3KMIA

Crystal structure of putative membrane protein from clostridium difficile 630
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
172
structure length
172
Chain Sequence
b'NIHKIHEVQKKLQEEVSIVLIDIADIIVNPKKENGYSRDLYTLNSLIDSSISETYDNINNTLLSDTRFFLEHMDIIKSQRDILENLYSYVSQLNSTPPQAHILSAFIHKIGYTEFEAETGNLLLEELKRLMISMKNQPLPVDRTEFENRAILFLCLTELKQFLVNRKHAQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative membrane protein COG4129
molecule tags Membrane protein
source organism Clostridium difficile
publication title Crystal structure of putative membrane protein from Clostridium difficile 630
rcsb
total genus 68
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11728 ArAE_1_C Putative aromatic acid exporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kmiA00
3KMIA
chains in the Genus database with same CATH superfamily
2D4UA 2EPMX 2R9RB 5EHHA 2XS1A 1K40A 2YEVA 3EHMA 3GANA 2VC9A 4WJ0A 2XXAA 1WATA 2NUPA 2XSEA 2A0UA 4OD5A 1OR2A 4DBRA 1D1CA 3HNKA 4PFOA 1ZHWA 4X0RA 4PK4A 5L0GA 5KYYA 1ORJA 1PD1A 1E85A 3M79A 3MYFA 3RVYA 1VYKA 4YL0A 4Z9HA 1HMOA 1HY5A 4IARA 3ZQYA 4PFPA 1QKRA 3QW0A 2YHSA 4JTAB 5FZTA 4YL1A 3EG9A 3Q6MA 4G78A 2JD3A 2Y3DA 5JP7A 2M64A 4FWVA 3S27A 2L7AA 4LDKA 3FAJA 3K1IC 2Q3TA 3DM9B 5B3IA 3V5YA 3PHF2 4Z9IA 4UDVA 1EQ1A 3HJCA 2PNOA 1BR4A 4CS9C 1MMNA 4OIPF 2OJED 4NCQA 2DGJA 1V55C 3CQZA 4ZLDA 3EGDA 2L6HA 1KNYA 2J7PA 4CDVA 1BDJB 5E3CA 3SXMA 1NSGB 2FAPB 3M4BA 4MS2A 2EIMC 3IQ6A 4U5BE 2YL1A 1V74B 5GPGB 4YWQA 4FAPB 2R7OA 3EG9B 1C03A 1K05A 4PJMA 2NUTA 1E84A 2AWCA 1ZU5A 1D1BA 2QLAA 2CW0F 5JSLA 4U5GA 3S29A 1C17M 2LIGA 2ETSA 2LK4A 3UGPA 2HSBA 3ASNC 1RMVA 2A1DD 3JSEO 1D0XA 3C8GB 1TR2A 5DS4A 2YL7A 2B0HA 3GEIA 3CAXA 3NRHA 4CSAC 1C02A 2XLEA 1VB5A 2AVKA 1ORSC 2WZFA 4JJFA 2G62A 3T6JA 2KYHA 2Y69C 4AE4B 4O79A 4D4XA 4XWJA 2PX3A 5L0FA 5JRAA 1B68A 2BC5A 2QUPA 2VCAA 3EHNA 2QY9A 4EHPA 1FNTc 2DYRC 4G7ZF 2P7VA 4CJOA 3N2ZB 4R32A 4XLPF 2IBFA 3DAGA 3RIPA 2YQYA 2CNWA 4CJGA 1FFTC 1Z5ZA 2LQGA 3EFOB 1CGNA 3KL4A 4IB4A 3W4YA 2P61A 1YA7O 2EPKX 4A4AA 2GAQA 1Z23A 2PBEA 2IXNA 3G4XA 3H2UA 1L3PA 1JPJA 3EQLF 3LS1A 3M15A 5COFA 1TQGA 4QI2A 1MNDA 5L3VA 3NYLA 2CYDA 3L0IA 3JCUQ 1ZHTA 4OINF 3S9OA 3V5ZA 3VRCA 1M2OA 3CEXA 2LFFA 1G4WR 1T9KA 2IXOA 2P6VA 3L8IA 4MW8A 1ZVZA 4W8PA 2H7VC 1G8XA 2DYSC 4J30B 2OJQA 4JCHA 4OIRF 1LI7A 3AG2C 5DQTA 2MHRA 3AOUA 5DQZA 3ATPA 4MTOA 2J7PD 3JRMO 1Q0KA 4P6IC 1BR2A 5BUOA 1T5OA 1VYIA 1O5HA 1MMAA 1Z6AA 4KI2A 4P9TA 1YDIA 4JTDB 2OG2A 3RQGA 1WOLA 4EBJA 4I1OB 2GDCA 1OCOC 2VH3A 5L0IA 4JIOA 2WL8A 3U0CA 1I5NA 5AC5A 4BEMJ 4E7ZA 3DWWA 3SXYA 5AGFA 4G0HA 1EA8A 2Q00A 2XLHA 3GWNA 1A7DA 4O6MA 1U0BB 3ZTZA 1Z3IX 3RQFA 3N0TA 4DRIB 3DAFA 4LDRA 2A0BA 5E3AA 1Y6DA 4DOZA 4AL1A 2ZD9A 4NTAA 4C3BA 2E87A 1Q0GA 2EPOA 1QLEC 1O87A 3IEEA 2NSGA 4LACB 2XM0A 2R7VA 3EPVA 1A0BA 5A69A 4U5CE 3NMKA 3ABMC 5FCLA 1KTMA 4HEAJ 2XS8A 3KH2A 3ZDLA 1FMVA 3QZCA 4YL3A 1A7EA 4C7OA 1AVOB 2JX0A 4DBQA 3UR3C 4CS8C 4JJGA 2WVQA 2OEXA 3WAQA 1TWAA 4I3MA 1VLSA 2W4MA 3T9OA 2YZSA 3C8GD 2QTVA 5F28E 5CIVA 3T6BA 2DB4A 3PCVA 3DJNB 2LFDA 2UUHA 3LUTB 4BG0A 1Q0MA 1NBBA 4C7OB 2KJGA 4BJ1A 1RJ9B 2P1AA 3U2MA 4Z9JA 5B3SC 5L0JA 3MFNA 1S05A 3V5XA 3NYJA 2XLOA 1ZHZA 3E9VA 1NZEA 4OIOF 4ULWA 3J06A 5KYYB 2PF4E 2PP4A 3EZHA 3BRJA 4NTBA 4E0HA 4W8KA 3B0PA 1ZW2A 3NMJA 5K0IA 1GM5A 2XXAB 1ZHYA 2R7SA 1TWHA 4CIHA 2Q7RA 4NY3A 1J8YF 1RXQA 1CGOA 1JPNA 3HNJA 4AX2A 2J9WA 5A6BA 4HFKB 1TFOB 3CZ6A 1NLXA 2IXPA 2X0CA 2R05A 3AGTA 3SEOA 3HNIA 5BQHA 2YKZA 1GQAA 3JYHA 1Q0FA 1ZU4A 3K66A 3MLGA 3O39A 1NU9C 3RYLA 3T4RA 4J7YA 3U5SA 3US6A 1BBHA 1PCXA 2J0XA 3HNLA 5BQGA 4B6IA 4CBEA 1MQVA 3QMKA 4YT2A 3DJUB 2X51A 1OCCC 3KMIA 1LM3B 2OKUA 4BEJA 3B9QA 3PDMP 1E2XA 4E7SA 1DOVA 2A6HF 2Y3HA 4IAOA 1T6IA 3JZ0A 4QI0A 4BJ5C 1CPQA 3EH1A 3NKEA 4JEAA 1T6UA 1AUEA 2ASRA 4U5HA 1H9GA 5KYWB 3RVZA 3RH3A 3Q6NA 3FHDA 3M4CA 3DI5A 2J45A 2P0NA 2NSFA 1N1CA 4GQHA 1ORYA 3M1CB 3A9CA 3DZAA 1HMDA 5D91A 3GM3A 3JRTA 1Z63A 1SF8A 1VMAA 3L8JA 2C04A 3FXHA 4PACA 1FMWA 2W4BA 3TD7A 4BJ5A 2Q9AA 5JLIA 3U8PA 1YZCA 2GA0A 1W2WA 5EGYA 4XQ1A 1NG1A 3EFOA 2Y39A 2KGOA 3DKAA 3L1MA 4EKWA 4N6HA 5L0CA 1R4TA 3ZTMA 3B71A 3K6BA 5T3WA 1TKNA 3FDQA 4IGGA 1MMGA 3S90A 2QE9A 2GFHA 4EBBA 3Q7LA 1NFNA 2FFHA 3RKOF 4LERA 3EGXA 2Q9BA 3C8ZA 3HKKA 2MWQA 3JYYA 4K1OA 1VK5A 1YAUO 2ZPAA 4P9FA 3X1OA 2B0JA 2YL0A 3B0UX 4EIYA 3IQCA 2M4EA 1IZMA 2EIKC 2GWWA 3SP1A 3U2LA 4MVUA 2XM4A 3KYIA 4GEHA 2WZGA 2XL4A 4KBLA 1J8MF 4NC3A 5KYUA 3EGXB 1ZHXA 3UMHA 3UNGC 1G4US 4WGZA 4U9DA 4WABA 4DRJB 1QVXA 5KYXB 2H8AA 3C62A 1G5ZA 3CSKA 4JW1A 5JVEA 2LP4A 5DS6A 3TOMA 3IQ5A 4PR9A 2AWYA 2KK1A 4YT8A 1M6TA 1SMYF 2XL8A 4ONSA 3PMRA 4G7HF 3JTLO 4J32B 4XLNF 3K33A 2VB6A 1FAPB 2IM8A 2Q9CA 3R2PA 4NTFA 5T3TA 3ABLC 2EPLX 3GEEA 4OIQF 3VF0A 1YZAA 2L6GA 2OOCA 2R25A 1OKKA 4MW3A 3SZRA 3JSZA 2W9YA 1YYJA 4CDAA 2R7XA 3S28A 2I15A 4CS8A 4AE4A 1IW7F 2R03A 1U6HA 2YLGA 2VCBA 1EKYA 4XPYA 4N4WA 1BZ4A 3T6GB 4E17A 4MVMA 4CIPA 2EIJC 2PFDA 3RQEA 3SYNA 3F47A 3SXKA 2V3CC 3K7DA 4YJWA 3UMKA 2ZXOA 1ZYRF 1Y4CA 2NUTB 1D1AA 3C8GA 2NPUA 3NKDA 1A41A 3R7CA 4FESA 3EH2A 1LIHA 1XZPA 4OD4A 2A69F 2LSEA 1V54C 1VOMA 2NUPB 2V26A 4MTFA 5E2QA 3SXZA 3TK0A 4XPXA 1QZXA 3AG3C 3K1IA 3LNRA 2YLIA 1JAFA 1Z7Qc 1O3UA 2I8BA 5KYXA 1HW2A 4U9EA 3L34A 1RCPA 4Q4ZF 2JPUA 3ECSA 4JC7A 3TOLA 2R7UA 2HFIA 3W2VA 2R7WA 2KQ9A 3GWLA 4IJJA 4LLCA 4D4NA 4KNVA 1OCZC 3RW0A 1ST6A 1CGME 2BL2A 2OCCC 3E70C 5A6JA 1GS9A 5JS5A 2H7OA 5DS5A 2XRHA 1DOWA 2ZXRA 3IPMO 4A2NB 4EBKA 2R7TA 3C63A 4JE9A 3LEOA 1PD0A 4DXWA 1OCRC 3FOPA 5KYWA 4M63A 1TWCA 3AQBA 2J0WA 3MBGA 1E83A 1QPUA 4MQ9F 1H7IA 1LI5A 3OA1A 4XEKA 1RJ9A 4JKVA 4ER9A 3VAYA 2WVOA 2TMVP 3LESA 1RKEA 1LKXA 4AL0A 3O55A 1HE1A 2F22A 4RD9A 1HW1A 2LD6A 2J9VA 5DVWA 1LE2A 3EGDB 2XLVA 4C3EA 3LLIA 3ZQVA 4RBNA 2HZ8A 2XL6A 4L6RA 3ZC4A 3Q7GA 1AEPA 3H2VA 5EK0A 2ICWG 3NDBB 1EI7A 4MVRA 4AK9A 3WODF 2AU5A 5B1AC 2VASA 2HS5A 3QTHA 4IWBA 1H9TA 1WN0A 2KW3C 3LS0A 1OXKA 3U9MA 5JT4A 5COMA 1RKCA 4RDAA 3TJ6A 4XEFA 1NFOA 4YT4A 4DVZA 3OEOA 5A6BD 4HFFB 1SZIA 2G3VA 4IRUA 3B29A 2OEVA 3SNHA 1M2VA 3JT1A 3O10A 2J8WA 4O7GA 5T1DB 4BJ6C 4EUKB 3FMSA 1OKKD 3WHNA 2CDQA 4U5EE 4ANJA 2YLDA 1YARO 3HLZA 2Z15A 3VM6A 1PV3A 4O6YA 2FGYA 2C03A 2XLMA 4JCZA 3AGUA 3K1HA 3QW1A 4BJTA 3GORA 4QDLA 4DRHB 2WZLA 1L7CA 3UMIA 1YVIA 1VTMP 1MNEA 2D5RB 2O9XA 4YN0B 3U8VA 3TJ5A 5L0HA 1OW6A 2EPNA 1TFKB 2PX0A 4KC9A 2CCYA 2J9UA 1JRAA 4MNDA 3W2WA 4BPMA 4PJLA 1E86A 1YJGA 2EILC 2H7BA 4Q5SF 4J7TA 1U89A 1UFBA 1V4AA 1WGWA 2BE5F 3EZIA 5A6KA 3ITFA 4ZLCA 2KSFA 1UG7A 2A6EF 1QQ3A 1M56C 2HSQA 2HJ3A 5F5HA 2VCCA 4HE8D 1T01A 1Q0DA 3I5PA 2XLWA 3ASOC 2CGEA 4YK5A 4CS9A 2DI3A 5IY5C 2HMQA 1QSPA 2IXMA 4H54A 3ZIBA 2W45A 3TULA 2LCHA 3DE8A 2HKVA 2R02A 3G50A 3H65A 3U3BA 3ZSUA 3IQTA 4N06A 1LVKA 4MVQA 1KU2A 4WGYA 1LE4A 1I4YA 2XLDA 4XTKA 4CS7A 3LLKA 2Y3GA 2QNLA 3B0VC 1SYQA 3MX3A 2IYLD 4CSAA 1T6QA 2IOQA 3QVZA 3S84A 4NQFA 2EINC 4JEBA 3NYMA 3ABKC 3G4ZA 1S7ZA 2J9BA 1MMDA 2NG1A 2R7QA 3GM2A 3AG1C 3OWTA 5B1BC 3RF3A 4LLEA 2OQMA 2WB7A 1VLTA 2RD9A 5HV9A 4H4KC 4O6NA 4Q7CA 3BEHA 5E33A 4JZAA 3NMIA 3LAYA 1YA9A 4I44A 3X2QC 5KYUB 2YL3A 256BA 4U5DE 1NU7D 3MYIA 1OW8A 1HE9A 3NG1A 1RKEB 1FFHA 5COGA 4C3DA 4DVYP 5KYNA 3QVYA 2AP3A 1K04A 1SR2A 4PJNA 4YT5A 3KYJA 3DXJF 3DM5A 4JVSA 4N6CA 4XEVA 4XPWA 3GODA 3W8HA 5DLJA 4EWCA 5BQIA 1XWJA 4F4BA 3RFYA 3O6XA 3U3FA 3DD7A 2HV6A 2YWAA 1JMWA 3AG4C 5L0DA 2UUIA 3KKBA 3AJMA 3LEVA 4ULVA 1GGQA 2L6FA 4PJJA 2Y3BA 5CI8A 5TJ5E 4LDQA 2L81A 2ZXPA 4CDYA 3U9JA 3DE9A 5JUAA 2J46A 1F1MA 1APCA 1OXBA 3FAPB 4K0DA 3GEHA 3FVYA 4JRZA 3LNMB 3I5QA 3KPHA 4CX9A 1WWPA 2CNWD 2HMZA 2HUJA 2G3KA 3C18A 3I4UA 4I1MA 4MVOA 3TQOA 1LS1A 2L9JA 5HSWA 5AC4A 2YRFA 3F46A 1JOGA 2A68F 2Q4FA 3GM1A 2KNHA 3ZWIA 1LS4A 2HV7A 4E0IA 3DMDA 4FX5A 4K7BA 3VYWA 4MTGA 2KC3A 1YYXA 1I4ZA 1M2VB 2OU6A 3WG7C 4KNWA 1XZQA 3ZG1A 3S0XA 1H6GA 4JURI 1FTSA 4GYTA 3A11A 5CI9A 2YVKA 3W8IA 1OR3A 1YLMA 4DJ9A 3POVA 1D0ZA 4E18A 1LPEA 2WVNA 4G7OF 5F5FA 1ZW3A 2MYSA 1D0YA 5A6AA 3V7OA 2R7RA 4JTCB 1OW7A 4MVZA 1M57C 1BR1A 1A7VA 3LJBA 1FR0A 1R5ID 4MVSA 4BJ6A 4IAQA 2ZXWC 2HJMA 3IHUA 3N24A 1WASA 4U5FE 1CPRA 1TWGA 3ZVRA 5L3QA 3AQCA 3UGOA 5D92A 3C7JA 1OQCA 1ZZPA 3FOOA 3EJNA 3HTKC 1WTYA 2RSEB 1JR8A
chains in the Genus database with same CATH topology
5EHHA 3EHMA 2YEVA 3GANA 4WJ0A 2XXAA 2NUPA 2XSEA 4OD5A 4DBRA 1D1CA 4PFOA 1ZHWA 4X0RA 4PK4A 5KYYA 1PD1A 1VYKA 4PFPA 2YHSA 3EG9A 3Q6MA 2JD3A 2Y3DA 4FWVA 3S27A 3FAJA 3K1IC 2Q3TA 3DM9B 3PHF2 3HJCA 1BR4A 4CS9C 1MMNA 4OIPF 2DGJA 1V55C 3CQZA 4ZLDA 3EGDA 2J7PA 5E3CA 4U5BE 2EIMC 4YWQA 2R7OA 3EG9B 4PJMA 2NUTA 1ZU5A 1D1BA 3S29A 2CW0F 4U5GA 3UGPA 3ASNC 2A1DD 1D0XA 1TR2A 5DS4A 3NRHA 4CSAC 2WZFA 4JJFA 2G62A 3T6JA 2Y69C 4AE4B 4O79A 4XWJA 2PX3A 3EHNA 2QY9A 2DYRC 4G7ZF 2P7VA 4XLPF 3N2ZB 3DAGA 3RIPA 2CNWA 1FFTC 1Z5ZA 3EFOB 3KL4A 1Z23A 2IXNA 3LS1A 1JPJA 3EQLF 4QI2A 1MNDA 5L3VA 3NYLA 3L0IA 3JCUQ 1ZHTA 4OINF 1M2OA 2IXOA 2P6VA 2H7VC 1G8XA 2DYSC 4J30B 4JCHA 4OIRF 5DQTA 2R7VA 3AG2C 5DQZA 2J7PD 4P6IC 1BR2A 5BUOA 1VYIA 1O5HA 1MMAA 1Z6AA 2OG2A 4I1OB 2VH3A 1OCOC 2WL8A 4E7ZA 4G0HA 4O6MA 1Z3IX 3N0TA 3DAFA 5E3AA 4C3BA 2E87A 1QLEC 1O87A 3IEEA 4LACB 3EPVA 4U5CE 5FCLA 3ABMC 4HEAJ 3KH2A 1FMVA 3QZCA 4C7OA 4DBQA 3UR3C 4CS8C 4JJGA 2WVQA 1TWAA 4I3MA 2W4MA 2YZSA 2QTVA 3T6BA 3DJNB 4BG0A 4C7OB 2KJGA 4BJ1A 1RJ9B 5B3SC 3NYJA 1ZHZA 3E9VA 1NZEA 4OIOF 4ULWA 5KYYB 2PF4E 2PP4A 3EZHA 4W8KA 3B0PA 2XXAB 1ZHYA 2R7SA 1TWHA 4CIHA 4NY3A 1J8YF 1JPNA 4AX2A 2J9WA 4HFKB 3CZ6A 2IXPA 3SEOA 3JYHA 3K66A 1ZU4A 3MLGA 3O39A 1NU9C 3RYLA 3T4RA 4CBEA 1PCXA 4B6IA 2J0XA 3QMKA 4YT2A 3DJUB 2X51A 1OCCC 3KMIA 4BEJA 3B9QA 4E7SA 2A6HF 2Y3HA 4IAOA 4QI0A 4KI2A 4BJ5C 3EH1A 3NKEA 4U5HA 5KYWB 3RH3A 3Q6NA 3FHDA 2J45A 1N1CA 3M1CB 3DZAA 5D91A 3JRTA 1Z63A 1SF8A 1VMAA 3TD7A 2C04A 1FMWA 2W4BA 4BJ5A 2Q9AA 1W2WA 5EGYA 1NG1A 3EFOA 2Y39A 2KGOA 3K6BA 5T3WA 1TKNA 3FDQA 1MMGA 2GFHA 4EBBA 3Q7LA 2FFHA 3RKOF 4LERA 3EGXA 2Q9BA 2MWQA 1VK5A 2ZPAA 3X1OA 3B0UX 2B0JA 2M4EA 1IZMA 2EIKC 3SP1A 4GEHA 2WZGA 2XL4A 4KBLA 1J8MF 5KYUA 3EGXB 1ZHXA 3UMHA 3UNGC 5KYXB 3CSKA 4JW1A 5DS6A 4YT8A 1SMYF 4G7HF 3PMRA 4J32B 4XLNF 3K33A 2VB6A 2Q9CA 5T3TA 3ABLC 4OIQF 1OKKA 3SZRA 3JSZA 2W9YA 2R7XA 3S28A 4CS8A 4AE4A 1IW7F 2EIJC 2PFDA 3SYNA 3F47A 2V3CC 3K7DA 4YJWA 3UMKA 2ZXOA 1ZYRF 2NUTB 1D1AA 3NKDA 4FESA 3EH2A 4OD4A 2A69F 2LSEA 1V54C 1VOMA 2NUPB 2V26A 5E2QA 5IY5C 1QZXA 3AG3C 3LNRA 5KYXA 2I8BA 3L34A 4Q4ZF 3ECSA 2R7UA 3W2VA 2R7WA 2KQ9A 4IJJA 4LLCA 4KNVA 1OCZC 1ST6A 2OCCC 3E70C 2H7OA 5DS5A 2XRHA 2ZXRA 4A2NB 2R7TA 5KYWA 1PD0A 1OCRC 4M63A 1TWCA 3AQBA 2J0WA 4MQ9F 3OA1A 1RJ9A 3VAYA 2WVOA 3LESA 1LKXA 4RD9A 2J9VA 5DVWA 3EGDB 4C3EA 3LLIA 4RBNA 3ZC4A 3Q7GA 3NDBB 4AK9A 3WODF 5B1AC 2VASA 4IWBA 2KW3C 3LS0A 4RDAA 4YT4A 4DVZA 3OEOA 4HFFB 1SZIA 2G3VA 4IRUA 3SNHA 4BJ6C 1M2VA 3JT1A 5T1DB 4O7GA 1OKKD 2CDQA 4U5EE 4ANJA 3HLZA 2Z15A 4O6YA 2FGYA 2C03A 3K1HA 4BJTA 4QDLA 2WZLA 3UMIA 1MNEA 2D5RB 2O9XA 4YN0B 2PX0A 4KC9A 2J9UA 4MNDA 3W2WA 4PJLA 2EILC 2H7BA 4Q5SF 2BE5F 1WGWA 3EZIA 3ITFA 4ZLCA 2A6EF 1M56C 5F5HA 4HE8D 3I5PA 3ASOC 2CGEA 4CS9A 2IXMA 3ZIBA 2W45A 3ZSUA 3H65A 4N06A 1LVKA 1KU2A 4CS7A 4XTKA 3LLKA 2Y3GA 3B0VC 3MX3A 2IYLD 4CSAA 2IOQA 2EINC 3NYMA 3ABKC 1S7ZA 2NG1A 1MMDA 2R7QA 3OWTA 3AG1C 5B1BC 4LLEA 2WB7A 4H4KC 4O6NA 4Q7CA 3X2QC 5E33A 4JZAA 5KYUB 3LAYA 4I44A 4U5DE 1NU7D 4DVYP 3NG1A 4C3DA 5KYNA 1FFHA 4PJNA 4YT5A 3DXJF 3DM5A 4JVSA 3W8HA 5DLJA 4EWCA 3GODA 4F4BA 3RFYA 3O6XA 3DD7A 2HV6A 3AG4C 3KKBA 3LEVA 4DOZA 5CI8A 4PJJA 2Y3BA 2L81A 2ZXPA 2J46A 4K0DA 3FVYA 3I5QA 2CNWD 2G3KA 3I4UA 4I1MA 5HSWA 1LS1A 2L9JA 3F46A 2A68F 2KNHA 2HV7A 3DMDA 4FX5A 4K7BA 3VYWA 1M2VB 3WG7C 4KNWA 3ZG1A 3S0XA 4JURI 1FTSA 4GYTA 5CI9A 3W8IA 3POVA 1D0ZA 2WVNA 4G7OF 5F5FA 2MYSA 1D0YA 3V7OA 2R7RA 3LJBA 1M57C 1BR1A 4BJ6A 2ZXWC 3N24A 4U5FE 1TWGA 3ZVRA 5L3QA 3UGOA 3AQCA 5D92A 3EJNA 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMI A; 
#chains in the Genus database with same CATH topology
 2D4U A;  2EPM X;  2R9R B;  5EHH A;  2XS1 A;  1K40 A;  2YEV A;  3EHM A;  3GAN A;  2VC9 A;  4WJ0 A;  2XXA A;  1WAT A;  2NUP A;  2XSE A;  2A0U A;  4OD5 A;  1OR2 A;  4DBR A;  1D1C A;  3HNK A;  4PFO A;  1ZHW A;  4X0R A;  4PK4 A;  5L0G A;  5KYY A;  1ORJ A;  1PD1 A;  1E85 A;  3M79 A;  3MYF A;  3RVY A;  1VYK A;  4YL0 A;  4Z9H A;  1HMO A;  1HY5 A;  4IAR A;  3ZQY A;  4PFP A;  1QKR A;  3QW0 A;  2YHS A;  4JTA B;  5FZT A;  4YL1 A;  3EG9 A;  3Q6M A;  4G78 A;  2JD3 A;  2Y3D A;  5JP7 A;  2M64 A;  4FWV A;  3S27 A;  2L7A A;  4LDK A;  3FAJ A;  3K1I C;  2Q3T A;  3DM9 B;  5B3I A;  3V5Y A;  3PHF 2;  4Z9I A;  4UDV A;  1EQ1 A;  3HJC A;  2PNO A;  1BR4 A;  4CS9 C;  1MMN A;  4OIP F;  2OJE D;  4NCQ A;  2DGJ A;  1V55 C;  3CQZ A;  4ZLD A;  3EGD A;  2L6H A;  1KNY A;  2J7P A;  4CDV A;  1BDJ B;  5E3C A;  3SXM A;  1NSG B;  2FAP B;  3M4B A;  4MS2 A;  2EIM C;  3IQ6 A;  4U5B E;  2YL1 A;  1V74 B;  5GPG B;  4YWQ A;  4FAP B;  2R7O A;  3EG9 B;  1C03 A;  1K05 A;  4PJM A;  2NUT A;  1E84 A;  2AWC A;  1ZU5 A;  1D1B A;  2QLA A;  2CW0 F;  5JSL A;  4U5G A;  3S29 A;  1C17 M;  2LIG A;  2ETS A;  2LK4 A;  3UGP A;  2HSB A;  3ASN C;  1RMV A;  2A1D D;  3JSE O;  1D0X A;  3C8G B;  1TR2 A;  5DS4 A;  2YL7 A;  2B0H A;  3GEI A;  3CAX A;  3NRH A;  4CSA C;  1C02 A;  2XLE A;  1VB5 A;  2AVK A;  1ORS C;  2WZF A;  4JJF A;  2G62 A;  3T6J A;  2KYH A;  2Y69 C;  4AE4 B;  4O79 A;  4D4X A;  4XWJ A;  2PX3 A;  5L0F A;  5JRA A;  1B68 A;  2BC5 A;  2QUP A;  2VCA A;  3EHN A;  2QY9 A;  4EHP A;  1FNT c;  2DYR C;  4G7Z F;  2P7V A;  4CJO A;  3N2Z B;  4R32 A;  4XLP F;  2IBF A;  3DAG A;  3RIP A;  2YQY A;  2CNW A;  4CJG A;  1FFT C;  1Z5Z A;  2LQG A;  3EFO B;  1CGN A;  3KL4 A;  4IB4 A;  3W4Y A;  2P61 A;  1YA7 O;  2EPK X;  4A4A A;  2GAQ A;  1Z23 A;  2PBE A;  2IXN A;  3G4X A;  3H2U A;  1L3P A;  1JPJ A;  3EQL F;  3LS1 A;  3M15 A;  5COF A;  1TQG A;  4QI2 A;  1MND A;  5L3V A;  3NYL A;  2CYD A;  3L0I A;  3JCU Q;  1ZHT A;  4OIN F;  3S9O A;  3V5Z A;  3VRC A;  1M2O A;  3CEX A;  2LFF A;  1G4W R;  1T9K A;  2IXO A;  2P6V A;  3L8I A;  4MW8 A;  1ZVZ A;  4W8P A;  2H7V C;  1G8X A;  2DYS C;  4J30 B;  2OJQ A;  4JCH A;  4OIR F;  1LI7 A;  3AG2 C;  5DQT A;  2MHR A;  3AOU A;  5DQZ A;  3ATP A;  4MTO A;  2J7P D;  3JRM O;  1Q0K A;  4P6I C;  1BR2 A;  5BUO A;  1T5O A;  1VYI A;  1O5H A;  1MMA A;  1Z6A A;  4KI2 A;  4P9T A;  1YDI A;  4JTD B;  2OG2 A;  3RQG A;  1WOL A;  4EBJ A;  4I1O B;  2GDC A;  1OCO C;  2VH3 A;  5L0I A;  4JIO A;  2WL8 A;  3U0C A;  1I5N A;  5AC5 A;  4BEM J;  4E7Z A;  3DWW A;  3SXY A;  5AGF A;  4G0H A;  1EA8 A;  2Q00 A;  2XLH A;  3GWN A;  1A7D A;  4O6M A;  1U0B B;  3ZTZ A;  1Z3I X;  3RQF A;  3N0T A;  4DRI B;  3DAF A;  4LDR A;  2A0B A;  5E3A A;  1Y6D A;  4DOZ A;  4AL1 A;  2ZD9 A;  4NTA A;  4C3B A;  2E87 A;  1Q0G A;  2EPO A;  1QLE C;  1O87 A;  3IEE A;  2NSG A;  4LAC B;  2XM0 A;  2R7V A;  3EPV A;  1A0B A;  5A69 A;  4U5C E;  3NMK A;  3ABM C;  5FCL A;  1KTM A;  4HEA J;  2XS8 A;  3KH2 A;  3ZDL A;  1FMV A;  3QZC A;  4YL3 A;  1A7E A;  4C7O A;  1AVO B;  2JX0 A;  4DBQ A;  3UR3 C;  4CS8 C;  4JJG A;  2WVQ A;  2OEX A;  3WAQ A;  1TWA A;  4I3M A;  1VLS A;  2W4M A;  3T9O A;  2YZS A;  3C8G D;  2QTV A;  5F28 E;  5CIV A;  3T6B A;  2DB4 A;  3PCV A;  3DJN B;  2LFD A;  2UUH A;  3LUT B;  4BG0 A;  1Q0M A;  1NBB A;  4C7O B;  2KJG A;  4BJ1 A;  1RJ9 B;  2P1A A;  3U2M A;  4Z9J A;  5B3S C;  5L0J A;  3MFN A;  1S05 A;  3V5X A;  3NYJ A;  2XLO A;  1ZHZ A;  3E9V A;  1NZE A;  4OIO F;  4ULW A;  3J06 A;  5KYY B;  2PF4 E;  2PP4 A;  3EZH A;  3BRJ A;  4NTB A;  4E0H A;  4W8K A;  3B0P A;  1ZW2 A;  3NMJ A;  5K0I A;  1GM5 A;  2XXA B;  1ZHY A;  2R7S A;  1TWH A;  4CIH A;  2Q7R A;  4NY3 A;  1J8Y F;  1RXQ A;  1CGO A;  1JPN A;  3HNJ A;  4AX2 A;  2J9W A;  5A6B A;  4HFK B;  1TFO B;  3CZ6 A;  1NLX A;  2IXP A;  2X0C A;  2R05 A;  3AGT A;  3SEO A;  3HNI A;  5BQH A;  2YKZ A;  1GQA A;  3JYH A;  1Q0F A;  1ZU4 A;  3K66 A;  3MLG A;  3O39 A;  1NU9 C;  3RYL A;  3T4R A;  4J7Y A;  3U5S A;  3US6 A;  1BBH A;  1PCX A;  2J0X A;  3HNL A;  5BQG A;  4B6I A;  4CBE A;  1MQV A;  3QMK A;  4YT2 A;  3DJU B;  2X51 A;  1OCC C;  3KMI A;  1LM3 B;  2OKU A;  4BEJ A;  3B9Q A;  3PDM P;  1E2X A;  4E7S A;  1DOV A;  2A6H F;  2Y3H A;  4IAO A;  1T6I A;  3JZ0 A;  4QI0 A;  4BJ5 C;  1CPQ A;  3EH1 A;  3NKE A;  4JEA A;  1T6U A;  1AUE A;  2ASR A;  4U5H A;  1H9G A;  5KYW B;  3RVZ A;  3RH3 A;  3Q6N A;  3FHD A;  3M4C A;  3DI5 A;  2J45 A;  2P0N A;  2NSF A;  1N1C A;  4GQH A;  1ORY A;  3M1C B;  3A9C A;  3DZA A;  1HMD A;  5D91 A;  3GM3 A;  3JRT A;  1Z63 A;  1SF8 A;  1VMA A;  3L8J A;  2C04 A;  3FXH A;  4PAC A;  1FMW A;  2W4B A;  3TD7 A;  4BJ5 A;  2Q9A A;  5JLI A;  3U8P A;  1YZC A;  2GA0 A;  1W2W A;  5EGY A;  4XQ1 A;  1NG1 A;  3EFO A;  2Y39 A;  2KGO A;  3DKA A;  3L1M A;  4EKW A;  4N6H A;  5L0C A;  1R4T A;  3ZTM A;  3B71 A;  3K6B A;  5T3W A;  1TKN A;  3FDQ A;  4IGG A;  1MMG A;  3S90 A;  2QE9 A;  2GFH A;  4EBB A;  3Q7L A;  1NFN A;  2FFH A;  3RKO F;  4LER A;  3EGX A;  2Q9B A;  3C8Z A;  3HKK A;  2MWQ A;  3JYY A;  4K1O A;  1VK5 A;  1YAU O;  2ZPA A;  4P9F A;  3X1O A;  2B0J A;  2YL0 A;  3B0U X;  4EIY A;  3IQC A;  2M4E A;  1IZM A;  2EIK C;  2GWW A;  3SP1 A;  3U2L A;  4MVU A;  2XM4 A;  3KYI A;  4GEH A;  2WZG A;  2XL4 A;  4KBL A;  1J8M F;  4NC3 A;  5KYU A;  3EGX B;  1ZHX A;  3UMH A;  3UNG C;  1G4U S;  4WGZ A;  4U9D A;  4WAB A;  4DRJ B;  1QVX A;  5KYX B;  2H8A A;  3C62 A;  1G5Z A;  3CSK A;  4JW1 A;  5JVE A;  2LP4 A;  5DS6 A;  3TOM A;  3IQ5 A;  4PR9 A;  2AWY A;  2KK1 A;  4YT8 A;  1M6T A;  1SMY F;  2XL8 A;  4ONS A;  3PMR A;  4G7H F;  3JTL O;  4J32 B;  4XLN F;  3K33 A;  2VB6 A;  1FAP B;  2IM8 A;  2Q9C A;  3R2P A;  4NTF A;  5T3T A;  3ABL C;  2EPL X;  3GEE A;  4OIQ F;  3VF0 A;  1YZA A;  2L6G A;  2OOC A;  2R25 A;  1OKK A;  4MW3 A;  3SZR A;  3JSZ A;  2W9Y A;  1YYJ A;  4CDA A;  2R7X A;  3S28 A;  2I15 A;  4CS8 A;  4AE4 A;  1IW7 F;  2R03 A;  1U6H A;  2YLG A;  2VCB A;  1EKY A;  4XPY A;  4N4W A;  1BZ4 A;  3T6G B;  4E17 A;  4MVM A;  4CIP A;  2EIJ C;  2PFD A;  3RQE A;  3SYN A;  3F47 A;  3SXK A;  2V3C C;  3K7D A;  4YJW A;  3UMK A;  2ZXO A;  1ZYR F;  1Y4C A;  2NUT B;  1D1A A;  3C8G A;  2NPU A;  3NKD A;  1A41 A;  3R7C A;  4FES A;  3EH2 A;  1LIH A;  1XZP A;  4OD4 A;  2A69 F;  2LSE A;  1V54 C;  1VOM A;  2NUP B;  2V26 A;  4MTF A;  5E2Q A;  3SXZ A;  3TK0 A;  4XPX A;  1QZX A;  3AG3 C;  3K1I A;  3LNR A;  2YLI A;  1JAF A;  1Z7Q c;  1O3U A;  2I8B A;  5KYX A;  1HW2 A;  4U9E A;  3L34 A;  1RCP A;  4Q4Z F;  2JPU A;  3ECS A;  4JC7 A;  3TOL A;  2R7U A;  2HFI A;  3W2V A;  2R7W A;  2KQ9 A;  3GWL A;  4IJJ A;  4LLC A;  4D4N A;  4KNV A;  1OCZ C;  3RW0 A;  1ST6 A;  1CGM E;  2BL2 A;  2OCC C;  3E70 C;  5A6J A;  1GS9 A;  5JS5 A;  2H7O A;  5DS5 A;  2XRH A;  1DOW A;  2ZXR A;  3IPM O;  4A2N B;  4EBK A;  2R7T A;  3C63 A;  4JE9 A;  3LEO A;  1PD0 A;  4DXW A;  1OCR C;  3FOP A;  5KYW A;  4M63 A;  1TWC A;  3AQB A;  2J0W A;  3MBG A;  1E83 A;  1QPU A;  4MQ9 F;  1H7I A;  1LI5 A;  3OA1 A;  4XEK A;  1RJ9 A;  4JKV A;  4ER9 A;  3VAY A;  2WVO A;  2TMV P;  3LES A;  1RKE A;  1LKX A;  4AL0 A;  3O55 A;  1HE1 A;  2F22 A;  4RD9 A;  1HW1 A;  2LD6 A;  2J9V A;  5DVW A;  1LE2 A;  3EGD B;  2XLV A;  4C3E A;  3LLI A;  3ZQV A;  4RBN A;  2HZ8 A;  2XL6 A;  4L6R A;  3ZC4 A;  3Q7G A;  1AEP A;  3H2V A;  5EK0 A;  2ICW G;  3NDB B;  1EI7 A;  4MVR A;  4AK9 A;  3WOD F;  2AU5 A;  5B1A C;  2VAS A;  2HS5 A;  3QTH A;  4IWB A;  1H9T A;  1WN0 A;  2KW3 C;  3LS0 A;  1OXK A;  3U9M A;  5JT4 A;  5COM A;  1RKC A;  4RDA A;  3TJ6 A;  4XEF A;  1NFO A;  4YT4 A;  4DVZ A;  3OEO A;  5A6B D;  4HFF B;  1SZI A;  2G3V A;  4IRU A;  3B29 A;  2OEV A;  3SNH A;  1M2V A;  3JT1 A;  3O10 A;  2J8W A;  4O7G A;  5T1D B;  4BJ6 C;  4EUK B;  3FMS A;  1OKK D;  3WHN A;  2CDQ A;  4U5E E;  4ANJ A;  2YLD A;  1YAR O;  3HLZ A;  2Z15 A;  3VM6 A;  1PV3 A;  4O6Y A;  2FGY A;  2C03 A;  2XLM A;  4JCZ A;  3AGU A;  3K1H A;  3QW1 A;  4BJT A;  3GOR A;  4QDL A;  4DRH B;  2WZL A;  1L7C A;  3UMI A;  1YVI A;  1VTM P;  1MNE A;  2D5R B;  2O9X A;  4YN0 B;  3U8V A;  3TJ5 A;  5L0H A;  1OW6 A;  2EPN A;  1TFK B;  2PX0 A;  4KC9 A;  2CCY A;  2J9U A;  1JRA A;  4MND A;  3W2W A;  4BPM A;  4PJL A;  1E86 A;  1YJG A;  2EIL C;  2H7B A;  4Q5S F;  4J7T A;  1U89 A;  1UFB A;  1V4A A;  1WGW A;  2BE5 F;  3EZI A;  5A6K A;  3ITF A;  4ZLC A;  2KSF A;  1UG7 A;  2A6E F;  1QQ3 A;  1M56 C;  2HSQ A;  2HJ3 A;  5F5H A;  2VCC A;  4HE8 D;  1T01 A;  1Q0D A;  3I5P A;  2XLW A;  3ASO C;  2CGE A;  4YK5 A;  4CS9 A;  2DI3 A;  5IY5 C;  2HMQ A;  1QSP A;  2IXM A;  4H54 A;  3ZIB A;  2W45 A;  3TUL A;  2LCH A;  3DE8 A;  2HKV A;  2R02 A;  3G50 A;  3H65 A;  3U3B A;  3ZSU A;  3IQT A;  4N06 A;  1LVK A;  4MVQ A;  1KU2 A;  4WGY A;  1LE4 A;  1I4Y A;  2XLD A;  4XTK A;  4CS7 A;  3LLK A;  2Y3G A;  2QNL A;  3B0V C;  1SYQ A;  3MX3 A;  2IYL D;  4CSA A;  1T6Q A;  2IOQ A;  3QVZ A;  3S84 A;  4NQF A;  2EIN C;  4JEB A;  3NYM A;  3ABK C;  3G4Z A;  1S7Z A;  2J9B A;  1MMD A;  2NG1 A;  2R7Q A;  3GM2 A;  3AG1 C;  3OWT A;  5B1B C;  3RF3 A;  4LLE A;  2OQM A;  2WB7 A;  1VLT A;  2RD9 A;  5HV9 A;  4H4K C;  4O6N A;  4Q7C A;  3BEH A;  5E33 A;  4JZA A;  3NMI A;  3LAY A;  1YA9 A;  4I44 A;  3X2Q C;  5KYU B;  2YL3 A;  256B A;  4U5D E;  1NU7 D;  3MYI A;  1OW8 A;  1HE9 A;  3NG1 A;  1RKE B;  1FFH A;  5COG A;  4C3D A;  4DVY P;  5KYN A;  3QVY A;  2AP3 A;  1K04 A;  1SR2 A;  4PJN A;  4YT5 A;  3KYJ A;  3DXJ F;  3DM5 A;  4JVS A;  4N6C A;  4XEV A;  4XPW A;  3GOD A;  3W8H A;  5DLJ A;  4EWC A;  5BQI A;  1XWJ A;  4F4B A;  3RFY A;  3O6X A;  3U3F A;  3DD7 A;  2HV6 A;  2YWA A;  1JMW A;  3AG4 C;  5L0D A;  2UUI A;  3KKB A;  3AJM A;  3LEV A;  4ULV A;  1GGQ A;  2L6F A;  4PJJ A;  2Y3B A;  5CI8 A;  5TJ5 E;  4LDQ A;  2L81 A;  2ZXP A;  4CDY A;  3U9J A;  3DE9 A;  5JUA A;  2J46 A;  1F1M A;  1APC A;  1OXB A;  3FAP B;  4K0D A;  3GEH A;  3FVY A;  4JRZ A;  3LNM B;  3I5Q A;  3KPH A;  4CX9 A;  1WWP A;  2CNW D;  2HMZ A;  2HUJ A;  2G3K A;  3C18 A;  3I4U A;  4I1M A;  4MVO A;  3TQO A;  1LS1 A;  2L9J A;  5HSW A;  5AC4 A;  2YRF A;  3F46 A;  1JOG A;  2A68 F;  2Q4F A;  3GM1 A;  2KNH A;  3ZWI A;  1LS4 A;  2HV7 A;  4E0I A;  3DMD A;  4FX5 A;  4K7B A;  3VYW A;  4MTG A;  2KC3 A;  1YYX A;  1I4Z A;  1M2V B;  2OU6 A;  3WG7 C;  4KNW A;  1XZQ A;  3ZG1 A;  3S0X A;  1H6G A;  4JUR I;  1FTS A;  4GYT A;  3A11 A;  5CI9 A;  2YVK A;  3W8I A;  1OR3 A;  1YLM A;  4DJ9 A;  3POV A;  1D0Z A;  4E18 A;  1LPE A;  2WVN A;  4G7O F;  5F5F A;  1ZW3 A;  2MYS A;  1D0Y A;  5A6A A;  3V7O A;  2R7R A;  4JTC B;  1OW7 A;  4MVZ A;  1M57 C;  1BR1 A;  1A7V A;  3LJB A;  1FR0 A;  1R5I D;  4MVS A;  4BJ6 A;  4IAQ A;  2ZXW C;  2HJM A;  3IHU A;  3N24 A;  1WAS A;  4U5F E;  1CPR A;  1TWG A;  3ZVR A;  5L3Q A;  3AQC A;  3UGO A;  5D92 A;  3C7J A;  1OQC A;  1ZZP A;  3FOO A;  3EJN A;  3HTK C;  1WTY A;  2RSE B;  1JR8 A; 
#chains in the Genus database with same CATH homology
 5EHH A;  3EHM A;  2YEV A;  3GAN A;  4WJ0 A;  2XXA A;  2NUP A;  2XSE A;  4OD5 A;  4DBR A;  1D1C A;  4PFO A;  1ZHW A;  4X0R A;  4PK4 A;  5KYY A;  1PD1 A;  1VYK A;  4PFP A;  2YHS A;  3EG9 A;  3Q6M A;  2JD3 A;  2Y3D A;  4FWV A;  3S27 A;  3FAJ A;  3K1I C;  2Q3T A;  3DM9 B;  3PHF 2;  3HJC A;  1BR4 A;  4CS9 C;  1MMN A;  4OIP F;  2DGJ A;  1V55 C;  3CQZ A;  4ZLD A;  3EGD A;  2J7P A;  5E3C A;  4U5B E;  2EIM C;  4YWQ A;  2R7O A;  3EG9 B;  4PJM A;  2NUT A;  1ZU5 A;  1D1B A;  3S29 A;  2CW0 F;  4U5G A;  3UGP A;  3ASN C;  2A1D D;  1D0X A;  1TR2 A;  5DS4 A;  3NRH A;  4CSA C;  2WZF A;  4JJF A;  2G62 A;  3T6J A;  2Y69 C;  4AE4 B;  4O79 A;  4XWJ A;  2PX3 A;  3EHN A;  2QY9 A;  2DYR C;  4G7Z F;  2P7V A;  4XLP F;  3N2Z B;  3DAG A;  3RIP A;  2CNW A;  1FFT C;  1Z5Z A;  3EFO B;  3KL4 A;  1Z23 A;  2IXN A;  3LS1 A;  1JPJ A;  3EQL F;  4QI2 A;  1MND A;  5L3V A;  3NYL A;  3L0I A;  3JCU Q;  1ZHT A;  4OIN F;  1M2O A;  2IXO A;  2P6V A;  2H7V C;  1G8X A;  2DYS C;  4J30 B;  4JCH A;  4OIR F;  5DQT A;  2R7V A;  3AG2 C;  5DQZ A;  2J7P D;  4P6I C;  1BR2 A;  5BUO A;  1VYI A;  1O5H A;  1MMA A;  1Z6A A;  2OG2 A;  4I1O B;  2VH3 A;  1OCO C;  2WL8 A;  4E7Z A;  4G0H A;  4O6M A;  1Z3I X;  3N0T A;  3DAF A;  5E3A A;  4C3B A;  2E87 A;  1QLE C;  1O87 A;  3IEE A;  4LAC B;  3EPV A;  4U5C E;  5FCL A;  3ABM C;  4HEA J;  3KH2 A;  1FMV A;  3QZC A;  4C7O A;  4DBQ A;  3UR3 C;  4CS8 C;  4JJG A;  2WVQ A;  1TWA A;  4I3M A;  2W4M A;  2YZS A;  2QTV A;  3T6B A;  3DJN B;  4BG0 A;  4C7O B;  2KJG A;  4BJ1 A;  1RJ9 B;  5B3S C;  3NYJ A;  1ZHZ A;  3E9V A;  1NZE A;  4OIO F;  4ULW A;  5KYY B;  2PF4 E;  2PP4 A;  3EZH A;  4W8K A;  3B0P A;  2XXA B;  1ZHY A;  2R7S A;  1TWH A;  4CIH A;  4NY3 A;  1J8Y F;  1JPN A;  4AX2 A;  2J9W A;  4HFK B;  3CZ6 A;  2IXP A;  3SEO A;  3JYH A;  3K66 A;  1ZU4 A;  3MLG A;  3O39 A;  1NU9 C;  3RYL A;  3T4R A;  4CBE A;  1PCX A;  4B6I A;  2J0X A;  3QMK A;  4YT2 A;  3DJU B;  2X51 A;  1OCC C;  3KMI A;  4BEJ A;  3B9Q A;  4E7S A;  2A6H F;  2Y3H A;  4IAO A;  4QI0 A;  4KI2 A;  4BJ5 C;  3EH1 A;  3NKE A;  4U5H A;  5KYW B;  3RH3 A;  3Q6N A;  3FHD A;  2J45 A;  1N1C A;  3M1C B;  3DZA A;  5D91 A;  3JRT A;  1Z63 A;  1SF8 A;  1VMA A;  3TD7 A;  2C04 A;  1FMW A;  2W4B A;  4BJ5 A;  2Q9A A;  1W2W A;  5EGY A;  1NG1 A;  3EFO A;  2Y39 A;  2KGO A;  3K6B A;  5T3W A;  1TKN A;  3FDQ A;  1MMG A;  2GFH A;  4EBB A;  3Q7L A;  2FFH A;  3RKO F;  4LER A;  3EGX A;  2Q9B A;  2MWQ A;  1VK5 A;  2ZPA A;  3X1O A;  3B0U X;  2B0J A;  2M4E A;  1IZM A;  2EIK C;  3SP1 A;  4GEH A;  2WZG A;  2XL4 A;  4KBL A;  1J8M F;  5KYU A;  3EGX B;  1ZHX A;  3UMH A;  3UNG C;  5KYX B;  3CSK A;  4JW1 A;  5DS6 A;  4YT8 A;  1SMY F;  4G7H F;  3PMR A;  4J32 B;  4XLN F;  3K33 A;  2VB6 A;  2Q9C A;  5T3T A;  3ABL C;  4OIQ F;  1OKK A;  3SZR A;  3JSZ A;  2W9Y A;  2R7X A;  3S28 A;  4CS8 A;  4AE4 A;  1IW7 F;  2EIJ C;  2PFD A;  3SYN A;  3F47 A;  2V3C C;  3K7D A;  4YJW A;  3UMK A;  2ZXO A;  1ZYR F;  2NUT B;  1D1A A;  3NKD A;  4FES A;  3EH2 A;  4OD4 A;  2A69 F;  2LSE A;  1V54 C;  1VOM A;  2NUP B;  2V26 A;  5E2Q A;  5IY5 C;  1QZX A;  3AG3 C;  3LNR A;  5KYX A;  2I8B A;  3L34 A;  4Q4Z F;  3ECS A;  2R7U A;  3W2V A;  2R7W A;  2KQ9 A;  4IJJ A;  4LLC A;  4KNV A;  1OCZ C;  1ST6 A;  2OCC C;  3E70 C;  2H7O A;  5DS5 A;  2XRH A;  2ZXR A;  4A2N B;  2R7T A;  5KYW A;  1PD0 A;  1OCR C;  4M63 A;  1TWC A;  3AQB A;  2J0W A;  4MQ9 F;  3OA1 A;  1RJ9 A;  3VAY A;  2WVO A;  3LES A;  1LKX A;  4RD9 A;  2J9V A;  5DVW A;  3EGD B;  4C3E A;  3LLI A;  4RBN A;  3ZC4 A;  3Q7G A;  3NDB B;  4AK9 A;  3WOD F;  5B1A C;  2VAS A;  4IWB A;  2KW3 C;  3LS0 A;  4RDA A;  4YT4 A;  4DVZ A;  3OEO A;  4HFF B;  1SZI A;  2G3V A;  4IRU A;  3SNH A;  4BJ6 C;  1M2V A;  3JT1 A;  5T1D B;  4O7G A;  1OKK D;  2CDQ A;  4U5E E;  4ANJ A;  3HLZ A;  2Z15 A;  4O6Y A;  2FGY A;  2C03 A;  3K1H A;  4BJT A;  4QDL A;  2WZL A;  3UMI A;  1MNE A;  2D5R B;  2O9X A;  4YN0 B;  2PX0 A;  4KC9 A;  2J9U A;  4MND A;  3W2W A;  4PJL A;  2EIL C;  2H7B A;  4Q5S F;  2BE5 F;  1WGW A;  3EZI A;  3ITF A;  4ZLC A;  2A6E F;  1M56 C;  5F5H A;  4HE8 D;  3I5P A;  3ASO C;  2CGE A;  4CS9 A;  2IXM A;  3ZIB A;  2W45 A;  3ZSU A;  3H65 A;  4N06 A;  1LVK A;  1KU2 A;  4CS7 A;  4XTK A;  3LLK A;  2Y3G A;  3B0V C;  3MX3 A;  2IYL D;  4CSA A;  2IOQ A;  2EIN C;  3NYM A;  3ABK C;  1S7Z A;  2NG1 A;  1MMD A;  2R7Q A;  3OWT A;  3AG1 C;  5B1B C;  4LLE A;  2WB7 A;  4H4K C;  4O6N A;  4Q7C A;  3X2Q C;  5E33 A;  4JZA A;  5KYU B;  3LAY A;  4I44 A;  4U5D E;  1NU7 D;  4DVY P;  3NG1 A;  4C3D A;  5KYN A;  1FFH A;  4PJN A;  4YT5 A;  3DXJ F;  3DM5 A;  4JVS A;  3W8H A;  5DLJ A;  4EWC A;  3GOD A;  4F4B A;  3RFY A;  3O6X A;  3DD7 A;  2HV6 A;  3AG4 C;  3KKB A;  3LEV A;  4DOZ A;  5CI8 A;  4PJJ A;  2Y3B A;  2L81 A;  2ZXP A;  2J46 A;  4K0D A;  3FVY A;  3I5Q A;  2CNW D;  2G3K A;  3I4U A;  4I1M A;  5HSW A;  1LS1 A;  2L9J A;  3F46 A;  2A68 F;  2KNH A;  2HV7 A;  3DMD A;  4FX5 A;  4K7B A;  3VYW A;  1M2V B;  3WG7 C;  4KNW A;  3ZG1 A;  3S0X A;  4JUR I;  1FTS A;  4GYT A;  5CI9 A;  3W8I A;  3POV A;  1D0Z A;  2WVN A;  4G7O F;  5F5F A;  2MYS A;  1D0Y A;  3V7O A;  2R7R A;  3LJB A;  1M57 C;  1BR1 A;  4BJ6 A;  2ZXW C;  3N24 A;  4U5F E;  1TWG A;  3ZVR A;  5L3Q A;  3UGO A;  3AQC A;  5D92 A;  3EJN A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...