2HFIA

Solution nmr structure of protein yppe from bacillus subtilis. northeast structural genomics consortium target sr213
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yppE
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hfiA00
2HFIA 2IM8A 2ETSA 2HUJA
chains in the Genus database with same CATH superfamily
2UUHA 3DAGA 4KC9A 4FAPB 1TWCA 3QZCA 3JSEO 4YT8A 2L7AA 1EA8A 1QZXA 4OIRF 2XLEA 2Y3HA 1ZU4A 4BEJA 2X51A 4MVOA 2XL4A 4IAOA 1NZEA 4N6HA 3M1CB 3FVYA 4QI2A 4J7TA 2PX0A 3SXMA 5KYUB 2D5RB 4JJGA 5TJ5E 3SNHA 2PX3A 2RSEB 1G4US 2GA0A 2R7SA 3NYLA 5E33A 4LERA 3ZWIA 5L0JA 1T5OA 4WJ0A 4MVUA 2Q00A 3AG4C 2ETSA 4IWBA 4UDVA 5K0IA 3DE9A 3R2PA 4FX5A 2VCCA 2XXAA 3N2ZB 1Q0DA 5L0DA 1AUEA 1SMYF 3L8JA 3K66A 3NG1A 1XWJA 4L6RA 1Q0GA 2HV7A 4XEKA 1T6QA 3IQTA 3JYHA 1RKEA 3LESA 3QVZA 3B29A 3DM9B 4AL0A 2KJGA 1MMDA 5KYWB 1H6GA 2Y3BA 2BE5F 4YJWA 1TR2A 4JW1A 3VAYA 3X1OA 4DJ9A 3H65A 3R7CA 3SZRA 1WGWA 4NCQA 5COMA 3ZC4A 4A2NB 2QNLA 3DM5A 2HMQA 4LDKA 4CS8C 5HSWA 1E83A 1YZCA 2A1DD 4GEHA 3LLKA 4CIPA 2PNOA 4G78A 4OD4A 3S90A 3E70C 1YLMA 4CS7A 3Q6NA 3LS1A 4PJNA 1OR3A 3NKDA 2VB6A 4HFKB 2WVQA 3C63A 3DI5A 4I44A 4Q7CA 3EGDA 4E7SA 1K05A 2HSQA 3M79A 2ZD9A 2ZXPA 4G0HA 3JYYA 2BL2A 1WN0A 3EH1A 2LFDA 3I5PA 4EUKB 3JT1A 2PFDA 4O79A 1D0ZA 4ULVA 2EPMX 2UUIA 2XLDA 3OEOA 3T6JA 1KTMA 3KYIA 2DB4A 2EPNA 4JIOA 2A0BA 3AQBA 1CPQA 5COFA 4GQHA 3RVYA 3ZQVA 5DS4A 2R7WA 5L3VA 1ORJA 1YAUO 1G8XA 2R02A 2WL8A 3DJNB 3PDMP 2XLOA 4IARA 1LM3B 2IOQA 2R7VA 2W4MA 1ZHXA 1RMVA 2P1AA 5AC5A 1NBBA 1TQGA 2H7VC 2KNHA 1VLSA 2OCCC 4J7YA 3KMIA 5FZTA 3W8IA 2CYDA 5KYYA 5DQZA 2ZPAA 4DBQA 3RF3A 3RQGA 3U3FA 4JRZA 2MWQA 3ABLC 1U0BB 2YQYA 3SP1A 4EIYA 1JR8A 3CZ6A 2YWAA 3AG2C 2R7TA 1A0BA 3S27A 2J0XA 2R7RA 2XLVA 4U5CE 1Z23A 3DMDA 1Z7Qc 1OR2A 2KK1A 1OW6A 3LEOA 1LVKA 3QVYA 3FAPB 1NU9C 2YEVA 3DWWA 2C04A 3W2WA 3U9JA 5F5HA 3MFNA 3AGTA 3IHUA 4KBLA 2HMZA 4MTGA 1YDIA 1FTSA 1YARO 3LAYA 3VM6A 1HY5A 2XS1A 2YL3A 3ASOC 5D92A 3TJ6A 3IQ6A 2EPKX 4JTAB 2VCBA 1D1CA 4I1MA 2FFHA 2G3VA 4JVSA 2ICWG 2IM8A 3OWTA 4DBRA 3JZ0A 1RKEB 4E7ZA 4CJGA 1YYXA 1FFTC 3U3BA 4YL0A 2YLDA 1VOMA 2YHSA 1LE2A 1A7EA 3AJMA 3E9VA 3EQLF 2X0CA 1C03A 1L7CA 2A68F 3U9MA 2R7UA 2J7PD 4EBJA 1BDJB 1RKCA 2IXOA 4LLCA 1ORSC 1EI7A 1SR2A 1ST6A 4N4WA 4Z9HA 1O3UA 1OCCC 3KL4A 2YVKA 3Q6MA 3V7OA 2EPOA 3C8GB 4JKVA 2R03A 2YRFA 3C8GD 1YA7O 3GANA 1C17M 2DGJA 3AGUA 4OIPF 1CGME 4EBKA 2GAQA 2HFIA 5D91A 5BQGA 3EZIA 3JRMO 2KQ9A 3SEOA 2XLHA 3QW0A 4MNDA 4W8PA 4ER9A 2Q9BA 1R4TA 1V54C 5E3CA 5B1AC 1ZU5A 3ZVRA 1QQ3A 2E87A 2VCAA 5EHHA 2VASA 2A0UA 1RJ9B 4P9FA 4X0RA 1OW8A 2XRHA 3SYNA 3SXYA 4CDYA 4CS8A 3ZTMA 5L0GA 4Z9IA 4MVSA 2J9BA 1Z63A 3EHMA 5DVWA 2XLMA 3S0XA 4CSAC 4JZAA 2P61A 4WABA 4Q4ZF 4O7GA 3RW0A 3BEHA 3GEIA 1EQ1A 1OCRC 2AWYA 2YKZA 4E0HA 1SZIA 2OJED 3TOLA 4ANJA 2WZFA 1D0XA 4JTDB 3B0UX 2KGOA 1WOLA 4PK4A 1GQAA 3U5SA 1ZHWA 2WB7A 4DVZA 3AG3C 4IGGA 4DVYP 5A6KA 4E18A 1LKXA 3T4RA 3WHNA 4B6IA 4AL1A 5B1BC 4CJOA 4E0IA 3GODA 3K1IA 2QUPA 3ABKC 1WTYA 3Q7LA 4XEVA 3ZIBA 1G4WR 2R7OA 3Q7GA 4LACB 2LCHA 2CNWA 3EFOA 4C7OA 2RD9A 3BRJA 2NUPB 1BZ4A 2GFHA 3C7JA 2A69F 3S84A 3W4YA 4AK9A 3HNLA 2J46A 3LS0A 2Y39A 5A6JA 3NRHA 4NC3A 3ITFA 4XTKA 1UG7A 3DXJF 4YN0B 2FAPB 1QSPA 4C3EA 1K04A 3FAJA 3G4XA 1Y6DA 4XPWA 4YWQA 3W2VA 3GWNA 5GPGB 2Y3GA 2A6HF 3VF0A 2HUJA 3ASNC 3H2UA 1LI7A 1OXBA 2J8WA 1VYIA 5EK0A 3S28A 5DQTA 1YA9A 2XM0A 2J9VA 3UMHA 3K1HA 3L34A 3RIPA 5A6BA 2WVNA 4XPYA 4YL3A 1HE1A 4BJTA 3L8IA 4BJ1A 3ZQYA 4GYTA 2XLWA 4I3MA 5KYUA 3TD7A 2Q3TA 4CIHA 3NYJA 3FDQA 2IXNA 2GDCA 3HNJA 3WODF 4KNVA 2W9YA 3HKKA 2D4UA 4WGYA 4DOZA 3I5QA 3ZTZA 4N6CA 1NLXA 1Q0FA 3U2LA 1BBHA 1D0YA 2EINC 2XSEA 5CIVA 4ONSA 4U5DE 1TWAA 1JMWA 3ZG1A 3B0PA 1MNEA 5L0HA 1TWHA 2J7PA 2NUPA 3IQCA 3LUTB 4O6YA 5JP7A 1NSGB 1TFOB 5E2QA 1FFHA 1FR0A 3EH2A 1M6TA 1PV3A 5L0CA 1M56C 2IYLD 4JEBA 5A6BD 1XZQA 4YK5A 1CPRA 5COGA 2G62A 1RXQA 2YZSA 1Z5ZA 3M4CA 1ORYA 1Z6AA 5T3WA 5KYNA 5DS6A 4AE4A 1PD1A 3N24A 2OEVA 2QE9A 2WVOA 4DRIB 1ZHYA 3CQZA 2WZGA 4YT4A 3TOMA 3SXZA 1M2OA 1VK5A 2ASRA 3QTHA 5JS5A 1YYJA 2Q9AA 2MHRA 3O39A 1I5NA 3KKBA 4BJ5C 1ZW2A 4ZLCA 4PR9A 5CI9A 1CGNA 4OIQF 2H8AA 3T6GB 1WATA 1S7ZA 2ZXRA 4NTFA 2PF4E 4O6NA 5FCLA 4U9DA 3T9OA 4EKWA 5A69A 1MMGA 2QTVA 1D1BA 2F22A 1VMAA 2B0HA 2DI3A 3LEVA 2LD6A 3NKEA 5L0FA 4QI0A 4U5GA 2QLAA 2W4BA 3FXHA 4PFOA 1ZHTA 3T6BA 1HW1A 4IJJA 4MVRA 3KPHA 1I4YA 2R25A 2Q9CA 1KNYA 3DJUB 1AEPA 1FMVA 1OW7A 2JD3A 3G50A 3K1IC 5KYXB 2C03A 2R7XA 3DE8A 3L1MA 1EKYA 4NY3A 1K40A 1H7IA 2L6GA 3K33A 1I4ZA 1GGQA 4LDQA 1NFNA 2Q7RA 3FOOA 4M63A 4EWCA 2L6FA 3LLIA 5HV9A 1LIHA 1E84A 4N06A 2NSFA 3VYWA 3ZDLA 3TK0A 4U5EE 2HV6A 3PMRA 1M57C 3H2VA 1QVXA 4HFFB 1ZYRF 4PFPA 5B3SC 5BQIA 4P6IC 1DOWA 4XPXA 2V3CC 1A7VA 1E2XA 2VH3A 2Z15A 4YT2A 3VRCA 3G4ZA 4MQ9F 1LPEA 4JURI 2AVKA 4G7HF 3GM3A 1T9KA 3B0VC 5F28E 4BJ6A 4ULWA 3RKOF 4BJ6C 3N0TA 4KI2A 3UMIA 2ZXOA 4MS2A 4J32B 4K1OA 4OINF 3EGXB 1DOVA 2EIJC 3MYIA 5CI8A 2P0NA 2KW3C 4EBBA 5F5FA 2FGYA 2JX0A 2OJQA 2YL7A 3IPMO 4PJMA 4DRHB 1BR2A 3C8GA 5KYXA 3AG1C 3FHDA 1E86A 3UGOA 4G7OF 1TKNA 2L81A 2VC9A 2HJ3A 2XM4A 1V74B 3GM2A 4YT5A 3GORA 1VB5A 4CBEA 3ECSA 3O55A 4BEMJ 1GS9A 2J0WA 2CDQA 5T3TA 4BPMA 4JE9A 2Q4FA 2R7QA 1ZW3A 4ZLDA 1TWGA 4OIOF 1BR1A 1NG1A 2CNWD 2ZXWC 4PJJA 3CAXA 3CEXA 5T1DB 4CSAA 2A6EF 3NMIA 2XL6A 1HMOA 1U6HA 1YJGA 3C18A 4J30B 1NU7D 4JEAA 3UGPA 4Q5SF 2J9WA 1JAFA 2BC5A 1VLTA 4NTBA 3TQOA 5JT4A 3A11A 5AC4A 3DKAA 4AX2A 2NPUA 4DXWA 3I4UA 1FMWA 1F1MA 1BR4A 1WASA 3O10A 5AGFA 1O5HA 5BUOA 2NUTA 3RYLA 3PHF2 2YL0A 3GEHA 3JCUQ 2IXPA 3F47A 3L0IA 2L6HA 1S05A 2CW0F 1KU2A 1NFOA 2OEXA 4I1OB 3ZSUA 4C3DA 3U2MA 1XZPA 1OCOC 3PCVA 1VTMP 1HMDA 3EG9A 1ZVZA 4LDRA 4IB4A 5A6AA 3FOPA 3UMKA 2EPLX 1OXKA 1T01A 3JSZA 1QKRA 3M4BA 2AWCA 3A9CA 4PACA 3SXKA 2KYHA 5JLIA 4K0DA 2TMVP 4CS9C 5L3QA 4JJFA 4JCZA 3K6BA 3AQCA 2LIGA 1CGOA 1MNDA 2JPUA 1J8MF 2OKUA 3OA1A 4IRUA 4JCHA 3RFYA 2YL1A 3V5YA 4F4BA 1G5ZA 3HNKA 4MVZA 4G7ZF 1H9TA 3LNRA 5JUAA 2Y3DA 2L9JA 4FESA 3US6A 1IZMA 2QY9A 3GEEA 2IBFA 4EHPA 3V5XA 4RDAA 3HNIA 1B68A 4DRJB 1ZZPA 1PD0A 2G3KA 3S29A 4A4AA 2J9UA 1YVIA 3JTLO 4H54A 2OOCA 3EHNA 4XLPF 2NG1A 4MTOA 3W8HA 1AVOB 2AU5A 3NYMA 1WWPA 1E85A 2NSGA 1ZHZA 2EIKC 2I8BA 2PBEA 3KYJA 4XWJA 4NTAA 2XXAB 3HJCA 2LP4A 3C8ZA 2HZ8A 2LFFA 2R05A 1SF8A 4BG0A 1FNTc 2R9RB 1U89A 2EIMC 3NMJA 1LE4A 1D1AA 1VYKA 4FWVA 4MW3A 1YZAA 2CGEA 1RCPA 2H7OA 2H7BA 1OQCA 1OKKA 2O9XA 3ATPA 3IQ5A 3QMKA 3EJNA 4H4KC 4O6MA 5DS5A 1V55C 1LS1A 4Z9JA 3DAFA 3MYFA 2HJMA 3LNMB 3B71A 4HE8D 4D4NA 2HSBA 1A7DA 1HE9A 4MTFA 5B3IA 4JTCB 1APCA 3RVZA 3TJ5A 5DLJA 2OG2A 4QDLA 2P7VA 2DYRC 5IY5C 1J8YF 2LQGA 4RD9A 3UR3C 4HEAJ 4CX9A 3NDBB 4PJLA 1C02A 3U8VA 4W8KA 2HS5A 2PP4A 3RQFA 4CS9A 3HTKC 4R32A 4CDVA 1GM5A 3AOUA 3EG9B 3MLGA 4U5BE 3CSKA 3EFOB 4C7OB 2M4EA 3X2QC 2LK4A 2MYSA 4RBNA 3WG7C 3EZHA 1QPUA 3MX3A 4LLEA 3RQEA 3S9OA 3NMKA 3QW1A 5BQHA 1JRAA 3RH3A 4XQ1A 3MBGA 2M64A 1MMNA 3M15A 1N1CA 1OKKD 2AP3A 3FMSA 2XS8A 2EILC 4C3BA 3WAQA 5KYYB 1UFBA 2YLGA 4IAQA 4MVQA 2J45A 1T6UA 4BJ5A 4E17A 3UNGC 3KH2A 4OD5A 4XEFA 3J06A 1M2VB 1V4AA 4U9EA 3JRTA 1MMAA 5L0IA 3O6XA 3POVA 1RJ9A 4MVMA 2HKVA 4D4XA 2CCYA 1PCXA 2P6VA 3DZAA 2KSFA 2XL8A 5EGYA 2V26A 1W2WA 1QLEC 1JPJA 1LS4A 1M2VA 5KYWA 3TULA 256BA 3EPVA 1MQVA 1TFKB 3GWLA 3LJBA 2LSEA 5JSLA 4CDAA 4MW8A 3U8PA 4AE4B 1Y4CA 2DYSC 4YL1A 1LI5A 3B9QA 1JPNA 3ABMC 3C62A 5JVEA 3K7DA 4KNWA 1JOGA 1IW7F 3HLZA 4JC7A 5JRAA 2GWWA 2WZLA 2KC3A 1R5ID 2I15A 1OCZC 1SYQA 3DD7A 4P9TA 2W45A 1Z3IX 1A41A 3EGDB 1HW2A 4K7BA 1O87A 1H9GA 1L3PA 3IEEA 3GM1A 3EGXA 4U5HA 3F46A 3V5ZA 3U0CA 2Y69C 5E3AA 1Q0MA 4WGZA 4NQFA 2NUTB 4U5FE 2OU6A 1FAPB 1T6IA 4XLNF 2B0JA 2YLIA 2IXMA 1Q0KA 2OQMA
chains in the Genus database with same CATH topology
2HFIA 2IM8A 2ETSA 2HUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFI A;  2IM8 A;  2ETS A;  2HUJ A; 
#chains in the Genus database with same CATH topology
 2UUH A;  3DAG A;  4KC9 A;  4FAP B;  1TWC A;  3QZC A;  3JSE O;  4YT8 A;  2L7A A;  1EA8 A;  1QZX A;  4OIR F;  2XLE A;  2Y3H A;  1ZU4 A;  4BEJ A;  2X51 A;  4MVO A;  2XL4 A;  4IAO A;  1NZE A;  4N6H A;  3M1C B;  3FVY A;  4QI2 A;  4J7T A;  2PX0 A;  3SXM A;  5KYU B;  2D5R B;  4JJG A;  5TJ5 E;  3SNH A;  2PX3 A;  2RSE B;  1G4U S;  2GA0 A;  2R7S A;  3NYL A;  5E33 A;  4LER A;  3ZWI A;  5L0J A;  1T5O A;  4WJ0 A;  4MVU A;  2Q00 A;  3AG4 C;  2ETS A;  4IWB A;  4UDV A;  5K0I A;  3DE9 A;  3R2P A;  4FX5 A;  2VCC A;  2XXA A;  3N2Z B;  1Q0D A;  5L0D A;  1AUE A;  1SMY F;  3L8J A;  3K66 A;  3NG1 A;  1XWJ A;  4L6R A;  1Q0G A;  2HV7 A;  4XEK A;  1T6Q A;  3IQT A;  3JYH A;  1RKE A;  3LES A;  3QVZ A;  3B29 A;  3DM9 B;  4AL0 A;  2KJG A;  1MMD A;  5KYW B;  1H6G A;  2Y3B A;  2BE5 F;  4YJW A;  1TR2 A;  4JW1 A;  3VAY A;  3X1O A;  4DJ9 A;  3H65 A;  3R7C A;  3SZR A;  1WGW A;  4NCQ A;  5COM A;  3ZC4 A;  4A2N B;  2QNL A;  3DM5 A;  2HMQ A;  4LDK A;  4CS8 C;  5HSW A;  1E83 A;  1YZC A;  2A1D D;  4GEH A;  3LLK A;  4CIP A;  2PNO A;  4G78 A;  4OD4 A;  3S90 A;  3E70 C;  1YLM A;  4CS7 A;  3Q6N A;  3LS1 A;  4PJN A;  1OR3 A;  3NKD A;  2VB6 A;  4HFK B;  2WVQ A;  3C63 A;  3DI5 A;  4I44 A;  4Q7C A;  3EGD A;  4E7S A;  1K05 A;  2HSQ A;  3M79 A;  2ZD9 A;  2ZXP A;  4G0H A;  3JYY A;  2BL2 A;  1WN0 A;  3EH1 A;  2LFD A;  3I5P A;  4EUK B;  3JT1 A;  2PFD A;  4O79 A;  1D0Z A;  4ULV A;  2EPM X;  2UUI A;  2XLD A;  3OEO A;  3T6J A;  1KTM A;  3KYI A;  2DB4 A;  2EPN A;  4JIO A;  2A0B A;  3AQB A;  1CPQ A;  5COF A;  4GQH A;  3RVY A;  3ZQV A;  5DS4 A;  2R7W A;  5L3V A;  1ORJ A;  1YAU O;  1G8X A;  2R02 A;  2WL8 A;  3DJN B;  3PDM P;  2XLO A;  4IAR A;  1LM3 B;  2IOQ A;  2R7V A;  2W4M A;  1ZHX A;  1RMV A;  2P1A A;  5AC5 A;  1NBB A;  1TQG A;  2H7V C;  2KNH A;  1VLS A;  2OCC C;  4J7Y A;  3KMI A;  5FZT A;  3W8I A;  2CYD A;  5KYY A;  5DQZ A;  2ZPA A;  4DBQ A;  3RF3 A;  3RQG A;  3U3F A;  4JRZ A;  2MWQ A;  3ABL C;  1U0B B;  2YQY A;  3SP1 A;  4EIY A;  1JR8 A;  3CZ6 A;  2YWA A;  3AG2 C;  2R7T A;  1A0B A;  3S27 A;  2J0X A;  2R7R A;  2XLV A;  4U5C E;  1Z23 A;  3DMD A;  1Z7Q c;  1OR2 A;  2KK1 A;  1OW6 A;  3LEO A;  1LVK A;  3QVY A;  3FAP B;  1NU9 C;  2YEV A;  3DWW A;  2C04 A;  3W2W A;  3U9J A;  5F5H A;  3MFN A;  3AGT A;  3IHU A;  4KBL A;  2HMZ A;  4MTG A;  1YDI A;  1FTS A;  1YAR O;  3LAY A;  3VM6 A;  1HY5 A;  2XS1 A;  2YL3 A;  3ASO C;  5D92 A;  3TJ6 A;  3IQ6 A;  2EPK X;  4JTA B;  2VCB A;  1D1C A;  4I1M A;  2FFH A;  2G3V A;  4JVS A;  2ICW G;  2IM8 A;  3OWT A;  4DBR A;  3JZ0 A;  1RKE B;  4E7Z A;  4CJG A;  1YYX A;  1FFT C;  3U3B A;  4YL0 A;  2YLD A;  1VOM A;  2YHS A;  1LE2 A;  1A7E A;  3AJM A;  3E9V A;  3EQL F;  2X0C A;  1C03 A;  1L7C A;  2A68 F;  3U9M A;  2R7U A;  2J7P D;  4EBJ A;  1BDJ B;  1RKC A;  2IXO A;  4LLC A;  1ORS C;  1EI7 A;  1SR2 A;  1ST6 A;  4N4W A;  4Z9H A;  1O3U A;  1OCC C;  3KL4 A;  2YVK A;  3Q6M A;  3V7O A;  2EPO A;  3C8G B;  4JKV A;  2R03 A;  2YRF A;  3C8G D;  1YA7 O;  3GAN A;  1C17 M;  2DGJ A;  3AGU A;  4OIP F;  1CGM E;  4EBK A;  2GAQ A;  2HFI A;  5D91 A;  5BQG A;  3EZI A;  3JRM O;  2KQ9 A;  3SEO A;  2XLH A;  3QW0 A;  4MND A;  4W8P A;  4ER9 A;  2Q9B A;  1R4T A;  1V54 C;  5E3C A;  5B1A C;  1ZU5 A;  3ZVR A;  1QQ3 A;  2E87 A;  2VCA A;  5EHH A;  2VAS A;  2A0U A;  1RJ9 B;  4P9F A;  4X0R A;  1OW8 A;  2XRH A;  3SYN A;  3SXY A;  4CDY A;  4CS8 A;  3ZTM A;  5L0G A;  4Z9I A;  4MVS A;  2J9B A;  1Z63 A;  3EHM A;  5DVW A;  2XLM A;  3S0X A;  4CSA C;  4JZA A;  2P61 A;  4WAB A;  4Q4Z F;  4O7G A;  3RW0 A;  3BEH A;  3GEI A;  1EQ1 A;  1OCR C;  2AWY A;  2YKZ A;  4E0H A;  1SZI A;  2OJE D;  3TOL A;  4ANJ A;  2WZF A;  1D0X A;  4JTD B;  3B0U X;  2KGO A;  1WOL A;  4PK4 A;  1GQA A;  3U5S A;  1ZHW A;  2WB7 A;  4DVZ A;  3AG3 C;  4IGG A;  4DVY P;  5A6K A;  4E18 A;  1LKX A;  3T4R A;  3WHN A;  4B6I A;  4AL1 A;  5B1B C;  4CJO A;  4E0I A;  3GOD A;  3K1I A;  2QUP A;  3ABK C;  1WTY A;  3Q7L A;  4XEV A;  3ZIB A;  1G4W R;  2R7O A;  3Q7G A;  4LAC B;  2LCH A;  2CNW A;  3EFO A;  4C7O A;  2RD9 A;  3BRJ A;  2NUP B;  1BZ4 A;  2GFH A;  3C7J A;  2A69 F;  3S84 A;  3W4Y A;  4AK9 A;  3HNL A;  2J46 A;  3LS0 A;  2Y39 A;  5A6J A;  3NRH A;  4NC3 A;  3ITF A;  4XTK A;  1UG7 A;  3DXJ F;  4YN0 B;  2FAP B;  1QSP A;  4C3E A;  1K04 A;  3FAJ A;  3G4X A;  1Y6D A;  4XPW A;  4YWQ A;  3W2V A;  3GWN A;  5GPG B;  2Y3G A;  2A6H F;  3VF0 A;  2HUJ A;  3ASN C;  3H2U A;  1LI7 A;  1OXB A;  2J8W A;  1VYI A;  5EK0 A;  3S28 A;  5DQT A;  1YA9 A;  2XM0 A;  2J9V A;  3UMH A;  3K1H A;  3L34 A;  3RIP A;  5A6B A;  2WVN A;  4XPY A;  4YL3 A;  1HE1 A;  4BJT A;  3L8I A;  4BJ1 A;  3ZQY A;  4GYT A;  2XLW A;  4I3M A;  5KYU A;  3TD7 A;  2Q3T A;  4CIH A;  3NYJ A;  3FDQ A;  2IXN A;  2GDC A;  3HNJ A;  3WOD F;  4KNV A;  2W9Y A;  3HKK A;  2D4U A;  4WGY A;  4DOZ A;  3I5Q A;  3ZTZ A;  4N6C A;  1NLX A;  1Q0F A;  3U2L A;  1BBH A;  1D0Y A;  2EIN C;  2XSE A;  5CIV A;  4ONS A;  4U5D E;  1TWA A;  1JMW A;  3ZG1 A;  3B0P A;  1MNE A;  5L0H A;  1TWH A;  2J7P A;  2NUP A;  3IQC A;  3LUT B;  4O6Y A;  5JP7 A;  1NSG B;  1TFO B;  5E2Q A;  1FFH A;  1FR0 A;  3EH2 A;  1M6T A;  1PV3 A;  5L0C A;  1M56 C;  2IYL D;  4JEB A;  5A6B D;  1XZQ A;  4YK5 A;  1CPR A;  5COG A;  2G62 A;  1RXQ A;  2YZS A;  1Z5Z A;  3M4C A;  1ORY A;  1Z6A A;  5T3W A;  5KYN A;  5DS6 A;  4AE4 A;  1PD1 A;  3N24 A;  2OEV A;  2QE9 A;  2WVO A;  4DRI B;  1ZHY A;  3CQZ A;  2WZG A;  4YT4 A;  3TOM A;  3SXZ A;  1M2O A;  1VK5 A;  2ASR A;  3QTH A;  5JS5 A;  1YYJ A;  2Q9A A;  2MHR A;  3O39 A;  1I5N A;  3KKB A;  4BJ5 C;  1ZW2 A;  4ZLC A;  4PR9 A;  5CI9 A;  1CGN A;  4OIQ F;  2H8A A;  3T6G B;  1WAT A;  1S7Z A;  2ZXR A;  4NTF A;  2PF4 E;  4O6N A;  5FCL A;  4U9D A;  3T9O A;  4EKW A;  5A69 A;  1MMG A;  2QTV A;  1D1B A;  2F22 A;  1VMA A;  2B0H A;  2DI3 A;  3LEV A;  2LD6 A;  3NKE A;  5L0F A;  4QI0 A;  4U5G A;  2QLA A;  2W4B A;  3FXH A;  4PFO A;  1ZHT A;  3T6B A;  1HW1 A;  4IJJ A;  4MVR A;  3KPH A;  1I4Y A;  2R25 A;  2Q9C A;  1KNY A;  3DJU B;  1AEP A;  1FMV A;  1OW7 A;  2JD3 A;  3G50 A;  3K1I C;  5KYX B;  2C03 A;  2R7X A;  3DE8 A;  3L1M A;  1EKY A;  4NY3 A;  1K40 A;  1H7I A;  2L6G A;  3K33 A;  1I4Z A;  1GGQ A;  4LDQ A;  1NFN A;  2Q7R A;  3FOO A;  4M63 A;  4EWC A;  2L6F A;  3LLI A;  5HV9 A;  1LIH A;  1E84 A;  4N06 A;  2NSF A;  3VYW A;  3ZDL A;  3TK0 A;  4U5E E;  2HV6 A;  3PMR A;  1M57 C;  3H2V A;  1QVX A;  4HFF B;  1ZYR F;  4PFP A;  5B3S C;  5BQI A;  4P6I C;  1DOW A;  4XPX A;  2V3C C;  1A7V A;  1E2X A;  2VH3 A;  2Z15 A;  4YT2 A;  3VRC A;  3G4Z A;  4MQ9 F;  1LPE A;  4JUR I;  2AVK A;  4G7H F;  3GM3 A;  1T9K A;  3B0V C;  5F28 E;  4BJ6 A;  4ULW A;  3RKO F;  4BJ6 C;  3N0T A;  4KI2 A;  3UMI A;  2ZXO A;  4MS2 A;  4J32 B;  4K1O A;  4OIN F;  3EGX B;  1DOV A;  2EIJ C;  3MYI A;  5CI8 A;  2P0N A;  2KW3 C;  4EBB A;  5F5F A;  2FGY A;  2JX0 A;  2OJQ A;  2YL7 A;  3IPM O;  4PJM A;  4DRH B;  1BR2 A;  3C8G A;  5KYX A;  3AG1 C;  3FHD A;  1E86 A;  3UGO A;  4G7O F;  1TKN A;  2L81 A;  2VC9 A;  2HJ3 A;  2XM4 A;  1V74 B;  3GM2 A;  4YT5 A;  3GOR A;  1VB5 A;  4CBE A;  3ECS A;  3O55 A;  4BEM J;  1GS9 A;  2J0W A;  2CDQ A;  5T3T A;  4BPM A;  4JE9 A;  2Q4F A;  2R7Q A;  1ZW3 A;  4ZLD A;  1TWG A;  4OIO F;  1BR1 A;  1NG1 A;  2CNW D;  2ZXW C;  4PJJ A;  3CAX A;  3CEX A;  5T1D B;  4CSA A;  2A6E F;  3NMI A;  2XL6 A;  1HMO A;  1U6H A;  1YJG A;  3C18 A;  4J30 B;  1NU7 D;  4JEA A;  3UGP A;  4Q5S F;  2J9W A;  1JAF A;  2BC5 A;  1VLT A;  4NTB A;  3TQO A;  5JT4 A;  3A11 A;  5AC4 A;  3DKA A;  4AX2 A;  2NPU A;  4DXW A;  3I4U A;  1FMW A;  1F1M A;  1BR4 A;  1WAS A;  3O10 A;  5AGF A;  1O5H A;  5BUO A;  2NUT A;  3RYL A;  3PHF 2;  2YL0 A;  3GEH A;  3JCU Q;  2IXP A;  3F47 A;  3L0I A;  2L6H A;  1S05 A;  2CW0 F;  1KU2 A;  1NFO A;  2OEX A;  4I1O B;  3ZSU A;  4C3D A;  3U2M A;  1XZP A;  1OCO C;  3PCV A;  1VTM P;  1HMD A;  3EG9 A;  1ZVZ A;  4LDR A;  4IB4 A;  5A6A A;  3FOP A;  3UMK A;  2EPL X;  1OXK A;  1T01 A;  3JSZ A;  1QKR A;  3M4B A;  2AWC A;  3A9C A;  4PAC A;  3SXK A;  2KYH A;  5JLI A;  4K0D A;  2TMV P;  4CS9 C;  5L3Q A;  4JJF A;  4JCZ A;  3K6B A;  3AQC A;  2LIG A;  1CGO A;  1MND A;  2JPU A;  1J8M F;  2OKU A;  3OA1 A;  4IRU A;  4JCH A;  3RFY A;  2YL1 A;  3V5Y A;  4F4B A;  1G5Z A;  3HNK A;  4MVZ A;  4G7Z F;  1H9T A;  3LNR A;  5JUA A;  2Y3D A;  2L9J A;  4FES A;  3US6 A;  1IZM A;  2QY9 A;  3GEE A;  2IBF A;  4EHP A;  3V5X A;  4RDA A;  3HNI A;  1B68 A;  4DRJ B;  1ZZP A;  1PD0 A;  2G3K A;  3S29 A;  4A4A A;  2J9U A;  1YVI A;  3JTL O;  4H54 A;  2OOC A;  3EHN A;  4XLP F;  2NG1 A;  4MTO A;  3W8H A;  1AVO B;  2AU5 A;  3NYM A;  1WWP A;  1E85 A;  2NSG A;  1ZHZ A;  2EIK C;  2I8B A;  2PBE A;  3KYJ A;  4XWJ A;  4NTA A;  2XXA B;  3HJC A;  2LP4 A;  3C8Z A;  2HZ8 A;  2LFF A;  2R05 A;  1SF8 A;  4BG0 A;  1FNT c;  2R9R B;  1U89 A;  2EIM C;  3NMJ A;  1LE4 A;  1D1A A;  1VYK A;  4FWV A;  4MW3 A;  1YZA A;  2CGE A;  1RCP A;  2H7O A;  2H7B A;  1OQC A;  1OKK A;  2O9X A;  3ATP A;  3IQ5 A;  3QMK A;  3EJN A;  4H4K C;  4O6M A;  5DS5 A;  1V55 C;  1LS1 A;  4Z9J A;  3DAF A;  3MYF A;  2HJM A;  3LNM B;  3B71 A;  4HE8 D;  4D4N A;  2HSB A;  1A7D A;  1HE9 A;  4MTF A;  5B3I A;  4JTC B;  1APC A;  3RVZ A;  3TJ5 A;  5DLJ A;  2OG2 A;  4QDL A;  2P7V A;  2DYR C;  5IY5 C;  1J8Y F;  2LQG A;  4RD9 A;  3UR3 C;  4HEA J;  4CX9 A;  3NDB B;  4PJL A;  1C02 A;  3U8V A;  4W8K A;  2HS5 A;  2PP4 A;  3RQF A;  4CS9 A;  3HTK C;  4R32 A;  4CDV A;  1GM5 A;  3AOU A;  3EG9 B;  3MLG A;  4U5B E;  3CSK A;  3EFO B;  4C7O B;  2M4E A;  3X2Q C;  2LK4 A;  2MYS A;  4RBN A;  3WG7 C;  3EZH A;  1QPU A;  3MX3 A;  4LLE A;  3RQE A;  3S9O A;  3NMK A;  3QW1 A;  5BQH A;  1JRA A;  3RH3 A;  4XQ1 A;  3MBG A;  2M64 A;  1MMN A;  3M15 A;  1N1C A;  1OKK D;  2AP3 A;  3FMS A;  2XS8 A;  2EIL C;  4C3B A;  3WAQ A;  5KYY B;  1UFB A;  2YLG A;  4IAQ A;  4MVQ A;  2J45 A;  1T6U A;  4BJ5 A;  4E17 A;  3UNG C;  3KH2 A;  4OD5 A;  4XEF A;  3J06 A;  1M2V B;  1V4A A;  4U9E A;  3JRT A;  1MMA A;  5L0I A;  3O6X A;  3POV A;  1RJ9 A;  4MVM A;  2HKV A;  4D4X A;  2CCY A;  1PCX A;  2P6V A;  3DZA A;  2KSF A;  2XL8 A;  5EGY A;  2V26 A;  1W2W A;  1QLE C;  1JPJ A;  1LS4 A;  1M2V A;  5KYW A;  3TUL A;  256B A;  3EPV A;  1MQV A;  1TFK B;  3GWL A;  3LJB A;  2LSE A;  5JSL A;  4CDA A;  4MW8 A;  3U8P A;  4AE4 B;  1Y4C A;  2DYS C;  4YL1 A;  1LI5 A;  3B9Q A;  1JPN A;  3ABM C;  3C62 A;  5JVE A;  3K7D A;  4KNW A;  1JOG A;  1IW7 F;  3HLZ A;  4JC7 A;  5JRA A;  2GWW A;  2WZL A;  2KC3 A;  1R5I D;  2I15 A;  1OCZ C;  1SYQ A;  3DD7 A;  4P9T A;  2W45 A;  1Z3I X;  1A41 A;  3EGD B;  1HW2 A;  4K7B A;  1O87 A;  1H9G A;  1L3P A;  3IEE A;  3GM1 A;  3EGX A;  4U5H A;  3F46 A;  3V5Z A;  3U0C A;  2Y69 C;  5E3A A;  1Q0M A;  4WGZ A;  4NQF A;  2NUT B;  4U5F E;  2OU6 A;  1FAP B;  1T6I A;  4XLN F;  2B0J A;  2YLI A;  2IXM A;  1Q0K A;  2OQM A; 
#chains in the Genus database with same CATH homology
 2HFI A;  2IM8 A;  2ETS A;  2HUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...