2W9YA

The structure of the lipid binding protein ce-far-7 from caenorhabditis elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
135
Chain Sequence
GAMSVASLPEVKNFFPTEQLEFSSSITADEKPVLHEVFQKHSCGEMIDEVSKKHPELGKRLATVLEGNKKRLDGLSPAAVEYAKKLIHMVTTTLCSLTVGKPIDDADAKRLHQEFQSLSSEDQAALRKNNPDIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID/RETINOL BINDING PROTEIN PROTEIN 7, ISOFORM A, CON
publication title Fatty Acid and Retinoid Binding Proteins Have Distinct Binding Pockets for the Two Types of Cargo
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Lipid transport
total genus 52
structure length 135
sequence length 140
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05823 Gp-FAR-1 Nematode fatty acid retinoid binding protein (Gp-FAR-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1100 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w9yA00
2W9YA
chains in the Genus database with same CATH superfamily
3DM9B 3RVZA 4JTCB 2GFHA 3ECSA 3K1IC 2NG1A 4FAPB 1LPEA 4LDRA 2ZD9A 4XEKA 4AE4B 1SF8A 2YL7A 4CS9C 4DVZA 1BDJB 4O79A 1C17M 2XS1A 3AG4C 3WAQA 5A6AA 2A68F 4YT2A 2L6HA 5KYWB 3KYJA 2LSEA 2KJGA 3RQGA 3ZQVA 1EA8A 4MTFA 4NTAA 2LQGA 4OD4A 5AC5A 3AG3C 3C8GB 3EGXA 4FESA 3VYWA 1NFNA 2NUPB 5COGA 1D1CA 5T3WA 2A6EF 4CJGA 5B3IA 4OINF 3RQEA 5L3VA 5A6BD 3HLZA 4DVYP 1OR3A 1JMWA 4YL0A 3GANA 1CPRA 1LE2A 256BA 5BQHA 3T4RA 4KNWA 4X0RA 4N06A 2D5RB 4RBNA 1JRAA 2XXAA 4YT5A 1M2OA 2AVKA 2A0UA 4AL1A 2EIJC 4WABA 4OD5A 1S05A 2UUIA 4BEMJ 4OIQF 3HNJA 3IHUA 1ORJA 4OIRF 1HE9A 3PCVA 3R2PA 3EFOB 3GWLA 2YWAA 3ASOC 4YWQA 3UMHA 4XEFA 4BJ5C 1FMWA 3DM5A 3IQ6A 2XM4A 3L8JA 2RSEB 3ZSUA 3S29A 1VYKA 2XRHA 5F5HA 5EGYA 3TULA 3TJ6A 4A2NB 2HUJA 1ZHTA 2VB6A 4KNVA 2L81A 1ZU4A 2Q7RA 5EHHA 3BEHA 3NMKA 1AEPA 1WTYA 3L0IA 5AC4A 1VTMP 3ZG1A 1JAFA 3F47A 2GWWA 2HFIA 1OW8A 2OEXA 3UGOA 2OCCC 3B71A 1Q0KA 2YVKA 3KKBA 1RJ9B 4CJOA 3UMIA 2QLAA 4MTGA 2HS5A 5BUOA 2YZSA 4BJ6A 5B3SC 1NZEA 1T9KA 3MYIA 2PP4A 3ZWIA 3JT1A 3O10A 4CDYA 1JOGA 3F46A 3M1CB 4E7ZA 1FFTC 1Y4CA 3U3FA 1MNEA 4MS2A 4BG0A 1KNYA 3JTLO 3KH2A 3LLKA 5D91A 1YDIA 1YLMA 4JKVA 2RD9A 4FWVA 2F22A 3Q7LA 3NYLA 1NG1A 2L6GA 3U9MA 1E86A 5EK0A 2Q9BA 1VMAA 2O9XA 3EZHA 4MVQA 2EPLX 1FNTc 2DB4A 2YL1A 1O3UA 3IQTA 4MNDA 3U9JA 1T6UA 3JYHA 5DS4A 1GM5A 4WGZA 4E7SA 1UFBA 1OCCC 3RF3A 3UMKA 1IZMA 2R7OA 2R7WA 2LCHA 2PF4E 3U5SA 1VYIA 2WZLA 4MW3A 3DD7A 3S90A 1EQ1A 3A11A 3RVYA 3O55A 3DKAA 1UG7A 4U5HA 2J7PA 4DRJB 4XLPF 1QQ3A 2LP4A 2W4BA 1QLEC 2Y3GA 3AQBA 3CZ6A 4XLNF 2AWYA 3VM6A 3CSKA 1MNDA 3QW1A 2EPOA 1CGOA 4RDAA 1NFOA 3FHDA 1ORYA 2LFFA 3EPVA 3AJMA 4G78A 4JCHA 1V54C 3M15A 1DOVA 1H7IA 1PD0A 4GQHA 1BR4A 2XLMA 3L8IA 5F28E 1MMNA 3JSEO 4N6CA 2YL3A 2CNWD 3PMRA 1O5HA 2PX3A 4BJ5A 4OIOF 4JEAA 5DS6A 3A9CA 1M2VB 1M57C 2J9VA 2PX0A 4BEJA 4E0IA 5CIVA 1HY5A 4XEVA 1I4YA 1MQVA 4Z9JA 1SR2A 3S0XA 2R7UA 3OWTA 2OU6A 3ABKC 4D4XA 4XPWA 3EG9B 4QDLA 5A6JA 2KYHA 4MVMA 1O87A 2A1DD 1R5ID 3NKDA 4U5DE 2WZFA 3B0VC 2J8WA 2IXNA 4NCQA 1I4ZA 2WVOA 2Y39A 2YHSA 4J7TA 3U8PA 3KYIA 5L0DA 2W45A 3GEIA 1RMVA 1OQCA 1V4AA 2EPKX 3HNKA 5L0IA 1FFHA 4XWJA 4CDVA 4NY3A 4EHPA 5L0CA 1G4WR 3I4UA 1Q0GA 3VRCA 2L6FA 4Q4ZF 3FOPA 4B6IA 1VB5A 3E70C 3HTKC 4LERA 3FAPB 4BJ1A 1M6TA 2QY9A 5DVWA 2HSBA 1BR1A 1LS1A 2ZPAA 4LLEA 4P9FA 3W4YA 4DBQA 2J9WA 4I1MA 4Z9HA 2VCCA 3Q6NA 3TJ5A 1ZHZA 1HMDA 5L0FA 3RKOF 3K66A 2XLHA 4MVSA 1TFOB 4XTKA 3ITFA 2Y69C 4U5EE 5HSWA 3SP1A 2Y3BA 1OKKA 3N2ZB 3U8VA 1NBBA 2L9JA 2XL6A 2E87A 2V3CC 3DZAA 1GS9A 2LD6A 3G4ZA 1L3PA 4KC9A 2P6VA 2JPUA 2WL8A 3RH3A 5BQIA 1HMOA 2NUTA 2HV7A 4JURI 3NRHA 3FVYA 1IW7F 5KYXA 4Q7CA 2OJQA 3K33A 4AK9A 1FR0A 3FXHA 1LVKA 4IAQA 5JVEA 4E18A 3DI5A 2H7VC 3NMIA 1HW2A 3DJNB 3G4XA 2Z15A 4G7HF 3CEXA 4OIPF 2EINC 2KQ9A 3FMSA 4W8PA 2P7VA 4F4BA 3M4BA 4UDVA 2EIMC 3ZIBA 3GM3A 3WG7C 4DOZA 5JRAA 5E33A 1OCOC 4EBJA 3NKEA 3V5XA 1A0BA 2J0XA 3GEEA 3DMDA 1H9TA 3LS1A 3QVYA 1OR2A 1ZYRF 3I5PA 4YT4A 4C7OB 1A7DA 2KGOA 3U3BA 1TWGA 3DAGA 1WN0A 4JRZA 4NTBA 3FDQA 2J9UA 2XM0A 3GM2A 4QI0A 1EI7A 2DYSC 3EGDB 2NSFA 3QVZA 2R03A 3V5YA 2HSQA 4MVZA 3SXMA 5KYYA 4QI2A 2PNOA 1MMDA 1JR8A 1K05A 4J30B 2Q4FA 2XS8A 1S7ZA 5A69A 3ZC4A 2KW3C 2G62A 1T5OA 4MW8A 1CPQA 1FMVA 4JIOA 3N0TA 1TR2A 4ONSA 4JJFA 2G3VA 1E83A 3ABMC 4JZAA 4O7GA 1WWPA 1ZHWA 2MHRA 2OQMA 2Q00A 1YAUO 3POVA 5KYUB 1XWJA 3R7CA 4IB4A 5A6KA 1RKEB 3W2VA 4YT8A 4O6MA 1ZU5A 3WHNA 1Z23A 2M4EA 1BR2A 1LI5A 2CYDA 3C8GA 4EKWA 2L7AA 2NUPA 2R7RA 3NYMA 3UNGC 2YQYA 3EJNA 4Q5SF 1TWAA 2FFHA 3HNLA 1ZHYA 2TMVP 4CSAA 3NMJA 2B0JA 2AU5A 1JPNA 2YRFA 3AOUA 3C8ZA 1YJGA 3HKKA 3LLIA 3LS0A 3QTHA 4MQ9F 2BL2A 5AGFA 1KU2A 4CIHA 3JRMO 1T01A 3O39A 3QZCA 2AWCA 4KBLA 4IJJA 1LIHA 4HEAJ 4J7YA 4E0HA 3EH2A 3K1HA 4U5FE 4U5GA 2QUPA 4W8KA 3LEVA 3MX3A 1T6QA 2GDCA 1LM3B 4BJTA 1D0ZA 1FTSA 2ASRA 3EFOA 1Y6DA 2YLGA 4JEBA 1AUEA 1SYQA 3AG2C 3US6A 3IQ5A 4ULVA 4HFKB 3RIPA 3ZTZA 1GQAA 2ETSA 2J7PD 1Q0MA 2PBEA 2QE9A 3ASNC 4MTOA 4ULWA 4Z9IA 3B0UX 1HE1A 2DYRC 5B1AC 2DI3A 2W9YA 3IPMO 3K6BA 1MMGA 4NTFA 3TK0A 4A4AA 5IY5C 1JPJA 3TQOA 1NU9C 5K0IA 1KTMA 2VCAA 4XPXA 1YVIA 2OEVA 2X0CA 1LS4A 3AQCA 1YA7O 3EQLF 3S84A 1YARO 3JZ0A 3NG1A 5DS5A 1QZXA 2VCBA 2LFDA 1ZW3A 3SNHA 3DAFA 5FCLA 1VK5A 1RJ9A 3JRTA 3S28A 1CGNA 2R25A 2V26A 1J8YF 2R02A 1QSPA 4C3BA 4CS8C 1TFKB 2OG2A 2IXMA 4YL3A 2LIGA 2XL8A 2CNWA 2J46A 3C62A 4M63A 1CGME 5JLIA 3PDMP 4C3EA 1ZZPA 3IEEA 3PHF2 3EGXB 4PFOA 1G5ZA 1RKCA 4EIYA 1EKYA 2J0WA 4PJLA 2CGEA 1Q0FA 4I1OB 4DRHB 2YL0A 4WGYA 4YN0B 3EH1A 4N6HA 2A6HF 2HMZA 3S27A 1T6IA 4CX9A 4J32B 1E85A 2R7SA 1XZQA 2H8AA 2D4UA 3RQFA 1ZVZA 4JE9A 5GPGB 4CIPA 1WATA 3SXKA 4GEHA 2FGYA 1K40A 2UUHA 2XXAB 2JX0A 4XQ1A 2R7XA 4U9EA 2IOQA 2M64A 4PJMA 1V55C 3GEHA 3ZDLA 2HZ8A 2ZXPA 3ABLC 2VH3A 1C02A 3L34A 4MVOA 4ZLDA 1PV3A 2GA0A 2QTVA 2HJ3A 2XLWA 3H2VA 3LAYA 4G7ZF 3AGUA 3O6XA 3FOOA 3X1OA 2WVNA 2KK1A 1ORSC 4U5BE 4DBRA 4K1OA 4FX5A 1ZW2A 2XLDA 4HE8D 3LJBA 4ER9A 4CSAC 1SMYF 5HV9A 4N4WA 4EBKA 2GAQA 2IXPA 2R7QA 2Q3TA 1WOLA 1OKKD 2YLDA 3K7DA 4P9TA 4WJ0A 3T9OA 4PJJA 1I5NA 3W2WA 1OXBA 1Z6AA 1Z5ZA 3MBGA 2MYSA 3KL4A 1A7VA 1M2VA 5DLJA 1Q0DA 2BE5F 4H54A 1D1AA 3E9VA 1J8MF 3ZVRA 2B0HA 2WZGA 3NDBB 1OCZC 3U2LA 3EG9A 3H2UA 2IYLD 3QW0A 5JS5A 2H7OA 3W8HA 1A41A 1YA9A 1YYXA 4GYTA 5L0GA 3J06A 5A6BA 2P61A 3DJUB 2DGJA 3SEOA 5F5FA 4IWBA 4C3DA 1G4US 1NSGB 1FAPB 1W2WA 4CS8A 3LNRA 2J9BA 4O6YA 2XLVA 3W8IA 3LNMB 4PACA 2H7BA 3GORA 5L0HA 1D0XA 1ST6A 4RD9A 1RXQA 5JT4A 2YLIA 5JP7A 3TD7A 4JW1A 3RW0A 4D4NA 2HKVA 3DE8A 3M79A 1E2XA 3JCUQ 3FAJA 4JJGA 2YKZA 2EPNA 3Q6MA 5CI8A 2OOCA 2IM8A 4CS7A 4EBBA 3KPHA 4L6RA 3ZQYA 1QPUA 1WASA 4HFFB 4JCZA 3ZTMA 2OKUA 3U0CA 1Z3IX 2P1AA 3T6JA 3V5ZA 5E2QA 3M4CA 3KMIA 4AE4A 3MYFA 2R05A 4I3MA 2R7TA 1GGQA 5T1DB 2MWQA 3UR3C 3Q7GA 3LEOA 5KYWA 2W4MA 3RFYA 2ICWG 5COMA 1TQGA 4I44A 1LE4A 3SXYA 3SZRA 4IGGA 5DQZA 4E17A 1L7CA 2X51A 4G0HA 2R7VA 2HJMA 3I5QA 3MFNA 4LDKA 4JVSA 4MVRA 4CDAA 2IBFA 4YL1A 3SXZA 2KNHA 1D1BA 3EHNA 1VLTA 2BC5A 4PK4A 3V7OA 2PFDA 4PR9A 1LI7A 3C8GD 3AGTA 2NSGA 3TOLA 3G50A 3DWWA 3SYNA 2CW0F 5CI9A 4DXWA 1OW6A 1TKNA 1VLSA 1WGWA 2Q9CA 4JTDB 1VOMA 5E3AA 3B0PA 3DE9A 4G7OF 1H6GA 2Y3DA 4H4KC 3WODF 4CBEA 1R4TA 3VF0A 2A69F 3K1IA 4MVUA 1PCXA 4C7OA 2XLOA 4CS9A 1C03A 3C63A 2ZXOA 3HNIA 4LLCA 3EGDA 2ZXRA 3AG1C 2OJED 4PJNA 4ZLCA 5JUAA 1H9GA 1OCRC 3L1MA 1DOWA 2QNLA 2XSEA 4IARA 1MMAA 4BPMA 3CQZA 1QVXA 1Z63A 1AVOB 1RCPA 3H65A 3GODA 4NC3A 5FZTA 1U0BB 1N1CA 2KSFA 1APCA 2JD3A 1HW1A 3OEOA 2R9RB 4JC7A 1BZ4A 1F1MA 2ZXWC 5T3TA 1M56C 3X2QC 2XL4A 3LESA 1OXKA 1PD1A 2HMQA 3B29A 1TWCA 4IAOA 3C18A 3B9QA 3T6BA 3MLGA 4IRUA 5D92A 4R32A 1V74B 2C03A 3RYLA 1QKRA 2I15A 2XLEA 4K0DA 2J45A 2VC9A 2NUTB 2WB7A 3DXJF 4PFPA 5KYUA 4AX2A 1RKEA 3BRJA 5KYXB 2KC3A 4DJ9A 2NPUA 4K7BA 5JSLA 4U9DA 2EIKC 3OA1A 3HJCA 5BQGA 3GM1A 3VAYA 5L3QA 1A7EA 4ANJA 2YEVA 4U5CE 4LACB 1ZHXA 1D0YA 2G3KA 4EUKB 5KYNA 3N24A 4LDQA 2C04A 3CAXA 3IQCA 1XZPA 4YJWA 3ATPA 3T6GB 3TOMA 1NLXA 2CCYA 1YYJA 1BBHA 4O6NA 1K04A 2EILC 4AL0A 1YZAA 2AP3A 4DRIB 2I8BA 2P0NA 4YK5A 3C7JA 1Z7Qc 1NU7D 1E84A 4KI2A 1YZCA 3QMKA 1OW7A 1TWHA 5DQTA 2A0BA 4JTAB 1G8XA 2Q9AA 2VASA 5COFA 5KYYB 3LUTB 1U89A 2Y3HA 4BJ6C 2CDQA 3NYJA 3JYYA 4XPYA 3GWNA 3EHMA 3U2MA 1B68A 5L0JA 4EWCA 2WVQA 2HV6A 3EZIA 5B1BC 1LKXA 2IXOA 2FAPB 1U6HA 5E3CA 2LK4A 4P6IC 5TJ5E 4NQFA 3UGPA 3S9OA 2EPMX 3JSZA 1SZIA
chains in the Genus database with same CATH topology
3DM9B 2GFHA 3ECSA 3K1IC 2NG1A 4AE4B 1SF8A 4CS9C 4DVZA 4O79A 3AG4C 2A68F 4YT2A 5KYWB 2LSEA 2KJGA 4OD4A 3AG3C 3EGXA 3VYWA 4FESA 2NUPB 5T3WA 1D1CA 2A6EF 4OINF 5L3VA 3HLZA 4DVYP 3GANA 3T4RA 4KNWA 4X0RA 4N06A 2D5RB 4RBNA 2XXAA 4YT5A 1M2OA 4OIQF 2EIJC 4OD5A 4OIRF 3EFOB 3ASOC 4YWQA 3UMHA 4BJ5C 1FMWA 3DM5A 3ZSUA 5EGYA 3S29A 1VYKA 2XRHA 5F5HA 4A2NB 1ZHTA 2VB6A 4KNVA 2L81A 1ZU4A 5EHHA 3L0IA 3ZG1A 3F47A 3UGOA 2OCCC 3KKBA 1RJ9B 3UMIA 5BUOA 2YZSA 4BJ6A 5B3SC 1NZEA 2PP4A 3JT1A 3M1CB 3F46A 4E7ZA 1FFTC 1MNEA 4BG0A 3KH2A 5D91A 3LLKA 4FWVA 3Q7LA 3NYLA 1NG1A 2Q9BA 1VMAA 2O9XA 3EZHA 4MNDA 3JYHA 5DS4A 1OCCC 3UMKA 1IZMA 2R7OA 2R7WA 2PF4E 1VYIA 2WZLA 3DD7A 4U5HA 2J7PA 4XLPF 2W4BA 3AQBA 1QLEC 2Y3GA 3CZ6A 4XLNF 3CSKA 1MNDA 4RDAA 3FHDA 3EPVA 4JCHA 1V54C 1PD0A 1BR4A 1MMNA 2CNWD 3PMRA 1O5HA 2PX3A 4BJ5A 4OIOF 5DS6A 1M2VB 1M57C 2J9VA 2PX0A 4BEJA 3S0XA 2R7UA 3OWTA 3ABKC 3EG9B 4QDLA 1O87A 2A1DD 3NKDA 4U5DE 3B0VC 2WZFA 2IXNA 2WVOA 2YHSA 2Y39A 2W45A 4XWJA 4NY3A 3I4UA 4Q4ZF 4B6IA 3E70C 3HTKC 4LERA 4BJ1A 5DVWA 2QY9A 1BR1A 1LS1A 2ZPAA 4LLEA 4DBQA 2J9WA 4I1MA 3Q6NA 1ZHZA 3RKOF 3K66A 4XTKA 3ITFA 2Y69C 4U5EE 5HSWA 3SP1A 2Y3BA 1OKKA 3N2ZB 2L9JA 2E87A 2V3CC 3DZAA 4KC9A 2P6VA 2WL8A 3RH3A 2NUTA 2HV7A 4JURI 3NRHA 3FVYA 1IW7F 5KYXA 4Q7CA 3K33A 4AK9A 1LVKA 2H7VC 3DJNB 2Z15A 4G7HF 2EINC 2KQ9A 4F4BA 2P7VA 2EIMC 3ZIBA 3WG7C 4DOZA 5E33A 1OCOC 3NKEA 2J0XA 3DMDA 3LS1A 1ZYRF 3I5PA 4YT4A 4C7OB 2KGOA 1TWGA 3DAGA 3FDQA 2J9UA 4QI0A 2DYSC 3EGDB 5KYYA 4QI2A 1MMDA 4J30B 1S7ZA 3ZC4A 2KW3C 2G62A 1FMVA 3N0TA 1TR2A 4JJFA 2G3VA 3ABMC 4JZAA 4O7GA 1ZHWA 3POVA 5KYUB 3W2VA 4YT8A 4O6MA 1ZU5A 1Z23A 2M4EA 1BR2A 2NUPA 2R7RA 3NYMA 3UNGC 4Q5SF 3EJNA 1TWAA 2FFHA 1ZHYA 4CSAA 2B0JA 1JPNA 3LS0A 4MQ9F 3LLIA 1KU2A 4CIHA 3O39A 3QZCA 4KBLA 4IJJA 4HEAJ 3EH2A 3K1HA 4U5FE 4U5GA 4W8KA 3LEVA 3MX3A 4BJTA 1D0ZA 1FTSA 3EFOA 3AG2C 4HFKB 3RIPA 4E7SA 2J7PD 4ULWA 3ASNC 3B0UX 2DYRC 5B1AC 2W9YA 3K6BA 4OIPF 1MMGA 5IY5C 1JPJA 1NU9C 3AQCA 3EQLF 3NG1A 5DS5A 1QZXA 3SNHA 3DAFA 5FCLA 1VK5A 1RJ9A 3JRTA 3S28A 2V26A 1J8YF 4CS8C 4C3BA 2OG2A 2IXMA 2CNWA 2J46A 4M63A 4C3EA 3IEEA 3PHF2 3EGXB 4PFOA 2J0WA 4PJLA 2CGEA 4I1OB 4YN0B 3EH1A 2A6HF 3S27A 2R7SA 4J32B 4GEHA 2FGYA 2XXAB 2R7XA 2IOQA 4PJMA 1V55C 2ZXPA 3ABLC 2VH3A 3L34A 4ZLDA 3LAYA 2QTVA 4G7ZF 3O6XA 3X1OA 2WVNA 4DBRA 4U5BE 4FX5A 4HE8D 3LJBA 4CSAC 1SMYF 2IXPA 2R7QA 2Q3TA 3K7DA 1OKKD 4WJ0A 4PJJA 3W2WA 1Z6AA 1Z5ZA 2MYSA 3KL4A 1M2VA 5DLJA 2BE5F 3ZVRA 1D1AA 3E9VA 1J8MF 2WZGA 3NDBB 1OCZC 3EG9A 2IYLD 2H7OA 3W8HA 4GYTA 3DJUB 2DGJA 3SEOA 5F5FA 4IWBA 4C3DA 1W2WA 4CS8A 3LNRA 4O6YA 3W8IA 2H7BA 1D0XA 1ST6A 4RD9A 3TD7A 4JW1A 3JCUQ 4JJGA 3FAJA 5CI8A 3Q6MA 4CS7A 4EBBA 4HFFB 1Z3IX 3T6JA 5E2QA 3KMIA 4AE4A 4I3MA 2R7TA 5T1DB 2MWQA 3UR3C 3Q7GA 5KYWA 2W4MA 3RFYA 4I44A 3SZRA 5DQZA 2X51A 4G0HA 2R7VA 3I5QA 4JVSA 2KNHA 1D1BA 3EHNA 4PK4A 3V7OA 2PFDA 3SYNA 2CW0F 5CI9A 1TKNA 1WGWA 2Q9CA 1VOMA 5E3AA 3B0PA 4G7OF 2Y3DA 4H4KC 3WODF 4CBEA 2A69F 1PCXA 4C7OA 4CS9A 2ZXOA 4LLCA 3EGDA 2ZXRA 3AG1C 4PJNA 4ZLCA 1OCRC 2XSEA 1MMAA 3CQZA 1Z63A 3H65A 3GODA 1N1CA 2JD3A 3OEOA 2ZXWC 5T3TA 1M56C 3X2QC 2XL4A 3LESA 1PD1A 1TWCA 4IAOA 3B9QA 3T6BA 3MLGA 4IRUA 5D92A 2C03A 3RYLA 4K0DA 2J45A 2WB7A 2NUTB 3DXJF 4PFPA 5KYUA 4AX2A 5KYXB 4K7BA 2EIKC 3OA1A 3HJCA 3VAYA 5L3QA 4ANJA 2YEVA 4U5CE 4LACB 1ZHXA 1D0YA 2G3KA 5KYNA 3N24A 2C04A 4YJWA 4O6NA 2EILC 2I8BA 1NU7D 4KI2A 1SZIA 3QMKA 1TWHA 5DQTA 1G8XA 2Q9AA 2VASA 5KYYB 2Y3HA 4BJ6C 2CDQA 3NYJA 3EHMA 4EWCA 2WVQA 2HV6A 3EZIA 5B1BC 1LKXA 2IXOA 5E3CA 3UGPA 4P6IC 3JSZA 1FFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9Y A; 
#chains in the Genus database with same CATH topology
 3DM9 B;  3RVZ A;  4JTC B;  2GFH A;  3ECS A;  3K1I C;  2NG1 A;  4FAP B;  1LPE A;  4LDR A;  2ZD9 A;  4XEK A;  4AE4 B;  1SF8 A;  2YL7 A;  4CS9 C;  4DVZ A;  1BDJ B;  4O79 A;  1C17 M;  2XS1 A;  3AG4 C;  3WAQ A;  5A6A A;  2A68 F;  4YT2 A;  2L6H A;  5KYW B;  3KYJ A;  2LSE A;  2KJG A;  3RQG A;  3ZQV A;  1EA8 A;  4MTF A;  4NTA A;  2LQG A;  4OD4 A;  5AC5 A;  3AG3 C;  3C8G B;  3EGX A;  4FES A;  3VYW A;  1NFN A;  2NUP B;  5COG A;  1D1C A;  5T3W A;  2A6E F;  4CJG A;  5B3I A;  4OIN F;  3RQE A;  5L3V A;  5A6B D;  3HLZ A;  4DVY P;  1OR3 A;  1JMW A;  4YL0 A;  3GAN A;  1CPR A;  1LE2 A;  256B A;  5BQH A;  3T4R A;  4KNW A;  4X0R A;  4N06 A;  2D5R B;  4RBN A;  1JRA A;  2XXA A;  4YT5 A;  1M2O A;  2AVK A;  2A0U A;  4AL1 A;  2EIJ C;  4WAB A;  4OD5 A;  1S05 A;  2UUI A;  4BEM J;  4OIQ F;  3HNJ A;  3IHU A;  1ORJ A;  4OIR F;  1HE9 A;  3PCV A;  3R2P A;  3EFO B;  3GWL A;  2YWA A;  3ASO C;  4YWQ A;  3UMH A;  4XEF A;  4BJ5 C;  1FMW A;  3DM5 A;  3IQ6 A;  2XM4 A;  3L8J A;  2RSE B;  3ZSU A;  3S29 A;  1VYK A;  2XRH A;  5F5H A;  5EGY A;  3TUL A;  3TJ6 A;  4A2N B;  2HUJ A;  1ZHT A;  2VB6 A;  4KNV A;  2L81 A;  1ZU4 A;  2Q7R A;  5EHH A;  3BEH A;  3NMK A;  1AEP A;  1WTY A;  3L0I A;  5AC4 A;  1VTM P;  3ZG1 A;  1JAF A;  3F47 A;  2GWW A;  2HFI A;  1OW8 A;  2OEX A;  3UGO A;  2OCC C;  3B71 A;  1Q0K A;  2YVK A;  3KKB A;  1RJ9 B;  4CJO A;  3UMI A;  2QLA A;  4MTG A;  2HS5 A;  5BUO A;  2YZS A;  4BJ6 A;  5B3S C;  1NZE A;  1T9K A;  3MYI A;  2PP4 A;  3ZWI A;  3JT1 A;  3O10 A;  4CDY A;  1JOG A;  3F46 A;  3M1C B;  4E7Z A;  1FFT C;  1Y4C A;  3U3F A;  1MNE A;  4MS2 A;  4BG0 A;  1KNY A;  3JTL O;  3KH2 A;  3LLK A;  5D91 A;  1YDI A;  1YLM A;  4JKV A;  2RD9 A;  4FWV A;  2F22 A;  3Q7L A;  3NYL A;  1NG1 A;  2L6G A;  3U9M A;  1E86 A;  5EK0 A;  2Q9B A;  1VMA A;  2O9X A;  3EZH A;  4MVQ A;  2EPL X;  1FNT c;  2DB4 A;  2YL1 A;  1O3U A;  3IQT A;  4MND A;  3U9J A;  1T6U A;  3JYH A;  5DS4 A;  1GM5 A;  4WGZ A;  4E7S A;  1UFB A;  1OCC C;  3RF3 A;  3UMK A;  1IZM A;  2R7O A;  2R7W A;  2LCH A;  2PF4 E;  3U5S A;  1VYI A;  2WZL A;  4MW3 A;  3DD7 A;  3S90 A;  1EQ1 A;  3A11 A;  3RVY A;  3O55 A;  3DKA A;  1UG7 A;  4U5H A;  2J7P A;  4DRJ B;  4XLP F;  1QQ3 A;  2LP4 A;  2W4B A;  1QLE C;  2Y3G A;  3AQB A;  3CZ6 A;  4XLN F;  2AWY A;  3VM6 A;  3CSK A;  1MND A;  3QW1 A;  2EPO A;  1CGO A;  4RDA A;  1NFO A;  3FHD A;  1ORY A;  2LFF A;  3EPV A;  3AJM A;  4G78 A;  4JCH A;  1V54 C;  3M15 A;  1DOV A;  1H7I A;  1PD0 A;  4GQH A;  1BR4 A;  2XLM A;  3L8I A;  5F28 E;  1MMN A;  3JSE O;  4N6C A;  2YL3 A;  2CNW D;  3PMR A;  1O5H A;  2PX3 A;  4BJ5 A;  4OIO F;  4JEA A;  5DS6 A;  3A9C A;  1M2V B;  1M57 C;  2J9V A;  2PX0 A;  4BEJ A;  4E0I A;  5CIV A;  1HY5 A;  4XEV A;  1I4Y A;  1MQV A;  4Z9J A;  1SR2 A;  3S0X A;  2R7U A;  3OWT A;  2OU6 A;  3ABK C;  4D4X A;  4XPW A;  3EG9 B;  4QDL A;  5A6J A;  2KYH A;  4MVM A;  1O87 A;  2A1D D;  1R5I D;  3NKD A;  4U5D E;  2WZF A;  3B0V C;  2J8W A;  2IXN A;  4NCQ A;  1I4Z A;  2WVO A;  2Y39 A;  2YHS A;  4J7T A;  3U8P A;  3KYI A;  5L0D A;  2W45 A;  3GEI A;  1RMV A;  1OQC A;  1V4A A;  2EPK X;  3HNK A;  5L0I A;  1FFH A;  4XWJ A;  4CDV A;  4NY3 A;  4EHP A;  5L0C A;  1G4W R;  3I4U A;  1Q0G A;  3VRC A;  2L6F A;  4Q4Z F;  3FOP A;  4B6I A;  1VB5 A;  3E70 C;  3HTK C;  4LER A;  3FAP B;  4BJ1 A;  1M6T A;  2QY9 A;  5DVW A;  2HSB A;  1BR1 A;  1LS1 A;  2ZPA A;  4LLE A;  4P9F A;  3W4Y A;  4DBQ A;  2J9W A;  4I1M A;  4Z9H A;  2VCC A;  3Q6N A;  3TJ5 A;  1ZHZ A;  1HMD A;  5L0F A;  3RKO F;  3K66 A;  2XLH A;  4MVS A;  1TFO B;  4XTK A;  3ITF A;  2Y69 C;  4U5E E;  5HSW A;  3SP1 A;  2Y3B A;  1OKK A;  3N2Z B;  3U8V A;  1NBB A;  2L9J A;  2XL6 A;  2E87 A;  2V3C C;  3DZA A;  1GS9 A;  2LD6 A;  3G4Z A;  1L3P A;  4KC9 A;  2P6V A;  2JPU A;  2WL8 A;  3RH3 A;  5BQI A;  1HMO A;  2NUT A;  2HV7 A;  4JUR I;  3NRH A;  3FVY A;  1IW7 F;  5KYX A;  4Q7C A;  2OJQ A;  3K33 A;  4AK9 A;  1FR0 A;  3FXH A;  1LVK A;  4IAQ A;  5JVE A;  4E18 A;  3DI5 A;  2H7V C;  3NMI A;  1HW2 A;  3DJN B;  3G4X A;  2Z15 A;  4G7H F;  3CEX A;  4OIP F;  2EIN C;  2KQ9 A;  3FMS A;  4W8P A;  2P7V A;  4F4B A;  3M4B A;  4UDV A;  2EIM C;  3ZIB A;  3GM3 A;  3WG7 C;  4DOZ A;  5JRA A;  5E33 A;  1OCO C;  4EBJ A;  3NKE A;  3V5X A;  1A0B A;  2J0X A;  3GEE A;  3DMD A;  1H9T A;  3LS1 A;  3QVY A;  1OR2 A;  1ZYR F;  3I5P A;  4YT4 A;  4C7O B;  1A7D A;  2KGO A;  3U3B A;  1TWG A;  3DAG A;  1WN0 A;  4JRZ A;  4NTB A;  3FDQ A;  2J9U A;  2XM0 A;  3GM2 A;  4QI0 A;  1EI7 A;  2DYS C;  3EGD B;  2NSF A;  3QVZ A;  2R03 A;  3V5Y A;  2HSQ A;  4MVZ A;  3SXM A;  5KYY A;  4QI2 A;  2PNO A;  1MMD A;  1JR8 A;  1K05 A;  4J30 B;  2Q4F A;  2XS8 A;  1S7Z A;  5A69 A;  3ZC4 A;  2KW3 C;  2G62 A;  1T5O A;  4MW8 A;  1CPQ A;  1FMV A;  4JIO A;  3N0T A;  1TR2 A;  4ONS A;  4JJF A;  2G3V A;  1E83 A;  3ABM C;  4JZA A;  4O7G A;  1WWP A;  1ZHW A;  2MHR A;  2OQM A;  2Q00 A;  1YAU O;  3POV A;  5KYU B;  1XWJ A;  3R7C A;  4IB4 A;  5A6K A;  1RKE B;  3W2V A;  4YT8 A;  4O6M A;  1ZU5 A;  3WHN A;  1Z23 A;  2M4E A;  1BR2 A;  1LI5 A;  2CYD A;  3C8G A;  4EKW A;  2L7A A;  2NUP A;  2R7R A;  3NYM A;  3UNG C;  2YQY A;  3EJN A;  4Q5S F;  1TWA A;  2FFH A;  3HNL A;  1ZHY A;  2TMV P;  4CSA A;  3NMJ A;  2B0J A;  2AU5 A;  1JPN A;  2YRF A;  3AOU A;  3C8Z A;  1YJG A;  3HKK A;  3LLI A;  3LS0 A;  3QTH A;  4MQ9 F;  2BL2 A;  5AGF A;  1KU2 A;  4CIH A;  3JRM O;  1T01 A;  3O39 A;  3QZC A;  2AWC A;  4KBL A;  4IJJ A;  1LIH A;  4HEA J;  4J7Y A;  4E0H A;  3EH2 A;  3K1H A;  4U5F E;  4U5G A;  2QUP A;  4W8K A;  3LEV A;  3MX3 A;  1T6Q A;  2GDC A;  1LM3 B;  4BJT A;  1D0Z A;  1FTS A;  2ASR A;  3EFO A;  1Y6D A;  2YLG A;  4JEB A;  1AUE A;  1SYQ A;  3AG2 C;  3US6 A;  3IQ5 A;  4ULV A;  4HFK B;  3RIP A;  3ZTZ A;  1GQA A;  2ETS A;  2J7P D;  1Q0M A;  2PBE A;  2QE9 A;  3ASN C;  4MTO A;  4ULW A;  4Z9I A;  3B0U X;  1HE1 A;  2DYR C;  5B1A C;  2DI3 A;  2W9Y A;  3IPM O;  3K6B A;  1MMG A;  4NTF A;  3TK0 A;  4A4A A;  5IY5 C;  1JPJ A;  3TQO A;  1NU9 C;  5K0I A;  1KTM A;  2VCA A;  4XPX A;  1YVI A;  2OEV A;  2X0C A;  1LS4 A;  3AQC A;  1YA7 O;  3EQL F;  3S84 A;  1YAR O;  3JZ0 A;  3NG1 A;  5DS5 A;  1QZX A;  2VCB A;  2LFD A;  1ZW3 A;  3SNH A;  3DAF A;  5FCL A;  1VK5 A;  1RJ9 A;  3JRT A;  3S28 A;  1CGN A;  2R25 A;  2V26 A;  1J8Y F;  2R02 A;  1QSP A;  4C3B A;  4CS8 C;  1TFK B;  2OG2 A;  2IXM A;  4YL3 A;  2LIG A;  2XL8 A;  2CNW A;  2J46 A;  3C62 A;  4M63 A;  1CGM E;  5JLI A;  3PDM P;  4C3E A;  1ZZP A;  3IEE A;  3PHF 2;  3EGX B;  4PFO A;  1G5Z A;  1RKC A;  4EIY A;  1EKY A;  2J0W A;  4PJL A;  2CGE A;  1Q0F A;  4I1O B;  4DRH B;  2YL0 A;  4WGY A;  4YN0 B;  3EH1 A;  4N6H A;  2A6H F;  2HMZ A;  3S27 A;  1T6I A;  4CX9 A;  4J32 B;  1E85 A;  2R7S A;  1XZQ A;  2H8A A;  2D4U A;  3RQF A;  1ZVZ A;  4JE9 A;  5GPG B;  4CIP A;  1WAT A;  3SXK A;  4GEH A;  2FGY A;  1K40 A;  2UUH A;  2XXA B;  2JX0 A;  4XQ1 A;  2R7X A;  4U9E A;  2IOQ A;  2M64 A;  4PJM A;  1V55 C;  3GEH A;  3ZDL A;  2HZ8 A;  2ZXP A;  3ABL C;  2VH3 A;  1C02 A;  3L34 A;  4MVO A;  4ZLD A;  1PV3 A;  2GA0 A;  2QTV A;  2HJ3 A;  2XLW A;  3H2V A;  3LAY A;  4G7Z F;  3AGU A;  3O6X A;  3FOO A;  3X1O A;  2WVN A;  2KK1 A;  1ORS C;  4U5B E;  4DBR A;  4K1O A;  4FX5 A;  1ZW2 A;  2XLD A;  4HE8 D;  3LJB A;  4ER9 A;  4CSA C;  1SMY F;  5HV9 A;  4N4W A;  4EBK A;  2GAQ A;  2IXP A;  2R7Q A;  2Q3T A;  1WOL A;  1OKK D;  2YLD A;  3K7D A;  4P9T A;  4WJ0 A;  3T9O A;  4PJJ A;  1I5N A;  3W2W A;  1OXB A;  1Z6A A;  1Z5Z A;  3MBG A;  2MYS A;  3KL4 A;  1A7V A;  1M2V A;  5DLJ A;  1Q0D A;  2BE5 F;  4H54 A;  1D1A A;  3E9V A;  1J8M F;  3ZVR A;  2B0H A;  2WZG A;  3NDB B;  1OCZ C;  3U2L A;  3EG9 A;  3H2U A;  2IYL D;  3QW0 A;  5JS5 A;  2H7O A;  3W8H A;  1A41 A;  1YA9 A;  1YYX A;  4GYT A;  5L0G A;  3J06 A;  5A6B A;  2P61 A;  3DJU B;  2DGJ A;  3SEO A;  5F5F A;  4IWB A;  4C3D A;  1G4U S;  1NSG B;  1FAP B;  1W2W A;  4CS8 A;  3LNR A;  2J9B A;  4O6Y A;  2XLV A;  3W8I A;  3LNM B;  4PAC A;  2H7B A;  3GOR A;  5L0H A;  1D0X A;  1ST6 A;  4RD9 A;  1RXQ A;  5JT4 A;  2YLI A;  5JP7 A;  3TD7 A;  4JW1 A;  3RW0 A;  4D4N A;  2HKV A;  3DE8 A;  3M79 A;  1E2X A;  3JCU Q;  3FAJ A;  4JJG A;  2YKZ A;  2EPN A;  3Q6M A;  5CI8 A;  2OOC A;  2IM8 A;  4CS7 A;  4EBB A;  3KPH A;  4L6R A;  3ZQY A;  1QPU A;  1WAS A;  4HFF B;  4JCZ A;  3ZTM A;  2OKU A;  3U0C A;  1Z3I X;  2P1A A;  3T6J A;  3V5Z A;  5E2Q A;  3M4C A;  3KMI A;  4AE4 A;  3MYF A;  2R05 A;  4I3M A;  2R7T A;  1GGQ A;  5T1D B;  2MWQ A;  3UR3 C;  3Q7G A;  3LEO A;  5KYW A;  2W4M A;  3RFY A;  2ICW G;  5COM A;  1TQG A;  4I44 A;  1LE4 A;  3SXY A;  3SZR A;  4IGG A;  5DQZ A;  4E17 A;  1L7C A;  2X51 A;  4G0H A;  2R7V A;  2HJM A;  3I5Q A;  3MFN A;  4LDK A;  4JVS A;  4MVR A;  4CDA A;  2IBF A;  4YL1 A;  3SXZ A;  2KNH A;  1D1B A;  3EHN A;  1VLT A;  2BC5 A;  4PK4 A;  3V7O A;  2PFD A;  4PR9 A;  1LI7 A;  3C8G D;  3AGT A;  2NSG A;  3TOL A;  3G50 A;  3DWW A;  3SYN A;  2CW0 F;  5CI9 A;  4DXW A;  1OW6 A;  1TKN A;  1VLS A;  1WGW A;  2Q9C A;  4JTD B;  1VOM A;  5E3A A;  3B0P A;  3DE9 A;  4G7O F;  1H6G A;  2Y3D A;  4H4K C;  3WOD F;  4CBE A;  1R4T A;  3VF0 A;  2A69 F;  3K1I A;  4MVU A;  1PCX A;  4C7O A;  2XLO A;  4CS9 A;  1C03 A;  3C63 A;  2ZXO A;  3HNI A;  4LLC A;  3EGD A;  2ZXR A;  3AG1 C;  2OJE D;  4PJN A;  4ZLC A;  5JUA A;  1H9G A;  1OCR C;  3L1M A;  1DOW A;  2QNL A;  2XSE A;  4IAR A;  1MMA A;  4BPM A;  3CQZ A;  1QVX A;  1Z63 A;  1AVO B;  1RCP A;  3H65 A;  3GOD A;  4NC3 A;  5FZT A;  1U0B B;  1N1C A;  2KSF A;  1APC A;  2JD3 A;  1HW1 A;  3OEO A;  2R9R B;  4JC7 A;  1BZ4 A;  1F1M A;  2ZXW C;  5T3T A;  1M56 C;  3X2Q C;  2XL4 A;  3LES A;  1OXK A;  1PD1 A;  2HMQ A;  3B29 A;  1TWC A;  4IAO A;  3C18 A;  3B9Q A;  3T6B A;  3MLG A;  4IRU A;  5D92 A;  4R32 A;  1V74 B;  2C03 A;  3RYL A;  1QKR A;  2I15 A;  2XLE A;  4K0D A;  2J45 A;  2VC9 A;  2NUT B;  2WB7 A;  3DXJ F;  4PFP A;  5KYU A;  4AX2 A;  1RKE A;  3BRJ A;  5KYX B;  2KC3 A;  4DJ9 A;  2NPU A;  4K7B A;  5JSL A;  4U9D A;  2EIK C;  3OA1 A;  3HJC A;  5BQG A;  3GM1 A;  3VAY A;  5L3Q A;  1A7E A;  4ANJ A;  2YEV A;  4U5C E;  4LAC B;  1ZHX A;  1D0Y A;  2G3K A;  4EUK B;  5KYN A;  3N24 A;  4LDQ A;  2C04 A;  3CAX A;  3IQC A;  1XZP A;  4YJW A;  3ATP A;  3T6G B;  3TOM A;  1NLX A;  2CCY A;  1YYJ A;  1BBH A;  4O6N A;  1K04 A;  2EIL C;  4AL0 A;  1YZA A;  2AP3 A;  4DRI B;  2I8B A;  2P0N A;  4YK5 A;  3C7J A;  1Z7Q c;  1NU7 D;  1E84 A;  4KI2 A;  1YZC A;  3QMK A;  1OW7 A;  1TWH A;  5DQT A;  2A0B A;  4JTA B;  1G8X A;  2Q9A A;  2VAS A;  5COF A;  5KYY B;  3LUT B;  1U89 A;  2Y3H A;  4BJ6 C;  2CDQ A;  3NYJ A;  3JYY A;  4XPY A;  3GWN A;  3EHM A;  3U2M A;  1B68 A;  5L0J A;  4EWC A;  2WVQ A;  2HV6 A;  3EZI A;  5B1B C;  1LKX A;  2IXO A;  2FAP B;  1U6H A;  5E3C A;  2LK4 A;  4P6I C;  5TJ5 E;  4NQF A;  3UGP A;  3S9O A;  2EPM X;  3JSZ A;  1SZI A; 
#chains in the Genus database with same CATH homology
 3DM9 B;  2GFH A;  3ECS A;  3K1I C;  2NG1 A;  4AE4 B;  1SF8 A;  4CS9 C;  4DVZ A;  4O79 A;  3AG4 C;  2A68 F;  4YT2 A;  5KYW B;  2LSE A;  2KJG A;  4OD4 A;  3AG3 C;  3EGX A;  3VYW A;  4FES A;  2NUP B;  5T3W A;  1D1C A;  2A6E F;  4OIN F;  5L3V A;  3HLZ A;  4DVY P;  3GAN A;  3T4R A;  4KNW A;  4X0R A;  4N06 A;  2D5R B;  4RBN A;  2XXA A;  4YT5 A;  1M2O A;  4OIQ F;  2EIJ C;  4OD5 A;  4OIR F;  3EFO B;  3ASO C;  4YWQ A;  3UMH A;  4BJ5 C;  1FMW A;  3DM5 A;  3ZSU A;  5EGY A;  3S29 A;  1VYK A;  2XRH A;  5F5H A;  4A2N B;  1ZHT A;  2VB6 A;  4KNV A;  2L81 A;  1ZU4 A;  5EHH A;  3L0I A;  3ZG1 A;  3F47 A;  3UGO A;  2OCC C;  3KKB A;  1RJ9 B;  3UMI A;  5BUO A;  2YZS A;  4BJ6 A;  5B3S C;  1NZE A;  2PP4 A;  3JT1 A;  3M1C B;  3F46 A;  4E7Z A;  1FFT C;  1MNE A;  4BG0 A;  3KH2 A;  5D91 A;  3LLK A;  4FWV A;  3Q7L A;  3NYL A;  1NG1 A;  2Q9B A;  1VMA A;  2O9X A;  3EZH A;  4MND A;  3JYH A;  5DS4 A;  1OCC C;  3UMK A;  1IZM A;  2R7O A;  2R7W A;  2PF4 E;  1VYI A;  2WZL A;  3DD7 A;  4U5H A;  2J7P A;  4XLP F;  2W4B A;  3AQB A;  1QLE C;  2Y3G A;  3CZ6 A;  4XLN F;  3CSK A;  1MND A;  4RDA A;  3FHD A;  3EPV A;  4JCH A;  1V54 C;  1PD0 A;  1BR4 A;  1MMN A;  2CNW D;  3PMR A;  1O5H A;  2PX3 A;  4BJ5 A;  4OIO F;  5DS6 A;  1M2V B;  1M57 C;  2J9V A;  2PX0 A;  4BEJ A;  3S0X A;  2R7U A;  3OWT A;  3ABK C;  3EG9 B;  4QDL A;  1O87 A;  2A1D D;  3NKD A;  4U5D E;  3B0V C;  2WZF A;  2IXN A;  2WVO A;  2YHS A;  2Y39 A;  2W45 A;  4XWJ A;  4NY3 A;  3I4U A;  4Q4Z F;  4B6I A;  3E70 C;  3HTK C;  4LER A;  4BJ1 A;  5DVW A;  2QY9 A;  1BR1 A;  1LS1 A;  2ZPA A;  4LLE A;  4DBQ A;  2J9W A;  4I1M A;  3Q6N A;  1ZHZ A;  3RKO F;  3K66 A;  4XTK A;  3ITF A;  2Y69 C;  4U5E E;  5HSW A;  3SP1 A;  2Y3B A;  1OKK A;  3N2Z B;  2L9J A;  2E87 A;  2V3C C;  3DZA A;  4KC9 A;  2P6V A;  2WL8 A;  3RH3 A;  2NUT A;  2HV7 A;  4JUR I;  3NRH A;  3FVY A;  1IW7 F;  5KYX A;  4Q7C A;  3K33 A;  4AK9 A;  1LVK A;  2H7V C;  3DJN B;  2Z15 A;  4G7H F;  2EIN C;  2KQ9 A;  4F4B A;  2P7V A;  2EIM C;  3ZIB A;  3WG7 C;  4DOZ A;  5E33 A;  1OCO C;  3NKE A;  2J0X A;  3DMD A;  3LS1 A;  1ZYR F;  3I5P A;  4YT4 A;  4C7O B;  2KGO A;  1TWG A;  3DAG A;  3FDQ A;  2J9U A;  4QI0 A;  2DYS C;  3EGD B;  5KYY A;  4QI2 A;  1MMD A;  4J30 B;  1S7Z A;  3ZC4 A;  2KW3 C;  2G62 A;  1FMV A;  3N0T A;  1TR2 A;  4JJF A;  2G3V A;  3ABM C;  4JZA A;  4O7G A;  1ZHW A;  3POV A;  5KYU B;  3W2V A;  4YT8 A;  4O6M A;  1ZU5 A;  1Z23 A;  2M4E A;  1BR2 A;  2NUP A;  2R7R A;  3NYM A;  3UNG C;  4Q5S F;  3EJN A;  1TWA A;  2FFH A;  1ZHY A;  4CSA A;  2B0J A;  1JPN A;  3LS0 A;  4MQ9 F;  3LLI A;  1KU2 A;  4CIH A;  3O39 A;  3QZC A;  4KBL A;  4IJJ A;  4HEA J;  3EH2 A;  3K1H A;  4U5F E;  4U5G A;  4W8K A;  3LEV A;  3MX3 A;  4BJT A;  1D0Z A;  1FTS A;  3EFO A;  3AG2 C;  4HFK B;  3RIP A;  4E7S A;  2J7P D;  4ULW A;  3ASN C;  3B0U X;  2DYR C;  5B1A C;  2W9Y A;  3K6B A;  4OIP F;  1MMG A;  5IY5 C;  1JPJ A;  1NU9 C;  3AQC A;  3EQL F;  3NG1 A;  5DS5 A;  1QZX A;  3SNH A;  3DAF A;  5FCL A;  1VK5 A;  1RJ9 A;  3JRT A;  3S28 A;  2V26 A;  1J8Y F;  4CS8 C;  4C3B A;  2OG2 A;  2IXM A;  2CNW A;  2J46 A;  4M63 A;  4C3E A;  3IEE A;  3PHF 2;  3EGX B;  4PFO A;  2J0W A;  4PJL A;  2CGE A;  4I1O B;  4YN0 B;  3EH1 A;  2A6H F;  3S27 A;  2R7S A;  4J32 B;  4GEH A;  2FGY A;  2XXA B;  2R7X A;  2IOQ A;  4PJM A;  1V55 C;  2ZXP A;  3ABL C;  2VH3 A;  3L34 A;  4ZLD A;  3LAY A;  2QTV A;  4G7Z F;  3O6X A;  3X1O A;  2WVN A;  4DBR A;  4U5B E;  4FX5 A;  4HE8 D;  3LJB A;  4CSA C;  1SMY F;  2IXP A;  2R7Q A;  2Q3T A;  3K7D A;  1OKK D;  4WJ0 A;  4PJJ A;  3W2W A;  1Z6A A;  1Z5Z A;  2MYS A;  3KL4 A;  1M2V A;  5DLJ A;  2BE5 F;  3ZVR A;  1D1A A;  3E9V A;  1J8M F;  2WZG A;  3NDB B;  1OCZ C;  3EG9 A;  2IYL D;  2H7O A;  3W8H A;  4GYT A;  3DJU B;  2DGJ A;  3SEO A;  5F5F A;  4IWB A;  4C3D A;  1W2W A;  4CS8 A;  3LNR A;  4O6Y A;  3W8I A;  2H7B A;  1D0X A;  1ST6 A;  4RD9 A;  3TD7 A;  4JW1 A;  3JCU Q;  4JJG A;  3FAJ A;  5CI8 A;  3Q6M A;  4CS7 A;  4EBB A;  4HFF B;  1Z3I X;  3T6J A;  5E2Q A;  3KMI A;  4AE4 A;  4I3M A;  2R7T A;  5T1D B;  2MWQ A;  3UR3 C;  3Q7G A;  5KYW A;  2W4M A;  3RFY A;  4I44 A;  3SZR A;  5DQZ A;  2X51 A;  4G0H A;  2R7V A;  3I5Q A;  4JVS A;  2KNH A;  1D1B A;  3EHN A;  4PK4 A;  3V7O A;  2PFD A;  3SYN A;  2CW0 F;  5CI9 A;  1TKN A;  1WGW A;  2Q9C A;  1VOM A;  5E3A A;  3B0P A;  4G7O F;  2Y3D A;  4H4K C;  3WOD F;  4CBE A;  2A69 F;  1PCX A;  4C7O A;  4CS9 A;  2ZXO A;  4LLC A;  3EGD A;  2ZXR A;  3AG1 C;  4PJN A;  4ZLC A;  1OCR C;  2XSE A;  1MMA A;  3CQZ A;  1Z63 A;  3H65 A;  3GOD A;  1N1C A;  2JD3 A;  3OEO A;  2ZXW C;  5T3T A;  1M56 C;  3X2Q C;  2XL4 A;  3LES A;  1PD1 A;  1TWC A;  4IAO A;  3B9Q A;  3T6B A;  3MLG A;  4IRU A;  5D92 A;  2C03 A;  3RYL A;  4K0D A;  2J45 A;  2WB7 A;  2NUT B;  3DXJ F;  4PFP A;  5KYU A;  4AX2 A;  5KYX B;  4K7B A;  2EIK C;  3OA1 A;  3HJC A;  3VAY A;  5L3Q A;  4ANJ A;  2YEV A;  4U5C E;  4LAC B;  1ZHX A;  1D0Y A;  2G3K A;  5KYN A;  3N24 A;  2C04 A;  4YJW A;  4O6N A;  2EIL C;  2I8B A;  1NU7 D;  4KI2 A;  1SZI A;  3QMK A;  1TWH A;  5DQT A;  1G8X A;  2Q9A A;  2VAS A;  5KYY B;  2Y3H A;  4BJ6 C;  2CDQ A;  3NYJ A;  3EHM A;  4EWC A;  2WVQ A;  2HV6 A;  3EZI A;  5B1B C;  1LKX A;  2IXO A;  5E3C A;  3UGP A;  4P6I C;  3JSZ A;  1FFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...