2HFIA

Solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yppE
publication title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213
rcsb
source organism Bacillus subtilis
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hfiA00
2ETSA 2IM8A 2HUJA 2HFIA
chains in the Genus database with same CATH superfamily
1J8MF 1MNDA 2HV7A 3SXYA 2IBFA 5KYUA 2YZSA 4BEMJ 1VK5A 4EUKB 1G4WR 1O87A 5BUOA 3K1IA 3ABMC 2YL7A 3ATPA 2Q00A 3GORA 2GAQA 3MYFA 4OIRF 1HE1A 2AWCA 1C02A 4IARA 3V5ZA 3X1OA 1FTSA 3GWNA 4JTAB 2XL4A 1HW1A 1OCRC 4JIOA 3K66A 3JTLO 1NFNA 2XLWA 3UMKA 3ABKC 1G4US 2E87A 3PCVA 4EKWA 3JSZA 1FNTc 1C17M 4C3BA 4IAQA 3GM1A 3SXKA 4LLEA 2AU5A 1ZHXA 5DS6A 5L3QA 2BL2A 1D0ZA 1YYXA 3DI5A 3K6BA 4LERA 4CIHA 3U3FA 1T6UA 2YL3A 3TJ6A 3JRMO 3AG3C 1M6TA 3TK0A 3FVYA 2KYHA 2LD6A 4PJLA 5F5HA 4D4NA 3DJNB 4AX2A 2A0UA 2V26A 2W4MA 4J7YA 2VC9A 2NG1A 4IWBA 1EI7A 3S84A 2Y3BA 4BJ6A 4CSAA 1Q0DA 5DVWA 1WTYA 2HJMA 4O6MA 3H65A 3EG9A 1WWPA 2B0JA 3EZHA 4CDYA 2J0XA 4U9EA 4LLCA 2A69F 1JOGA 5E2QA 4J30B 5B3IA 2R05A 3KL4A 2Q7RA 5KYXA 1K04A 1Q0FA 2R7UA 3C8ZA 1RJ9A 1MMAA 4EWCA 3G50A 4IGGA 1WOLA 2TMVP 3UGPA 4U5HA 2A68F 4EIYA 4JEBA 2NUTA 4CS8C 1VYKA 1OW7A 1E86A 4QI0A 2ICWG 2OJQA 3L8IA 4ZLCA 5E3AA 1TFOB 1JRAA 4P9FA 3JSEO 2IXPA 2HFIA 2D5RB 3S29A 1OCOC 2X51A 2XM0A 5B3SC 1QZXA 1H9GA 3LEVA 4U5BE 2OEXA 2PBEA 2WVQA 5EGYA 3WAQA 5KYUB 2NSFA 4NQFA 1JPNA 1AEPA 1LE2A 1MMDA 1ORYA 2HZ8A 1V4AA 2P6VA 3GM2A 3LLKA 2H8AA 2J7PD 3O39A 4LACB 3RFYA 1TQGA 5DLJA 2HS5A 2HKVA 3JT1A 1HMOA 1NZEA 2LP4A 3C8GD 2GWWA 4I1MA 4O79A 1A7DA 1LS4A 3MX3A 3RF3A 1HY5A 2R9RB 2ZXWC 5D92A 4ZLDA 1YZAA 2LSEA 1N1CA 2Y39A 2XLOA 4MW3A 3ITFA 2PX3A 3Q6MA 3KYIA 4NC3A 256BA 2ETSA 1GGQA 2GDCA 2AVKA 1TWCA 1Z5ZA 3RIPA 3ZSUA 3ZDLA 5JRAA 1NSGB 2DB4A 2Y69C 4XQ1A 1GM5A 3AQCA 1Z7Qc 3FAJA 3SYNA 1LPEA 4AL1A 3KMIA 2KK1A 1OKKD 1LI5A 2R7QA 3L1MA 4IAOA 3ZG1A 2VCCA 4K0DA 2R7OA 4U5CE 2P61A 3OEOA 1Y4CA 1SF8A 1DOWA 3C63A 3AJMA 4XEFA 4EBBA 3SZRA 2YWAA 1A7VA 1WGWA 4C7OA 2ASRA 1QSPA 4YL0A 4P6IC 4R32A 1T01A 1IW7F 2AWYA 3SNHA 3NYJA 2I8BA 2Y3DA 1TFKB 1IZMA 3CQZA 3U5SA 4ULVA 4JTDB 3ZQVA 2EIJC 4CS9A 3ASNC 1FR0A 3E9VA 5BQHA 1PV3A 2HSQA 2HSBA 2NPUA 3NYLA 3HNIA 4W8PA 3GM3A 2P1AA 2PNOA 3A11A 1T6QA 2PX0A 2G3KA 3MYIA 4YT8A 2Y3HA 3SEOA 1M2VB 4JCZA 2L9JA 3HJCA 4GEHA 3W2VA 5KYXB 1VTMP 1FAPB 4YWQA 4AL0A 1JR8A 2J9BA 3SP1A 2AP3A 5KYWB 2XRHA 2CNWD 4DRJB 5L0DA 4G78A 5CI9A 1HMDA 4JEAA 4WGYA 4XTKA 1XZPA 4ANJA 1G5ZA 3UMIA 1GQAA 2EIKC 2OJED 1UG7A 1RXQA 1KNYA 1AVOB 1RKCA 4E7SA 1BDJB 2XLHA 3DMDA 3G4ZA 4DBQA 2R7WA 4G7ZF 3IHUA 3LLIA 1OKKA 4FWVA 3PMRA 4MQ9F 1ZHTA 5JLIA 2MYSA 3DWWA 1G8XA 3EGXA 3EZIA 4XWJA 2IXMA 3EHNA 1A41A 3FDQA 2YRFA 3T4RA 1E85A 3FOOA 2ZPAA 2PFDA 3IQTA 4K1OA 3RVZA 1FFTC 1ORJA 2R7XA 1YLMA 2EPLX 3GWLA 4OIPF 4ULWA 1T9KA 1YZCA 3ASOC 2XLMA 3Q7GA 4KBLA 2OKUA 1CGNA 3RKOF 3NKEA 4WJ0A 1B68A 1TWHA 4B6IA 3NMKA 4YN0B 3UNGC 4XEVA 1ZYRF 1JMWA 2WZGA 1ZU4A 4FESA 2G62A 4O7GA 4U5DE 3S9OA 2JD3A 1AUEA 1ORSC 2XS1A 3EPVA 3KKBA 2J46A 3LESA 4E17A 3PHF2 3EH1A 4GQHA 1O5HA 2HV6A 3VM6A 1Z3IX 4MTGA 1L3PA 3V7OA 2R7RA 5DS5A 4BJ5C 1L7CA 3A9CA 1TWGA 3C62A 1TWAA 4N4WA 3DJUB 1FFHA 4C7OB 3NKDA 5CIVA 3U9JA 3HKKA 2C04A 4NCQA 5JT4A 3AGUA 4JC7A 3KYJA 2NUPA 3L8JA 2Q4FA 1F1MA 4OINF 3F47A 2QLAA 4DJ9A 3J06A 2CW0F 3V5XA 4LDRA 2WL8A 3VYWA 1YARO 3ECSA 3K1IC 4YK5A 3B0UX 1K40A 2A6HF 3H2VA 3WHNA 4YT2A 4Z9IA 3M1CB 4PJMA 4E18A 1VLTA 1ST6A 1PD0A 1DOVA 1VOMA 2J45A 2XSEA 4QI2A 1NG1A 3O10A 1M2VA 1LI7A 3C8GB 1J8YF 2A6EF 1BR4A 4O6YA 5KYYB 5KYWA 2WVNA 5E33A 2H7VC 4DVYP 4H4KC 1FMVA 2OCCC 1T5OA 3F46A 4Q7CA 3WG7C 1YAUO 2R02A 4PJJA 4G7HF 3LJBA 3TOMA 1ZHYA 3TOLA 1RMVA 2W9YA 1OW6A 4MVUA 1NFOA 1QLEC 3UMHA 1VB5A 4E0IA 4BPMA 2EPMX 1EA8A 2YLDA 4BG0A 1D0XA 4N06A 4ER9A 5A6BD 5GPGB 3W8IA 4YJWA 2I15A 3IQCA 3EGXB 3AGTA 3ZIBA 2RD9A 4BJ1A 2Q9BA 2NSGA 3ZWIA 4BJ6C 4CSAC 4FX5A 4NTFA 4F4BA 3Q7LA 2HMQA 2M64A 2YLGA 1QVXA 1RCPA 4EHPA 2DI3A 1BR2A 1GS9A 3C18A 4MVMA 4ONSA 4L6RA 1ZHWA 2J8WA 2Q9AA 2VH3A 2GA0A 2OG2A 5EK0A 2M4EA 5AGFA 1R5ID 2EPKX 3N2ZB 3NMJA 1I5NA 1TR2A 4HFFB 3ZVRA 3JYYA 2XLEA 1NLXA 1VLSA 5COMA 2Y3GA 3CEXA 4U5FE 4NY3A 2VASA 1A0BA 3I5QA 2YVKA 2J0WA 1D0YA 3HNLA 3U9MA 5L0GA 2R7SA 2YL1A 1KU2A 3BEHA 5HSWA 4RD9A 4A2NB 1BR1A 3QVZA 5K0IA 4UDVA 3CZ6A 1JAFA 1ZW2A 4KNVA 4LDKA 2UUIA 1H9TA 1V54C 5B1BC 2IOQA 3EQLF 3TJ5A 3R2PA 2LCHA 2NUPB 4H54A 4GYTA 2G3VA 5DS4A 1OR2A 4O6NA 1YJGA 4OIQF 4XPWA 5JSLA 2LFFA 3HLZA 3LEOA 4MVQA 3H2UA 4DOZA 2PP4A 2RSEB 5DQZA 4MVOA 5A6BA 5FCLA 5L0IA 5EHHA 4W8KA 3SXZA 3VAYA 2CCYA 4J7TA 4CJGA 1PD1A 5L0CA 2J7PA 2ZXOA 3T6BA 3B71A 3LAYA 2R03A 3OA1A 3T6GB 4C3EA 1MQVA 1QQ3A 5T1DB 4BEJA 2L81A 3C8GA 2XL8A 3HTKC 4AE4B 3AQBA 2C03A 5KYYA 3S0XA 3M79A 1V55C 3X2QC 1OXKA 2ZXRA 2J9UA 3G4XA 4K7BA 3HNJA 2EPNA 3N24A 2BE5F 1H6GA 2WZFA 3CAXA 4XLNF 3EJNA 1OR3A 2XLVA 5L0HA 4JURI 3EH2A 4DRIB 3NYMA 4YT5A 1HW2A 1S05A 3GANA 1ZVZA 4I1OB 4XPXA 1APCA 1LVKA 1OXBA 4YL1A 3QW1A 4HFKB 3QTHA 1YA9A 2BC5A 2J9WA 3GODA 4JCHA 4MNDA 3M4CA 1M2OA 1NU9C 1E84A 3QMKA 3EFOB 4KC9A 2DYSC 1V74B 5DQTA 2EIMC 4WGZA 4PK4A 2CYDA 2ZXPA 5D91A 3EHMA 4CS9C 3U8VA 5KYNA 1SZIA 3NMIA 2L6FA 2A1DD 2JPUA 4IJJA 3KH2A 1JPJA 4MVZA 4DBRA 1SYQA 1ZHZA 3FXHA 3IQ6A 3M4BA 4IB4A 4I3MA 5BQIA 2MHRA 3MFNA 4BJ5A 2QUPA 2X0CA 3DD7A 3IEEA 3MBGA 2VCBA 1M57C 4J32B 2P7VA 1BBHA 2YKZA 2HJ3A 4X0RA 3N0TA 2KNHA 5COGA 2JX0A 2R25A 3DE8A 1QKRA 3DXJF 3RH3A 2VB6A 3RW0A 3LNRA 3S27A 4OD4A 2IXNA 4N6HA 1E2XA 2CNWA 1RKEB 1VYIA 3AG4C 2MWQA 4MVRA 3SXMA 3U3BA 4CJOA 2XM4A 3C7JA 2LQGA 3K33A 3IQ5A 3B0VC 2LIGA 3M15A 4Z9JA 4NTAA 4YT4A 1U6HA 5AC5A 1WASA 2VCAA 5E3CA 1U0BB 3ZTZA 4XPYA 4P9TA 4I44A 2XS8A 3OWTA 1VMAA 3ABLC 3FMSA 1E83A 1D1BA 1QPUA 2OEVA 1H7IA 2PF4E 2YL0A 3JCUQ 4Q5SF 2YLIA 2HUJA 2LFDA 4KI2A 1CPQA 4WABA 1MMNA 1Q0MA 1U89A 3DAFA 4MS2A 3UR3C 5L3VA 2IXOA 2XL6A 2KQ9A 4CS8A 3I4UA 3AG2C 3LS0A 1HE9A 4RDAA 1ZU5A 2KJGA 1PCXA 4CDVA 4AE4A 2IYLD 4JKVA 3DAGA 5T3TA 3NDBB 3VRCA 5A69A 2HMZA 4JW1A 5F5FA 2QNLA 3LUTB 3WODF 2DYRC 5COFA 2B0HA 2EINC 1TKNA 5BQGA 4DRHB 3KPHA 3I5PA 1CGME 2P0NA 3MLGA 4E7ZA 4CS7A 3LS1A 4MTOA 2GFHA 5L0FA 4QDLA 1OW8A 1YA7O 1ZW3A 4M63A 4U9DA 1SMYF 1O3UA 3T6JA 5A6AA 1R4TA 1I4ZA 2WZLA 4N6CA 3E70C 2KGOA 1S7ZA 4Z9HA 4CIPA 5JUAA 2H7BA 3TQOA 3U2LA 4JVSA 5JVEA 2W4BA 4CDAA 3EFOA 3DKAA 3JYHA 3L0IA 3QZCA 4JZAA 1ZZPA 4IRUA 4YL3A 2D4UA 2WB7A 3ZTMA 4RBNA 3FAPB 4DVZA 3W4YA 1SR2A 2CDQA 1YYJA 3B0PA 3DM9B 1K05A 4LDQA 5HV9A 4Q4ZF 3BRJA 5T3WA 1MNEA 4FAPB 3ZQYA 3EGDB 4MVSA 1I4YA 2QE9A 5F28E 3RVYA 1MMGA 1OCCC 1FMWA 3GEIA 3RYLA 1Q0GA 1D1CA 2XXAB 1EKYA 2Q9CA 1C03A 3QVYA 2LK4A 2L7AA 4JTCB 1T6IA 2DGJA 2KSFA 1CGOA 3POVA 3W2WA 3O6XA 1LKXA 5L0JA 3O55A 2H7OA 4JRZA 4JJFA 1XZQA 2F22A 2R7VA 1RKEA 3TULA 4A4AA 2FGYA 1NU7D 3U2MA 4BJTA 1Y6DA 5IY5C 4HEAJ 5A6JA 1D1AA 5A6KA 2L6GA 2YQYA 2FAPB 3CSKA 3JRTA 4AK9A 2OOCA 1KTMA 2OU6A 3UGOA 3NRHA 3QW0A 2QY9A 4MW8A 1LM3B 3B29A 1OCZC 1BZ4A 2WVOA 1YDIA 3B9QA 1LS1A 3S28A 2EILC 2FFHA 2KW3C 5AC4A 1WN0A 2YHSA 1LIHA 3DE9A 2KC3A 5JP7A 4C3DA 4U5EE 2V3CC 3U8PA 1Z6AA 1Z63A 1EQ1A 1OQCA 3U0CA 3V5YA 2J9VA 4KNWA 4JJGA 4HE8D 1CPRA 3RQFA 2ZD9A 5FZTA 1M56C 4NTBA 2A0BA 2O9XA 3K1HA 4PACA 4PJNA 5B1AC 1A7EA 3AG1C 3EG9B 2W45A 3GEEA 3HNKA 3R7CA 5JS5A 3DZAA 4U5GA 3AOUA 3RQEA 3T9OA 2IM8A 2Z15A 1UFBA 3PDMP 2Q3TA 1Z23A 3W8HA 3S90A 3FOPA 4XLPF 4D4XA 3NG1A 4PFPA 5TJ5E 3JZ0A 1Q0KA 1YVIA 4EBJA 4G7OF 2CGEA 4JE9A 3K7DA 1RJ9B 4OIOF 4XEKA 4MTFA 3VF0A 2OQMA 1WATA 3RQGA 4EBKA 4OD5A 4DXWA 1NBBA 4PR9A 3GEHA 3EGDA 3FHDA 1W2WA 2NUTB 4CX9A 3TD7A 3US6A 4E0HA 3LNMB 2R7TA 4CBEA 3L34A 2QTVA 4PFOA 5CI8A 3Q6NA 2XXAA 2YEVA 2EPOA 3DM5A 4G0HA 1XWJA 2XLDA 3IPMO 2L6HA 3ZC4A 2UUHA 1LE4A
chains in the Genus database with same CATH topology
2ETSA 2IM8A 2HUJA 2HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETS A;  2IM8 A;  2HUJ A;  2HFI A; 
#chains in the Genus database with same CATH topology
 1J8M F;  1MND A;  2HV7 A;  3SXY A;  2IBF A;  5KYU A;  2YZS A;  4BEM J;  1VK5 A;  4EUK B;  1G4W R;  1O87 A;  5BUO A;  3K1I A;  3ABM C;  2YL7 A;  3ATP A;  2Q00 A;  3GOR A;  2GAQ A;  3MYF A;  4OIR F;  1HE1 A;  2AWC A;  1C02 A;  4IAR A;  3V5Z A;  3X1O A;  1FTS A;  3GWN A;  4JTA B;  2XL4 A;  1HW1 A;  1OCR C;  4JIO A;  3K66 A;  3JTL O;  1NFN A;  2XLW A;  3UMK A;  3ABK C;  1G4U S;  2E87 A;  3PCV A;  4EKW A;  3JSZ A;  1FNT c;  1C17 M;  4C3B A;  4IAQ A;  3GM1 A;  3SXK A;  4LLE A;  2AU5 A;  1ZHX A;  5DS6 A;  5L3Q A;  2BL2 A;  1D0Z A;  1YYX A;  3DI5 A;  3K6B A;  4LER A;  4CIH A;  3U3F A;  1T6U A;  2YL3 A;  3TJ6 A;  3JRM O;  3AG3 C;  1M6T A;  3TK0 A;  3FVY A;  2KYH A;  2LD6 A;  4PJL A;  5F5H A;  4D4N A;  3DJN B;  4AX2 A;  2A0U A;  2V26 A;  2W4M A;  4J7Y A;  2VC9 A;  2NG1 A;  4IWB A;  1EI7 A;  3S84 A;  2Y3B A;  4BJ6 A;  4CSA A;  1Q0D A;  5DVW A;  1WTY A;  2HJM A;  4O6M A;  3H65 A;  3EG9 A;  1WWP A;  2B0J A;  3EZH A;  4CDY A;  2J0X A;  4U9E A;  4LLC A;  2A69 F;  1JOG A;  5E2Q A;  4J30 B;  5B3I A;  2R05 A;  3KL4 A;  2Q7R A;  5KYX A;  1K04 A;  1Q0F A;  2R7U A;  3C8Z A;  1RJ9 A;  1MMA A;  4EWC A;  3G50 A;  4IGG A;  1WOL A;  2TMV P;  3UGP A;  4U5H A;  2A68 F;  4EIY A;  4JEB A;  2NUT A;  4CS8 C;  1VYK A;  1OW7 A;  1E86 A;  4QI0 A;  2ICW G;  2OJQ A;  3L8I A;  4ZLC A;  5E3A A;  1TFO B;  1JRA A;  4P9F A;  3JSE O;  2IXP A;  2HFI A;  2D5R B;  3S29 A;  1OCO C;  2X51 A;  2XM0 A;  5B3S C;  1QZX A;  1H9G A;  3LEV A;  4U5B E;  2OEX A;  2PBE A;  2WVQ A;  5EGY A;  3WAQ A;  5KYU B;  2NSF A;  4NQF A;  1JPN A;  1AEP A;  1LE2 A;  1MMD A;  1ORY A;  2HZ8 A;  1V4A A;  2P6V A;  3GM2 A;  3LLK A;  2H8A A;  2J7P D;  3O39 A;  4LAC B;  3RFY A;  1TQG A;  5DLJ A;  2HS5 A;  2HKV A;  3JT1 A;  1HMO A;  1NZE A;  2LP4 A;  3C8G D;  2GWW A;  4I1M A;  4O79 A;  1A7D A;  1LS4 A;  3MX3 A;  3RF3 A;  1HY5 A;  2R9R B;  2ZXW C;  5D92 A;  4ZLD A;  1YZA A;  2LSE A;  1N1C A;  2Y39 A;  2XLO A;  4MW3 A;  3ITF A;  2PX3 A;  3Q6M A;  3KYI A;  4NC3 A;  256B A;  2ETS A;  1GGQ A;  2GDC A;  2AVK A;  1TWC A;  1Z5Z A;  3RIP A;  3ZSU A;  3ZDL A;  5JRA A;  1NSG B;  2DB4 A;  2Y69 C;  4XQ1 A;  1GM5 A;  3AQC A;  1Z7Q c;  3FAJ A;  3SYN A;  1LPE A;  4AL1 A;  3KMI A;  2KK1 A;  1OKK D;  1LI5 A;  2R7Q A;  3L1M A;  4IAO A;  3ZG1 A;  2VCC A;  4K0D A;  2R7O A;  4U5C E;  2P61 A;  3OEO A;  1Y4C A;  1SF8 A;  1DOW A;  3C63 A;  3AJM A;  4XEF A;  4EBB A;  3SZR A;  2YWA A;  1A7V A;  1WGW A;  4C7O A;  2ASR A;  1QSP A;  4YL0 A;  4P6I C;  4R32 A;  1T01 A;  1IW7 F;  2AWY A;  3SNH A;  3NYJ A;  2I8B A;  2Y3D A;  1TFK B;  1IZM A;  3CQZ A;  3U5S A;  4ULV A;  4JTD B;  3ZQV A;  2EIJ C;  4CS9 A;  3ASN C;  1FR0 A;  3E9V A;  5BQH A;  1PV3 A;  2HSQ A;  2HSB A;  2NPU A;  3NYL A;  3HNI A;  4W8P A;  3GM3 A;  2P1A A;  2PNO A;  3A11 A;  1T6Q A;  2PX0 A;  2G3K A;  3MYI A;  4YT8 A;  2Y3H A;  3SEO A;  1M2V B;  4JCZ A;  2L9J A;  3HJC A;  4GEH A;  3W2V A;  5KYX B;  1VTM P;  1FAP B;  4YWQ A;  4AL0 A;  1JR8 A;  2J9B A;  3SP1 A;  2AP3 A;  5KYW B;  2XRH A;  2CNW D;  4DRJ B;  5L0D A;  4G78 A;  5CI9 A;  1HMD A;  4JEA A;  4WGY A;  4XTK A;  1XZP A;  4ANJ A;  1G5Z A;  3UMI A;  1GQA A;  2EIK C;  2OJE D;  1UG7 A;  1RXQ A;  1KNY A;  1AVO B;  1RKC A;  4E7S A;  1BDJ B;  2XLH A;  3DMD A;  3G4Z A;  4DBQ A;  2R7W A;  4G7Z F;  3IHU A;  3LLI A;  1OKK A;  4FWV A;  3PMR A;  4MQ9 F;  1ZHT A;  5JLI A;  2MYS A;  3DWW A;  1G8X A;  3EGX A;  3EZI A;  4XWJ A;  2IXM A;  3EHN A;  1A41 A;  3FDQ A;  2YRF A;  3T4R A;  1E85 A;  3FOO A;  2ZPA A;  2PFD A;  3IQT A;  4K1O A;  3RVZ A;  1FFT C;  1ORJ A;  2R7X A;  1YLM A;  2EPL X;  3GWL A;  4OIP F;  4ULW A;  1T9K A;  1YZC A;  3ASO C;  2XLM A;  3Q7G A;  4KBL A;  2OKU A;  1CGN A;  3RKO F;  3NKE A;  4WJ0 A;  1B68 A;  1TWH A;  4B6I A;  3NMK A;  4YN0 B;  3UNG C;  4XEV A;  1ZYR F;  1JMW A;  2WZG A;  1ZU4 A;  4FES A;  2G62 A;  4O7G A;  4U5D E;  3S9O A;  2JD3 A;  1AUE A;  1ORS C;  2XS1 A;  3EPV A;  3KKB A;  2J46 A;  3LES A;  4E17 A;  3PHF 2;  3EH1 A;  4GQH A;  1O5H A;  2HV6 A;  3VM6 A;  1Z3I X;  4MTG A;  1L3P A;  3V7O A;  2R7R A;  5DS5 A;  4BJ5 C;  1L7C A;  3A9C A;  1TWG A;  3C62 A;  1TWA A;  4N4W A;  3DJU B;  1FFH A;  4C7O B;  3NKD A;  5CIV A;  3U9J A;  3HKK A;  2C04 A;  4NCQ A;  5JT4 A;  3AGU A;  4JC7 A;  3KYJ A;  2NUP A;  3L8J A;  2Q4F A;  1F1M A;  4OIN F;  3F47 A;  2QLA A;  4DJ9 A;  3J06 A;  2CW0 F;  3V5X A;  4LDR A;  2WL8 A;  3VYW A;  1YAR O;  3ECS A;  3K1I C;  4YK5 A;  3B0U X;  1K40 A;  2A6H F;  3H2V A;  3WHN A;  4YT2 A;  4Z9I A;  3M1C B;  4PJM A;  4E18 A;  1VLT A;  1ST6 A;  1PD0 A;  1DOV A;  1VOM A;  2J45 A;  2XSE A;  4QI2 A;  1NG1 A;  3O10 A;  1M2V A;  1LI7 A;  3C8G B;  1J8Y F;  2A6E F;  1BR4 A;  4O6Y A;  5KYY B;  5KYW A;  2WVN A;  5E33 A;  2H7V C;  4DVY P;  4H4K C;  1FMV A;  2OCC C;  1T5O A;  3F46 A;  4Q7C A;  3WG7 C;  1YAU O;  2R02 A;  4PJJ A;  4G7H F;  3LJB A;  3TOM A;  1ZHY A;  3TOL A;  1RMV A;  2W9Y A;  1OW6 A;  4MVU A;  1NFO A;  1QLE C;  3UMH A;  1VB5 A;  4E0I A;  4BPM A;  2EPM X;  1EA8 A;  2YLD A;  4BG0 A;  1D0X A;  4N06 A;  4ER9 A;  5A6B D;  5GPG B;  3W8I A;  4YJW A;  2I15 A;  3IQC A;  3EGX B;  3AGT A;  3ZIB A;  2RD9 A;  4BJ1 A;  2Q9B A;  2NSG A;  3ZWI A;  4BJ6 C;  4CSA C;  4FX5 A;  4NTF A;  4F4B A;  3Q7L A;  2HMQ A;  2M64 A;  2YLG A;  1QVX A;  1RCP A;  4EHP A;  2DI3 A;  1BR2 A;  1GS9 A;  3C18 A;  4MVM A;  4ONS A;  4L6R A;  1ZHW A;  2J8W A;  2Q9A A;  2VH3 A;  2GA0 A;  2OG2 A;  5EK0 A;  2M4E A;  5AGF A;  1R5I D;  2EPK X;  3N2Z B;  3NMJ A;  1I5N A;  1TR2 A;  4HFF B;  3ZVR A;  3JYY A;  2XLE A;  1NLX A;  1VLS A;  5COM A;  2Y3G A;  3CEX A;  4U5F E;  4NY3 A;  2VAS A;  1A0B A;  3I5Q A;  2YVK A;  2J0W A;  1D0Y A;  3HNL A;  3U9M A;  5L0G A;  2R7S A;  2YL1 A;  1KU2 A;  3BEH A;  5HSW A;  4RD9 A;  4A2N B;  1BR1 A;  3QVZ A;  5K0I A;  4UDV A;  3CZ6 A;  1JAF A;  1ZW2 A;  4KNV A;  4LDK A;  2UUI A;  1H9T A;  1V54 C;  5B1B C;  2IOQ A;  3EQL F;  3TJ5 A;  3R2P A;  2LCH A;  2NUP B;  4H54 A;  4GYT A;  2G3V A;  5DS4 A;  1OR2 A;  4O6N A;  1YJG A;  4OIQ F;  4XPW A;  5JSL A;  2LFF A;  3HLZ A;  3LEO A;  4MVQ A;  3H2U A;  4DOZ A;  2PP4 A;  2RSE B;  5DQZ A;  4MVO A;  5A6B A;  5FCL A;  5L0I A;  5EHH A;  4W8K A;  3SXZ A;  3VAY A;  2CCY A;  4J7T A;  4CJG A;  1PD1 A;  5L0C A;  2J7P A;  2ZXO A;  3T6B A;  3B71 A;  3LAY A;  2R03 A;  3OA1 A;  3T6G B;  4C3E A;  1MQV A;  1QQ3 A;  5T1D B;  4BEJ A;  2L81 A;  3C8G A;  2XL8 A;  3HTK C;  4AE4 B;  3AQB A;  2C03 A;  5KYY A;  3S0X A;  3M79 A;  1V55 C;  3X2Q C;  1OXK A;  2ZXR A;  2J9U A;  3G4X A;  4K7B A;  3HNJ A;  2EPN A;  3N24 A;  2BE5 F;  1H6G A;  2WZF A;  3CAX A;  4XLN F;  3EJN A;  1OR3 A;  2XLV A;  5L0H A;  4JUR I;  3EH2 A;  4DRI B;  3NYM A;  4YT5 A;  1HW2 A;  1S05 A;  3GAN A;  1ZVZ A;  4I1O B;  4XPX A;  1APC A;  1LVK A;  1OXB A;  4YL1 A;  3QW1 A;  4HFK B;  3QTH A;  1YA9 A;  2BC5 A;  2J9W A;  3GOD A;  4JCH A;  4MND A;  3M4C A;  1M2O A;  1NU9 C;  1E84 A;  3QMK A;  3EFO B;  4KC9 A;  2DYS C;  1V74 B;  5DQT A;  2EIM C;  4WGZ A;  4PK4 A;  2CYD A;  2ZXP A;  5D91 A;  3EHM A;  4CS9 C;  3U8V A;  5KYN A;  1SZI A;  3NMI A;  2L6F A;  2A1D D;  2JPU A;  4IJJ A;  3KH2 A;  1JPJ A;  4MVZ A;  4DBR A;  1SYQ A;  1ZHZ A;  3FXH A;  3IQ6 A;  3M4B A;  4IB4 A;  4I3M A;  5BQI A;  2MHR A;  3MFN A;  4BJ5 A;  2QUP A;  2X0C A;  3DD7 A;  3IEE A;  3MBG A;  2VCB A;  1M57 C;  4J32 B;  2P7V A;  1BBH A;  2YKZ A;  2HJ3 A;  4X0R A;  3N0T A;  2KNH A;  5COG A;  2JX0 A;  2R25 A;  3DE8 A;  1QKR A;  3DXJ F;  3RH3 A;  2VB6 A;  3RW0 A;  3LNR A;  3S27 A;  4OD4 A;  2IXN A;  4N6H A;  1E2X A;  2CNW A;  1RKE B;  1VYI A;  3AG4 C;  2MWQ A;  4MVR A;  3SXM A;  3U3B A;  4CJO A;  2XM4 A;  3C7J A;  2LQG A;  3K33 A;  3IQ5 A;  3B0V C;  2LIG A;  3M15 A;  4Z9J A;  4NTA A;  4YT4 A;  1U6H A;  5AC5 A;  1WAS A;  2VCA A;  5E3C A;  1U0B B;  3ZTZ A;  4XPY A;  4P9T A;  4I44 A;  2XS8 A;  3OWT A;  1VMA A;  3ABL C;  3FMS A;  1E83 A;  1D1B A;  1QPU A;  2OEV A;  1H7I A;  2PF4 E;  2YL0 A;  3JCU Q;  4Q5S F;  2YLI A;  2HUJ A;  2LFD A;  4KI2 A;  1CPQ A;  4WAB A;  1MMN A;  1Q0M A;  1U89 A;  3DAF A;  4MS2 A;  3UR3 C;  5L3V A;  2IXO A;  2XL6 A;  2KQ9 A;  4CS8 A;  3I4U A;  3AG2 C;  3LS0 A;  1HE9 A;  4RDA A;  1ZU5 A;  2KJG A;  1PCX A;  4CDV A;  4AE4 A;  2IYL D;  4JKV A;  3DAG A;  5T3T A;  3NDB B;  3VRC A;  5A69 A;  2HMZ A;  4JW1 A;  5F5F A;  2QNL A;  3LUT B;  3WOD F;  2DYR C;  5COF A;  2B0H A;  2EIN C;  1TKN A;  5BQG A;  4DRH B;  3KPH A;  3I5P A;  1CGM E;  2P0N A;  3MLG A;  4E7Z A;  4CS7 A;  3LS1 A;  4MTO A;  2GFH A;  5L0F A;  4QDL A;  1OW8 A;  1YA7 O;  1ZW3 A;  4M63 A;  4U9D A;  1SMY F;  1O3U A;  3T6J A;  5A6A A;  1R4T A;  1I4Z A;  2WZL A;  4N6C A;  3E70 C;  2KGO A;  1S7Z A;  4Z9H A;  4CIP A;  5JUA A;  2H7B A;  3TQO A;  3U2L A;  4JVS A;  5JVE A;  2W4B A;  4CDA A;  3EFO A;  3DKA A;  3JYH A;  3L0I A;  3QZC A;  4JZA A;  1ZZP A;  4IRU A;  4YL3 A;  2D4U A;  2WB7 A;  3ZTM A;  4RBN A;  3FAP B;  4DVZ A;  3W4Y A;  1SR2 A;  2CDQ A;  1YYJ A;  3B0P A;  3DM9 B;  1K05 A;  4LDQ A;  5HV9 A;  4Q4Z F;  3BRJ A;  5T3W A;  1MNE A;  4FAP B;  3ZQY A;  3EGD B;  4MVS A;  1I4Y A;  2QE9 A;  5F28 E;  3RVY A;  1MMG A;  1OCC C;  1FMW A;  3GEI A;  3RYL A;  1Q0G A;  1D1C A;  2XXA B;  1EKY A;  2Q9C A;  1C03 A;  3QVY A;  2LK4 A;  2L7A A;  4JTC B;  1T6I A;  2DGJ A;  2KSF A;  1CGO A;  3POV A;  3W2W A;  3O6X A;  1LKX A;  5L0J A;  3O55 A;  2H7O A;  4JRZ A;  4JJF A;  1XZQ A;  2F22 A;  2R7V A;  1RKE A;  3TUL A;  4A4A A;  2FGY A;  1NU7 D;  3U2M A;  4BJT A;  1Y6D A;  5IY5 C;  4HEA J;  5A6J A;  1D1A A;  5A6K A;  2L6G A;  2YQY A;  2FAP B;  3CSK A;  3JRT A;  4AK9 A;  2OOC A;  1KTM A;  2OU6 A;  3UGO A;  3NRH A;  3QW0 A;  2QY9 A;  4MW8 A;  1LM3 B;  3B29 A;  1OCZ C;  1BZ4 A;  2WVO A;  1YDI A;  3B9Q A;  1LS1 A;  3S28 A;  2EIL C;  2FFH A;  2KW3 C;  5AC4 A;  1WN0 A;  2YHS A;  1LIH A;  3DE9 A;  2KC3 A;  5JP7 A;  4C3D A;  4U5E E;  2V3C C;  3U8P A;  1Z6A A;  1Z63 A;  1EQ1 A;  1OQC A;  3U0C A;  3V5Y A;  2J9V A;  4KNW A;  4JJG A;  4HE8 D;  1CPR A;  3RQF A;  2ZD9 A;  5FZT A;  1M56 C;  4NTB A;  2A0B A;  2O9X A;  3K1H A;  4PAC A;  4PJN A;  5B1A C;  1A7E A;  3AG1 C;  3EG9 B;  2W45 A;  3GEE A;  3HNK A;  3R7C A;  5JS5 A;  3DZA A;  4U5G A;  3AOU A;  3RQE A;  3T9O A;  2IM8 A;  2Z15 A;  1UFB A;  3PDM P;  2Q3T A;  1Z23 A;  3W8H A;  3S90 A;  3FOP A;  4XLP F;  4D4X A;  3NG1 A;  4PFP A;  5TJ5 E;  3JZ0 A;  1Q0K A;  1YVI A;  4EBJ A;  4G7O F;  2CGE A;  4JE9 A;  3K7D A;  1RJ9 B;  4OIO F;  4XEK A;  4MTF A;  3VF0 A;  2OQM A;  1WAT A;  3RQG A;  4EBK A;  4OD5 A;  4DXW A;  1NBB A;  4PR9 A;  3GEH A;  3EGD A;  3FHD A;  1W2W A;  2NUT B;  4CX9 A;  3TD7 A;  3US6 A;  4E0H A;  3LNM B;  2R7T A;  4CBE A;  3L34 A;  2QTV A;  4PFO A;  5CI8 A;  3Q6N A;  2XXA A;  2YEV A;  2EPO A;  3DM5 A;  4G0H A;  1XWJ A;  2XLD A;  3IPM O;  2L6H A;  3ZC4 A;  2UUH A;  1LE4 A; 
#chains in the Genus database with same CATH homology
 2ETS A;  2IM8 A;  2HUJ A;  2HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...