 4RDAA 4XLNF 4BJ6C 2EIJC 5CI9A 5B3SC 2R7SA 2J45A 1TR2A 4HEAJ 3E70C 4U5BE 2H7BA 1D0XA 4I3MA 2Y39A 1OCOC 3AG4C 2WVOA 3IEEA 3LJBA 3UNGC 4G0HA 4BEJA 1J8MF 3W8HA 2FFHA 2A6HF 2CNWA 5B1BC 5E2QA 3HJCA 3X2QC 5DVWA 4HFFB 1VYKA 4Q5SF 4X0RA 2HV7A 3DXJF 4O6YA 4J32B 1TWAA 3JSZA 3OA1A 4OIRF 3FVYA 3T4RA 1FTSA 2IXNA 1WGWA 4K7BA 5F5HA 4U5DE 1Z5ZA 1M2OA 2IXOA 3NYJA 1ZHWA 2QTVA 5KYYB 3N0TA 5KYYA 2W45A 2J7PA 2X51A 3LEVA 3LLKA 2KJGA 3HLZA 4XTKA 3W2VA 3AQCA 3EHNA 4MQ9F 4OIPF 2R7UA 3QMKA 4U5GA 3I4UA 2A1DD 4DBQA 4OIQF 4H4KC 4U5HA 3B0PA 4K0DA 3W8IA 3EZIA 2IYLD 4YT5A 1V54C 4G7HF 1OKKD 1TWGA 4W8KA 1D0YA 5IY5C 1ZHXA 4ZLDA 4CS9A 1ZU4A 3ITFA 2KQ9A 3CZ6A 3EH1A 1W2WA 2NUPB 2Q3TA 3NKDA 4PK4A 3Q6MA 3ZVRA 2NUPA 1ZHTA 3PMRA 1O87A 3LLIA 2IXMA 3EQLF 3HTKC 4GYTA 4BJ1A 2R7XA 4KBLA 3EH2A 5E3AA 2W9YA 4PJJA 4Q7CA 4I1MA 1Z63A 2NUTA 3UGOA 2D5RB 2PFDA 2EINC 2JD3A 2WVNA 1OCZC 1TWCA 2I8BA 1LKXA 3NRHA 3LS0A 3F46A 3EPVA 4LLCA 5T3TA 3KL4A 3S27A 5L3VA 2Q9AA 3EZHA 2J46A 4JURI 4AX2A 2ZPAA 2CNWD 3LAYA 2G3VA 3EGXB 2CDQA 4BJTA 3Q7GA 3EGXA 1ZHZA 4JZAA 4E7SA 4I1OB 2PP4A 2E87A 4C3BA 1QLEC 4XLPF 4IAOA 4QI0A 3QZCA 2J9UA 4CIHA 4A2NB 1O5HA 1Z3IX 3CQZA 2V26A 2FGYA 4MNDA 2Z15A 4B6IA 2WL8A 2XL4A 3EHMA 3KMIA 3RIPA 1NU7D 1ST6A 3LESA 3K1IC 1VOMA 4LERA 3NYMA 3NG1A 5CI8A 3VYWA 5L3QA 1Z23A 3AG1C 2ZXPA 3ASNC 3LNRA 4CS9C 5DLJA 2W4MA 2MYSA 2Q9BA 3B0VC 1ZYRF 2J7PD 2DYRC 4G7OF 3F47A 2G62A 2R7WA 3N24A 1FMWA 3UMIA 3ABMC 1NZEA 2A6EF 1G8XA 3SP1A 3SYNA 2KW3C 2R7TA 3ECSA 1M2VB 1PD0A 3RKOF 1M2VA 2W4BA 2YEVA 1RJ9A 3MLGA 2WZLA 2A69F 3S28A 3UMHA 4CS8A 3W2WA 4ANJA 3ZG1A 2Y3BA 4YJWA 4JVSA 2L81A 3FDQA 4CSAA 4HFKB 3S0XA 3DM5A 2Y3HA 3KH2A 3UMKA 4Q4ZF 5D91A 4C7OB 1FFTC 3FAJA 3NDBB 4C7OA 2H7VC 3VAYA 4YT2A 3L0IA 5EGYA 1VMAA 4O7GA 4DOZA 4AK9A 3ABLC 4FESA 1BR1A 2VB6A 2J9VA 4FWVA 2P6VA 3T6BA 4JJGA 3DAFA 3WODF 4DVYP 4DVZA 5EHHA 3H65A 2HV6A 3SEOA 3NYLA 1J8YF 5KYWB 1NG1A 5KYWA 5F5FA 2XRHA 4O79A 2MWQA 3EFOB 4YWQA 3Q7LA 3EFOA 5DS5A 2O9XA 4IRUA 3AQBA 5T1DB 4CS7A 2NUTB 2EILC 3DAGA 2DYSC 3UR3C 2R7QA 4OINF 2DGJA 4G7ZF 3NKEA 3ABKC 1ZHYA 4P6IC 4PFPA 4BJ5A 3K1HA 3DJNB 5E33A 3UGPA 4F4BA 2XXAA 3I5QA 5KYUB 1V55C 2J0WA 4CS8C 5KYUA 3RFYA 4BG0A 3RYLA 2H7OA 1OCCC 2GFHA 4CSAC 2C03A 2A68F 1MMNA 1VYIA 3RH3A 1IZMA 4J30B 2G3KA 1TWHA 1SMYF 4LACB 4JW1A 2WVQA 3O6XA 2ZXWC 2P7VA 4RD9A 1ZU5A 4OD4A 2WZFA 3B9QA 3DMDA 3JCUQ 3PHF2 2CGEA 2XSEA 3DD7A 1VK5A 4HE8D 1JPNA 3M1CB 4XWJA 4AE4A 4U5EE 3OEOA 4PJNA 4DBRA 1KU2A 4KNWA 2PF4E 5D92A 2Y3DA 3S29A 1SF8A 3KKBA 4N06A 5E3CA 3EG9B 2V3CC 1FMVA 3EG9A 4YT8A 3K7DA 3OWTA 1D1AA 3K66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMI A; 
#chains in the Genus database with same CATH topology
 2PX0 A;  1QZX A;  1NLX A;  1U89 A;  1K40 A;  3FOO A;  5JLI A;  1YDI A;  1IW7 F;  3KYI A;  1RJ9 B;  3K33 A;  4AL0 A;  3ZC4 A;  2A0U A;  4IB4 A;  5L0J A;  3JRT A;  1OW7 A;  2LCH A;  2EIM C;  4ZLC A;  1LIH A;  5A6J A;  1NBB A;  2D4U A;  2HZ8 A;  1VTM P;  2M64 A;  4BJ5 C;  1ZW2 A;  4FX5 A;  2OCC C;  2VAS A;  3PCV A;  3ZQY A;  4M63 A;  1TKN A;  3HNL A;  1PD1 A;  4O6M A;  3JYH A;  3TUL A;  1I5N A;  2LP4 A;  3ASO C;  2DB4 A;  3SXY A;  4DXW A;  4EBJ A;  4N6C A;  3N2Z B;  3PDM P;  3IQT A;  4RBN A;  4C3D A;  4KI2 A;  3DZA A;  1E2X A;  2KNH A;  3IQC A;  5DQZ A;  4NTA A;  2OEX A;  1F1M A;  5BUO A;  4NC3 A;  2PNO A;  4JTA B;  3O55 A;  5JT4 A;  5L0I A;  1HW2 A;  2Q9C A;  4CJG A;  3IHU A;  3GAN A;  3ZDL A;  2R7V A;  2J8W A;  1ZVZ A;  1O3U A;  1T6Q A;  4ONS A;  4IWB A;  3Q6N A;  4CBE A;  3X1O A;  1LS4 A;  3GEE A;  4BEM J;  4JCH A;  1MMA A;  1PV3 A;  4MW8 A;  4JIO A;  1YJG A;  4XEF A;  1A7D A;  4P9F A;  1D1C A;  2VCB A;  4MVZ A;  3U9M A;  3LS1 A;  1NU9 C;  3U9J A;  1CPQ A;  1D0Z A;  1ZW3 A;  5BQH A;  2KGO A;  2R02 A;  2XLM A;  2ZXR A;  4EBB A;  2WZG A;  5KYN A;  1LS1 A;  1MNE A;  2L9J A;  5DS4 A;  3RIP A;  1H7I A;  3JT1 A;  2R7O A;  4MVO A;  3T6G B;  1D1B A;  3TJ5 A;  2M4E A;  2WB7 A;  1M56 C;  1OXB A;  3E9V A;  3WG7 C;  4XPX A;  3AG3 C;  4O6N A;  5K0I A;  4BJ6 A;  3EGD B;  4WAB A;  3AGU A;  4ULW A;  3B71 A;  4PJL A;  3EGD A;  1T6I A;  3CSK A;  4U5F E;  4QDL A;  2R9R B;  3POV A;  2L6F A;  4E18 A;  3FXH A;  2OJQ A;  1M57 C;  1S7Z A;  1FNT c;  3GOD A;  2GWW A;  2C04 A;  5DQT A;  5A6K A;  4JJF A;  3DJU B;  2LFF A;  3JTL O;  5AC4 A;  4CIP A;  3U2M A;  3NMJ A;  1YYJ A;  1OQC A;  3MX3 A;  2J0X A;  3H2U A;  2IOQ A;  3KPH A;  4MVR A;  2QE9 A;  3QVY A;  1HMD A;  3DWW A;  1A7E A;  1VLT A;  2CW0 F;  2Y3G A;  2QLA A;  2ZXO A;  4J7T A;  3TOM A;  5B1A C;  4OD5 A;  2YHS A;  1SR2 A;  4NTB A;  3EJN A;  4EWC A;  1EKY A;  1BR2 A;  1MND A;  3TOL A;  1MMG A;  3AG2 C;  1ORY A;  2VH3 A;  4NY3 A;  2NSG A;  3ZWI A;  2XXA B;  5T3W A;  1K05 A;  4CDY A;  5A6A A;  1N1C A;  5BQG A;  2EIK C;  2ASR A;  1ZZP A;  1Y6D A;  4PAC A;  1BZ4 A;  3V7O A;  3I5P A;  3VM6 A;  4MVQ A;  1TFK B;  3FHD A;  3ZTM A;  3C8Z A;  2BE5 F;  2Q7R A;  1JPJ A;  1JR8 A;  3T6J A;  4CDV A;  1E84 A;  1Q0K A;  2QY9 A;  3DKA A;  4KNV A;  4LLE A;  4EIY A;  4XQ1 A;  4XPW A;  3B0U X;  3ZIB A;  1SZI A;  1MMD A;  2FAP B;  2ETS A;  3SNH A;  3U5S A;  4U5C E;  1I4Z A;  3L8I A;  2X0C A;  1JOG A;  1LVK A;  2YKZ A;  1OCR C;  2OOC A;  4KC9 A;  3ZSU A;  2B0J A;  4WJ0 A;  3TD7 A;  1BR4 A;  3RVY A;  1RMV A;  1OKK A;  5KYX B;  2YZS A;  4G78 A;  5HSW A;  1PCX A;  1NFN A;  5KYX A;  1E85 A;  4I44 A;  2OG2 A;  3WAQ A;  2Q00 A;  2J9W A;  3DI5 A;  3IQ5 A;  4QI2 A;  4GEH A;  4D4N A;  2PX3 A;  4OIO F;  2IXP A;  3ZTZ A;  2LSE A;  4ULV A;  3DM9 B;  4PJM A;  3SZR A;  4AE4 B;  4AL1 A;  2NG1 A;  4IJJ A;  4YL3 A;  5FCL A;  2R7R A;  1Z6A A;  2Y69 C;  4E7Z A;  4YT4 A;  2J9B A;  3C18 A;  4C3E A;  2AWY A;  4MTO A;  1FFH A;  2KK1 A;  3K6B A;  3QTH A;  3L34 A;  3V5X A;  5DS6 A;  1K04 A;  4PFO A;  4YN0 B;  3O39 A;  3FMS A;  4RDA A;  3HNK A;  4XLN F;  1RKC A;  3O10 A;  2EIJ C;  3GWN A;  5CI9 A;  4BJ6 C;  5B3S C;  2R7S A;  2J45 A;  1TR2 A;  3LNM B;  4HEA J;  4E0I A;  3E70 C;  4U5B E;  3R2P A;  2H7B A;  4MTG A;  1D0X A;  4I3M A;  1LM3 B;  2Y39 A;  1E86 A;  1OCO C;  2GA0 A;  3AG4 C;  1OR3 A;  2WVO A;  3IEE A;  3LJB A;  3UNG C;  1JAF A;  4G0H A;  4BEJ A;  2L6H A;  4ER9 A;  5BQI A;  1J8M F;  3W8H A;  2FFH A;  2A6H F;  2CNW A;  5A69 A;  5B1B C;  3GM2 A;  5E2Q A;  1Z7Q c;  3U3F A;  3HJC A;  3JRM O;  3X2Q C;  1H6G A;  3CAX A;  4HFF B;  4J7Y A;  3B29 A;  5DVW A;  1T9K A;  3ZQV A;  4EHP A;  1A41 A;  1R5I D;  1UG7 A;  2OU6 A;  1VYK A;  1QQ3 A;  1V4A A;  4Q5S F;  4LDK A;  4X0R A;  2HV7 A;  3DXJ F;  4O6Y A;  1FAP B;  2XS1 A;  2KSF A;  2NSF A;  3KYJ A;  4J32 B;  1VB5 A;  2BL2 A;  3TJ6 A;  2OKU A;  1TWA A;  3JSZ A;  1LE2 A;  4MTF A;  3OA1 A;  4OIR F;  2XLO A;  3G4X A;  3FVY A;  1LI5 A;  1LPE A;  4Z9J A;  3T4R A;  3TQO A;  2QNL A;  4U9D A;  1FTS A;  1YYX A;  3C62 A;  2IXN A;  2LD6 A;  1WGW A;  3WHN A;  4K7B A;  5F5H A;  4U5D E;  1Z5Z A;  1M2O A;  4YL0 A;  1I4Y A;  3RQF A;  2IXO A;  2HUJ A;  3NYJ A;  1ZHW A;  2QTV A;  3C8G B;  5CIV A;  3C8G A;  5FZT A;  5KYY B;  3N0T A;  1RXQ A;  5KYY A;  1G5Z A;  2YRF A;  4XEK A;  2W45 A;  2J7P A;  3RVZ A;  2HFI A;  2X51 A;  1U0B B;  3LEV A;  3LLK A;  2KJG A;  3HLZ A;  4XTK A;  1TFO B;  1RCP A;  2XM4 A;  3W2V A;  3AQC A;  3EHN A;  1YLM A;  1G4W R;  2ZD9 A;  4MQ9 F;  2PBE A;  3RQE A;  3L1M A;  2Q4F A;  4DRH B;  4OIP F;  1CPR A;  3QMK A;  4U5G A;  2IBF A;  2AVK A;  3I4U A;  3BRJ A;  3NMK A;  2A1D D;  2YLD A;  1C02 A;  4DBQ A;  3K1I A;  4OIQ F;  4H4K C;  4U5H A;  3B0P A;  4H54 A;  2OQM A;  3M4C A;  4JTC B;  4K0D A;  3W8I A;  5AC5 A;  1ORS C;  3EZI A;  2IYL D;  4YT5 A;  1V54 C;  2XL8 A;  1Q0D A;  3QW0 A;  3U2L A;  4G7H F;  1OKK D;  1TWG A;  2NPU A;  4W8K A;  1D0Y A;  5IY5 C;  1ZHX A;  3GWL A;  4ZLD A;  4CS9 A;  5AGF A;  1ZU4 A;  3ITF A;  2GAQ A;  2KQ9 A;  3CZ6 A;  1YA9 A;  3EH1 A;  1LE4 A;  2LQG A;  4Z9I A;  1W2W A;  2NUP B;  2Q3T A;  1CGN A;  1OW8 A;  2XLV A;  3NKD A;  3AGT A;  3Q6M A;  2NUP A;  4PK4 A;  1ZHT A;  3ZVR A;  5TJ5 E;  5JRA A;  3PMR A;  4U9E A;  1O87 A;  3LLI A;  5COF A;  2XLW A;  2IXM A;  1T01 A;  3RF3 A;  2TMV P;  3EQL F;  3HTK C;  4GYT A;  4BJ1 A;  2R7X A;  4KBL A;  3EH2 A;  5E3A A;  2W9Y A;  4PJJ A;  4IAR A;  4LDR A;  4Q7C A;  1WAT A;  4I1M A;  5JS5 A;  1Z63 A;  1ORJ A;  1T6U A;  2EPL X;  2NUT A;  1OR2 A;  3UGO A;  2D5R B;  1CGO A;  1V74 B;  2PFD A;  2YVK A;  2EPM X;  2EIN C;  2JD3 A;  2WVN A;  1OCZ C;  1BBH A;  1TWC A;  1LKX A;  2I8B A;  3V5Y A;  3NRH A;  3LS0 A;  3F46 A;  1Q0F A;  2VC9 A;  3EPV A;  3L8J A;  1HY5 A;  4JEB A;  4LLC A;  1NFO A;  1AUE A;  5T3T A;  1L7C A;  3JSE O;  4JRZ A;  3KL4 A;  4IAQ A;  3S27 A;  1A7V A;  5L0G A;  2Q9A A;  5L3V A;  3EZH A;  3SXK A;  2J46 A;  2GDC A;  4JUR I;  2ZPA A;  2CNW D;  3LAY A;  4JTD B;  2G3V A;  3EGX B;  4AX2 A;  2HMZ A;  2CDQ A;  2XLH A;  4BJT A;  3Q7G A;  3EGX A;  1ZHZ A;  4JZA A;  2JX0 A;  3LEO A;  4E7S A;  1B68 A;  4MS2 A;  3J06 A;  3MBG A;  2YL7 A;  4I1O B;  2PP4 A;  2E87 A;  4C3B A;  1QLE C;  2HJM A;  1DOW A;  4JC7 A;  2OJE D;  4XLP F;  1MQV A;  4IAO A;  4FAP B;  4QI0 A;  1QPU A;  2BC5 A;  1EQ1 A;  3QZC A;  2AU5 A;  2J9U A;  4CIH A;  4A2N B;  1DOV A;  1O5H A;  1Z3I X;  3CQZ A;  1YZC A;  2V26 A;  4IGG A;  1WTY A;  2HS5 A;  2AWC A;  2FGY A;  2Z15 A;  3GOR A;  2WL8 A;  4MND A;  4B6I A;  3A11 A;  5A6B A;  2XL4 A;  3QW1 A;  1WWP A;  1OW6 A;  1WN0 A;  1NU7 D;  1ST6 A;  3EHM A;  3JYY A;  3KMI A;  3LES A;  4LDQ A;  3K1I C;  1VOM A;  4LER A;  4PR9 A;  2HSQ A;  3NYM A;  3NG1 A;  5CI8 A;  3MFN A;  2B0H A;  2R03 A;  3RQG A;  3VYW A;  2KC3 A;  4MVU A;  5L3Q A;  1UFB A;  1Z23 A;  3AG1 C;  4JEA A;  4GQH A;  4BPM A;  1YA7 O;  2ZXP A;  3AOU A;  3ASN C;  3CEX A;  3DE9 A;  3LNR A;  4CS9 C;  4N4W A;  3C8G D;  5DLJ A;  1S05 A;  1HE9 A;  2W4M A;  2MYS A;  3R7C A;  5JSL A;  2Q9B A;  3B0V C;  1ZYR F;  4JE9 A;  2A0B A;  2J7P D;  2XL6 A;  1T5O A;  2DYR C;  4G7O F;  3F47 A;  2G62 A;  3NMI A;  4E17 A;  2R7W A;  4UDV A;  3N24 A;  4DRJ B;  2R7U A;  1FMW A;  3UMI A;  3ABM C;  1NZE A;  4A4A A;  1SYQ A;  2A6E F;  1G8X A;  2XS8 A;  3SP1 A;  3SYN A;  3US6 A;  2KW3 C;  1Q0M A;  3RW0 A;  5L0H A;  2R7T A;  3ECS A;  1M2V B;  4XEV A;  1PD0 A;  1XZP A;  4DJ9 A;  2EPK X;  2P0N A;  1M2V A;  2W4B A;  3RKO F;  1TQG A;  5L0D A;  2YEV A;  1HE1 A;  1RJ9 A;  3MLG A;  2WZL A;  2A69 F;  3S28 A;  2LFD A;  2YQY A;  3UMH A;  1NSG B;  2XLD A;  4EKW A;  2IM8 A;  4CS8 A;  2R05 A;  3W2W A;  1XWJ A;  3ZG1 A;  3FOP A;  4ANJ A;  2Y3B A;  5JVE A;  2F22 A;  3A9C A;  4YJW A;  4JVS A;  2L81 A;  4MVM A;  4EUK B;  2MHR A;  3FDQ A;  4CSA A;  4HFK B;  3S0X A;  2KYH A;  3S90 A;  5HV9 A;  3DM5 A;  2Y3H A;  1RKE B;  3SXZ A;  3KH2 A;  5F28 E;  3GM1 A;  1RKE A;  3UMK A;  4Q4Z F;  5D91 A;  4N6H A;  4C7O B;  1FFT C;  5L0C A;  3FAJ A;  3NDB B;  1A0B A;  2XLE A;  2RD9 A;  4C7O A;  2H7V C;  3VAY A;  1E83 A;  1EI7 A;  4MVS A;  2OEV A;  4YT2 A;  3S9O A;  3L0I A;  4Z9H A;  1Y4C A;  3C7J A;  3IPM O;  2CYD A;  3GM3 A;  3LUT B;  5EGY A;  1VMA A;  3U0C A;  3M79 A;  4O7G A;  4DOZ A;  4AK9 A;  1C17 M;  3ABL C;  1YVI A;  4K1O A;  4FES A;  1BR1 A;  2VB6 A;  4CX9 A;  2J9V A;  4FWV A;  2P6V A;  1HMO A;  4R32 A;  3T6B A;  4JJG A;  3DAF A;  3WOD F;  1YAR O;  2ICW G;  4DVY P;  3HNJ A;  2UUH A;  4DVZ A;  3U8P A;  2CCY A;  2VCC A;  5EHH A;  3H65 A;  2HV6 A;  5B3I A;  1M6T A;  4JCZ A;  3SEO A;  3NYL A;  1AVO B;  1EA8 A;  1J8Y F;  5KYW B;  3VF0 A;  2YL3 A;  1NG1 A;  1G4U S;  1QSP A;  5KYW A;  4EBK A;  1GM5 A;  5F5F A;  1Q0G A;  1VLS A;  2LK4 A;  2MWQ A;  2VCA A;  2XRH A;  3EFO B;  3Q7L A;  4O79 A;  4YWQ A;  1H9G A;  3HKK A;  3EFO A;  1QKR A;  2O9X A;  4XPY A;  5DS5 A;  2AP3 A;  3G50 A;  1GGQ A;  4NTF A;  4IRU A;  3AQB A;  2L6G A;  2L7A A;  5GPG B;  3MYF A;  5T1D B;  2NUT B;  2H8A A;  4CS7 A;  2EIL C;  1WOL A;  3DAG A;  2P1A A;  5A6B D;  3AJM A;  3GEI A;  3DE8 A;  2DYS C;  2QUP A;  4CJO A;  3UR3 C;  2R7Q A;  4DRI B;  4OIN F;  2HKV A;  2DGJ A;  2LIG A;  2HMQ A;  4G7Z F;  3NKE A;  3ABK C;  1ZHY A;  4P6I C;  1C03 A;  4PFP A;  4BJ5 A;  1XZQ A;  3K1H A;  3DJN B;  5E33 A;  2R25 A;  4F4B A;  3UGP A;  2XM0 A;  3BEH A;  2HJ3 A;  2YL0 A;  3MYI A;  2XXA A;  2RSE B;  3U8V A;  3I5Q A;  5KYU B;  1V55 C;  2I15 A;  3U3B A;  2J0W A;  4CS8 C;  3ATP A;  5KYU A;  5COG A;  1GS9 A;  3W4Y A;  1WAS A;  2DI3 A;  3RFY A;  5L0F A;  4BG0 A;  3JZ0 A;  3M15 A;  3RYL A;  3IQ6 A;  5JUA A;  2H7O A;  1OCC C;  2GFH A;  256B A;  3FAP B;  4CSA C;  1JRA A;  1CGM E;  2C03 A;  2A68 F;  5EK0 A;  4CDA A;  1MMN A;  1VYI A;  3RH3 A;  1IZM A;  4J30 B;  1BDJ B;  2YLI A;  2G3K A;  1TWH A;  2P61 A;  4NQF A;  1SMY F;  1R4T A;  2UUI A;  4LAC B;  4NCQ A;  1HW1 A;  4JW1 A;  4YK5 A;  2WVQ A;  3V5Z A;  1KTM A;  3O6X A;  2ZXW C;  2P7V A;  4RD9 A;  3HNI A;  1ZU5 A;  4OD4 A;  2WZF A;  3S84 A;  2JPU A;  3B9Q A;  1GQA A;  3DMD A;  3JCU Q;  3PHF 2;  2CGE A;  2XSE A;  3DD7 A;  1OXK A;  4W8P A;  1VK5 A;  1KNY A;  2EPN A;  2HSB A;  4HE8 D;  5COM A;  4E0H A;  1JPN A;  2YLG A;  1LI7 A;  3SXM A;  1U6H A;  4P9T A;  3M1C B;  4XWJ A;  3M4B A;  4AE4 A;  4MW3 A;  3QVZ A;  1AEP A;  1JMW A;  2EPO A;  3OEO A;  4U5E E;  4WGY A;  4PJN A;  4DBR A;  4WGZ A;  1KU2 A;  4YL1 A;  2YL1 A;  1H9T A;  1YZA A;  4KNW A;  3TK0 A;  2PF4 E;  1APC A;  1QVX A;  4D4X A;  3VRC A;  5D92 A;  3C63 A;  2Y3D A;  2YWA A;  3S29 A;  1SF8 A;  3KKB A;  4N06 A;  5E3C A;  3H2V A;  3T9O A;  3EG9 B;  4L6R A;  1L3P A;  2V3C C;  3GEH A;  3G4Z A;  1FMV A;  1YAU O;  3EG9 A;  1FR0 A;  4YT8 A;  3K7D A;  3OWT A;  1D1A A;  3K66 A;  4JKV A;  5JP7 A; 
#chains in the Genus database with same CATH homology
 2PX0 A;  1QZX A;  1IW7 F;  1RJ9 B;  3K33 A;  3ZC4 A;  3JRT A;  2EIM C;  4ZLC A;  4BJ5 C;  4FX5 A;  2OCC C;  2VAS A;  4M63 A;  1TKN A;  1PD1 A;  4O6M A;  3JYH A;  3ASO C;  3N2Z B;  4RBN A;  4C3D A;  4KI2 A;  3DZA A;  2KNH A;  5DQZ A;  5BUO A;  2Q9C A;  3GAN A;  2R7V A;  4CBE A;  4IWB A;  3Q6N A;  3X1O A;  4JCH A;  1MMA A;  1D1C A;  3LS1 A;  1NU9 C;  1D0Z A;  2KGO A;  2ZXR A;  4EBB A;  2WZG A;  5KYN A;  1LS1 A;  1MNE A;  2L9J A;  5DS4 A;  3JT1 A;  2R7O A;  1D1B A;  2M4E A;  2WB7 A;  1M56 C;  3E9V A;  3WG7 C;  3AG3 C;  4O6N A;  4BJ6 A;  3EGD B;  4ULW A;  4PJL A;  3EGD A;  3CSK A;  4U5F E;  4QDL A;  3POV A;  1M57 C;  1S7Z A;  3GOD A;  2C04 A;  5DQT A;  4JJF A;  3DJU B;  3MX3 A;  2J0X A;  2IOQ A;  2CW0 F;  2Y3G A;  2ZXO A;  5B1A C;  4OD5 A;  2YHS A;  4EWC A;  3EJN A;  1BR2 A;  1MND A;  1MMG A;  3AG2 C;  2VH3 A;  4NY3 A;  2XXA B;  5T3W A;  1N1C A;  2EIK C;  3V7O A;  3I5P A;  3FHD A;  2BE5 F;  1JPJ A;  3T6J A;  2QY9 A;  4KNV A;  4LLE A;  3B0U X;  3ZIB A;  1SZI A;  1MMD A;  3SNH A;  4U5C E;  1LVK A;  1OCR C;  4KC9 A;  3ZSU A;  2B0J A;  4WJ0 A;  3TD7 A;  1BR4 A;  1OKK A;  5KYX B;  2YZS A;  5HSW A;  1PCX A;  5KYX A;  4I44 A;  2OG2 A;  2J9W A;  4QI2 A;  4GEH A;  2PX3 A;  4OIO F;  2IXP A;  2LSE A;  3DM9 B;  4PJM A;  3SZR A;  4AE4 B;  2NG1 A;  4IJJ A;  5FCL A;  2R7R A;  1Z6A A;  2Y69 C;  4E7Z A;  4YT4 A;  4C3E A;  1FFH A;  3K6B A;  3L34 A;  5DS6 A;  4PFO A;  4YN0 B;  3O39 A;  4RDA A;  4XLN F;  4BJ6 C;  2EIJ C;  5CI9 A;  5B3S C;  2R7S A;  2J45 A;  1TR2 A;  4HEA J;  3E70 C;  4U5B E;  2H7B A;  1D0X A;  4I3M A;  2Y39 A;  1OCO C;  3AG4 C;  2WVO A;  3IEE A;  3LJB A;  3UNG C;  4G0H A;  4BEJ A;  1J8M F;  3W8H A;  2FFH A;  2A6H F;  2CNW A;  5B1B C;  5E2Q A;  3HJC A;  3X2Q C;  5DVW A;  4HFF B;  1VYK A;  4Q5S F;  4X0R A;  2HV7 A;  3DXJ F;  4O6Y A;  4J32 B;  1TWA A;  3JSZ A;  3OA1 A;  4OIR F;  3FVY A;  3T4R A;  1FTS A;  2IXN A;  1WGW A;  4K7B A;  5F5H A;  4U5D E;  1Z5Z A;  1M2O A;  2IXO A;  3NYJ A;  1ZHW A;  2QTV A;  5KYY B;  3N0T A;  5KYY A;  2W45 A;  2J7P A;  2X51 A;  3LEV A;  3LLK A;  2KJG A;  3HLZ A;  4XTK A;  3W2V A;  3AQC A;  3EHN A;  4MQ9 F;  4OIP F;  2R7U A;  3QMK A;  4U5G A;  3I4U A;  2A1D D;  4DBQ A;  4OIQ F;  4H4K C;  4U5H A;  3B0P A;  4K0D A;  3W8I A;  3EZI A;  2IYL D;  4YT5 A;  1V54 C;  4G7H F;  1OKK D;  1TWG A;  4W8K A;  1D0Y A;  5IY5 C;  1ZHX A;  4ZLD A;  4CS9 A;  1ZU4 A;  3ITF A;  2KQ9 A;  3CZ6 A;  3EH1 A;  1W2W A;  2NUP B;  2Q3T A;  3NKD A;  4PK4 A;  3Q6M A;  3ZVR A;  2NUP A;  1ZHT A;  3PMR A;  1O87 A;  3LLI A;  2IXM A;  3EQL F;  3HTK C;  4GYT A;  4BJ1 A;  2R7X A;  4KBL A;  3EH2 A;  5E3A A;  2W9Y A;  4PJJ A;  4Q7C A;  4I1M A;  1Z63 A;  2NUT A;  3UGO A;  2D5R B;  2PFD A;  2EIN C;  2JD3 A;  2WVN A;  1OCZ C;  1TWC A;  2I8B A;  1LKX A;  3NRH A;  3LS0 A;  3F46 A;  3EPV A;  4LLC A;  5T3T A;  3KL4 A;  3S27 A;  5L3V A;  2Q9A A;  3EZH A;  2J46 A;  4JUR I;  4AX2 A;  2ZPA A;  2CNW D;  3LAY A;  2G3V A;  3EGX B;  2CDQ A;  4BJT A;  3Q7G A;  3EGX A;  1ZHZ A;  4JZA A;  4E7S A;  4I1O B;  2PP4 A;  2E87 A;  4C3B A;  1QLE C;  4XLP F;  4IAO A;  4QI0 A;  3QZC A;  2J9U A;  4CIH A;  4A2N B;  1O5H A;  1Z3I X;  3CQZ A;  2V26 A;  2FGY A;  4MND A;  2Z15 A;  4B6I A;  2WL8 A;  2XL4 A;  3EHM A;  3KMI A;  3RIP A;  1NU7 D;  1ST6 A;  3LES A;  3K1I C;  1VOM A;  4LER A;  3NYM A;  3NG1 A;  5CI8 A;  3VYW A;  5L3Q A;  1Z23 A;  3AG1 C;  2ZXP A;  3ASN C;  3LNR A;  4CS9 C;  5DLJ A;  2W4M A;  2MYS A;  2Q9B A;  3B0V C;  1ZYR F;  2J7P D;  2DYR C;  4G7O F;  3F47 A;  2G62 A;  2R7W A;  3N24 A;  1FMW A;  3UMI A;  3ABM C;  1NZE A;  2A6E F;  1G8X A;  3SP1 A;  3SYN A;  2KW3 C;  2R7T A;  3ECS A;  1M2V B;  1PD0 A;  3RKO F;  1M2V A;  2W4B A;  2YEV A;  1RJ9 A;  3MLG A;  2WZL A;  2A69 F;  3S28 A;  3UMH A;  4CS8 A;  3W2W A;  4ANJ A;  3ZG1 A;  2Y3B A;  4YJW A;  4JVS A;  2L81 A;  3FDQ A;  4CSA A;  4HFK B;  3S0X A;  3DM5 A;  2Y3H A;  3KH2 A;  3UMK A;  4Q4Z F;  5D91 A;  4C7O B;  1FFT C;  3FAJ A;  3NDB B;  4C7O A;  2H7V C;  3VAY A;  4YT2 A;  3L0I A;  5EGY A;  1VMA A;  4O7G A;  4DOZ A;  4AK9 A;  3ABL C;  4FES A;  1BR1 A;  2VB6 A;  2J9V A;  4FWV A;  2P6V A;  3T6B A;  4JJG A;  3DAF A;  3WOD F;  4DVY P;  4DVZ A;  5EHH A;  3H65 A;  2HV6 A;  3SEO A;  3NYL A;  1J8Y F;  5KYW B;  1NG1 A;  5KYW A;  5F5F A;  2XRH A;  4O79 A;  2MWQ A;  3EFO B;  4YWQ A;  3Q7L A;  3EFO A;  5DS5 A;  2O9X A;  4IRU A;  3AQB A;  5T1D B;  4CS7 A;  2NUT B;  2EIL C;  3DAG A;  2DYS C;  3UR3 C;  2R7Q A;  4OIN F;  2DGJ A;  4G7Z F;  3NKE A;  3ABK C;  1ZHY A;  4P6I C;  4PFP A;  4BJ5 A;  3K1H A;  3DJN B;  5E33 A;  3UGP A;  4F4B A;  2XXA A;  3I5Q A;  5KYU B;  1V55 C;  2J0W A;  4CS8 C;  5KYU A;  3RFY A;  4BG0 A;  3RYL A;  2H7O A;  1OCC C;  2GFH A;  4CSA C;  2C03 A;  2A68 F;  1MMN A;  1VYI A;  3RH3 A;  1IZM A;  4J30 B;  2G3K A;  1TWH A;  1SMY F;  4LAC B;  4JW1 A;  2WVQ A;  3O6X A;  2ZXW C;  2P7V A;  4RD9 A;  1ZU5 A;  4OD4 A;  2WZF A;  3B9Q A;  3DMD A;  3JCU Q;  3PHF 2;  2CGE A;  2XSE A;  3DD7 A;  1VK5 A;  4HE8 D;  1JPN A;  3M1C B;  4XWJ A;  4AE4 A;  4U5E E;  3OEO A;  4PJN A;  4DBR A;  1KU2 A;  4KNW A;  2PF4 E;  5D92 A;  2Y3D A;  3S29 A;  1SF8 A;  3KKB A;  4N06 A;  5E3C A;  3EG9 B;  2V3C C;  1FMV A;  3EG9 A;  4YT8 A;  3K7D A;  3OWT A;  1D1A A;  3K66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...