2W9YA

The structure of the lipid binding protein ce-far-7 from caenorhabditis elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
135
Chain Sequence
GAMSVASLPEVKNFFPTEQLEFSSSITADEKPVLHEVFQKHSCGEMIDEVSKKHPELGKRLATVLEGNKKRLDGLSPAAVEYAKKLIHMVTTTLCSLTVGKPIDDADAKRLHQEFQSLSSEDQAALRKNNPDIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords FATTY ACID/RETINOL BINDING PROTEIN PROTEIN 7, ISOFORM A, CON
publication title Fatty Acid and Retinoid Binding Proteins Have Distinct Binding Pockets for the Two Types of Cargo
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 52
structure length 135
sequence length 140
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05823 Gp-FAR-1 Nematode fatty acid retinoid binding protein (Gp-FAR-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1100 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w9yA00
2W9YA
chains in the Genus database with same CATH superfamily
1OR2A 4E0HA 3LNRA 3U9JA 3CQZA 2XXAA 1H9GA 4QI2A 4MNDA 4NCQA 1SR2A 3PDMP 2Y69C 3HNKA 3TD7A 4OIQF 4EBKA 1LE2A 5HSWA 3J06A 256BA 1CPQA 4GYTA 4NY3A 2HKVA 5COGA 3S0XA 2CGEA 1JPJA 2QTVA 5COFA 2W45A 2KYHA 4I1OB 4DRJB 2AP3A 3EZHA 1IW7F 3WAQA 2P1AA 1F1MA 2JX0A 1SZIA 1HY5A 4JKVA 4FWVA 1OCRC 4U5FE 4A4AA 2NUPB 3JRMO 4IB4A 4JVSA 2DI3A 4LACB 5D92A 2J9BA 3IQ6A 1OCOC 2CNWD 3M1CB 3ZDLA 1M6TA 2L9JA 1Y4CA 4MTOA 3RQEA 3S27A 4X0RA 2YL0A 2R7RA 2R03A 3NMJA 1NBBA 4J32B 4YL3A 3SXKA 4C3EA 4CIPA 2A69F 4MVZA 4YN0B 4JURI 2XS8A 4I3MA 2JD3A 4PJMA 1GS9A 3HJCA 1QZXA 4NTFA 1Y6DA 3AG3C 4MW8A 1QKRA 2IXPA 3MBGA 3EFOA 2G62A 4GEHA 1VYKA 4HEAJ 5BUOA 3EGXA 2QY9A 3L0IA 2DGJA 1YYJA 4LDQA 2L6HA 1K04A 4IJJA 2X0CA 1C02A 4MVUA 1E83A 2A6HF 4XPXA 1A7VA 2YL7A 1C03A 1A7EA 2Y3HA 2DB4A 3ZG1A 4OIPF 2WL8A 5FCLA 2AVKA 3EJNA 5L0CA 3ASNC 3EH2A 1VLTA 4AX2A 2G3VA 1BZ4A 2EPMX 3GORA 1PD1A 1G4US 2EIKC 3B71A 3EG9A 4ZLCA 1WGWA 1D0YA 5BQHA 4FESA 1ZW2A 3SXMA 3W4YA 1U6HA 2A68F 5JRAA 1OKKA 2E87A 4DVYP 2HV7A 4HFKB 4XLNF 1Z63A 3CAXA 2YZSA 3EHNA 5DQZA 2HUJA 2Q3TA 3ZVRA 3POVA 4E0IA 4PFOA 2PX3A 1V4AA 3M4CA 1JMWA 1TFOB 3KL4A 3X1OA 4IRUA 3O6XA 3I4UA 1AVOB 2XLEA 1QLEC 2XS1A 1ZHZA 2BE5F 5BQGA 3SEOA 4DVZA 2AWYA 3JCUQ 4MVMA 5EHHA 4CSAA 4CS9C 2V26A 2J7PA 4JCHA 4XLPF 1V54C 1PCXA 4G7ZF 4HFFB 3LLIA 2WZGA 4JTAB 2R02A 1PV3A 1TWCA 4YWQA 3K1IA 1H7IA 2EINC 4PACA 4PR9A 4NQFA 4N6HA 1FFTC 3Q7LA 3DD7A 3LJBA 1RKEA 2Q4FA 1TWGA 1QSPA 4CS8C 2LFDA 4E7ZA 3NYLA 5JUAA 1SYQA 3V5YA 4BEMJ 4CS7A 4U5BE 2NUTB 4JRZA 4B6IA 2XSEA 5B3SC 3NYMA 1YVIA 2Y3BA 3HNIA 3EHMA 3Q6NA 1E2XA 3VRCA 2CYDA 2IXMA 1FMWA 3HNJA 4DXWA 1U0BB 5JP7A 5L0HA 3TULA 2NSFA 1T5OA 1YZAA 4LERA 1NZEA 1BR1A 4Z9IA 4CBEA 3LUTB 2KJGA 2PP4A 4DBQA 4CIHA 4WJ0A 1L3PA 4O7GA 3UGOA 3ZTZA 1QVXA 3T4RA 1A0BA 1EA8A 2EIJC 1RJ9A 3BRJA 4NTAA 5JT4A 1EKYA 4EHPA 3I5QA 1YYXA 3FXHA 5KYNA 2H8AA 2KC3A 3UNGC 3SXZA 5B1BC 1D0XA 1EQ1A 4CX9A 4N6CA 5B1AC 1J8MF 3VAYA 2ETSA 2R7WA 2CCYA 2G3KA 3G4ZA 3K66A 3RVYA 2BL2A 5KYWA 5KYXB 4Q4ZF 2VC9A 2ASRA 4XPWA 3LAYA 2VASA 4KI2A 3DWWA 4J7YA 1OCZC 4RD9A 4EIYA 3T6GB 4EBBA 4OIOF 1HE1A 1M2VB 1ZVZA 4N4WA 3VYWA 4JW1A 3MYIA 2HJ3A 2GFHA 3H2VA 3MX3A 3DAGA 4XPYA 3VM6A 2AWCA 1OXBA 2BC5A 4MVRA 4U9EA 1VYIA 3V7OA 1JPNA 2OEVA 1YJGA 2Q00A 2WZFA 4MQ9F 1AEPA 3ZC4A 4CDYA 4U5CE 2W4MA 3WG7C 5KYYB 1W2WA 3FAJA 1YA9A 2H7BA 1MMGA 1LIHA 4FAPB 1WTYA 3G4XA 4IAQA 2OJQA 2J7PD 2NPUA 1SMYF 1ORYA 3C8GB 3QVYA 3U8VA 1I4ZA 2HJMA 2XLDA 4JTDB 3SP1A 5CI9A 2P7VA 1T9KA 5F28E 4KBLA 1BR2A 4N06A 3DJNB 1KNYA 1O5HA 3QW0A 2IXOA 3ECSA 4OD4A 2WB7A 2R7VA 1A7DA 1MMDA 3AGUA 3NG1A 4K7BA 5D91A 2B0HA 5A69A 3U9MA 4MTFA 3E9VA 2KW3C 4HE8D 4G0HA 2C03A 2Y3DA 3FOOA 1TFKB 1ZYRF 3C7JA 3JZ0A 2Q7RA 4CS9A 3AQCA 2L7AA 2HZ8A 1B68A 5EK0A 3TK0A 3GWNA 1RKCA 3U3BA 1RMVA 3NKEA 3U2LA 1RXQA 3MLGA 4BPMA 2B0JA 2LQGA 2KQ9A 5E2QA 3EGDB 4WABA 3SXYA 3W2WA 2YKZA 1ZHWA 1E86A 1CGOA 1J8YF 2WVNA 4PFPA 4U9DA 4CS8A 2FFHA 4MVSA 2XLMA 4EKWA 1WATA 3QVZA 3AOUA 4LLEA 3NDBB 1NU7D 4E7SA 4P9FA 2Z15A 1RCPA 5AC5A 5KYUB 2VH3A 1NLXA 4XEKA 1JOGA 2F22A 5CIVA 1M57C 1Z5ZA 4DRHB 3B0VC 1Q0KA 2ZXOA 2OJED 2Y39A 2XM0A 3ABKC 3B29A 1NFNA 3QTHA 2P61A 2EPNA 3GODA 4K1OA 4DOZA 3S84A 2LFFA 2IM8A 2YRFA 1Z23A 3EQLF 3KKBA 2NG1A 5JS5A 1D0ZA 2HS5A 2OG2A 4EBJA 3HNLA 3EZIA 2UUHA 3ABMC 3LNMB 3NKDA 4CJOA 2JPUA 3TJ5A 1JAFA 5JVEA 2OOCA 4RBNA 1LVKA 5AGFA 2QUPA 4D4XA 5F5FA 3TOLA 4LDKA 4YL1A 3W8IA 2ZD9A 3U5SA 1O3UA 3BEHA 1FR0A 3FMSA 4W8KA 3U2MA 2TMVP 3K7DA 1DOWA 2L6GA 1HW2A 3LLKA 2R9RB 1YLMA 1VTMP 1YZCA 1LE4A 3O55A 1FAPB 3IEEA 3TOMA 4A2NB 1NSGB 3KMIA 3A11A 4U5HA 3PCVA 4Z9HA 1ST6A 2YL3A 2LD6A 5A6KA 2XM4A 2NUPA 4AE4B 2GDCA 2YL1A 3R2PA 3AQBA 3JSEO 4XEVA 5T3TA 3W8HA 4D4NA 2LIGA 4BJ1A 3RIPA 3Q7GA 3L8IA 4E17A 2PFDA 1LKXA 4QI0A 3ZTMA 5L3QA 4C7OB 1YAUO 3GANA 3C8ZA 3K6BA 1OW7A 3KH2A 3KYIA 3NYJA 4BJTA 1GM5A 2XXAB 1MMNA 1S05A 1S7ZA 1UG7A 1MQVA 2IXNA 1OQCA 3DJUB 3LEOA 3S29A 5L0GA 1V74B 2R7XA 2RSEB 2O9XA 3N2ZB 2VCAA 3U0CA 2ICWG 4UDVA 4W8PA 5B3IA 2A1DD 2W4BA 1OXKA 1FFHA 1VOMA 2H7OA 4U5DE 1M56C 3AG2C 3JYYA 3S28A 3L1MA 2YQYA 4JCZA 2A6EF 3JYHA 4IGGA 2P0NA 3A9CA 3GM3A 5JSLA 1TKNA 2OEXA 2WVOA 3ATPA 3DE9A 2XRHA 4PJNA 1GQAA 1T6UA 3C62A 1Z3IX 5DVWA 3R7CA 2J9UA 3HLZA 3ZWIA 2EPKX 1G4WR 2MHRA 4O6NA 5T1DB 5KYUA 2CNWA 4GQHA 2WZLA 4BJ6A 3LEVA 4YJWA 2EPOA 2Q9AA 3SYNA 1D1BA 3FVYA 3ZSUA 1SF8A 4KNVA 1NU9C 2PNOA 3AG4C 3IQ5A 5L0DA 2J9VA 5GPGB 2DYRC 2XLVA 4I44A 4EWCA 2YVKA 3L8JA 1G5ZA 3EH1A 1XZPA 4H4KC 1XWJA 1HMDA 2YLDA 2MWQA 4XTKA 3ZQVA 1LM3B 2Y3GA 4Z9JA 4BJ5C 4DRIB 1OKKD 2HMQA 2PX0A 3EGXB 1I4YA 5DS6A 3UMIA 1E84A 1K40A 2AU5A 3GEEA 4YT5A 4CDAA 3CEXA 4JC7A 4Q5SF 2J9WA 3RYLA 4G7HF 3T6BA 2QE9A 2XL6A 4MVQA 1ZZPA 1APCA 4XEFA 3E70C 3SZRA 2L81A 5E3CA 1WWPA 5A6AA 3OEOA 1FTSA 3QZCA 2Q9CA 3RVZA 1NFOA 4E18A 1Q0FA 1BR4A 1V55C 3TJ6A 1OR3A 3M4BA 3EG9B 4P6IC 4KC9A 4YT8A 1HE9A 1ZU5A 2LSEA 4L6RA 4PJJA 1KTMA 3MYFA 3DI5A 1ZW3A 2I15A 4JZAA 3LESA 3IQTA 4BEJA 1VMAA 3DXJF 4O6YA 4FX5A 1YA7O 2GA0A 2OQMA 4Q7CA 4BG0A 2R7TA 3KPHA 3L34A 3N24A 4C7OA 2NUTA 2ZPAA 3UR3C 4F4BA 2J0XA 3RKOF 2GAQA 3GM1A 2X51A 3O10A 2HV6A 2XLWA 2PBEA 1WN0A 4O6MA 3UMKA 1A41A 3OWTA 4BJ6C 2IBFA 4PJLA 5IY5C 2XLHA 2YEVA 4RDAA 4M63A 1LS1A 2FGYA 2EILC 2KGOA 1FMVA 1QQ3A 3JTLO 1ORJA 2C04A 1TWHA 3K33A 3KYJA 4U5EE 1XZQA 3OA1A 2EPLX 3S90A 1IZMA 4C3DA 3FDQA 1K05A 3HKKA 1RKEB 2MYSA 3T6JA 2L6FA 2A0UA 1ORSC 1AUEA 5HV9A 1MNEA 1Q0DA 4EUKB 2J8WA 3CZ6A 3H2UA 5KYXA 3JT1A 1VB5A 1OW6A 5AC4A 1U89A 3T9OA 3F46A 4AK9A 3M15A 2A0BA 2FAPB 2LP4A 5A6BA 3GM2A 3ZIBA 3DE8A 1M2VA 4JJFA 1LI5A 1TR2A 5L3VA 1KU2A 4G78A 3F47A 4J7TA 3IPMO 4P9TA 2ZXWC 2KSFA 1OCCC 2P6VA 3NMKA 3DAFA 3WODF 3IQCA 1HMOA 2HFIA 2ZXPA 3DZAA 1RJ9B 2UUIA 4JJGA 4MTGA 3RH3A 3B0UX 4ZLDA 1D1CA 3DMDA 1LI7A 5KYYA 3IHUA 1VLSA 3FOPA 3QW1A 1CGNA 1N1CA 4OD5A 4ULWA 1ZHTA 5E3AA 2CDQA 3M79A 4QDLA 1E85A 4AL1A 2NSGA 4MW3A 2GWWA 4NTBA 3PHF2 1EI7A 4AL0A 2Q9BA 5KYWB 1I5NA 4CDVA 1UFBA 3C8GA 4BJ5A 1HW1A 1WASA 2R7OA 4ER9A 2QNLA 1O87A 1TWAA 2YHSA 2J0WA 3NMIA 4JE9A 1BBHA 4OIRF 5DS4A 2XLOA 3ZQYA 2VCCA 3RQFA 5CI8A 5L0FA 4JTCB 3FAPB 1LS4A 3JSZA 2J45A 1YDIA 5E33A 4I1MA 3V5XA 1D1AA 4LDRA 3LS0A 3PMRA 2KNHA 2XL8A 1BDJB 2YLIA 1Z6AA 1JRAA 4G7OF 3EPVA 2HMZA 1M2OA 3AG1C 2ZXRA 4JEBA 4O79A 2OKUA 4YT4A 3W2VA 5A6JA 1T6QA 1T01A 2KK1A 3H65A 1Z7Qc 3U3FA 1T6IA 3AGTA 4DJ9A 4PK4A 5L0IA 2R7SA 3EGDA 2OCCC 1H9TA 2VCBA 2OU6A 4WGYA 3UMHA 5L0JA 3GEHA 4OINF 2IOQA 2YLGA 3ASOC 4XWJA 2HSBA 1R4TA 3B0PA 4ULVA 2R7UA 3US6A 1Q0GA 3RW0A 4DBRA 3ABLC 3O39A 5TJ5E 2HSQA 3DM9B 1DOVA 1NG1A 3FHDA 1OW8A 1GGQA 1JR8A 4H54A 1ZU4A 4XQ1A 1VK5A 5FZTA 3TQOA 3VF0A 3RFYA 2V3CC 3B9QA 3DKAA 3GWLA 2H7VC 3C18A 3LS1A 5JLIA 1MMAA 2R05A 4K0DA 4IWBA 2D5RB 3CSKA 3RF3A 4ANJA 3I5PA 4WGZA 1R5ID 5A6BD 2DYSC 3U8PA 5DQTA 5BQIA 4YL0A 1CGME 3EFOB 3JRTA 1YARO 1C17M 3MFNA 4IAOA 2LCHA 2M64A 4IARA 3GEIA 5DLJA 3G50A 3ITFA 3AJMA 5T3WA 2R25A 2IYLD 3HTKC 4JEAA 2J46A 3RQGA 4MS2A 1G8XA 2QLAA 3QMKA 4YK5A 2I8BA 4CJGA 1LPEA 1ZHYA 3K1HA 1H6GA 3SNHA 3WHNA 1FNTc 4KNWA 1PD0A 3DM5A 4LLCA 4C3BA 4YT2A 5F5HA 3S9OA 3C8GD 4NC3A 2R7QA 1L7CA 1TQGA 3Q6MA 2YWAA 3N0TA 3C63A 2RD9A 2WVQA 5COMA 5DS5A 4CSAC 1ZHXA 1QPUA 3V5ZA 2PF4E 2XL4A 2EIMC 4MVOA 4ONSA 4U5GA 2LK4A 4AE4A 5EGYA 5K0IA 1MNDA 2CW0F 3X2QC 3UGPA 2D4UA 2VB6A 3NRHA 4J30B 4R32A 2W9YA 3K1IC 4JIOA 1CPRA 1Q0MA 1WOLA 2M4EA
chains in the Genus database with same CATH topology
3LNRA 2XXAA 3CQZA 4QI2A 4MNDA 2Y69C 3TD7A 4OIQF 5HSWA 4GYTA 4NY3A 3S0XA 2CGEA 1JPJA 2QTVA 2W45A 4I1OB 3EZHA 1IW7F 1SZIA 4FWVA 1OCRC 4U5FE 2NUPB 4JVSA 4LACB 5D92A 1OCOC 2CNWD 3M1CB 2L9JA 3S27A 4X0RA 2R7RA 4J32B 4C3EA 2A69F 4YN0B 4JURI 4I3MA 2JD3A 4PJMA 3HJCA 1QZXA 3AG3C 2IXPA 4GEHA 3EFOA 2G62A 1VYKA 4HEAJ 5BUOA 3EGXA 2QY9A 3L0IA 2DGJA 4IJJA 2A6HF 2Y3HA 3ZG1A 4OIPF 2WL8A 5FCLA 3EJNA 3ASNC 3EH2A 4AX2A 2G3VA 1PD1A 2EIKC 3EG9A 4ZLCA 1WGWA 1D0YA 4FESA 2A68F 1OKKA 2E87A 4DVYP 2HV7A 4HFKB 4XLNF 1Z63A 2YZSA 3EHNA 5DQZA 2Q3TA 3ZVRA 3POVA 4PFOA 2PX3A 3KL4A 3X1OA 4IRUA 3O6XA 3I4UA 4DVZA 3SEOA 1QLEC 1ZHZA 2BE5F 5EHHA 4CSAA 3JCUQ 4CS9C 2V26A 2J7PA 4JCHA 4XLPF 1V54C 1PCXA 4G7ZF 4HFFB 3LLIA 2WZGA 4YWQA 1TWCA 2EINC 1FFTC 3Q7LA 3DD7A 3LJBA 1TWGA 4CS8C 4E7ZA 3NYLA 4CS7A 4U5BE 2NUTB 4B6IA 2XSEA 5B3SC 3NYMA 2Y3BA 3EHMA 3Q6NA 2IXMA 1FMWA 4LERA 4CBEA 1NZEA 1BR1A 4DBQA 2KJGA 2PP4A 4WJ0A 4O7GA 3UGOA 3T4RA 2EIJC 1RJ9A 3I5QA 5KYNA 3UNGC 5B1BC 1D0XA 5B1AC 1J8MF 3VAYA 2R7WA 2G3KA 3K66A 5KYXB 5KYWA 4Q4ZF 3LAYA 2VASA 4KI2A 1OCZC 4RD9A 4EBBA 4OIOF 1M2VB 3VYWA 4JW1A 2GFHA 3MX3A 3DAGA 3V7OA 1VYIA 1JPNA 2WZFA 4MQ9F 3ZC4A 4U5CE 2W4MA 3WG7C 5KYYB 1W2WA 3FAJA 2H7BA 1MMGA 2J7PD 1SMYF 3SP1A 5CI9A 2P7VA 4KBLA 1BR2A 4N06A 3DJNB 1O5HA 4OD4A 2IXOA 3ECSA 2R7VA 2WB7A 4K7BA 1MMDA 3NG1A 5D91A 3E9VA 2KW3C 4HE8D 4G0HA 2C03A 2Y3DA 1ZYRF 4CS9A 3AQCA 3NKEA 3MLGA 2B0JA 2KQ9A 5E2QA 3EGDB 3W2WA 1ZHWA 2WVNA 1J8YF 4PFPA 4CS8A 2FFHA 4LLEA 3NDBB 1NU7D 4E7SA 2Z15A 5KYUB 2VH3A 1M57C 1Z5ZA 3B0VC 2ZXOA 2Y39A 3ABKC 3GODA 4DOZA 1Z23A 3EQLF 3KKBA 2NG1A 1D0ZA 2OG2A 3EZIA 3ABMC 3NKDA 4RBNA 1LVKA 5F5FA 3W8IA 4W8KA 3K7DA 3LLKA 4A2NB 3IEEA 3KMIA 4U5HA 1ST6A 2NUPA 4AE4B 3AQBA 3W8HA 5T3TA 4BJ1A 3RIPA 3Q7GA 2PFDA 1LKXA 4QI0A 5L3QA 4C7OB 3GANA 3K6BA 3KH2A 3NYJA 4BJTA 2XXAB 1MMNA 1S7ZA 2IXNA 3DJUB 3S29A 2R7XA 2O9XA 3N2ZB 2A1DD 2W4BA 1VOMA 1FFHA 2H7OA 4U5DE 1M56C 3AG2C 3S28A 2A6EF 3JYHA 1TKNA 2WVOA 4PJNA 4CIHA 2XRHA 5DVWA 1Z3IX 2J9UA 3HLZA 4O6NA 5T1DB 5KYUA 2CNWA 2WZLA 4BJ6A 3LEVA 4YJWA 2Q9AA 3SYNA 1D1BA 3FVYA 3ZSUA 1SF8A 4KNVA 1NU9C 3AG4C 2J9VA 2DYRC 4I44A 4EWCA 3EH1A 4H4KC 2MWQA 4XTKA 2Y3GA 4BJ5C 1OKKD 2PX0A 3EGXB 5DS6A 3UMIA 4YT5A 4Q5SF 2J9WA 3RYLA 4G7HF 3T6BA 3E70C 3SZRA 2L81A 5E3CA 3OEOA 1FTSA 3QZCA 2Q9CA 1BR4A 1V55C 3EG9B 4P6IC 4KC9A 4YT8A 1ZU5A 2LSEA 4PJJA 4JZAA 3LESA 4BEJA 1VMAA 3DXJF 4O6YA 4FX5A 4BG0A 4Q7CA 2R7TA 3L34A 3N24A 4C7OA 2NUTA 2ZPAA 3UR3C 4F4BA 2J0XA 3RKOF 2X51A 2HV6A 4O6MA 3UMKA 3OWTA 4BJ6C 4PJLA 5IY5C 2YEVA 4RDAA 4M63A 1LS1A 2FGYA 2EILC 2KGOA 3K33A 1FMVA 2C04A 1TWHA 4U5EE 3OA1A 1IZMA 4C3DA 3FDQA 2MYSA 3T6JA 1MNEA 3CZ6A 5KYXA 3JT1A 3F46A 4AK9A 3ZIBA 1M2VA 4JJFA 1TR2A 5L3VA 1KU2A 3F47A 2ZXWC 1OCCC 2P6VA 3DAFA 3WODF 2ZXPA 4JJGA 3DZAA 1RJ9B 3B0UX 4ZLDA 3RH3A 1D1CA 3DMDA 5KYYA 4OD5A 5E3AA 1N1CA 4ULWA 1ZHTA 2CDQA 4QDLA 3PHF2 5KYWB 2Q9BA 4BJ5A 2R7OA 1O87A 1TWAA 2YHSA 2J0WA 4OIRF 5DS4A 5CI8A 3JSZA 2J45A 5E33A 4I1MA 1D1AA 3LS0A 3PMRA 2KNHA 1Z6AA 4G7OF 3EPVA 4O79A 1M2OA 3AG1C 2ZXRA 4YT4A 3W2VA 3H65A 4PK4A 2R7SA 3EGDA 2OCCC 3UMHA 4OINF 2IOQA 3ASOC 4XWJA 3B0PA 2R7UA 4DBRA 3ABLC 3O39A 3DM9B 1NG1A 3FHDA 2V3CC 1ZU4A 1VK5A 3RFYA 3B9QA 2H7VC 3LS1A 1MMAA 4K0DA 4IWBA 2D5RB 3CSKA 4ANJA 3I5PA 2DYSC 5DQTA 3EFOB 3JRTA 4IAOA 5DLJA 3ITFA 5T3WA 2IYLD 3HTKC 2J46A 1G8XA 3QMKA 2I8BA 3K1HA 1ZHYA 3SNHA 4KNWA 3DM5A 1PD0A 4LLCA 4C3BA 4YT2A 5F5HA 2R7QA 3Q6MA 3N0TA 5DS5A 2WVQA 4CSAC 1ZHXA 2PF4E 2XL4A 2EIMC 4U5GA 4AE4A 5EGYA 1MNDA 2CW0F 3X2QC 3UGPA 3NRHA 2VB6A 4J30B 2W9YA 3K1IC 2M4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9Y A; 
#chains in the Genus database with same CATH topology
 1OR2 A;  4E0H A;  3LNR A;  3U9J A;  3CQZ A;  2XXA A;  1H9G A;  4QI2 A;  4MND A;  4NCQ A;  1SR2 A;  3PDM P;  2Y69 C;  3HNK A;  3TD7 A;  4OIQ F;  4EBK A;  1LE2 A;  5HSW A;  3J06 A;  256B A;  1CPQ A;  4GYT A;  4NY3 A;  2HKV A;  5COG A;  3S0X A;  2CGE A;  1JPJ A;  2QTV A;  5COF A;  2W45 A;  2KYH A;  4I1O B;  4DRJ B;  2AP3 A;  3EZH A;  1IW7 F;  3WAQ A;  2P1A A;  1F1M A;  2JX0 A;  1SZI A;  1HY5 A;  4JKV A;  4FWV A;  1OCR C;  4U5F E;  4A4A A;  2NUP B;  3JRM O;  4IB4 A;  4JVS A;  2DI3 A;  4LAC B;  5D92 A;  2J9B A;  3IQ6 A;  1OCO C;  2CNW D;  3M1C B;  3ZDL A;  1M6T A;  2L9J A;  1Y4C A;  4MTO A;  3RQE A;  3S27 A;  4X0R A;  2YL0 A;  2R7R A;  2R03 A;  3NMJ A;  1NBB A;  4J32 B;  4YL3 A;  3SXK A;  4C3E A;  4CIP A;  2A69 F;  4MVZ A;  4YN0 B;  4JUR I;  2XS8 A;  4I3M A;  2JD3 A;  4PJM A;  1GS9 A;  3HJC A;  1QZX A;  4NTF A;  1Y6D A;  3AG3 C;  4MW8 A;  1QKR A;  2IXP A;  3MBG A;  3EFO A;  2G62 A;  4GEH A;  1VYK A;  4HEA J;  5BUO A;  3EGX A;  2QY9 A;  3L0I A;  2DGJ A;  1YYJ A;  4LDQ A;  2L6H A;  1K04 A;  4IJJ A;  2X0C A;  1C02 A;  4MVU A;  1E83 A;  2A6H F;  4XPX A;  1A7V A;  2YL7 A;  1C03 A;  1A7E A;  2Y3H A;  2DB4 A;  3ZG1 A;  4OIP F;  2WL8 A;  5FCL A;  2AVK A;  3EJN A;  5L0C A;  3ASN C;  3EH2 A;  1VLT A;  4AX2 A;  2G3V A;  1BZ4 A;  2EPM X;  3GOR A;  1PD1 A;  1G4U S;  2EIK C;  3B71 A;  3EG9 A;  4ZLC A;  1WGW A;  1D0Y A;  5BQH A;  4FES A;  1ZW2 A;  3SXM A;  3W4Y A;  1U6H A;  2A68 F;  5JRA A;  1OKK A;  2E87 A;  4DVY P;  2HV7 A;  4HFK B;  4XLN F;  1Z63 A;  3CAX A;  2YZS A;  3EHN A;  5DQZ A;  2HUJ A;  2Q3T A;  3ZVR A;  3POV A;  4E0I A;  4PFO A;  2PX3 A;  1V4A A;  3M4C A;  1JMW A;  1TFO B;  3KL4 A;  3X1O A;  4IRU A;  3O6X A;  3I4U A;  1AVO B;  2XLE A;  1QLE C;  2XS1 A;  1ZHZ A;  2BE5 F;  5BQG A;  3SEO A;  4DVZ A;  2AWY A;  3JCU Q;  4MVM A;  5EHH A;  4CSA A;  4CS9 C;  2V26 A;  2J7P A;  4JCH A;  4XLP F;  1V54 C;  1PCX A;  4G7Z F;  4HFF B;  3LLI A;  2WZG A;  4JTA B;  2R02 A;  1PV3 A;  1TWC A;  4YWQ A;  3K1I A;  1H7I A;  2EIN C;  4PAC A;  4PR9 A;  4NQF A;  4N6H A;  1FFT C;  3Q7L A;  3DD7 A;  3LJB A;  1RKE A;  2Q4F A;  1TWG A;  1QSP A;  4CS8 C;  2LFD A;  4E7Z A;  3NYL A;  5JUA A;  1SYQ A;  3V5Y A;  4BEM J;  4CS7 A;  4U5B E;  2NUT B;  4JRZ A;  4B6I A;  2XSE A;  5B3S C;  3NYM A;  1YVI A;  2Y3B A;  3HNI A;  3EHM A;  3Q6N A;  1E2X A;  3VRC A;  2CYD A;  2IXM A;  1FMW A;  3HNJ A;  4DXW A;  1U0B B;  5JP7 A;  5L0H A;  3TUL A;  2NSF A;  1T5O A;  1YZA A;  4LER A;  1NZE A;  1BR1 A;  4Z9I A;  4CBE A;  3LUT B;  2KJG A;  2PP4 A;  4DBQ A;  4CIH A;  4WJ0 A;  1L3P A;  4O7G A;  3UGO A;  3ZTZ A;  1QVX A;  3T4R A;  1A0B A;  1EA8 A;  2EIJ C;  1RJ9 A;  3BRJ A;  4NTA A;  5JT4 A;  1EKY A;  4EHP A;  3I5Q A;  1YYX A;  3FXH A;  5KYN A;  2H8A A;  2KC3 A;  3UNG C;  3SXZ A;  5B1B C;  1D0X A;  1EQ1 A;  4CX9 A;  4N6C A;  5B1A C;  1J8M F;  3VAY A;  2ETS A;  2R7W A;  2CCY A;  2G3K A;  3G4Z A;  3K66 A;  3RVY A;  2BL2 A;  5KYW A;  5KYX B;  4Q4Z F;  2VC9 A;  2ASR A;  4XPW A;  3LAY A;  2VAS A;  4KI2 A;  3DWW A;  4J7Y A;  1OCZ C;  4RD9 A;  4EIY A;  3T6G B;  4EBB A;  4OIO F;  1HE1 A;  1M2V B;  1ZVZ A;  4N4W A;  3VYW A;  4JW1 A;  3MYI A;  2HJ3 A;  2GFH A;  3H2V A;  3MX3 A;  3DAG A;  4XPY A;  3VM6 A;  2AWC A;  1OXB A;  2BC5 A;  4MVR A;  4U9E A;  1VYI A;  3V7O A;  1JPN A;  2OEV A;  1YJG A;  2Q00 A;  2WZF A;  4MQ9 F;  1AEP A;  3ZC4 A;  4CDY A;  4U5C E;  2W4M A;  3WG7 C;  5KYY B;  1W2W A;  3FAJ A;  1YA9 A;  2H7B A;  1MMG A;  1LIH A;  4FAP B;  1WTY A;  3G4X A;  4IAQ A;  2OJQ A;  2J7P D;  2NPU A;  1SMY F;  1ORY A;  3C8G B;  3QVY A;  3U8V A;  1I4Z A;  2HJM A;  2XLD A;  4JTD B;  3SP1 A;  5CI9 A;  2P7V A;  1T9K A;  5F28 E;  4KBL A;  1BR2 A;  4N06 A;  3DJN B;  1KNY A;  1O5H A;  3QW0 A;  2IXO A;  3ECS A;  4OD4 A;  2WB7 A;  2R7V A;  1A7D A;  1MMD A;  3AGU A;  3NG1 A;  4K7B A;  5D91 A;  2B0H A;  5A69 A;  3U9M A;  4MTF A;  3E9V A;  2KW3 C;  4HE8 D;  4G0H A;  2C03 A;  2Y3D A;  3FOO A;  1TFK B;  1ZYR F;  3C7J A;  3JZ0 A;  2Q7R A;  4CS9 A;  3AQC A;  2L7A A;  2HZ8 A;  1B68 A;  5EK0 A;  3TK0 A;  3GWN A;  1RKC A;  3U3B A;  1RMV A;  3NKE A;  3U2L A;  1RXQ A;  3MLG A;  4BPM A;  2B0J A;  2LQG A;  2KQ9 A;  5E2Q A;  3EGD B;  4WAB A;  3SXY A;  3W2W A;  2YKZ A;  1ZHW A;  1E86 A;  1CGO A;  1J8Y F;  2WVN A;  4PFP A;  4U9D A;  4CS8 A;  2FFH A;  4MVS A;  2XLM A;  4EKW A;  1WAT A;  3QVZ A;  3AOU A;  4LLE A;  3NDB B;  1NU7 D;  4E7S A;  4P9F A;  2Z15 A;  1RCP A;  5AC5 A;  5KYU B;  2VH3 A;  1NLX A;  4XEK A;  1JOG A;  2F22 A;  5CIV A;  1M57 C;  1Z5Z A;  4DRH B;  3B0V C;  1Q0K A;  2ZXO A;  2OJE D;  2Y39 A;  2XM0 A;  3ABK C;  3B29 A;  1NFN A;  3QTH A;  2P61 A;  2EPN A;  3GOD A;  4K1O A;  4DOZ A;  3S84 A;  2LFF A;  2IM8 A;  2YRF A;  1Z23 A;  3EQL F;  3KKB A;  2NG1 A;  5JS5 A;  1D0Z A;  2HS5 A;  2OG2 A;  4EBJ A;  3HNL A;  3EZI A;  2UUH A;  3ABM C;  3LNM B;  3NKD A;  4CJO A;  2JPU A;  3TJ5 A;  1JAF A;  5JVE A;  2OOC A;  4RBN A;  1LVK A;  5AGF A;  2QUP A;  4D4X A;  5F5F A;  3TOL A;  4LDK A;  4YL1 A;  3W8I A;  2ZD9 A;  3U5S A;  1O3U A;  3BEH A;  1FR0 A;  3FMS A;  4W8K A;  3U2M A;  2TMV P;  3K7D A;  1DOW A;  2L6G A;  1HW2 A;  3LLK A;  2R9R B;  1YLM A;  1VTM P;  1YZC A;  1LE4 A;  3O55 A;  1FAP B;  3IEE A;  3TOM A;  4A2N B;  1NSG B;  3KMI A;  3A11 A;  4U5H A;  3PCV A;  4Z9H A;  1ST6 A;  2YL3 A;  2LD6 A;  5A6K A;  2XM4 A;  2NUP A;  4AE4 B;  2GDC A;  2YL1 A;  3R2P A;  3AQB A;  3JSE O;  4XEV A;  5T3T A;  3W8H A;  4D4N A;  2LIG A;  4BJ1 A;  3RIP A;  3Q7G A;  3L8I A;  4E17 A;  2PFD A;  1LKX A;  4QI0 A;  3ZTM A;  5L3Q A;  4C7O B;  1YAU O;  3GAN A;  3C8Z A;  3K6B A;  1OW7 A;  3KH2 A;  3KYI A;  3NYJ A;  4BJT A;  1GM5 A;  2XXA B;  1MMN A;  1S05 A;  1S7Z A;  1UG7 A;  1MQV A;  2IXN A;  1OQC A;  3DJU B;  3LEO A;  3S29 A;  5L0G A;  1V74 B;  2R7X A;  2RSE B;  2O9X A;  3N2Z B;  2VCA A;  3U0C A;  2ICW G;  4UDV A;  4W8P A;  5B3I A;  2A1D D;  2W4B A;  1OXK A;  1FFH A;  1VOM A;  2H7O A;  4U5D E;  1M56 C;  3AG2 C;  3JYY A;  3S28 A;  3L1M A;  2YQY A;  4JCZ A;  2A6E F;  3JYH A;  4IGG A;  2P0N A;  3A9C A;  3GM3 A;  5JSL A;  1TKN A;  2OEX A;  2WVO A;  3ATP A;  3DE9 A;  2XRH A;  4PJN A;  1GQA A;  1T6U A;  3C62 A;  1Z3I X;  5DVW A;  3R7C A;  2J9U A;  3HLZ A;  3ZWI A;  2EPK X;  1G4W R;  2MHR A;  4O6N A;  5T1D B;  5KYU A;  2CNW A;  4GQH A;  2WZL A;  4BJ6 A;  3LEV A;  4YJW A;  2EPO A;  2Q9A A;  3SYN A;  1D1B A;  3FVY A;  3ZSU A;  1SF8 A;  4KNV A;  1NU9 C;  2PNO A;  3AG4 C;  3IQ5 A;  5L0D A;  2J9V A;  5GPG B;  2DYR C;  2XLV A;  4I44 A;  4EWC A;  2YVK A;  3L8J A;  1G5Z A;  3EH1 A;  1XZP A;  4H4K C;  1XWJ A;  1HMD A;  2YLD A;  2MWQ A;  4XTK A;  3ZQV A;  1LM3 B;  2Y3G A;  4Z9J A;  4BJ5 C;  4DRI B;  1OKK D;  2HMQ A;  2PX0 A;  3EGX B;  1I4Y A;  5DS6 A;  3UMI A;  1E84 A;  1K40 A;  2AU5 A;  3GEE A;  4YT5 A;  4CDA A;  3CEX A;  4JC7 A;  4Q5S F;  2J9W A;  3RYL A;  4G7H F;  3T6B A;  2QE9 A;  2XL6 A;  4MVQ A;  1ZZP A;  1APC A;  4XEF A;  3E70 C;  3SZR A;  2L81 A;  5E3C A;  1WWP A;  5A6A A;  3OEO A;  1FTS A;  3QZC A;  2Q9C A;  3RVZ A;  1NFO A;  4E18 A;  1Q0F A;  1BR4 A;  1V55 C;  3TJ6 A;  1OR3 A;  3M4B A;  3EG9 B;  4P6I C;  4KC9 A;  4YT8 A;  1HE9 A;  1ZU5 A;  2LSE A;  4L6R A;  4PJJ A;  1KTM A;  3MYF A;  3DI5 A;  1ZW3 A;  2I15 A;  4JZA A;  3LES A;  3IQT A;  4BEJ A;  1VMA A;  3DXJ F;  4O6Y A;  4FX5 A;  1YA7 O;  2GA0 A;  2OQM A;  4Q7C A;  4BG0 A;  2R7T A;  3KPH A;  3L34 A;  3N24 A;  4C7O A;  2NUT A;  2ZPA A;  3UR3 C;  4F4B A;  2J0X A;  3RKO F;  2GAQ A;  3GM1 A;  2X51 A;  3O10 A;  2HV6 A;  2XLW A;  2PBE A;  1WN0 A;  4O6M A;  3UMK A;  1A41 A;  3OWT A;  4BJ6 C;  2IBF A;  4PJL A;  5IY5 C;  2XLH A;  2YEV A;  4RDA A;  4M63 A;  1LS1 A;  2FGY A;  2EIL C;  2KGO A;  1FMV A;  1QQ3 A;  3JTL O;  1ORJ A;  2C04 A;  1TWH A;  3K33 A;  3KYJ A;  4U5E E;  1XZQ A;  3OA1 A;  2EPL X;  3S90 A;  1IZM A;  4C3D A;  3FDQ A;  1K05 A;  3HKK A;  1RKE B;  2MYS A;  3T6J A;  2L6F A;  2A0U A;  1ORS C;  1AUE A;  5HV9 A;  1MNE A;  1Q0D A;  4EUK B;  2J8W A;  3CZ6 A;  3H2U A;  5KYX A;  3JT1 A;  1VB5 A;  1OW6 A;  5AC4 A;  1U89 A;  3T9O A;  3F46 A;  4AK9 A;  3M15 A;  2A0B A;  2FAP B;  2LP4 A;  5A6B A;  3GM2 A;  3ZIB A;  3DE8 A;  1M2V A;  4JJF A;  1LI5 A;  1TR2 A;  5L3V A;  1KU2 A;  4G78 A;  3F47 A;  4J7T A;  3IPM O;  4P9T A;  2ZXW C;  2KSF A;  1OCC C;  2P6V A;  3NMK A;  3DAF A;  3WOD F;  3IQC A;  1HMO A;  2HFI A;  2ZXP A;  3DZA A;  1RJ9 B;  2UUI A;  4JJG A;  4MTG A;  3RH3 A;  3B0U X;  4ZLD A;  1D1C A;  3DMD A;  1LI7 A;  5KYY A;  3IHU A;  1VLS A;  3FOP A;  3QW1 A;  1CGN A;  1N1C A;  4OD5 A;  4ULW A;  1ZHT A;  5E3A A;  2CDQ A;  3M79 A;  4QDL A;  1E85 A;  4AL1 A;  2NSG A;  4MW3 A;  2GWW A;  4NTB A;  3PHF 2;  1EI7 A;  4AL0 A;  2Q9B A;  5KYW B;  1I5N A;  4CDV A;  1UFB A;  3C8G A;  4BJ5 A;  1HW1 A;  1WAS A;  2R7O A;  4ER9 A;  2QNL A;  1O87 A;  1TWA A;  2YHS A;  2J0W A;  3NMI A;  4JE9 A;  1BBH A;  4OIR F;  5DS4 A;  2XLO A;  3ZQY A;  2VCC A;  3RQF A;  5CI8 A;  5L0F A;  4JTC B;  3FAP B;  1LS4 A;  3JSZ A;  2J45 A;  1YDI A;  5E33 A;  4I1M A;  3V5X A;  1D1A A;  4LDR A;  3LS0 A;  3PMR A;  2KNH A;  2XL8 A;  1BDJ B;  2YLI A;  1Z6A A;  1JRA A;  4G7O F;  3EPV A;  2HMZ A;  1M2O A;  3AG1 C;  2ZXR A;  4JEB A;  4O79 A;  2OKU A;  4YT4 A;  3W2V A;  5A6J A;  1T6Q A;  1T01 A;  2KK1 A;  3H65 A;  1Z7Q c;  3U3F A;  1T6I A;  3AGT A;  4DJ9 A;  4PK4 A;  5L0I A;  2R7S A;  3EGD A;  2OCC C;  1H9T A;  2VCB A;  2OU6 A;  4WGY A;  3UMH A;  5L0J A;  3GEH A;  4OIN F;  2IOQ A;  2YLG A;  3ASO C;  4XWJ A;  2HSB A;  1R4T A;  3B0P A;  4ULV A;  2R7U A;  3US6 A;  1Q0G A;  3RW0 A;  4DBR A;  3ABL C;  3O39 A;  5TJ5 E;  2HSQ A;  3DM9 B;  1DOV A;  1NG1 A;  3FHD A;  1OW8 A;  1GGQ A;  1JR8 A;  4H54 A;  1ZU4 A;  4XQ1 A;  1VK5 A;  5FZT A;  3TQO A;  3VF0 A;  3RFY A;  2V3C C;  3B9Q A;  3DKA A;  3GWL A;  2H7V C;  3C18 A;  3LS1 A;  5JLI A;  1MMA A;  2R05 A;  4K0D A;  4IWB A;  2D5R B;  3CSK A;  3RF3 A;  4ANJ A;  3I5P A;  4WGZ A;  1R5I D;  5A6B D;  2DYS C;  3U8P A;  5DQT A;  5BQI A;  4YL0 A;  1CGM E;  3EFO B;  3JRT A;  1YAR O;  1C17 M;  3MFN A;  4IAO A;  2LCH A;  2M64 A;  4IAR A;  3GEI A;  5DLJ A;  3G50 A;  3ITF A;  3AJM A;  5T3W A;  2R25 A;  2IYL D;  3HTK C;  4JEA A;  2J46 A;  3RQG A;  4MS2 A;  1G8X A;  2QLA A;  3QMK A;  4YK5 A;  2I8B A;  4CJG A;  1LPE A;  1ZHY A;  3K1H A;  1H6G A;  3SNH A;  3WHN A;  1FNT c;  4KNW A;  1PD0 A;  3DM5 A;  4LLC A;  4C3B A;  4YT2 A;  5F5H A;  3S9O A;  3C8G D;  4NC3 A;  2R7Q A;  1L7C A;  1TQG A;  3Q6M A;  2YWA A;  3N0T A;  3C63 A;  2RD9 A;  2WVQ A;  5COM A;  5DS5 A;  4CSA C;  1ZHX A;  1QPU A;  3V5Z A;  2PF4 E;  2XL4 A;  2EIM C;  4MVO A;  4ONS A;  4U5G A;  2LK4 A;  4AE4 A;  5EGY A;  5K0I A;  1MND A;  2CW0 F;  3X2Q C;  3UGP A;  2D4U A;  2VB6 A;  3NRH A;  4J30 B;  4R32 A;  2W9Y A;  3K1I C;  4JIO A;  1CPR A;  1Q0M A;  1WOL A;  2M4E A; 
#chains in the Genus database with same CATH homology
 3LNR A;  2XXA A;  3CQZ A;  4QI2 A;  4MND A;  2Y69 C;  3TD7 A;  4OIQ F;  5HSW A;  4GYT A;  4NY3 A;  3S0X A;  2CGE A;  1JPJ A;  2QTV A;  2W45 A;  4I1O B;  3EZH A;  1IW7 F;  1SZI A;  4FWV A;  1OCR C;  4U5F E;  2NUP B;  4JVS A;  4LAC B;  5D92 A;  1OCO C;  2CNW D;  3M1C B;  2L9J A;  3S27 A;  4X0R A;  2R7R A;  4J32 B;  4C3E A;  2A69 F;  4YN0 B;  4JUR I;  4I3M A;  2JD3 A;  4PJM A;  3HJC A;  1QZX A;  3AG3 C;  2IXP A;  4GEH A;  3EFO A;  2G62 A;  1VYK A;  4HEA J;  5BUO A;  3EGX A;  2QY9 A;  3L0I A;  2DGJ A;  4IJJ A;  2A6H F;  2Y3H A;  3ZG1 A;  4OIP F;  2WL8 A;  5FCL A;  3EJN A;  3ASN C;  3EH2 A;  4AX2 A;  2G3V A;  1PD1 A;  2EIK C;  3EG9 A;  4ZLC A;  1WGW A;  1D0Y A;  4FES A;  2A68 F;  1OKK A;  2E87 A;  4DVY P;  2HV7 A;  4HFK B;  4XLN F;  1Z63 A;  2YZS A;  3EHN A;  5DQZ A;  2Q3T A;  3ZVR A;  3POV A;  4PFO A;  2PX3 A;  3KL4 A;  3X1O A;  4IRU A;  3O6X A;  3I4U A;  4DVZ A;  3SEO A;  1QLE C;  1ZHZ A;  2BE5 F;  5EHH A;  4CSA A;  3JCU Q;  4CS9 C;  2V26 A;  2J7P A;  4JCH A;  4XLP F;  1V54 C;  1PCX A;  4G7Z F;  4HFF B;  3LLI A;  2WZG A;  4YWQ A;  1TWC A;  2EIN C;  1FFT C;  3Q7L A;  3DD7 A;  3LJB A;  1TWG A;  4CS8 C;  4E7Z A;  3NYL A;  4CS7 A;  4U5B E;  2NUT B;  4B6I A;  2XSE A;  5B3S C;  3NYM A;  2Y3B A;  3EHM A;  3Q6N A;  2IXM A;  1FMW A;  4LER A;  4CBE A;  1NZE A;  1BR1 A;  4DBQ A;  2KJG A;  2PP4 A;  4WJ0 A;  4O7G A;  3UGO A;  3T4R A;  2EIJ C;  1RJ9 A;  3I5Q A;  5KYN A;  3UNG C;  5B1B C;  1D0X A;  5B1A C;  1J8M F;  3VAY A;  2R7W A;  2G3K A;  3K66 A;  5KYX B;  5KYW A;  4Q4Z F;  3LAY A;  2VAS A;  4KI2 A;  1OCZ C;  4RD9 A;  4EBB A;  4OIO F;  1M2V B;  3VYW A;  4JW1 A;  2GFH A;  3MX3 A;  3DAG A;  3V7O A;  1VYI A;  1JPN A;  2WZF A;  4MQ9 F;  3ZC4 A;  4U5C E;  2W4M A;  3WG7 C;  5KYY B;  1W2W A;  3FAJ A;  2H7B A;  1MMG A;  2J7P D;  1SMY F;  3SP1 A;  5CI9 A;  2P7V A;  4KBL A;  1BR2 A;  4N06 A;  3DJN B;  1O5H A;  4OD4 A;  2IXO A;  3ECS A;  2R7V A;  2WB7 A;  4K7B A;  1MMD A;  3NG1 A;  5D91 A;  3E9V A;  2KW3 C;  4HE8 D;  4G0H A;  2C03 A;  2Y3D A;  1ZYR F;  4CS9 A;  3AQC A;  3NKE A;  3MLG A;  2B0J A;  2KQ9 A;  5E2Q A;  3EGD B;  3W2W A;  1ZHW A;  2WVN A;  1J8Y F;  4PFP A;  4CS8 A;  2FFH A;  4LLE A;  3NDB B;  1NU7 D;  4E7S A;  2Z15 A;  5KYU B;  2VH3 A;  1M57 C;  1Z5Z A;  3B0V C;  2ZXO A;  2Y39 A;  3ABK C;  3GOD A;  4DOZ A;  1Z23 A;  3EQL F;  3KKB A;  2NG1 A;  1D0Z A;  2OG2 A;  3EZI A;  3ABM C;  3NKD A;  4RBN A;  1LVK A;  5F5F A;  3W8I A;  4W8K A;  3K7D A;  3LLK A;  4A2N B;  3IEE A;  3KMI A;  4U5H A;  1ST6 A;  2NUP A;  4AE4 B;  3AQB A;  3W8H A;  5T3T A;  4BJ1 A;  3RIP A;  3Q7G A;  2PFD A;  1LKX A;  4QI0 A;  5L3Q A;  4C7O B;  3GAN A;  3K6B A;  3KH2 A;  3NYJ A;  4BJT A;  2XXA B;  1MMN A;  1S7Z A;  2IXN A;  3DJU B;  3S29 A;  2R7X A;  2O9X A;  3N2Z B;  2A1D D;  2W4B A;  1VOM A;  1FFH A;  2H7O A;  4U5D E;  1M56 C;  3AG2 C;  3S28 A;  2A6E F;  3JYH A;  1TKN A;  2WVO A;  4PJN A;  4CIH A;  2XRH A;  5DVW A;  1Z3I X;  2J9U A;  3HLZ A;  4O6N A;  5T1D B;  5KYU A;  2CNW A;  2WZL A;  4BJ6 A;  3LEV A;  4YJW A;  2Q9A A;  3SYN A;  1D1B A;  3FVY A;  3ZSU A;  1SF8 A;  4KNV A;  1NU9 C;  3AG4 C;  2J9V A;  2DYR C;  4I44 A;  4EWC A;  3EH1 A;  4H4K C;  2MWQ A;  4XTK A;  2Y3G A;  4BJ5 C;  1OKK D;  2PX0 A;  3EGX B;  5DS6 A;  3UMI A;  4YT5 A;  4Q5S F;  2J9W A;  3RYL A;  4G7H F;  3T6B A;  3E70 C;  3SZR A;  2L81 A;  5E3C A;  3OEO A;  1FTS A;  3QZC A;  2Q9C A;  1BR4 A;  1V55 C;  3EG9 B;  4P6I C;  4KC9 A;  4YT8 A;  1ZU5 A;  2LSE A;  4PJJ A;  4JZA A;  3LES A;  4BEJ A;  1VMA A;  3DXJ F;  4O6Y A;  4FX5 A;  4BG0 A;  4Q7C A;  2R7T A;  3L34 A;  3N24 A;  4C7O A;  2NUT A;  2ZPA A;  3UR3 C;  4F4B A;  2J0X A;  3RKO F;  2X51 A;  2HV6 A;  4O6M A;  3UMK A;  3OWT A;  4BJ6 C;  4PJL A;  5IY5 C;  2YEV A;  4RDA A;  4M63 A;  1LS1 A;  2FGY A;  2EIL C;  2KGO A;  3K33 A;  1FMV A;  2C04 A;  1TWH A;  4U5E E;  3OA1 A;  1IZM A;  4C3D A;  3FDQ A;  2MYS A;  3T6J A;  1MNE A;  3CZ6 A;  5KYX A;  3JT1 A;  3F46 A;  4AK9 A;  3ZIB A;  1M2V A;  4JJF A;  1TR2 A;  5L3V A;  1KU2 A;  3F47 A;  2ZXW C;  1OCC C;  2P6V A;  3DAF A;  3WOD F;  2ZXP A;  4JJG A;  3DZA A;  1RJ9 B;  3B0U X;  4ZLD A;  3RH3 A;  1D1C A;  3DMD A;  5KYY A;  4OD5 A;  5E3A A;  1N1C A;  4ULW A;  1ZHT A;  2CDQ A;  4QDL A;  3PHF 2;  5KYW B;  2Q9B A;  4BJ5 A;  2R7O A;  1O87 A;  1TWA A;  2YHS A;  2J0W A;  4OIR F;  5DS4 A;  5CI8 A;  3JSZ A;  2J45 A;  5E33 A;  4I1M A;  1D1A A;  3LS0 A;  3PMR A;  2KNH A;  1Z6A A;  4G7O F;  3EPV A;  4O79 A;  1M2O A;  3AG1 C;  2ZXR A;  4YT4 A;  3W2V A;  3H65 A;  4PK4 A;  2R7S A;  3EGD A;  2OCC C;  3UMH A;  4OIN F;  2IOQ A;  3ASO C;  4XWJ A;  3B0P A;  2R7U A;  4DBR A;  3ABL C;  3O39 A;  3DM9 B;  1NG1 A;  3FHD A;  2V3C C;  1ZU4 A;  1VK5 A;  3RFY A;  3B9Q A;  2H7V C;  3LS1 A;  1MMA A;  4K0D A;  4IWB A;  2D5R B;  3CSK A;  4ANJ A;  3I5P A;  2DYS C;  5DQT A;  3EFO B;  3JRT A;  4IAO A;  5DLJ A;  3ITF A;  5T3W A;  2IYL D;  3HTK C;  2J46 A;  1G8X A;  3QMK A;  2I8B A;  3K1H A;  1ZHY A;  3SNH A;  4KNW A;  3DM5 A;  1PD0 A;  4LLC A;  4C3B A;  4YT2 A;  5F5H A;  2R7Q A;  3Q6M A;  3N0T A;  5DS5 A;  2WVQ A;  4CSA C;  1ZHX A;  2PF4 E;  2XL4 A;  2EIM C;  4U5G A;  4AE4 A;  5EGY A;  1MND A;  2CW0 F;  3X2Q C;  3UGP A;  3NRH A;  2VB6 A;  4J30 B;  2W9Y A;  3K1I C;  2M4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...