2HFIA

Solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yppE
publication title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hfiA00
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH superfamily
5T1DB 5FCLA 3W2WA 3K7DA 3K1IC 3O6XA 4XPWA 2JX0A 4CJGA 5DS6A 3UGOA 2J8WA 2NG1A 3EJNA 4KNWA 1KTMA 4NY3A 2LQGA 4CBEA 4JJGA 4U5BE 1VK5A 4JC7A 1LVKA 4MVOA 3VF0A 1C03A 4YN0B 4YJWA 1GGQA 2LP4A 2W45A 2ZXRA 4D4XA 2A68F 2A6EF 3HNKA 3M4CA 1LI7A 3RF3A 3SZRA 1JAFA 4N6HA 2W4BA 2R7XA 4DOZA 3LUTB 3NYLA 2XM0A 3EH2A 3JYYA 4E7ZA 1D0YA 1OR3A 2HMZA 3FMSA 4AX2A 1HW2A 1RKEB 2YVKA 2E87A 3ATPA 3FOOA 1V55C 4LDRA 3L34A 1TKNA 1DOWA 4DJ9A 1RXQA 4AE4A 3LNMB 2XL4A 1APCA 3M1CB 1FR0A 2I15A 1EA8A 3C62A 1YARO 2HFIA 4C3DA 2L6GA 3OWTA 4JTCB 1OCZC 2O9XA 2IM8A 2YHSA 1BDJB 3GM1A 2DB4A 4GYTA 2ZD9A 1OQCA 1ZHXA 2DI3A 4W8PA 1RKEA 1U6HA 2VCAA 3H2UA 1U89A 1D1CA 1T01A 4RBNA 3DJNB 4XTKA 1KNYA 4YL0A 3S9OA 4KI2A 1OKKA 3HTKC 1TR2A 1RJ9B 2DYSC 4EHPA 3O10A 1JPJA 1LS4A 2DGJA 2LCHA 3PDMP 4MW3A 1Q0GA 3LNRA 4I44A 4QI2A 3A11A 4XEFA 1Z63A 1W2WA 1ORJA 1ZW2A 2L7AA 2Q4FA 3ECSA 4U5DE 1VOMA 1ORSC 3RQGA 3B0VC 3T6JA 2YL1A 2R02A 3AOUA 2L81A 3EG9B 2KYHA 3U5SA 2EPKX 4BJ6A 4IAOA 1DOVA 3EGXB 4JTDB 1E2XA 4NTBA 1H9TA 3EHMA 4PJNA 2OEVA 1R4TA 3G4ZA 3LEOA 3U9MA 3TJ5A 2D4UA 1WASA 2DYRC 2NPUA 2WZLA 1O3UA 2XSEA 3NMJA 3DM5A 3UMKA 2OJQA 4JRZA 4CIHA 2AVKA 3NYMA 1G8XA 1TQGA 2L6HA 2ZXPA 1FFTC 2M4EA 3ZWIA 3EG9A 4JEAA 4MQ9F 3B0UX 4L6RA 5BQIA 3S84A 4JIOA 5DS4A 1EKYA 3NMKA 2MYSA 2FGYA 4IARA 3UMIA 4CX9A 1SR2A 2CNWA 1CPRA 4O6YA 3CQZA 3V5XA 3U0CA 5KYNA 1ZVZA 4WGYA 1ZU5A 2HKVA 4P6IC 1WOLA 4CS9C 4DBQA 5B3IA 2QE9A 4PACA 1NZEA 3ZIBA 4DRIB 4EKWA 2XXAB 5EGYA 3EFOA 3DWWA 1M6TA 4E17A 2HS5A 3PCVA 5GPGB 4ANJA 4MTFA 1ST6A 3SXYA 4I1OB 3LLIA 2YRFA 2HMQA 3NDBB 3B71A 1I4YA 3U3BA 2LD6A 3RQEA 1HE1A 2C04A 3AG1C 1D1AA 2PP4A 2OOCA 3GEHA 3MYFA 3DAFA 4KBLA 1S7ZA 2HSBA 3LAYA 4DVYP 4CDVA 2IBFA 5A69A 3EHNA 5L0GA 3SYNA 1JMWA 1OCOC 1QPUA 1VB5A 2I8BA 4MTOA 5KYWB 2ICWG 3Q7LA 1BBHA 3ZG1A 4KNVA 2NUPB 3RYLA 1OCRC 3C8GA 2J46A 1FMVA 1YDIA 5DVWA 4E0HA 2KGOA 3M4BA 2XLOA 4LLCA 1NU9C 1HY5A 4AK9A 1Z7Qc 3GM2A 2CDQA 3CAXA 4K1OA 4MVSA 3AG4C 3EGDA 5A6JA 1EI7A 1QVXA 2YLIA 3RKOF 5E3AA 4BPMA 4CJOA 4FAPB 5KYWA 2X51A 2YL3A 4NC3A 4XLPF 1ZHTA 1TWAA 3ABLC 2J7PA 2KW3C 3S29A 2PNOA 2XS8A 4OIQF 2IXMA 1LI5A 1HE9A 3ZC4A 4OIPF 1Q0FA 1R5ID 4U5EE 2X0CA 5KYXB 1D0XA 4G7HF 1WTYA 2J9BA 1M2VB 4YL3A 1VMAA 4IB4A 1MMNA 5CIVA 4G7ZF 1XZQA 4CS8A 5T3TA 5IY5C 2PBEA 2R05A 3RFYA 3SXMA 2R7TA 4Q5SF 1AVOB 1MQVA 4I1MA 2Y69C 1YA9A 4AL1A 1YJGA 5HV9A 3ZQYA 4K7BA 1HMOA 1MNDA 1NG1A 2YWAA 5BUOA 3FVYA 4KC9A 3TJ6A 3EZHA 3LS0A 1FMWA 3UR3C 2H8AA 1M2VA 1Z5ZA 2UUIA 1CPQA 5F5HA 2Q7RA 3M79A 2P61A 5JVEA 1BR1A 2WVOA 1J8MF 4J32B 3K6BA 1T6IA 4BJ5C 4LERA 2P1AA 2VC9A 3UMHA 2EILC 3U2MA 3DM9B 4MTGA 3RH3A 3WODF 4E18A 1E84A 1AEPA 2ETSA 1E85A 1RMVA 1M56C 1L3PA 2BC5A 5E2QA 1M57C 1OKKD 1M2OA 5BQHA 3KKBA 3HKKA 4JZAA 1YZCA 2HJ3A 2V26A 4QI0A 3SXKA 2YL7A 3WAQA 3AGTA 3DAGA 3GORA 2M64A 3V7OA 2J9WA 5AGFA 1H9GA 2ZXOA 1K40A 3ZQVA 4R32A 2LFDA 2XL6A 1XWJA 3GODA 3M15A 3Q6MA 4HFKB 1PD1A 2IXNA 2PFDA 1A7EA 2EIMC 1JR8A 1ZHWA 2PX0A 2Y3BA 3HJCA 3ZSUA 4MVMA 4NQFA 5L0CA 4WABA 5KYUB 4IWBA 4LLEA 4FX5A 5EK0A 2W4MA 2Y3HA 2GA0A 3AJMA 1T6QA 2JPUA 4IRUA 3E70C 3K33A 4PR9A 4C7OB 4HEAJ 3ASNC 3GWNA 1ORYA 1Z23A 2D5RB 3VAYA 2Y39A 1GM5A 2Q3TA 2Q9AA 3DE9A 5L0DA 1C02A 1T6UA 4NCQA 3O55A 5JS5A 4LDQA 3TOLA 2A0BA 1JPNA 3W8IA 2A1DD 1NSGB 2HV7A 1QLEC 3JTLO 3N24A 5F28E 2W9YA 1A0BA 3OEOA 2CYDA 2RD9A 1RJ9A 1K04A 2A0UA 4DBRA 3L1MA 2GDCA 2VH3A 4NTAA 4BJ1A 4CIPA 1TFOB 2CNWD 3L8JA 3X1OA 4C7OA 1LE4A 1SF8A 4JEBA 2KSFA 4BG0A 4QDLA 3VRCA 1CGNA 2B0JA 3X2QC 3KL4A 4N4WA 2Q9BA 3CZ6A 2GFHA 3WHNA 1MMDA 4BJ6C 2B0HA 1PV3A 1GS9A 1SYQA 4Q7CA 4XQ1A 2G62A 2VB6A 1HW1A 3IPMO 3QMKA 4U9DA 1EQ1A 3C7JA 5L3QA 5JSLA 3EGXA 3F46A 4JCHA 5TJ5E 1V74B 4FWVA 3U8VA 1S05A 3DZAA 2L9JA 5DQTA 2HJMA 3ASOC 5COGA 2NUTB 1T5OA 2G3KA 2EPLX 3GEEA 3UNGC 4C3EA 5A6BD 1AUEA 2CW0F 3R2PA 1OW8A 3NKDA 1XZPA 4OIRF 4YT4A 3JRMO 2TMVP 5L0IA 4X0RA 1MMAA 3T6GB 2YLDA 3I5QA 1CGME 5B1BC 2EINC 2WVQA 3JSEO 1WGWA 1YYXA 2CGEA 5E33A 5DQZA 4PJLA 4YL1A 2J45A 1I5NA 3GEIA 3AQCA 3C8GD 4XWJA 5D92A 4XLNF 1Z6AA 4P9FA 1G4US 1TWGA 3C63A 3NKEA 4IJJA 4MNDA 3IEEA 4IAQA 3ITFA 5A6BA 2XXAA 2BE5F 2IXPA 4GQHA 3QVYA 256BA 5AC4A 1NU7D 5D91A 1HMDA 4O79A 3FOPA 1UG7A 3N2ZB 3J06A 1NLXA 1Z3IX 5JRAA 2EIKC 5K0IA 2WZFA 5AC5A 1SMYF 3JRTA 1WATA 2AWCA 3PHF2 2ZPAA 2J7PD 2KK1A 2VCBA 3KMIA 3LESA 3L8IA 1NFOA 3ZDLA 4CSAC 1FNTc 3DJUB 3HNLA 4MVZA 2L6FA 1BR2A 4EWCA 1FTSA 3US6A 2XL8A 2IOQA 5CI8A 1ZYRF 2R7OA 3Q7GA 2AWYA 4U5GA 3NG1A 1A7VA 4IGGA 4PFPA 4U9EA 1I4ZA 2WVNA 3JCUQ 1WN0A 3POVA 5B1AC 4OD5A 3TQOA 4ULWA 3IQ5A 2J9VA 2NUPA 1OW7A 4RD9A 2J0WA 2H7OA 3N0TA 3EQLF 5JT4A 1LS1A 3IQ6A 3L0IA 4JKVA 4MVQA 1VLSA 2AU5A 3JSZA 1VTMP 1CGOA 3BRJA 2R25A 3S90A 3T4RA 1N1CA 2P6VA 2YZSA 1V54C 2IXOA 1F1MA 3HNJA 1YVIA 3JZ0A 3JYHA 3QZCA 3RW0A 3TD7A 1UFBA 3DMDA 2ASRA 4XPYA 2WL8A 2YLGA 3AQBA 2R7UA 4WGZA 3A9CA 4YWQA 2OEXA 4I3MA 3JT1A 1VLTA 3B0PA 4D4NA 2KQ9A 1VYKA 4HFFB 3IHUA 3B29A 4Q4ZF 3V5ZA 2OQMA 4A4AA 5KYXA 1SZIA 3E9VA 4JVSA 2OKUA 2R03A 3IQTA 3K1IA 3RVZA 2FFHA 1IW7F 2XS1A 4EUKB 3MX3A 1NBBA 3S28A 3K66A 4H4KC 4N6CA 1IZMA 4NTFA 3ABKC 2H7BA 1QQ3A 1K05A 1LPEA 4MS2A 3NYJA 1Q0KA 4PJMA 3W2VA 4CDAA 2WZGA 3EZIA 2R7WA 3UGPA 2NSFA 4BJ5A 2R7VA 3I5PA 3AGUA 3LS1A 1G5ZA 3R7CA 2LK4A 3ZTMA 4YT5A 4AE4B 1OR2A 4MW8A 4LDKA 2EIJC 3C18A 4O6MA 4DRHB 3MYIA 1QSPA 1YYJA 4O6NA 4Z9IA 4ZLDA 4B6IA 2XLHA 3RVYA 2QNLA 2YL0A 2A69F 1WWPA 1YAUO 1KU2A 3SEOA 1PCXA 1LE2A 2P7VA 3FDQA 1TWCA 2RSEB 4LACB 3FAJA 3Q6NA 4DVZA 5KYYB 1OCCC 5L0JA 4U5CE 1ZHZA 4UDVA 3DI5A 4BJTA 1TFKB 2V3CC 1MMGA 1RKCA 4EIYA 4U5HA 4G7OF 1VYIA 3VM6A 2J0XA 5KYUA 3SP1A 1G4WR 2XM4A 2A6HF 1L7CA 2JD3A 2UUHA 3KYIA 3W4YA 3KPHA 4P9TA 2HZ8A 2LFFA 4YT8A 1BR4A 4OINF 1LKXA 4FESA 2FAPB 2IYLD 2QLAA 4PK4A 3OA1A 1GQAA 3WG7C 5KYYA 5EHHA 4XPXA 5COFA 4DXWA 2KJGA 3F47A 3SXZA 2OG2A 4E7SA 1D0ZA 2XLDA 2G3VA 3QW1A 3NRHA 2R7QA 3RIPA 4XEVA 1Y4CA 1OXKA 4G0HA 1JRAA 2NSGA 4ER9A 3AG2C 4J30B 2BL2A 1ZZPA 4ULVA 4MVRA 4E0IA 3EH1A 1D1BA 1OXBA 1BZ4A 1YA7O 4YK5A 4HE8D 2R9RB 4JURI 4ONSA 1YZAA 5BQGA 4ZLCA 2WB7A 3CEXA 4K0DA 3SNHA 3G50A 1A7DA 3G4XA 4CS7A 1LM3B 4CS9A 2QUPA 3EFOB 3QW0A 4J7TA 3LLKA 1QZXA 1O5HA 1PD0A 2EPMX 3CSKA 3HLZA 3HNIA 3MLGA 2LIGA 1O87A 3B9QA 3U8PA 1LIHA 1H6GA 1ZHYA 2NUTA 1Q0DA 2MHRA 2OCCC 4WJ0A 4A2NB 2HSQA 3S0XA 3TOMA 2KC3A 5DLJA 3ZVRA 3KH2A 3H2VA 3ABMC 4JJFA 2EPNA 4G78A 2J9UA 3DXJF 2OJED 3LEVA 4BEJA 4C3BA 4CDYA 5B3SC 1T9KA 2AP3A 4EBBA 5L0HA 3IQCA 2GWWA 4MVUA 4JTAB 1FAPB 4PFOA 2QY9A 2PX3A 3K1HA 1C17M 1JOGA 1YLMA 3C8ZA 3KYJA 2HV6A 3FHDA 4F4BA 4J7YA 2Y3DA 4YT2A 1FFHA 4JCZA 2ZXWC 4EBKA 5L0FA 5DS5A 2MWQA 4BEMJ 3U3FA 5JLIA 3C8GB 1ZU4A 4RDAA 3RQFA 3V5YA 1B68A 3I4UA 2XRHA 1E83A 2YEVA 3O39A 3T6BA 4CSAA 3U2LA 1E86A 4M63A 2R7SA 3GM3A 5CI9A 3EGDB 3VYWA 3MBGA 3S27A 2F22A 3U9JA 3GANA 5T3WA 2XLMA 3DKAA 5L3VA 1Q0MA 2Q9CA 2LSEA 2EPOA 3DD7A 2KNHA 3FAPB 4O7GA 3TULA 2QTVA 2C03A 2Y3GA 4XEKA 2H7VC 2YQYA 1A41A 3MFNA 4Z9JA 5A6AA 2XLVA 1Y6DA 4JW1A 4N06A 1RCPA 3TK0A 3ZTZA 2P0NA 5E3CA 4EBJA 2R7RA 3QTHA 4DRJB 1H7IA 4H54A 3AG3C 2VCCA 2OU6A 5F5FA 2PF4E 4U5FE 1QKRA 4GEHA 4OD4A 3NMIA 3W8HA 1U0BB 3EPVA 4PJJA 4Z9HA 4AL0A 5A6KA 5JUAA 1OW6A 2XLEA 3GWLA 4CS8C 4JE9A 3BEHA 3QVZA 2Q00A 5HSWA 1J8YF 2Z15A 1ZW3A 3FXHA 2XLWA 3T9OA 2YKZA 1MNEA 5COMA 1TWHA 2CCYA 3H65A 2HUJA 4W8KA 4OIOF 1V4AA 1NFNA 2GAQA 5FZTA 3PMRA 3LJBA 2VASA 5JP7A 3DE8A
chains in the Genus database with same CATH topology
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
#chains in the Genus database with same CATH topology
 5T1D B;  5FCL A;  3W2W A;  3K7D A;  3K1I C;  3O6X A;  4XPW A;  2JX0 A;  4CJG A;  5DS6 A;  3UGO A;  2J8W A;  2NG1 A;  3EJN A;  4KNW A;  1KTM A;  4NY3 A;  2LQG A;  4CBE A;  4JJG A;  4U5B E;  1VK5 A;  4JC7 A;  1LVK A;  4MVO A;  3VF0 A;  1C03 A;  4YN0 B;  4YJW A;  1GGQ A;  2LP4 A;  2W45 A;  2ZXR A;  4D4X A;  2A68 F;  2A6E F;  3HNK A;  3M4C A;  1LI7 A;  3RF3 A;  3SZR A;  1JAF A;  4N6H A;  2W4B A;  2R7X A;  4DOZ A;  3LUT B;  3NYL A;  2XM0 A;  3EH2 A;  3JYY A;  4E7Z A;  1D0Y A;  1OR3 A;  2HMZ A;  3FMS A;  4AX2 A;  1HW2 A;  1RKE B;  2YVK A;  2E87 A;  3ATP A;  3FOO A;  1V55 C;  4LDR A;  3L34 A;  1TKN A;  1DOW A;  4DJ9 A;  1RXQ A;  4AE4 A;  3LNM B;  2XL4 A;  1APC A;  3M1C B;  1FR0 A;  2I15 A;  1EA8 A;  3C62 A;  1YAR O;  2HFI A;  4C3D A;  2L6G A;  3OWT A;  4JTC B;  1OCZ C;  2O9X A;  2IM8 A;  2YHS A;  1BDJ B;  3GM1 A;  2DB4 A;  4GYT A;  2ZD9 A;  1OQC A;  1ZHX A;  2DI3 A;  4W8P A;  1RKE A;  1U6H A;  2VCA A;  3H2U A;  1U89 A;  1D1C A;  1T01 A;  4RBN A;  3DJN B;  4XTK A;  1KNY A;  4YL0 A;  3S9O A;  4KI2 A;  1OKK A;  3HTK C;  1TR2 A;  1RJ9 B;  2DYS C;  4EHP A;  3O10 A;  1JPJ A;  1LS4 A;  2DGJ A;  2LCH A;  3PDM P;  4MW3 A;  1Q0G A;  3LNR A;  4I44 A;  4QI2 A;  3A11 A;  4XEF A;  1Z63 A;  1W2W A;  1ORJ A;  1ZW2 A;  2L7A A;  2Q4F A;  3ECS A;  4U5D E;  1VOM A;  1ORS C;  3RQG A;  3B0V C;  3T6J A;  2YL1 A;  2R02 A;  3AOU A;  2L81 A;  3EG9 B;  2KYH A;  3U5S A;  2EPK X;  4BJ6 A;  4IAO A;  1DOV A;  3EGX B;  4JTD B;  1E2X A;  4NTB A;  1H9T A;  3EHM A;  4PJN A;  2OEV A;  1R4T A;  3G4Z A;  3LEO A;  3U9M A;  3TJ5 A;  2D4U A;  1WAS A;  2DYR C;  2NPU A;  2WZL A;  1O3U A;  2XSE A;  3NMJ A;  3DM5 A;  3UMK A;  2OJQ A;  4JRZ A;  4CIH A;  2AVK A;  3NYM A;  1G8X A;  1TQG A;  2L6H A;  2ZXP A;  1FFT C;  2M4E A;  3ZWI A;  3EG9 A;  4JEA A;  4MQ9 F;  3B0U X;  4L6R A;  5BQI A;  3S84 A;  4JIO A;  5DS4 A;  1EKY A;  3NMK A;  2MYS A;  2FGY A;  4IAR A;  3UMI A;  4CX9 A;  1SR2 A;  2CNW A;  1CPR A;  4O6Y A;  3CQZ A;  3V5X A;  3U0C A;  5KYN A;  1ZVZ A;  4WGY A;  1ZU5 A;  2HKV A;  4P6I C;  1WOL A;  4CS9 C;  4DBQ A;  5B3I A;  2QE9 A;  4PAC A;  1NZE A;  3ZIB A;  4DRI B;  4EKW A;  2XXA B;  5EGY A;  3EFO A;  3DWW A;  1M6T A;  4E17 A;  2HS5 A;  3PCV A;  5GPG B;  4ANJ A;  4MTF A;  1ST6 A;  3SXY A;  4I1O B;  3LLI A;  2YRF A;  2HMQ A;  3NDB B;  3B71 A;  1I4Y A;  3U3B A;  2LD6 A;  3RQE A;  1HE1 A;  2C04 A;  3AG1 C;  1D1A A;  2PP4 A;  2OOC A;  3GEH A;  3MYF A;  3DAF A;  4KBL A;  1S7Z A;  2HSB A;  3LAY A;  4DVY P;  4CDV A;  2IBF A;  5A69 A;  3EHN A;  5L0G A;  3SYN A;  1JMW A;  1OCO C;  1QPU A;  1VB5 A;  2I8B A;  4MTO A;  5KYW B;  2ICW G;  3Q7L A;  1BBH A;  3ZG1 A;  4KNV A;  2NUP B;  3RYL A;  1OCR C;  3C8G A;  2J46 A;  1FMV A;  1YDI A;  5DVW A;  4E0H A;  2KGO A;  3M4B A;  2XLO A;  4LLC A;  1NU9 C;  1HY5 A;  4AK9 A;  1Z7Q c;  3GM2 A;  2CDQ A;  3CAX A;  4K1O A;  4MVS A;  3AG4 C;  3EGD A;  5A6J A;  1EI7 A;  1QVX A;  2YLI A;  3RKO F;  5E3A A;  4BPM A;  4CJO A;  4FAP B;  5KYW A;  2X51 A;  2YL3 A;  4NC3 A;  4XLP F;  1ZHT A;  1TWA A;  3ABL C;  2J7P A;  2KW3 C;  3S29 A;  2PNO A;  2XS8 A;  4OIQ F;  2IXM A;  1LI5 A;  1HE9 A;  3ZC4 A;  4OIP F;  1Q0F A;  1R5I D;  4U5E E;  2X0C A;  5KYX B;  1D0X A;  4G7H F;  1WTY A;  2J9B A;  1M2V B;  4YL3 A;  1VMA A;  4IB4 A;  1MMN A;  5CIV A;  4G7Z F;  1XZQ A;  4CS8 A;  5T3T A;  5IY5 C;  2PBE A;  2R05 A;  3RFY A;  3SXM A;  2R7T A;  4Q5S F;  1AVO B;  1MQV A;  4I1M A;  2Y69 C;  1YA9 A;  4AL1 A;  1YJG A;  5HV9 A;  3ZQY A;  4K7B A;  1HMO A;  1MND A;  1NG1 A;  2YWA A;  5BUO A;  3FVY A;  4KC9 A;  3TJ6 A;  3EZH A;  3LS0 A;  1FMW A;  3UR3 C;  2H8A A;  1M2V A;  1Z5Z A;  2UUI A;  1CPQ A;  5F5H A;  2Q7R A;  3M79 A;  2P61 A;  5JVE A;  1BR1 A;  2WVO A;  1J8M F;  4J32 B;  3K6B A;  1T6I A;  4BJ5 C;  4LER A;  2P1A A;  2VC9 A;  3UMH A;  2EIL C;  3U2M A;  3DM9 B;  4MTG A;  3RH3 A;  3WOD F;  4E18 A;  1E84 A;  1AEP A;  2ETS A;  1E85 A;  1RMV A;  1M56 C;  1L3P A;  2BC5 A;  5E2Q A;  1M57 C;  1OKK D;  1M2O A;  5BQH A;  3KKB A;  3HKK A;  4JZA A;  1YZC A;  2HJ3 A;  2V26 A;  4QI0 A;  3SXK A;  2YL7 A;  3WAQ A;  3AGT A;  3DAG A;  3GOR A;  2M64 A;  3V7O A;  2J9W A;  5AGF A;  1H9G A;  2ZXO A;  1K40 A;  3ZQV A;  4R32 A;  2LFD A;  2XL6 A;  1XWJ A;  3GOD A;  3M15 A;  3Q6M A;  4HFK B;  1PD1 A;  2IXN A;  2PFD A;  1A7E A;  2EIM C;  1JR8 A;  1ZHW A;  2PX0 A;  2Y3B A;  3HJC A;  3ZSU A;  4MVM A;  4NQF A;  5L0C A;  4WAB A;  5KYU B;  4IWB A;  4LLE A;  4FX5 A;  5EK0 A;  2W4M A;  2Y3H A;  2GA0 A;  3AJM A;  1T6Q A;  2JPU A;  4IRU A;  3E70 C;  3K33 A;  4PR9 A;  4C7O B;  4HEA J;  3ASN C;  3GWN A;  1ORY A;  1Z23 A;  2D5R B;  3VAY A;  2Y39 A;  1GM5 A;  2Q3T A;  2Q9A A;  3DE9 A;  5L0D A;  1C02 A;  1T6U A;  4NCQ A;  3O55 A;  5JS5 A;  4LDQ A;  3TOL A;  2A0B A;  1JPN A;  3W8I A;  2A1D D;  1NSG B;  2HV7 A;  1QLE C;  3JTL O;  3N24 A;  5F28 E;  2W9Y A;  1A0B A;  3OEO A;  2CYD A;  2RD9 A;  1RJ9 A;  1K04 A;  2A0U A;  4DBR A;  3L1M A;  2GDC A;  2VH3 A;  4NTA A;  4BJ1 A;  4CIP A;  1TFO B;  2CNW D;  3L8J A;  3X1O A;  4C7O A;  1LE4 A;  1SF8 A;  4JEB A;  2KSF A;  4BG0 A;  4QDL A;  3VRC A;  1CGN A;  2B0J A;  3X2Q C;  3KL4 A;  4N4W A;  2Q9B A;  3CZ6 A;  2GFH A;  3WHN A;  1MMD A;  4BJ6 C;  2B0H A;  1PV3 A;  1GS9 A;  1SYQ A;  4Q7C A;  4XQ1 A;  2G62 A;  2VB6 A;  1HW1 A;  3IPM O;  3QMK A;  4U9D A;  1EQ1 A;  3C7J A;  5L3Q A;  5JSL A;  3EGX A;  3F46 A;  4JCH A;  5TJ5 E;  1V74 B;  4FWV A;  3U8V A;  1S05 A;  3DZA A;  2L9J A;  5DQT A;  2HJM A;  3ASO C;  5COG A;  2NUT B;  1T5O A;  2G3K A;  2EPL X;  3GEE A;  3UNG C;  4C3E A;  5A6B D;  1AUE A;  2CW0 F;  3R2P A;  1OW8 A;  3NKD A;  1XZP A;  4OIR F;  4YT4 A;  3JRM O;  2TMV P;  5L0I A;  4X0R A;  1MMA A;  3T6G B;  2YLD A;  3I5Q A;  1CGM E;  5B1B C;  2EIN C;  2WVQ A;  3JSE O;  1WGW A;  1YYX A;  2CGE A;  5E33 A;  5DQZ A;  4PJL A;  4YL1 A;  2J45 A;  1I5N A;  3GEI A;  3AQC A;  3C8G D;  4XWJ A;  5D92 A;  4XLN F;  1Z6A A;  4P9F A;  1G4U S;  1TWG A;  3C63 A;  3NKE A;  4IJJ A;  4MND A;  3IEE A;  4IAQ A;  3ITF A;  5A6B A;  2XXA A;  2BE5 F;  2IXP A;  4GQH A;  3QVY A;  256B A;  5AC4 A;  1NU7 D;  5D91 A;  1HMD A;  4O79 A;  3FOP A;  1UG7 A;  3N2Z B;  3J06 A;  1NLX A;  1Z3I X;  5JRA A;  2EIK C;  5K0I A;  2WZF A;  5AC5 A;  1SMY F;  3JRT A;  1WAT A;  2AWC A;  3PHF 2;  2ZPA A;  2J7P D;  2KK1 A;  2VCB A;  3KMI A;  3LES A;  3L8I A;  1NFO A;  3ZDL A;  4CSA C;  1FNT c;  3DJU B;  3HNL A;  4MVZ A;  2L6F A;  1BR2 A;  4EWC A;  1FTS A;  3US6 A;  2XL8 A;  2IOQ A;  5CI8 A;  1ZYR F;  2R7O A;  3Q7G A;  2AWY A;  4U5G A;  3NG1 A;  1A7V A;  4IGG A;  4PFP A;  4U9E A;  1I4Z A;  2WVN A;  3JCU Q;  1WN0 A;  3POV A;  5B1A C;  4OD5 A;  3TQO A;  4ULW A;  3IQ5 A;  2J9V A;  2NUP A;  1OW7 A;  4RD9 A;  2J0W A;  2H7O A;  3N0T A;  3EQL F;  5JT4 A;  1LS1 A;  3IQ6 A;  3L0I A;  4JKV A;  4MVQ A;  1VLS A;  2AU5 A;  3JSZ A;  1VTM P;  1CGO A;  3BRJ A;  2R25 A;  3S90 A;  3T4R A;  1N1C A;  2P6V A;  2YZS A;  1V54 C;  2IXO A;  1F1M A;  3HNJ A;  1YVI A;  3JZ0 A;  3JYH A;  3QZC A;  3RW0 A;  3TD7 A;  1UFB A;  3DMD A;  2ASR A;  4XPY A;  2WL8 A;  2YLG A;  3AQB A;  2R7U A;  4WGZ A;  3A9C A;  4YWQ A;  2OEX A;  4I3M A;  3JT1 A;  1VLT A;  3B0P A;  4D4N A;  2KQ9 A;  1VYK A;  4HFF B;  3IHU A;  3B29 A;  4Q4Z F;  3V5Z A;  2OQM A;  4A4A A;  5KYX A;  1SZI A;  3E9V A;  4JVS A;  2OKU A;  2R03 A;  3IQT A;  3K1I A;  3RVZ A;  2FFH A;  1IW7 F;  2XS1 A;  4EUK B;  3MX3 A;  1NBB A;  3S28 A;  3K66 A;  4H4K C;  4N6C A;  1IZM A;  4NTF A;  3ABK C;  2H7B A;  1QQ3 A;  1K05 A;  1LPE A;  4MS2 A;  3NYJ A;  1Q0K A;  4PJM A;  3W2V A;  4CDA A;  2WZG A;  3EZI A;  2R7W A;  3UGP A;  2NSF A;  4BJ5 A;  2R7V A;  3I5P A;  3AGU A;  3LS1 A;  1G5Z A;  3R7C A;  2LK4 A;  3ZTM A;  4YT5 A;  4AE4 B;  1OR2 A;  4MW8 A;  4LDK A;  2EIJ C;  3C18 A;  4O6M A;  4DRH B;  3MYI A;  1QSP A;  1YYJ A;  4O6N A;  4Z9I A;  4ZLD A;  4B6I A;  2XLH A;  3RVY A;  2QNL A;  2YL0 A;  2A69 F;  1WWP A;  1YAU O;  1KU2 A;  3SEO A;  1PCX A;  1LE2 A;  2P7V A;  3FDQ A;  1TWC A;  2RSE B;  4LAC B;  3FAJ A;  3Q6N A;  4DVZ A;  5KYY B;  1OCC C;  5L0J A;  4U5C E;  1ZHZ A;  4UDV A;  3DI5 A;  4BJT A;  1TFK B;  2V3C C;  1MMG A;  1RKC A;  4EIY A;  4U5H A;  4G7O F;  1VYI A;  3VM6 A;  2J0X A;  5KYU A;  3SP1 A;  1G4W R;  2XM4 A;  2A6H F;  1L7C A;  2JD3 A;  2UUH A;  3KYI A;  3W4Y A;  3KPH A;  4P9T A;  2HZ8 A;  2LFF A;  4YT8 A;  1BR4 A;  4OIN F;  1LKX A;  4FES A;  2FAP B;  2IYL D;  2QLA A;  4PK4 A;  3OA1 A;  1GQA A;  3WG7 C;  5KYY A;  5EHH A;  4XPX A;  5COF A;  4DXW A;  2KJG A;  3F47 A;  3SXZ A;  2OG2 A;  4E7S A;  1D0Z A;  2XLD A;  2G3V A;  3QW1 A;  3NRH A;  2R7Q A;  3RIP A;  4XEV A;  1Y4C A;  1OXK A;  4G0H A;  1JRA A;  2NSG A;  4ER9 A;  3AG2 C;  4J30 B;  2BL2 A;  1ZZP A;  4ULV A;  4MVR A;  4E0I A;  3EH1 A;  1D1B A;  1OXB A;  1BZ4 A;  1YA7 O;  4YK5 A;  4HE8 D;  2R9R B;  4JUR I;  4ONS A;  1YZA A;  5BQG A;  4ZLC A;  2WB7 A;  3CEX A;  4K0D A;  3SNH A;  3G50 A;  1A7D A;  3G4X A;  4CS7 A;  1LM3 B;  4CS9 A;  2QUP A;  3EFO B;  3QW0 A;  4J7T A;  3LLK A;  1QZX A;  1O5H A;  1PD0 A;  2EPM X;  3CSK A;  3HLZ A;  3HNI A;  3MLG A;  2LIG A;  1O87 A;  3B9Q A;  3U8P A;  1LIH A;  1H6G A;  1ZHY A;  2NUT A;  1Q0D A;  2MHR A;  2OCC C;  4WJ0 A;  4A2N B;  2HSQ A;  3S0X A;  3TOM A;  2KC3 A;  5DLJ A;  3ZVR A;  3KH2 A;  3H2V A;  3ABM C;  4JJF A;  2EPN A;  4G78 A;  2J9U A;  3DXJ F;  2OJE D;  3LEV A;  4BEJ A;  4C3B A;  4CDY A;  5B3S C;  1T9K A;  2AP3 A;  4EBB A;  5L0H A;  3IQC A;  2GWW A;  4MVU A;  4JTA B;  1FAP B;  4PFO A;  2QY9 A;  2PX3 A;  3K1H A;  1C17 M;  1JOG A;  1YLM A;  3C8Z A;  3KYJ A;  2HV6 A;  3FHD A;  4F4B A;  4J7Y A;  2Y3D A;  4YT2 A;  1FFH A;  4JCZ A;  2ZXW C;  4EBK A;  5L0F A;  5DS5 A;  2MWQ A;  4BEM J;  3U3F A;  5JLI A;  3C8G B;  1ZU4 A;  4RDA A;  3RQF A;  3V5Y A;  1B68 A;  3I4U A;  2XRH A;  1E83 A;  2YEV A;  3O39 A;  3T6B A;  4CSA A;  3U2L A;  1E86 A;  4M63 A;  2R7S A;  3GM3 A;  5CI9 A;  3EGD B;  3VYW A;  3MBG A;  3S27 A;  2F22 A;  3U9J A;  3GAN A;  5T3W A;  2XLM A;  3DKA A;  5L3V A;  1Q0M A;  2Q9C A;  2LSE A;  2EPO A;  3DD7 A;  2KNH A;  3FAP B;  4O7G A;  3TUL A;  2QTV A;  2C03 A;  2Y3G A;  4XEK A;  2H7V C;  2YQY A;  1A41 A;  3MFN A;  4Z9J A;  5A6A A;  2XLV A;  1Y6D A;  4JW1 A;  4N06 A;  1RCP A;  3TK0 A;  3ZTZ A;  2P0N A;  5E3C A;  4EBJ A;  2R7R A;  3QTH A;  4DRJ B;  1H7I A;  4H54 A;  3AG3 C;  2VCC A;  2OU6 A;  5F5F A;  2PF4 E;  4U5F E;  1QKR A;  4GEH A;  4OD4 A;  3NMI A;  3W8H A;  1U0B B;  3EPV A;  4PJJ A;  4Z9H A;  4AL0 A;  5A6K A;  5JUA A;  1OW6 A;  2XLE A;  3GWL A;  4CS8 C;  4JE9 A;  3BEH A;  3QVZ A;  2Q00 A;  5HSW A;  1J8Y F;  2Z15 A;  1ZW3 A;  3FXH A;  2XLW A;  3T9O A;  2YKZ A;  1MNE A;  5COM A;  1TWH A;  2CCY A;  3H65 A;  2HUJ A;  4W8K A;  4OIO F;  1V4A A;  1NFN A;  2GAQ A;  5FZT A;  3PMR A;  3LJB A;  2VAS A;  5JP7 A;  3DE8 A; 
#chains in the Genus database with same CATH homology
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...