2HFIA

Solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
b'MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yppE
publication title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hfiA00
2HUJA 2HFIA 2IM8A 2ETSA
chains in the Genus database with same CATH superfamily
3FAJA 3JRTA 1OCCC 1MMAA 4E0HA 2FAPB 1Z23A 2ZD9A 4YT5A 3K66A 3B0PA 3POVA 2EPMX 4IARA 1UG7A 4MVUA 2PFDA 4AK9A 4BJTA 4X0RA 4F4BA 4JC7A 3ASNC 1ZHTA 3DJUB 1MMNA 3K7DA 3C18A 2C04A 2KQ9A 2W4MA 5GPGB 2LSEA 3LESA 1BZ4A 2YLDA 2GWWA 4LLEA 3FOOA 4WJ0A 2F22A 3NYMA 1WATA 4IJJA 1T9KA 1WTYA 4MNDA 1KU2A 4BPMA 2AP3A 2J9BA 2WL8A 4MTFA 5EK0A 2OU6A 3U9JA 1YZCA 5DVWA 2MYSA 3V7OA 5L3QA 1S7ZA 3ZC4A 2A6HF 1NSGB 2KSFA 4LERA 5TJ5E 1JR8A 1Z6AA 3O10A 1E83A 1ZVZA 4PR9A 3LAYA 1CGOA 2PF4E 1ZU4A 2QNLA 5B3SC 1EQ1A 3OWTA 4DBQA 2ZPAA 1E85A 1SZIA 3TD7A 3L0IA 4EBBA 3A11A 1VTMP 1QZXA 3B9QA 3W8IA 2DYRC 4XWJA 3GEIA 1QLEC 4UDVA 2BC5A 1Q0DA 3UGPA 4KNWA 4ULWA 1OCOC 1NZEA 2XLVA 2ZXOA 1V55C 5DQZA 1PD1A 2YVKA 1W2WA 2Z15A 1APCA 1J8YF 3K1HA 3OEOA 2C03A 4YL1A 3SXYA 1M2OA 3B0VC 4OIPF 5COGA 1JMWA 3CZ6A 1D1CA 4K1OA 2FGYA 3LLIA 4O79A 3U9MA 5JUAA 5D91A 1T6UA 1TWCA 2HV7A 2EPOA 3JSZA 4O6YA 4W8KA 3JCUQ 1GS9A 2XXAA 1D1BA 2HFIA 3EFOA 2A1DD 2Y3GA 1BR1A 4JCHA 4O6NA 4KC9A 2B0HA 4XTKA 3ZG1A 3JZ0A 1UFBA 3X1OA 1XZQA 2HJ3A 2J0XA 2LP4A 3IQ5A 3KH2A 4L6RA 3DE8A 2EPNA 3DWWA 3GM3A 4EUKB 4MVSA 4PFPA 4OIQF 4IWBA 1RMVA 3MX3A 3DI5A 3ABLC 2W4BA 1E84A 2VH3A 4FWVA 3R7CA 5DS4A 5KYUA 1ZW3A 4Z9IA 3N0TA 4KNVA 3VF0A 3E9VA 1K40A 3U2LA 2CDQA 4DJ9A 3WAQA 4BEMJ 2L9JA 4PJNA 4JRZA 2LFDA 4A4AA 4G7OF 3ZDLA 2D5RB 2HUJA 2M64A 3KYJA 3EGDA 4J7TA 2R03A 4EHPA 2DGJA 2RSEB 256BA 3LNMB 4LDRA 3CQZA 1ZW2A 4DRIB 1D1AA 1ST6A 3KPHA 3RFYA 2HS5A 5BQHA 3UMIA 4EWCA 1ORJA 1YDIA 3FAPB 4E17A 1OW6A 2R7QA 1V74B 3LUTB 1K04A 2XLEA 3V5XA 3ZTMA 3F47A 3JYYA 2H7BA 2XS8A 4CSAA 4CDYA 3ZSUA 3ZWIA 4FAPB 1J8MF 1D0YA 3RF3A 3W2VA 2R05A 4NY3A 2OQMA 2VCCA 2QTVA 1HW2A 1Y6DA 2YWAA 3HTKC 1HE1A 2DI3A 3M4CA 3MBGA 1HMDA 4IAOA 2FFHA 4MS2A 1CPRA 2CNWD 3PHF2 3PDMP 4JEAA 4MW3A 4ZLCA 3QMKA 4CBEA 2R7OA 3UMKA 4DRJB 1JPNA 3T6JA 1U0BB 4FX5A 4I44A 2A0UA 3SXMA 2CW0F 3TK0A 1ZHYA 1VLTA 2YEVA 3EPVA 1L7CA 2KJGA 3EGDB 4XEVA 2YL3A 4OD5A 1NU7D 4IAQA 2LIGA 3C8GA 2OEXA 4GYTA 3CSKA 3GM2A 4JJFA 3U2MA 3H2VA 1FTSA 2XXAB 3GM1A 3NMIA 3EHMA 2H8AA 3GODA 3TOMA 2IXPA 1SYQA 3PCVA 2XLWA 2YRFA 4ZLDA 3Q7LA 3L8JA 1R5ID 4QDLA 3Q6MA 4Z9HA 4WGYA 2J0WA 1Q0GA 2MWQA 4AE4A 4C3EA 1QQ3A 3EH2A 4JZAA 4CS8C 4DVZA 2G3KA 1A7EA 2WVNA 4QI0A 2WZGA 2XLDA 3US6A 2LK4A 3I4UA 4E7ZA 3QVZA 4N4WA 3ZVRA 3W8HA 4I1OB 4BJ6A 4PJMA 1ZHZA 1BR2A 1VYIA 1CGNA 2QLAA 1MMDA 1YYXA 1NFOA 4WGZA 2CYDA 2HKVA 3VM6A 5KYWA 4C3DA 5JP7A 1M2VA 2LD6A 3U0CA 2PNOA 1OW8A 2WVOA 3U3FA 4E0IA 1LIHA 3OA1A 5AC4A 1RCPA 3JT1A 1SR2A 5F5FA 4XPXA 1AUEA 3C8GB 4G78A 3SZRA 1OQCA 2Y39A 5L0DA 1D0ZA 4GEHA 1WASA 3QTHA 4AL0A 1A41A 1Z5ZA 2CNWA 3WHNA 5AGFA 5JT4A 3DAGA 2NUTB 3FVYA 4C3BA 1CGME 3HKKA 3DM5A 4N6HA 4AE4B 3Q7GA 1MNDA 4IB4A 3B0UX 3G50A 1LE4A 1NFNA 2AU5A 5FCLA 3RQFA 1T5OA 1XZPA 3KKBA 1WGWA 2YLGA 3SXZA 4DVYP 5L3VA 4XPYA 4EKWA 2DYSC 3NG1A 4U5CE 4LACB 2PX0A 4EBJA 3VAYA 4MVQA 5BQIA 4Z9JA 3S90A 1N1CA 2H7VC 2OCCC 2PX3A 1M2VB 2UUIA 3GWNA 4MTOA 2HSBA 4P6IC 1RKEA 2XL8A 3DXJF 1ZHXA 3MLGA 1C17M 5A69A 3T9OA 3NKEA 4HFKB 5A6BD 4Q4ZF 3N2ZB 2PP4A 5T3TA 3S29A 5AC5A 5KYYA 3L8IA 2Q9BA 4O6MA 3UR3C 1RXQA 3W4YA 3HJCA 3H65A 3EZIA 4K0DA 4N6CA 4W8PA 5L0CA 1Z3IX 3O55A 2BE5F 3JTLO 3M4BA 4HE8D 4AX2A 1JOGA 1WN0A 1E2XA 2Q3TA 1V4AA 1WOLA 1YA7O 5HSWA 1FFHA 1I4ZA 1LE2A 2A69F 2WVQA 3T6GB 5E2QA 4MVRA 1M56C 3AOUA 1OKKD 2B0JA 3DKAA 5A6AA 4H54A 1PCXA 4PFOA 4N06A 2OJED 1M6TA 2AWYA 4QI2A 2R7UA 1K05A 3GANA 5T3WA 3WODF 4D4XA 2EPKX 3AGUA 3HNJA 1WWPA 1MQVA 3EG9A 5BQGA 1YYJA 1TFKB 2IXOA 3ECSA 4JTDB 2ETSA 5B1AC 3K1IA 1OXBA 4U5EE 3VYWA 1U89A 2Y3BA 3IQ6A 3FMSA 4DXWA 5L0HA 1QVXA 2W45A 3ZQYA 2R7VA 3AQCA 2L7AA 5D92A 3EFOB 3KYIA 1M57C 4MQ9F 2Y3DA 2L81A 4JVSA 3LS0A 1Q0MA 2IYLD 4D4NA 2LFFA 3X2QC 3QZCA 3SP1A 3V5YA 2OOCA 4G7ZF 2KNHA 4EBKA 5DS6A 4BJ5A 4NTAA 2P0NA 2YHSA 4KBLA 1A7DA 3E70C 4U5GA 1G8XA 2J8WA 4DOZA 3GORA 1GQAA 4ONSA 2J9WA 2LCHA 5L0JA 5COMA 4FESA 1VB5A 3HLZA 3LEVA 3ZQVA 1VK5A 2P7VA 1ZYRF 1H9TA 2X0CA 2KC3A 4JTAB 3L34A 5B3IA 3J06A 3RYLA 3SNHA 3RW0A 3ASOC 4CS9A 3O6XA 1E86A 3EHNA 4JKVA 4XLNF 1IZMA 2NPUA 4NTBA 3RKOF 3JRMO 1L3PA 4NCQA 4CJOA 2QE9A 1OKKA 2R25A 3AG3C 3AGTA 4HEAJ 3EGXA 2WB7A 2A0BA 3G4ZA 3U3BA 1CPQA 1OCRC 3EZHA 2J46A 2JPUA 4RD9A 2Q7RA 1JPJA 2VC9A 5JSLA 5JLIA 1FAPB 3JYHA 3RQEA 1GM5A 5B1BC 4G7HF 4CSAC 4JURI 4NC3A 1ZZPA 3DMDA 2D4UA 1JAFA 1ZHWA 4M63A 1A7VA 1PV3A 2GFHA 3IHUA 3RVYA 4JW1A 4KI2A 3NKDA 1BDJB 4P9TA 5COFA 2OJQA 5F5HA 3HNIA 3QW0A 2WZFA 4YT8A 4MW8A 1TKNA 3KMIA 3HNLA 3PMRA 2MHRA 3AG4C 1T01A 1G4WR 2ASRA 5JVEA 1FR0A 4J32B 4JJGA 3SYNA 1HE9A 2IM8A 2G62A 4U9DA 5A6JA 2XSEA 2JD3A 3M15A 5KYUB 1HMOA 1TR2A 3DJNB 4DBRA 2AVKA 1RJ9A 3M79A 3I5QA 5KYXA 4JIOA 4CDAA 1EA8A 3MFNA 1Y4CA 5L0FA 4HFFB 2ZXWC 1LM3B 4DRHB 3I5PA 2HSQA 1FFTC 2I8BA 3GWLA 2R02A 2EIJC 4PK4A 3A9CA 3NYJA 4U5DE 4U5FE 3NMJA 3Q6NA 2HZ8A 3EGXB 4YN0B 4EIYA 4ER9A 2YQYA 2ICWG 2YL0A 3NYLA 1H9GA 3DE9A 3CAXA 1Z7Qc 4AL1A 2JX0A 3ABMC 3C62A 1YLMA 2P1AA 1RKCA 3RQGA 2WZLA 5KYNA 3RVZA 2M4EA 4J30B 2XLOA 5L0IA 2R7TA 4OD4A 2J7PD 1YA9A 1TWGA 3C8ZA 3JSEO 4I3MA 3SEOA 4BJ6C 5DS5A 4IGGA 2YKZA 5T1DB 1I4YA 4H4KC 3DD7A 1Q0FA 2YLIA 3GEEA 3QW1A 3LJBA 1OW7A 4O7GA 2Q4FA 4XPWA 4XLPF 3ATPA 2VASA 5F28E 5KYWB 1RJ9B 5KYXB 2VCAA 3S84A 4JTCB 1YVIA 1T6QA 1S05A 1DOWA 2OEVA 2EIKC 2XRHA 3LEOA 2TMVP 1ZU5A 1O5HA 2Q9CA 5E33A 3ABKC 3O39A 2YL7A 1H7IA 1YZAA 1KNYA 4MVZA 1OR3A 4RDAA 4YT2A 2R7RA 3HNKA 1KTMA 4U5HA 3LLKA 2X51A 3RH3A 1IW7F 3IEEA 5EGYA 5CI8A 1C02A 4YJWA 2OG2A 3U8VA 1YARO 4E18A 1F1MA 2L6GA 4LLCA 3S0XA 2DB4A 4C7OA 4JCZA 3FHDA 2I15A 4IRUA 2J9UA 3EH1A 1Q0KA 2KGOA 3M1CB 5L0GA 3LNRA 3EJNA 3K33A 1TWHA 3S9OA 5K0IA 3V5ZA 4R32A 4XQ1A 3H2UA 2G3VA 2NG1A 3VRCA 3S28A 4LDKA 3AQBA 4P9FA 1LVKA 5DLJA 1OXKA 4PACA 2RD9A 3W2WA 3FOPA 4OINF 4U9EA 1FMVA 1RKEB 3AG2C 4JEBA 1NBBA 2R7WA 4PJLA 1AEPA 1BBHA 2KYHA 2NSGA 2J7PA 1FMWA 2V26A 3ZTZA 2V3CC 4CIHA 2QUPA 2P6VA 3UMHA 5HV9A 5KYYB 3FXHA 4J7YA 3C7JA 2XM4A 5A6KA 1HY5A 4K7BA 2NUPA 3SXKA 3AG1C 3R2PA 3C8GD 5BUOA 1I5NA 3RIPA 5A6BA 5E3AA 2HJMA 2E87A 2XL4A 3TJ6A 3DZAA 4E7SA 1TWAA 3TOLA 1A0BA 3CEXA 3T6BA 3QVYA 1T6IA 4NTFA 2GAQA 4BJ1A 4BEJA 4OIOF 1MNEA 3F46A 4C7OB 4WABA 2ZXRA 1SMYF 3MYFA 1O87A 3NMKA 1YJGA 1MMGA 2L6FA 1PD0A 1VYKA 1B68A 4CDVA 4CIPA 5EHHA 4Q7CA 2XLHA 3WG7C 1Z63A 3DAFA 2GA0A 2HV6A 2VB6A 1QPUA 2A68F 2PBEA 2O9XA 4MVMA 5CIVA 1BR4A 3U5SA 2BL2A 2J45A 2Q9AA 2R9RB 4MVOA 3UNGC 3K1IC 1R4TA 4I1MA 3EG9B 3EQLF 4XEKA 2R7SA 1AVOB 2GDCA 2LQGA 5CI9A 1C03A 2A6EF 1LS4A 1ORYA 4ULVA 4YK5A 3ITFA 4A2NB 4YWQA 1SF8A 4GQHA 5FZTA 3NRHA 4BG0A 2KW3C 4CS8A 1NG1A 1H6GA 2IXMA 2NUPB 3K6BA 2CCYA 4NQFA 3TJ5A 4OIRF 1LI7A 2EINC 2HMQA 2IXNA 2XM0A 3BRJA 3C63A 3IPMO 3KL4A 4JE9A 4CX9A 2VCBA 1NLXA 4BJ5C 2OKUA 1EI7A 1TFOB 2J9VA 3U8PA 1LS1A 3NDBB 1JRAA 3MYIA 1U6HA 1VOMA 4CS7A 1V54C 4LDQA 3B71A 3S27A 1YAUO 2NSFA 1LKXA 1QKRA 4PJJA 2XS1A 4RBNA 4YL0A 2IOQA 2CGEA 2YL1A 2R7XA 3FDQA 3GEHA 1D0XA 3IQTA 3IQCA 2P61A 4MTGA 1G5ZA 1LPEA 1VMAA 4G0HA 1FNTc 1NU9C 2EIMC 3G4XA 1G4US 3AJMA 3DM9B 4U5BE 4CS9C 5IY5C 2EPLX 1VLSA 4YL3A 1TQGA 1XWJA 2KK1A 1ORSC 1OR2A 2UUHA 2XL6A 2Y69C 3ZIBA 4CJGA 5JRAA 5JS5A 3UGOA 1EKYA 2Q00A 1O3UA 2W9YA 3BEHA 2AWCA 2NUTA 2Y3HA 3T4RA 1LI5A 3TULA 4ANJA 2YZSA 2QY9A 2IBFA 3L1MA 2L6HA 2ZXPA 4YT4A 2EILC 2H7OA 1HW1A 3LS1A 4Q5SF 1DOVA 2HMZA 3N24A 1GGQA 5E3CA 1OCZC 3B29A 3TQOA 4B6IA 5DQTA 1QSPA 2XLMA 4XEFA
chains in the Genus database with same CATH topology
2HUJA 2HFIA 2IM8A 2ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUJ A;  2HFI A;  2IM8 A;  2ETS A; 
#chains in the Genus database with same CATH topology
 3FAJ A;  3JRT A;  1OCC C;  1MMA A;  4E0H A;  2FAP B;  1Z23 A;  2ZD9 A;  4YT5 A;  3K66 A;  3B0P A;  3POV A;  2EPM X;  4IAR A;  1UG7 A;  4MVU A;  2PFD A;  4AK9 A;  4BJT A;  4X0R A;  4F4B A;  4JC7 A;  3ASN C;  1ZHT A;  3DJU B;  1MMN A;  3K7D A;  3C18 A;  2C04 A;  2KQ9 A;  2W4M A;  5GPG B;  2LSE A;  3LES A;  1BZ4 A;  2YLD A;  2GWW A;  4LLE A;  3FOO A;  4WJ0 A;  2F22 A;  3NYM A;  1WAT A;  4IJJ A;  1T9K A;  1WTY A;  4MND A;  1KU2 A;  4BPM A;  2AP3 A;  2J9B A;  2WL8 A;  4MTF A;  5EK0 A;  2OU6 A;  3U9J A;  1YZC A;  5DVW A;  2MYS A;  3V7O A;  5L3Q A;  1S7Z A;  3ZC4 A;  2A6H F;  1NSG B;  2KSF A;  4LER A;  5TJ5 E;  1JR8 A;  1Z6A A;  3O10 A;  1E83 A;  1ZVZ A;  4PR9 A;  3LAY A;  1CGO A;  2PF4 E;  1ZU4 A;  2QNL A;  5B3S C;  1EQ1 A;  3OWT A;  4DBQ A;  2ZPA A;  1E85 A;  1SZI A;  3TD7 A;  3L0I A;  4EBB A;  3A11 A;  1VTM P;  1QZX A;  3B9Q A;  3W8I A;  2DYR C;  4XWJ A;  3GEI A;  1QLE C;  4UDV A;  2BC5 A;  1Q0D A;  3UGP A;  4KNW A;  4ULW A;  1OCO C;  1NZE A;  2XLV A;  2ZXO A;  1V55 C;  5DQZ A;  1PD1 A;  2YVK A;  1W2W A;  2Z15 A;  1APC A;  1J8Y F;  3K1H A;  3OEO A;  2C03 A;  4YL1 A;  3SXY A;  1M2O A;  3B0V C;  4OIP F;  5COG A;  1JMW A;  3CZ6 A;  1D1C A;  4K1O A;  2FGY A;  3LLI A;  4O79 A;  3U9M A;  5JUA A;  5D91 A;  1T6U A;  1TWC A;  2HV7 A;  2EPO A;  3JSZ A;  4O6Y A;  4W8K A;  3JCU Q;  1GS9 A;  2XXA A;  1D1B A;  2HFI A;  3EFO A;  2A1D D;  2Y3G A;  1BR1 A;  4JCH A;  4O6N A;  4KC9 A;  2B0H A;  4XTK A;  3ZG1 A;  3JZ0 A;  1UFB A;  3X1O A;  1XZQ A;  2HJ3 A;  2J0X A;  2LP4 A;  3IQ5 A;  3KH2 A;  4L6R A;  3DE8 A;  2EPN A;  3DWW A;  3GM3 A;  4EUK B;  4MVS A;  4PFP A;  4OIQ F;  4IWB A;  1RMV A;  3MX3 A;  3DI5 A;  3ABL C;  2W4B A;  1E84 A;  2VH3 A;  4FWV A;  3R7C A;  5DS4 A;  5KYU A;  1ZW3 A;  4Z9I A;  3N0T A;  4KNV A;  3VF0 A;  3E9V A;  1K40 A;  3U2L A;  2CDQ A;  4DJ9 A;  3WAQ A;  4BEM J;  2L9J A;  4PJN A;  4JRZ A;  2LFD A;  4A4A A;  4G7O F;  3ZDL A;  2D5R B;  2HUJ A;  2M64 A;  3KYJ A;  3EGD A;  4J7T A;  2R03 A;  4EHP A;  2DGJ A;  2RSE B;  256B A;  3LNM B;  4LDR A;  3CQZ A;  1ZW2 A;  4DRI B;  1D1A A;  1ST6 A;  3KPH A;  3RFY A;  2HS5 A;  5BQH A;  3UMI A;  4EWC A;  1ORJ A;  1YDI A;  3FAP B;  4E17 A;  1OW6 A;  2R7Q A;  1V74 B;  3LUT B;  1K04 A;  2XLE A;  3V5X A;  3ZTM A;  3F47 A;  3JYY A;  2H7B A;  2XS8 A;  4CSA A;  4CDY A;  3ZSU A;  3ZWI A;  4FAP B;  1J8M F;  1D0Y A;  3RF3 A;  3W2V A;  2R05 A;  4NY3 A;  2OQM A;  2VCC A;  2QTV A;  1HW2 A;  1Y6D A;  2YWA A;  3HTK C;  1HE1 A;  2DI3 A;  3M4C A;  3MBG A;  1HMD A;  4IAO A;  2FFH A;  4MS2 A;  1CPR A;  2CNW D;  3PHF 2;  3PDM P;  4JEA A;  4MW3 A;  4ZLC A;  3QMK A;  4CBE A;  2R7O A;  3UMK A;  4DRJ B;  1JPN A;  3T6J A;  1U0B B;  4FX5 A;  4I44 A;  2A0U A;  3SXM A;  2CW0 F;  3TK0 A;  1ZHY A;  1VLT A;  2YEV A;  3EPV A;  1L7C A;  2KJG A;  3EGD B;  4XEV A;  2YL3 A;  4OD5 A;  1NU7 D;  4IAQ A;  2LIG A;  3C8G A;  2OEX A;  4GYT A;  3CSK A;  3GM2 A;  4JJF A;  3U2M A;  3H2V A;  1FTS A;  2XXA B;  3GM1 A;  3NMI A;  3EHM A;  2H8A A;  3GOD A;  3TOM A;  2IXP A;  1SYQ A;  3PCV A;  2XLW A;  2YRF A;  4ZLD A;  3Q7L A;  3L8J A;  1R5I D;  4QDL A;  3Q6M A;  4Z9H A;  4WGY A;  2J0W A;  1Q0G A;  2MWQ A;  4AE4 A;  4C3E A;  1QQ3 A;  3EH2 A;  4JZA A;  4CS8 C;  4DVZ A;  2G3K A;  1A7E A;  2WVN A;  4QI0 A;  2WZG A;  2XLD A;  3US6 A;  2LK4 A;  3I4U A;  4E7Z A;  3QVZ A;  4N4W A;  3ZVR A;  3W8H A;  4I1O B;  4BJ6 A;  4PJM A;  1ZHZ A;  1BR2 A;  1VYI A;  1CGN A;  2QLA A;  1MMD A;  1YYX A;  1NFO A;  4WGZ A;  2CYD A;  2HKV A;  3VM6 A;  5KYW A;  4C3D A;  5JP7 A;  1M2V A;  2LD6 A;  3U0C A;  2PNO A;  1OW8 A;  2WVO A;  3U3F A;  4E0I A;  1LIH A;  3OA1 A;  5AC4 A;  1RCP A;  3JT1 A;  1SR2 A;  5F5F A;  4XPX A;  1AUE A;  3C8G B;  4G78 A;  3SZR A;  1OQC A;  2Y39 A;  5L0D A;  1D0Z A;  4GEH A;  1WAS A;  3QTH A;  4AL0 A;  1A41 A;  1Z5Z A;  2CNW A;  3WHN A;  5AGF A;  5JT4 A;  3DAG A;  2NUT B;  3FVY A;  4C3B A;  1CGM E;  3HKK A;  3DM5 A;  4N6H A;  4AE4 B;  3Q7G A;  1MND A;  4IB4 A;  3B0U X;  3G50 A;  1LE4 A;  1NFN A;  2AU5 A;  5FCL A;  3RQF A;  1T5O A;  1XZP A;  3KKB A;  1WGW A;  2YLG A;  3SXZ A;  4DVY P;  5L3V A;  4XPY A;  4EKW A;  2DYS C;  3NG1 A;  4U5C E;  4LAC B;  2PX0 A;  4EBJ A;  3VAY A;  4MVQ A;  5BQI A;  4Z9J A;  3S90 A;  1N1C A;  2H7V C;  2OCC C;  2PX3 A;  1M2V B;  2UUI A;  3GWN A;  4MTO A;  2HSB A;  4P6I C;  1RKE A;  2XL8 A;  3DXJ F;  1ZHX A;  3MLG A;  1C17 M;  5A69 A;  3T9O A;  3NKE A;  4HFK B;  5A6B D;  4Q4Z F;  3N2Z B;  2PP4 A;  5T3T A;  3S29 A;  5AC5 A;  5KYY A;  3L8I A;  2Q9B A;  4O6M A;  3UR3 C;  1RXQ A;  3W4Y A;  3HJC A;  3H65 A;  3EZI A;  4K0D A;  4N6C A;  4W8P A;  5L0C A;  1Z3I X;  3O55 A;  2BE5 F;  3JTL O;  3M4B A;  4HE8 D;  4AX2 A;  1JOG A;  1WN0 A;  1E2X A;  2Q3T A;  1V4A A;  1WOL A;  1YA7 O;  5HSW A;  1FFH A;  1I4Z A;  1LE2 A;  2A69 F;  2WVQ A;  3T6G B;  5E2Q A;  4MVR A;  1M56 C;  3AOU A;  1OKK D;  2B0J A;  3DKA A;  5A6A A;  4H54 A;  1PCX A;  4PFO A;  4N06 A;  2OJE D;  1M6T A;  2AWY A;  4QI2 A;  2R7U A;  1K05 A;  3GAN A;  5T3W A;  3WOD F;  4D4X A;  2EPK X;  3AGU A;  3HNJ A;  1WWP A;  1MQV A;  3EG9 A;  5BQG A;  1YYJ A;  1TFK B;  2IXO A;  3ECS A;  4JTD B;  2ETS A;  5B1A C;  3K1I A;  1OXB A;  4U5E E;  3VYW A;  1U89 A;  2Y3B A;  3IQ6 A;  3FMS A;  4DXW A;  5L0H A;  1QVX A;  2W45 A;  3ZQY A;  2R7V A;  3AQC A;  2L7A A;  5D92 A;  3EFO B;  3KYI A;  1M57 C;  4MQ9 F;  2Y3D A;  2L81 A;  4JVS A;  3LS0 A;  1Q0M A;  2IYL D;  4D4N A;  2LFF A;  3X2Q C;  3QZC A;  3SP1 A;  3V5Y A;  2OOC A;  4G7Z F;  2KNH A;  4EBK A;  5DS6 A;  4BJ5 A;  4NTA A;  2P0N A;  2YHS A;  4KBL A;  1A7D A;  3E70 C;  4U5G A;  1G8X A;  2J8W A;  4DOZ A;  3GOR A;  1GQA A;  4ONS A;  2J9W A;  2LCH A;  5L0J A;  5COM A;  4FES A;  1VB5 A;  3HLZ A;  3LEV A;  3ZQV A;  1VK5 A;  2P7V A;  1ZYR F;  1H9T A;  2X0C A;  2KC3 A;  4JTA B;  3L34 A;  5B3I A;  3J06 A;  3RYL A;  3SNH A;  3RW0 A;  3ASO C;  4CS9 A;  3O6X A;  1E86 A;  3EHN A;  4JKV A;  4XLN F;  1IZM A;  2NPU A;  4NTB A;  3RKO F;  3JRM O;  1L3P A;  4NCQ A;  4CJO A;  2QE9 A;  1OKK A;  2R25 A;  3AG3 C;  3AGT A;  4HEA J;  3EGX A;  2WB7 A;  2A0B A;  3G4Z A;  3U3B A;  1CPQ A;  1OCR C;  3EZH A;  2J46 A;  2JPU A;  4RD9 A;  2Q7R A;  1JPJ A;  2VC9 A;  5JSL A;  5JLI A;  1FAP B;  3JYH A;  3RQE A;  1GM5 A;  5B1B C;  4G7H F;  4CSA C;  4JUR I;  4NC3 A;  1ZZP A;  3DMD A;  2D4U A;  1JAF A;  1ZHW A;  4M63 A;  1A7V A;  1PV3 A;  2GFH A;  3IHU A;  3RVY A;  4JW1 A;  4KI2 A;  3NKD A;  1BDJ B;  4P9T A;  5COF A;  2OJQ A;  5F5H A;  3HNI A;  3QW0 A;  2WZF A;  4YT8 A;  4MW8 A;  1TKN A;  3KMI A;  3HNL A;  3PMR A;  2MHR A;  3AG4 C;  1T01 A;  1G4W R;  2ASR A;  5JVE A;  1FR0 A;  4J32 B;  4JJG A;  3SYN A;  1HE9 A;  2IM8 A;  2G62 A;  4U9D A;  5A6J A;  2XSE A;  2JD3 A;  3M15 A;  5KYU B;  1HMO A;  1TR2 A;  3DJN B;  4DBR A;  2AVK A;  1RJ9 A;  3M79 A;  3I5Q A;  5KYX A;  4JIO A;  4CDA A;  1EA8 A;  3MFN A;  1Y4C A;  5L0F A;  4HFF B;  2ZXW C;  1LM3 B;  4DRH B;  3I5P A;  2HSQ A;  1FFT C;  2I8B A;  3GWL A;  2R02 A;  2EIJ C;  4PK4 A;  3A9C A;  3NYJ A;  4U5D E;  4U5F E;  3NMJ A;  3Q6N A;  2HZ8 A;  3EGX B;  4YN0 B;  4EIY A;  4ER9 A;  2YQY A;  2ICW G;  2YL0 A;  3NYL A;  1H9G A;  3DE9 A;  3CAX A;  1Z7Q c;  4AL1 A;  2JX0 A;  3ABM C;  3C62 A;  1YLM A;  2P1A A;  1RKC A;  3RQG A;  2WZL A;  5KYN A;  3RVZ A;  2M4E A;  4J30 B;  2XLO A;  5L0I A;  2R7T A;  4OD4 A;  2J7P D;  1YA9 A;  1TWG A;  3C8Z A;  3JSE O;  4I3M A;  3SEO A;  4BJ6 C;  5DS5 A;  4IGG A;  2YKZ A;  5T1D B;  1I4Y A;  4H4K C;  3DD7 A;  1Q0F A;  2YLI A;  3GEE A;  3QW1 A;  3LJB A;  1OW7 A;  4O7G A;  2Q4F A;  4XPW A;  4XLP F;  3ATP A;  2VAS A;  5F28 E;  5KYW B;  1RJ9 B;  5KYX B;  2VCA A;  3S84 A;  4JTC B;  1YVI A;  1T6Q A;  1S05 A;  1DOW A;  2OEV A;  2EIK C;  2XRH A;  3LEO A;  2TMV P;  1ZU5 A;  1O5H A;  2Q9C A;  5E33 A;  3ABK C;  3O39 A;  2YL7 A;  1H7I A;  1YZA A;  1KNY A;  4MVZ A;  1OR3 A;  4RDA A;  4YT2 A;  2R7R A;  3HNK A;  1KTM A;  4U5H A;  3LLK A;  2X51 A;  3RH3 A;  1IW7 F;  3IEE A;  5EGY A;  5CI8 A;  1C02 A;  4YJW A;  2OG2 A;  3U8V A;  1YAR O;  4E18 A;  1F1M A;  2L6G A;  4LLC A;  3S0X A;  2DB4 A;  4C7O A;  4JCZ A;  3FHD A;  2I15 A;  4IRU A;  2J9U A;  3EH1 A;  1Q0K A;  2KGO A;  3M1C B;  5L0G A;  3LNR A;  3EJN A;  3K33 A;  1TWH A;  3S9O A;  5K0I A;  3V5Z A;  4R32 A;  4XQ1 A;  3H2U A;  2G3V A;  2NG1 A;  3VRC A;  3S28 A;  4LDK A;  3AQB A;  4P9F A;  1LVK A;  5DLJ A;  1OXK A;  4PAC A;  2RD9 A;  3W2W A;  3FOP A;  4OIN F;  4U9E A;  1FMV A;  1RKE B;  3AG2 C;  4JEB A;  1NBB A;  2R7W A;  4PJL A;  1AEP A;  1BBH A;  2KYH A;  2NSG A;  2J7P A;  1FMW A;  2V26 A;  3ZTZ A;  2V3C C;  4CIH A;  2QUP A;  2P6V A;  3UMH A;  5HV9 A;  5KYY B;  3FXH A;  4J7Y A;  3C7J A;  2XM4 A;  5A6K A;  1HY5 A;  4K7B A;  2NUP A;  3SXK A;  3AG1 C;  3R2P A;  3C8G D;  5BUO A;  1I5N A;  3RIP A;  5A6B A;  5E3A A;  2HJM A;  2E87 A;  2XL4 A;  3TJ6 A;  3DZA A;  4E7S A;  1TWA A;  3TOL A;  1A0B A;  3CEX A;  3T6B A;  3QVY A;  1T6I A;  4NTF A;  2GAQ A;  4BJ1 A;  4BEJ A;  4OIO F;  1MNE A;  3F46 A;  4C7O B;  4WAB A;  2ZXR A;  1SMY F;  3MYF A;  1O87 A;  3NMK A;  1YJG A;  1MMG A;  2L6F A;  1PD0 A;  1VYK A;  1B68 A;  4CDV A;  4CIP A;  5EHH A;  4Q7C A;  2XLH A;  3WG7 C;  1Z63 A;  3DAF A;  2GA0 A;  2HV6 A;  2VB6 A;  1QPU A;  2A68 F;  2PBE A;  2O9X A;  4MVM A;  5CIV A;  1BR4 A;  3U5S A;  2BL2 A;  2J45 A;  2Q9A A;  2R9R B;  4MVO A;  3UNG C;  3K1I C;  1R4T A;  4I1M A;  3EG9 B;  3EQL F;  4XEK A;  2R7S A;  1AVO B;  2GDC A;  2LQG A;  5CI9 A;  1C03 A;  2A6E F;  1LS4 A;  1ORY A;  4ULV A;  4YK5 A;  3ITF A;  4A2N B;  4YWQ A;  1SF8 A;  4GQH A;  5FZT A;  3NRH A;  4BG0 A;  2KW3 C;  4CS8 A;  1NG1 A;  1H6G A;  2IXM A;  2NUP B;  3K6B A;  2CCY A;  4NQF A;  3TJ5 A;  4OIR F;  1LI7 A;  2EIN C;  2HMQ A;  2IXN A;  2XM0 A;  3BRJ A;  3C63 A;  3IPM O;  3KL4 A;  4JE9 A;  4CX9 A;  2VCB A;  1NLX A;  4BJ5 C;  2OKU A;  1EI7 A;  1TFO B;  2J9V A;  3U8P A;  1LS1 A;  3NDB B;  1JRA A;  3MYI A;  1U6H A;  1VOM A;  4CS7 A;  1V54 C;  4LDQ A;  3B71 A;  3S27 A;  1YAU O;  2NSF A;  1LKX A;  1QKR A;  4PJJ A;  2XS1 A;  4RBN A;  4YL0 A;  2IOQ A;  2CGE A;  2YL1 A;  2R7X A;  3FDQ A;  3GEH A;  1D0X A;  3IQT A;  3IQC A;  2P61 A;  4MTG A;  1G5Z A;  1LPE A;  1VMA A;  4G0H A;  1FNT c;  1NU9 C;  2EIM C;  3G4X A;  1G4U S;  3AJM A;  3DM9 B;  4U5B E;  4CS9 C;  5IY5 C;  2EPL X;  1VLS A;  4YL3 A;  1TQG A;  1XWJ A;  2KK1 A;  1ORS C;  1OR2 A;  2UUH A;  2XL6 A;  2Y69 C;  3ZIB A;  4CJG A;  5JRA A;  5JS5 A;  3UGO A;  1EKY A;  2Q00 A;  1O3U A;  2W9Y A;  3BEH A;  2AWC A;  2NUT A;  2Y3H A;  3T4R A;  1LI5 A;  3TUL A;  4ANJ A;  2YZS A;  2QY9 A;  2IBF A;  3L1M A;  2L6H A;  2ZXP A;  4YT4 A;  2EIL C;  2H7O A;  1HW1 A;  3LS1 A;  4Q5S F;  1DOV A;  2HMZ A;  3N24 A;  1GGQ A;  5E3C A;  1OCZ C;  3B29 A;  3TQO A;  4B6I A;  5DQT A;  1QSP A;  2XLM A;  4XEF A; 
#chains in the Genus database with same CATH homology
 2HUJ A;  2HFI A;  2IM8 A;  2ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...