2HFIA

Solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yppE
publication title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hfiA00
2HFIA 2ETSA 2HUJA 2IM8A
chains in the Genus database with same CATH superfamily
4DBRA 3ITFA 4X0RA 1SF8A 3ABLC 1YARO 2AWYA 3K1HA 2R7TA 3JTLO 2J45A 5DLJA 3K33A 4G0HA 4E0IA 5KYXA 2R7QA 4XEKA 4O7GA 2ETSA 2EIMC 2XM0A 2HJ3A 5A69A 1OW6A 2OEXA 2OKUA 1WATA 1ZU5A 1NZEA 5EK0A 4WABA 5A6AA 4N06A 3PCVA 3SZRA 2ZXOA 2GA0A 4MVQA 5COMA 1G8XA 5JP7A 1V55C 4LDQA 4DOZA 1TWGA 3G50A 3CAXA 4LERA 4DRHB 1L3PA 1YA7O 2XS1A 2I15A 2PX3A 4YK5A 3V7OA 2V26A 4QI0A 3TOMA 3PDMP 3ZQVA 2XXAA 4OD4A 3G4XA 2YL7A 2Q9AA 1D0XA 3GODA 2HUJA 4C3EA 1E84A 3EPVA 4CS8A 2XL4A 5D92A 3JYYA 5DS5A 2BC5A 4JJGA 1HMOA 2YKZA 1TWAA 4E7ZA 4MTFA 3IEEA 5B1AC 1BDJB 3DAGA 3C62A 1I5NA 3L34A 3LUTB 5T1DB 2R7XA 3EQLF 2WVOA 4H4KC 2EPMX 3VM6A 1KU2A 3EGDB 1D1AA 2LCHA 1YZCA 3K1IA 3U3BA 3T6JA 1JMWA 2YL1A 1W2WA 4YL3A 4JKVA 1LKXA 3L8IA 1D1BA 1VLSA 3AJMA 3VYWA 4Q4ZF 2HV7A 3OWTA 1YA9A 1ORJA 3J06A 1TWHA 2AP3A 4U5DE 4WJ0A 5D91A 3T4RA 2Q9CA 2XSEA 4CJGA 3VRCA 3KYIA 3LEVA 1Z5ZA 3MBGA 3U2MA 3RVZA 3OEOA 5KYWB 1OCCC 1ZHXA 1WGWA 2A69F 2OJQA 2R02A 1MMAA 3ABKC 1OCOC 3Q7LA 1RJ9A 4MVUA 4U5GA 5GPGB 1M2OA 3EZHA 3KPHA 4IWBA 2HKVA 1E86A 3V5XA 4MS2A 1L7CA 1OW8A 2Y3DA 1OQCA 3IQTA 3LNMB 1H7IA 1K05A 3TOLA 1V4AA 4U9EA 1SYQA 2KW3C 1NFOA 4ER9A 5L0GA 4YL0A 3MYIA 1Y4CA 4JIOA 3RQEA 1ST6A 2IYLD 1PD0A 4FAPB 3SXZA 4IJJA 1NLXA 2LFDA 4DXWA 3K7DA 2BE5F 3DZAA 1LI7A 3LJBA 2VC9A 1LI5A 3NYJA 2DYRC 4IB4A 1JAFA 4RD9A 4PJLA 4LDKA 2M4EA 2B0JA 2G3KA 2PFDA 2PP4A 1ZW2A 4XLPF 1HW2A 3NG1A 4HFFB 4YJWA 3M4BA 4DBQA 4AX2A 3TK0A 1S05A 5JRAA 3MFNA 3UMIA 5DS6A 3RW0A 3JRTA 4EIYA 4CSAC 4MTOA 2VCAA 2VASA 4BPMA 1XZPA 4YL1A 2R03A 4GYTA 2CW0F 2M64A 5T3WA 5AC5A 1OW7A 3K6BA 2H7BA 4CBEA 1LS4A 3EHMA 4XWJA 5L3VA 3AG4C 3IPMO 2JX0A 4ULWA 3GORA 4YN0B 1KTMA 4W8PA 4HFKB 1T6IA 4BEMJ 1EI7A 2PX0A 1CGOA 4JZAA 5COGA 3ZG1A 2NSFA 1IZMA 4JURI 4G7HF 1Q0KA 4JTAB 4MQ9F 1Z3IX 4MW3A 3US6A 1E83A 2J9UA 2R9RB 4JTCB 4CDAA 3UGOA 3N2ZB 2HMZA 1WTYA 2KYHA 4PJMA 2R7SA 4XTKA 1YVIA 3M79A 4O79A 1YJGA 4PFPA 2H7OA 3I4UA 3LAYA 2HZ8A 1ZVZA 5KYXB 2XLEA 1VYIA 2LQGA 2P61A 4JJFA 4RDAA 2LSEA 2Q9BA 2CGEA 4GEHA 4YWQA 2XRHA 3IQ6A 1VB5A 3H65A 5EGYA 4ONSA 4BJ6C 2D5RB 3DM5A 3JSEO 3L8JA 3MLGA 1V54C 2C04A 4O6NA 3TD7A 3S9OA 3IQ5A 1TKNA 4YT5A 3W8HA 4BJ5A 4CX9A 1QQ3A 2AVKA 5E3AA 3ZC4A 4D4XA 4R32A 5FCLA 4AK9A 2UUIA 3N24A 2Q3TA 3U9MA 4EBKA 1ZYRF 4OIOF 1LS1A 3X1OA 1CGNA 5DQZA 4F4BA 3U3FA 2R7UA 2HJMA 1Z6AA 1SMYF 2IM8A 2QY9A 3W4YA 5L0DA 1D0YA 1H9GA 1MMNA 2P1AA 3C7JA 2V3CC 5L3QA 1A41A 2RSEB 1OCRC 3DWWA 2PF4E 3EGXA 3DAFA 2NUPB 3EFOA 1O5HA 4E7SA 4OIPF 2HMQA 2XXAB 1K40A 1OR3A 1HW1A 3C18A 4RBNA 1MMGA 3T9OA 2EPLX 2G3VA 5AC4A 2W9YA 4P9TA 2NG1A 3B0VC 1VTMP 4CIPA 2HS5A 2WVQA 2YLIA 3AGTA 2YLGA 1Z23A 2H8AA 3RFYA 2R7OA 256BA 1A0BA 4I1MA 4HEAJ 5DS4A 3ECSA 2J9WA 2W4BA 3V5YA 2WZGA 2ICWG 3ZTMA 4U5EE 4A4AA 2P0NA 1T9KA 2P7VA 2J7PA 3KYJA 3EH1A 2WB7A 2HV6A 3QTHA 5JSLA 5TJ5E 3TJ6A 3POVA 2EPKX 3H2VA 5B3IA 2NUPA 3DJNB 2A1DD 2D4UA 4JRZA 4UDVA 4CS7A 1M6TA 3CSKA 3E70C 3MX3A 3GM1A 3X2QC 4G78A 3AGUA 3LLKA 3G4ZA 1U89A 2WVNA 2YLDA 4EKWA 5E2QA 4K0DA 4KNVA 4NC3A 3WAQA 3O6XA 2KK1A 1RMVA 4NY3A 3EG9A 3I5QA 1RJ9B 2DGJA 1QVXA 5K0IA 1CPRA 2E87A 4OD5A 2MWQA 3OA1A 4JTDB 2LFFA 1QKRA 3FAPB 2ZD9A 1BZ4A 2FAPB 4CDYA 3C8ZA 5A6KA 3B0PA 2ZXPA 2QNLA 3Q6NA 3O10A 4Z9IA 3S28A 1JPNA 1Q0GA 4CS9A 5CIVA 1M2VA 4CIHA 3S84A 2DYSC 2Y39A 3SP1A 1EQ1A 1YYJA 2EIJC 2P6VA 4XEVA 4IAQA 2YWAA 4ZLCA 2J0XA 3FMSA 1FMWA 2YEVA 4PJJA 2X0CA 5L0HA 5DVWA 1FTSA 3Q6MA 3LNRA 1V74B 1HMDA 2L6HA 2VB6A 1RXQA 3MYFA 2UUHA 2KJGA 3FXHA 3U5SA 3WODF 1YYXA 4PR9A 4QI2A 4CS8C 5L0CA 2OQMA 3JZ0A 3T6BA 2EPOA 1J8MF 2A6HF 4EUKB 3RKOF 5JLIA 2XLOA 3GWNA 3C8GA 1EKYA 3RH3A 3QZCA 1JOGA 1VK5A 3C63A 4NQFA 1QLEC 2RD9A 2NSGA 2ZXWC 3NRHA 4LACB 1VYKA 4MTGA 3TJ5A 4ULVA 1QZXA 4GQHA 5HV9A 2XLWA 1WWPA 2NUTA 1UG7A 3ABMC 3DE8A 3K1IC 3HNLA 4MVSA 2IXOA 3I5PA 4NTAA 2WZLA 2WZFA 3FVYA 4P6IC 4U5CE 4PJNA 4AE4A 2QE9A 2A68F 1ORYA 1U6HA 2CDQA 1RKEA 1ZW3A 4LLEA 1BR1A 1VLTA 2YL0A 1NSGB 1MQVA 4YT8A 3NKEA 5JVEA 4EBJA 3KKBA 3ZQYA 2KNHA 2IXPA 2MHRA 2YZSA 3SXMA 4CDVA 5B3SC 3W2WA 3DXJF 2J7PD 1NFNA 3QMKA 1NU9C 3GWLA 3KMIA 1OXBA 3UNGC 4C3DA 2R7WA 5F28E 1JPJA 2EILC 3GM2A 5KYUA 4ZLDA 1UFBA 3U9JA 2R7VA 2L7AA 3O55A 3ZTZA 5KYNA 1B68A 3NYLA 4JCZA 1PD1A 1MNDA 3EZIA 5JT4A 3GM3A 3NMKA 1LIHA 2IXMA 5FZTA 1OXKA 4Q5SF 3W2VA 4WGZA 3UR3C 1KNYA 3HLZA 3EH2A 2OOCA 3EGXB 3RQFA 3EFOB 4IGGA 4QDLA 5L0IA 1OKKD 2XM4A 2W4MA 3DD7A 2BL2A 3F47A 1WOLA 4JW1A 4KC9A 3SXKA 3DMDA 3NMIA 3BEHA 2IOQA 1A7VA 1GGQA 1K04A 1NG1A 1YLMA 3QVZA 2Q7RA 3QW1A 3L0IA 4U5FE 3QVYA 3Q7GA 1O3UA 3FDQA 1ZHYA 3A11A 5AGFA 1TQGA 1T6QA 1OCZC 4J7TA 4JEAA 1DOWA 2CYDA 5BQIA 1DOVA 3B0UX 3U8VA 2HFIA 1TR2A 5B1BC 4C3BA 2TMVP 2LK4A 1Q0FA 4EBBA 4EWCA 3M4CA 3DI5A 1HY5A 4IARA 3UMKA 5E3CA 3SNHA 3TULA 2EINC 2QUPA 3H2UA 4MNDA 4U5HA 1MNEA 4A2NB 5A6BA 3B29A 2XLDA 4XPXA 1J8YF 4G7ZF 4C7OA 3T6GB 2B0HA 3HNJA 1FAPB 4G7OF 3RQGA 3C8GD 3DJUB 3ASNC 3S90A 1BR4A 4XEFA 3R7CA 4JVSA 1F1MA 3UMHA 1TFOB 5IY5C 4JEBA 2ZPAA 3JSZA 4O6MA 4JC7A 3U2LA 1Z7Qc 3VF0A 1Z63A 4Z9JA 3RIPA 2YRFA 3EG9B 3HNIA 3KH2A 1CGME 1LM3B 2FFHA 2YVKA 4MW8A 3ZSUA 1D1CA 1C03A 3BRJA 3NMJA 4DVZA 2EPNA 1AVOB 2IBFA 5T3TA 4I44A 1PV3A 1AUEA 2YL3A 4BJ5C 1VOMA 2XLHA 2XL8A 4KNWA 2KSFA 1T6UA 2Q4FA 2A0UA 1M2VB 2OCCC 3JCUQ 5KYYA 1RCPA 1M56C 4P9FA 4O6YA 3R2PA 2GWWA 3FHDA 3HJCA 5L0FA 1TFKB 4AL1A 3B71A 5JUAA 3JT1A 4L6RA 1ZZPA 3CZ6A 1O87A 3JRMO 1BR2A 4PFOA 3SEOA 1T01A 4K7BA 4XQ1A 4FESA 3ZIBA 3JYHA 2Y3GA 1LVKA 2YHSA 4FWVA 4WGYA 4D4NA 4YT2A 2A0BA 2PNOA 3CQZA 3UGPA 2L9JA 1OKKA 4U9DA 5E33A 3AG2C 4YT4A 3C8GB 2R7RA 2KGOA 1WASA 3A9CA 2HSBA 4BJTA 3GEHA 1A7DA 3L1MA 4DRIB 3LS1A 1FFTC 1C17M 2JD3A 2QLAA 2NUTB 2WL8A 4FX5A 1GS9A 5CI9A 4DJ9A 5EHHA 1XWJA 1AEPA 2J8WA 4AE4B 1HE1A 2AWCA 1T5OA 2VCBA 4N4WA 3AG1C 3WG7C 3M15A 4LLCA 5F5HA 1E85A 5COFA 1RKEB 3U8PA 3S0XA 2CNWD 3HKKA 3PMRA 4KBLA 4H54A 3TQOA 3DKAA 3ZVRA 3S29A 2KC3A 3FAJA 5BQHA 1HE9A 1Q0DA 1Q0MA 1ZHZA 2OEVA 1BBHA 2ZXRA 1C02A 2MYSA 3O39A 2L6GA 1GQAA 3K66A 3RYLA 2Y3HA 4OIQF 3EJNA 4MVZA 2J46A 2J0WA 3CEXA 4DVYP 5A6BD 4PACA 4XLNF 4E0HA 4Z9HA 1CPQA 4Q7CA 1U0BB 4M63A 1NU7D 2G62A 4BJ1A 5KYUB 1H9TA 4MVOA 2CCYA 4PK4A 3B9QA 3HNKA 2LD6A 4J7YA 3V5ZA 3ASOC 1S7ZA 3N0TA 3SYNA 4B6IA 2KQ9A 1A7EA 2I8BA 4CSAA 4CS9C 2O9XA 1APCA 1JR8A 4J30B 2J9VA 3EHNA 5CI8A 3EGDA 3GANA 1ZHWA 1OR2A 1G5ZA 1QPUA 2GFHA 2J9BA 2R25A 2W45A 1I4YA 4I1OB 4NCQA 1LE4A 2H7VC 1YAUO 3NYMA 3AG3C 5JS5A 2NPUA 2Q00A 3ZDLA 1QSPA 5BQGA 5L0JA 2HSQA 1FR0A 3E9VA 3ZWIA 4CJOA 3DM9B 2LIGA 4IAOA 3NDBB 4E17A 2XL6A 3LEOA 4E18A 1R5ID 3ATPA 5KYWA 4NTFA 4K1OA 3IQCA 1Y6DA 4JCHA 2L6FA 2OJED 3KL4A 3W8IA 1D0ZA 5HSWA 2XLVA 4ANJA 1I4ZA 4EHPA 1TWCA 4W8KA 4BJ6A 4DRJB 2GDCA 3QW0A 1NBBA 3AQBA 2OU6A 2X51A 3HTKC 3M1CB 4J32B 1R4TA 1JRAA 2PBEA 2QTVA 3GEIA 4NTBA 4C7OB 3FOOA 1G4WR 1ORSC 2Z15A 3DE9A 2VH3A 2XLMA 4OIRF 3RVYA 1RKCA 3LLIA 3NKDA 2GAQA 3F46A 2FGYA 2A6EF 1G4US 1E2XA 1SZIA 2R05A 1FNTc 1MMDA 2YQYA 5BUOA 2CNWA 3VAYA 1FFHA 2L81A 5F5FA 3AOUA 4BG0A 2OG2A 3GEEA 4MVRA 3PHF2 1EA8A 2XS8A 3LS0A 1PCXA 3RF3A 1LPEA 3SXYA 1ZU4A 4U5BE 1GM5A 4AL0A 4KI2A 1N1CA 4XPYA 1H6GA 1LE2A 1M57C 5A6JA 1XZQA 2C03A 1FMVA 4HE8D 3AQCA 4IRUA 4N6HA 1YZAA 4OINF 3U0CA 2EIKC 4BEJA 2Y69C 2LP4A 5KYYB 4I3MA 2ASRA 3IHUA 3WHNA 1SR2A 4JE9A 4LDRA 1ZHTA 2Y3BA 3S27A 1IW7F 2F22A 2IXNA 2DB4A 2JPUA 1WN0A 3LESA 4MVMA 4N6CA 1YDIA 3FOPA 4XPWA 2VCCA 5DQTA 1VMAA 2DI3A 2AU5A
chains in the Genus database with same CATH topology
2HFIA 2ETSA 2HUJA 2IM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFI A;  2ETS A;  2HUJ A;  2IM8 A; 
#chains in the Genus database with same CATH topology
 4DBR A;  3ITF A;  4X0R A;  1SF8 A;  3ABL C;  1YAR O;  2AWY A;  3K1H A;  2R7T A;  3JTL O;  2J45 A;  5DLJ A;  3K33 A;  4G0H A;  4E0I A;  5KYX A;  2R7Q A;  4XEK A;  4O7G A;  2ETS A;  2EIM C;  2XM0 A;  2HJ3 A;  5A69 A;  1OW6 A;  2OEX A;  2OKU A;  1WAT A;  1ZU5 A;  1NZE A;  5EK0 A;  4WAB A;  5A6A A;  4N06 A;  3PCV A;  3SZR A;  2ZXO A;  2GA0 A;  4MVQ A;  5COM A;  1G8X A;  5JP7 A;  1V55 C;  4LDQ A;  4DOZ A;  1TWG A;  3G50 A;  3CAX A;  4LER A;  4DRH B;  1L3P A;  1YA7 O;  2XS1 A;  2I15 A;  2PX3 A;  4YK5 A;  3V7O A;  2V26 A;  4QI0 A;  3TOM A;  3PDM P;  3ZQV A;  2XXA A;  4OD4 A;  3G4X A;  2YL7 A;  2Q9A A;  1D0X A;  3GOD A;  2HUJ A;  4C3E A;  1E84 A;  3EPV A;  4CS8 A;  2XL4 A;  5D92 A;  3JYY A;  5DS5 A;  2BC5 A;  4JJG A;  1HMO A;  2YKZ A;  1TWA A;  4E7Z A;  4MTF A;  3IEE A;  5B1A C;  1BDJ B;  3DAG A;  3C62 A;  1I5N A;  3L34 A;  3LUT B;  5T1D B;  2R7X A;  3EQL F;  2WVO A;  4H4K C;  2EPM X;  3VM6 A;  1KU2 A;  3EGD B;  1D1A A;  2LCH A;  1YZC A;  3K1I A;  3U3B A;  3T6J A;  1JMW A;  2YL1 A;  1W2W A;  4YL3 A;  4JKV A;  1LKX A;  3L8I A;  1D1B A;  1VLS A;  3AJM A;  3VYW A;  4Q4Z F;  2HV7 A;  3OWT A;  1YA9 A;  1ORJ A;  3J06 A;  1TWH A;  2AP3 A;  4U5D E;  4WJ0 A;  5D91 A;  3T4R A;  2Q9C A;  2XSE A;  4CJG A;  3VRC A;  3KYI A;  3LEV A;  1Z5Z A;  3MBG A;  3U2M A;  3RVZ A;  3OEO A;  5KYW B;  1OCC C;  1ZHX A;  1WGW A;  2A69 F;  2OJQ A;  2R02 A;  1MMA A;  3ABK C;  1OCO C;  3Q7L A;  1RJ9 A;  4MVU A;  4U5G A;  5GPG B;  1M2O A;  3EZH A;  3KPH A;  4IWB A;  2HKV A;  1E86 A;  3V5X A;  4MS2 A;  1L7C A;  1OW8 A;  2Y3D A;  1OQC A;  3IQT A;  3LNM B;  1H7I A;  1K05 A;  3TOL A;  1V4A A;  4U9E A;  1SYQ A;  2KW3 C;  1NFO A;  4ER9 A;  5L0G A;  4YL0 A;  3MYI A;  1Y4C A;  4JIO A;  3RQE A;  1ST6 A;  2IYL D;  1PD0 A;  4FAP B;  3SXZ A;  4IJJ A;  1NLX A;  2LFD A;  4DXW A;  3K7D A;  2BE5 F;  3DZA A;  1LI7 A;  3LJB A;  2VC9 A;  1LI5 A;  3NYJ A;  2DYR C;  4IB4 A;  1JAF A;  4RD9 A;  4PJL A;  4LDK A;  2M4E A;  2B0J A;  2G3K A;  2PFD A;  2PP4 A;  1ZW2 A;  4XLP F;  1HW2 A;  3NG1 A;  4HFF B;  4YJW A;  3M4B A;  4DBQ A;  4AX2 A;  3TK0 A;  1S05 A;  5JRA A;  3MFN A;  3UMI A;  5DS6 A;  3RW0 A;  3JRT A;  4EIY A;  4CSA C;  4MTO A;  2VCA A;  2VAS A;  4BPM A;  1XZP A;  4YL1 A;  2R03 A;  4GYT A;  2CW0 F;  2M64 A;  5T3W A;  5AC5 A;  1OW7 A;  3K6B A;  2H7B A;  4CBE A;  1LS4 A;  3EHM A;  4XWJ A;  5L3V A;  3AG4 C;  3IPM O;  2JX0 A;  4ULW A;  3GOR A;  4YN0 B;  1KTM A;  4W8P A;  4HFK B;  1T6I A;  4BEM J;  1EI7 A;  2PX0 A;  1CGO A;  4JZA A;  5COG A;  3ZG1 A;  2NSF A;  1IZM A;  4JUR I;  4G7H F;  1Q0K A;  4JTA B;  4MQ9 F;  1Z3I X;  4MW3 A;  3US6 A;  1E83 A;  2J9U A;  2R9R B;  4JTC B;  4CDA A;  3UGO A;  3N2Z B;  2HMZ A;  1WTY A;  2KYH A;  4PJM A;  2R7S A;  4XTK A;  1YVI A;  3M79 A;  4O79 A;  1YJG A;  4PFP A;  2H7O A;  3I4U A;  3LAY A;  2HZ8 A;  1ZVZ A;  5KYX B;  2XLE A;  1VYI A;  2LQG A;  2P61 A;  4JJF A;  4RDA A;  2LSE A;  2Q9B A;  2CGE A;  4GEH A;  4YWQ A;  2XRH A;  3IQ6 A;  1VB5 A;  3H65 A;  5EGY A;  4ONS A;  4BJ6 C;  2D5R B;  3DM5 A;  3JSE O;  3L8J A;  3MLG A;  1V54 C;  2C04 A;  4O6N A;  3TD7 A;  3S9O A;  3IQ5 A;  1TKN A;  4YT5 A;  3W8H A;  4BJ5 A;  4CX9 A;  1QQ3 A;  2AVK A;  5E3A A;  3ZC4 A;  4D4X A;  4R32 A;  5FCL A;  4AK9 A;  2UUI A;  3N24 A;  2Q3T A;  3U9M A;  4EBK A;  1ZYR F;  4OIO F;  1LS1 A;  3X1O A;  1CGN A;  5DQZ A;  4F4B A;  3U3F A;  2R7U A;  2HJM A;  1Z6A A;  1SMY F;  2IM8 A;  2QY9 A;  3W4Y A;  5L0D A;  1D0Y A;  1H9G A;  1MMN A;  2P1A A;  3C7J A;  2V3C C;  5L3Q A;  1A41 A;  2RSE B;  1OCR C;  3DWW A;  2PF4 E;  3EGX A;  3DAF A;  2NUP B;  3EFO A;  1O5H A;  4E7S A;  4OIP F;  2HMQ A;  2XXA B;  1K40 A;  1OR3 A;  1HW1 A;  3C18 A;  4RBN A;  1MMG A;  3T9O A;  2EPL X;  2G3V A;  5AC4 A;  2W9Y A;  4P9T A;  2NG1 A;  3B0V C;  1VTM P;  4CIP A;  2HS5 A;  2WVQ A;  2YLI A;  3AGT A;  2YLG A;  1Z23 A;  2H8A A;  3RFY A;  2R7O A;  256B A;  1A0B A;  4I1M A;  4HEA J;  5DS4 A;  3ECS A;  2J9W A;  2W4B A;  3V5Y A;  2WZG A;  2ICW G;  3ZTM A;  4U5E E;  4A4A A;  2P0N A;  1T9K A;  2P7V A;  2J7P A;  3KYJ A;  3EH1 A;  2WB7 A;  2HV6 A;  3QTH A;  5JSL A;  5TJ5 E;  3TJ6 A;  3POV A;  2EPK X;  3H2V A;  5B3I A;  2NUP A;  3DJN B;  2A1D D;  2D4U A;  4JRZ A;  4UDV A;  4CS7 A;  1M6T A;  3CSK A;  3E70 C;  3MX3 A;  3GM1 A;  3X2Q C;  4G78 A;  3AGU A;  3LLK A;  3G4Z A;  1U89 A;  2WVN A;  2YLD A;  4EKW A;  5E2Q A;  4K0D A;  4KNV A;  4NC3 A;  3WAQ A;  3O6X A;  2KK1 A;  1RMV A;  4NY3 A;  3EG9 A;  3I5Q A;  1RJ9 B;  2DGJ A;  1QVX A;  5K0I A;  1CPR A;  2E87 A;  4OD5 A;  2MWQ A;  3OA1 A;  4JTD B;  2LFF A;  1QKR A;  3FAP B;  2ZD9 A;  1BZ4 A;  2FAP B;  4CDY A;  3C8Z A;  5A6K A;  3B0P A;  2ZXP A;  2QNL A;  3Q6N A;  3O10 A;  4Z9I A;  3S28 A;  1JPN A;  1Q0G A;  4CS9 A;  5CIV A;  1M2V A;  4CIH A;  3S84 A;  2DYS C;  2Y39 A;  3SP1 A;  1EQ1 A;  1YYJ A;  2EIJ C;  2P6V A;  4XEV A;  4IAQ A;  2YWA A;  4ZLC A;  2J0X A;  3FMS A;  1FMW A;  2YEV A;  4PJJ A;  2X0C A;  5L0H A;  5DVW A;  1FTS A;  3Q6M A;  3LNR A;  1V74 B;  1HMD A;  2L6H A;  2VB6 A;  1RXQ A;  3MYF A;  2UUH A;  2KJG A;  3FXH A;  3U5S A;  3WOD F;  1YYX A;  4PR9 A;  4QI2 A;  4CS8 C;  5L0C A;  2OQM A;  3JZ0 A;  3T6B A;  2EPO A;  1J8M F;  2A6H F;  4EUK B;  3RKO F;  5JLI A;  2XLO A;  3GWN A;  3C8G A;  1EKY A;  3RH3 A;  3QZC A;  1JOG A;  1VK5 A;  3C63 A;  4NQF A;  1QLE C;  2RD9 A;  2NSG A;  2ZXW C;  3NRH A;  4LAC B;  1VYK A;  4MTG A;  3TJ5 A;  4ULV A;  1QZX A;  4GQH A;  5HV9 A;  2XLW A;  1WWP A;  2NUT A;  1UG7 A;  3ABM C;  3DE8 A;  3K1I C;  3HNL A;  4MVS A;  2IXO A;  3I5P A;  4NTA A;  2WZL A;  2WZF A;  3FVY A;  4P6I C;  4U5C E;  4PJN A;  4AE4 A;  2QE9 A;  2A68 F;  1ORY A;  1U6H A;  2CDQ A;  1RKE A;  1ZW3 A;  4LLE A;  1BR1 A;  1VLT A;  2YL0 A;  1NSG B;  1MQV A;  4YT8 A;  3NKE A;  5JVE A;  4EBJ A;  3KKB A;  3ZQY A;  2KNH A;  2IXP A;  2MHR A;  2YZS A;  3SXM A;  4CDV A;  5B3S C;  3W2W A;  3DXJ F;  2J7P D;  1NFN A;  3QMK A;  1NU9 C;  3GWL A;  3KMI A;  1OXB A;  3UNG C;  4C3D A;  2R7W A;  5F28 E;  1JPJ A;  2EIL C;  3GM2 A;  5KYU A;  4ZLD A;  1UFB A;  3U9J A;  2R7V A;  2L7A A;  3O55 A;  3ZTZ A;  5KYN A;  1B68 A;  3NYL A;  4JCZ A;  1PD1 A;  1MND A;  3EZI A;  5JT4 A;  3GM3 A;  3NMK A;  1LIH A;  2IXM A;  5FZT A;  1OXK A;  4Q5S F;  3W2V A;  4WGZ A;  3UR3 C;  1KNY A;  3HLZ A;  3EH2 A;  2OOC A;  3EGX B;  3RQF A;  3EFO B;  4IGG A;  4QDL A;  5L0I A;  1OKK D;  2XM4 A;  2W4M A;  3DD7 A;  2BL2 A;  3F47 A;  1WOL A;  4JW1 A;  4KC9 A;  3SXK A;  3DMD A;  3NMI A;  3BEH A;  2IOQ A;  1A7V A;  1GGQ A;  1K04 A;  1NG1 A;  1YLM A;  3QVZ A;  2Q7R A;  3QW1 A;  3L0I A;  4U5F E;  3QVY A;  3Q7G A;  1O3U A;  3FDQ A;  1ZHY A;  3A11 A;  5AGF A;  1TQG A;  1T6Q A;  1OCZ C;  4J7T A;  4JEA A;  1DOW A;  2CYD A;  5BQI A;  1DOV A;  3B0U X;  3U8V A;  2HFI A;  1TR2 A;  5B1B C;  4C3B A;  2TMV P;  2LK4 A;  1Q0F A;  4EBB A;  4EWC A;  3M4C A;  3DI5 A;  1HY5 A;  4IAR A;  3UMK A;  5E3C A;  3SNH A;  3TUL A;  2EIN C;  2QUP A;  3H2U A;  4MND A;  4U5H A;  1MNE A;  4A2N B;  5A6B A;  3B29 A;  2XLD A;  4XPX A;  1J8Y F;  4G7Z F;  4C7O A;  3T6G B;  2B0H A;  3HNJ A;  1FAP B;  4G7O F;  3RQG A;  3C8G D;  3DJU B;  3ASN C;  3S90 A;  1BR4 A;  4XEF A;  3R7C A;  4JVS A;  1F1M A;  3UMH A;  1TFO B;  5IY5 C;  4JEB A;  2ZPA A;  3JSZ A;  4O6M A;  4JC7 A;  3U2L A;  1Z7Q c;  3VF0 A;  1Z63 A;  4Z9J A;  3RIP A;  2YRF A;  3EG9 B;  3HNI A;  3KH2 A;  1CGM E;  1LM3 B;  2FFH A;  2YVK A;  4MW8 A;  3ZSU A;  1D1C A;  1C03 A;  3BRJ A;  3NMJ A;  4DVZ A;  2EPN A;  1AVO B;  2IBF A;  5T3T A;  4I44 A;  1PV3 A;  1AUE A;  2YL3 A;  4BJ5 C;  1VOM A;  2XLH A;  2XL8 A;  4KNW A;  2KSF A;  1T6U A;  2Q4F A;  2A0U A;  1M2V B;  2OCC C;  3JCU Q;  5KYY A;  1RCP A;  1M56 C;  4P9F A;  4O6Y A;  3R2P A;  2GWW A;  3FHD A;  3HJC A;  5L0F A;  1TFK B;  4AL1 A;  3B71 A;  5JUA A;  3JT1 A;  4L6R A;  1ZZP A;  3CZ6 A;  1O87 A;  3JRM O;  1BR2 A;  4PFO A;  3SEO A;  1T01 A;  4K7B A;  4XQ1 A;  4FES A;  3ZIB A;  3JYH A;  2Y3G A;  1LVK A;  2YHS A;  4FWV A;  4WGY A;  4D4N A;  4YT2 A;  2A0B A;  2PNO A;  3CQZ A;  3UGP A;  2L9J A;  1OKK A;  4U9D A;  5E33 A;  3AG2 C;  4YT4 A;  3C8G B;  2R7R A;  2KGO A;  1WAS A;  3A9C A;  2HSB A;  4BJT A;  3GEH A;  1A7D A;  3L1M A;  4DRI B;  3LS1 A;  1FFT C;  1C17 M;  2JD3 A;  2QLA A;  2NUT B;  2WL8 A;  4FX5 A;  1GS9 A;  5CI9 A;  4DJ9 A;  5EHH A;  1XWJ A;  1AEP A;  2J8W A;  4AE4 B;  1HE1 A;  2AWC A;  1T5O A;  2VCB A;  4N4W A;  3AG1 C;  3WG7 C;  3M15 A;  4LLC A;  5F5H A;  1E85 A;  5COF A;  1RKE B;  3U8P A;  3S0X A;  2CNW D;  3HKK A;  3PMR A;  4KBL A;  4H54 A;  3TQO A;  3DKA A;  3ZVR A;  3S29 A;  2KC3 A;  3FAJ A;  5BQH A;  1HE9 A;  1Q0D A;  1Q0M A;  1ZHZ A;  2OEV A;  1BBH A;  2ZXR A;  1C02 A;  2MYS A;  3O39 A;  2L6G A;  1GQA A;  3K66 A;  3RYL A;  2Y3H A;  4OIQ F;  3EJN A;  4MVZ A;  2J46 A;  2J0W A;  3CEX A;  4DVY P;  5A6B D;  4PAC A;  4XLN F;  4E0H A;  4Z9H A;  1CPQ A;  4Q7C A;  1U0B B;  4M63 A;  1NU7 D;  2G62 A;  4BJ1 A;  5KYU B;  1H9T A;  4MVO A;  2CCY A;  4PK4 A;  3B9Q A;  3HNK A;  2LD6 A;  4J7Y A;  3V5Z A;  3ASO C;  1S7Z A;  3N0T A;  3SYN A;  4B6I A;  2KQ9 A;  1A7E A;  2I8B A;  4CSA A;  4CS9 C;  2O9X A;  1APC A;  1JR8 A;  4J30 B;  2J9V A;  3EHN A;  5CI8 A;  3EGD A;  3GAN A;  1ZHW A;  1OR2 A;  1G5Z A;  1QPU A;  2GFH A;  2J9B A;  2R25 A;  2W45 A;  1I4Y A;  4I1O B;  4NCQ A;  1LE4 A;  2H7V C;  1YAU O;  3NYM A;  3AG3 C;  5JS5 A;  2NPU A;  2Q00 A;  3ZDL A;  1QSP A;  5BQG A;  5L0J A;  2HSQ A;  1FR0 A;  3E9V A;  3ZWI A;  4CJO A;  3DM9 B;  2LIG A;  4IAO A;  3NDB B;  4E17 A;  2XL6 A;  3LEO A;  4E18 A;  1R5I D;  3ATP A;  5KYW A;  4NTF A;  4K1O A;  3IQC A;  1Y6D A;  4JCH A;  2L6F A;  2OJE D;  3KL4 A;  3W8I A;  1D0Z A;  5HSW A;  2XLV A;  4ANJ A;  1I4Z A;  4EHP A;  1TWC A;  4W8K A;  4BJ6 A;  4DRJ B;  2GDC A;  3QW0 A;  1NBB A;  3AQB A;  2OU6 A;  2X51 A;  3HTK C;  3M1C B;  4J32 B;  1R4T A;  1JRA A;  2PBE A;  2QTV A;  3GEI A;  4NTB A;  4C7O B;  3FOO A;  1G4W R;  1ORS C;  2Z15 A;  3DE9 A;  2VH3 A;  2XLM A;  4OIR F;  3RVY A;  1RKC A;  3LLI A;  3NKD A;  2GAQ A;  3F46 A;  2FGY A;  2A6E F;  1G4U S;  1E2X A;  1SZI A;  2R05 A;  1FNT c;  1MMD A;  2YQY A;  5BUO A;  2CNW A;  3VAY A;  1FFH A;  2L81 A;  5F5F A;  3AOU A;  4BG0 A;  2OG2 A;  3GEE A;  4MVR A;  3PHF 2;  1EA8 A;  2XS8 A;  3LS0 A;  1PCX A;  3RF3 A;  1LPE A;  3SXY A;  1ZU4 A;  4U5B E;  1GM5 A;  4AL0 A;  4KI2 A;  1N1C A;  4XPY A;  1H6G A;  1LE2 A;  1M57 C;  5A6J A;  1XZQ A;  2C03 A;  1FMV A;  4HE8 D;  3AQC A;  4IRU A;  4N6H A;  1YZA A;  4OIN F;  3U0C A;  2EIK C;  4BEJ A;  2Y69 C;  2LP4 A;  5KYY B;  4I3M A;  2ASR A;  3IHU A;  3WHN A;  1SR2 A;  4JE9 A;  4LDR A;  1ZHT A;  2Y3B A;  3S27 A;  1IW7 F;  2F22 A;  2IXN A;  2DB4 A;  2JPU A;  1WN0 A;  3LES A;  4MVM A;  4N6C A;  1YDI A;  3FOP A;  4XPW A;  2VCC A;  5DQT A;  1VMA A;  2DI3 A;  2AU5 A; 
#chains in the Genus database with same CATH homology
 2HFI A;  2ETS A;  2HUJ A;  2IM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...