2W9YA

The structure of the lipid binding protein ce-far-7 from caenorhabditis elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
135
Chain Sequence
GAMSVASLPEVKNFFPTEQLEFSSSITADEKPVLHEVFQKHSCGEMIDEVSKKHPELGKRLATVLEGNKKRLDGLSPAAVEYAKKLIHMVTTTLCSLTVGKPIDDADAKRLHQEFQSLSSEDQAALRKNNPDIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID/RETINOL BINDING PROTEIN PROTEIN 7, ISOFORM A, CON
publication title Fatty Acid and Retinoid Binding Proteins Have Distinct Binding Pockets for the Two Types of Cargo
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Lipid transport
total genus 52
structure length 135
sequence length 140
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05823 Gp-FAR-1 Nematode fatty acid retinoid binding protein (Gp-FAR-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1100 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w9yA00
2W9YA
chains in the Genus database with same CATH superfamily
1C03A 2PP4A 1NZEA 1FTSA 3O10A 1N1CA 5B1AC 1T9KA 3SEOA 2OEVA 4CJGA 4ER9A 4PACA 3ASOC 3LAYA 1JPJA 2TMVP 4MVZA 3W2WA 1AVOB 1Q0FA 3WG7C 2MWQA 4GEHA 5IY5C 1LIHA 3LJBA 3Q7LA 2R7QA 3LEOA 3HNIA 2IBFA 4M63A 4CS8C 1ZW3A 2LIGA 3SNHA 2HJMA 4U5BE 4BJTA 3UGOA 1MQVA 2XL4A 2J9VA 2EPKX 4KI2A 3EG9B 3MYIA 1JOGA 1QVXA 2XLDA 5GPGB 4YK5A 3S28A 2R7XA 2HV6A 4LACB 1VTMP 4Z9HA 3S29A 4AK9A 3C8GA 4CJOA 3PHF2 1FFHA 4MTOA 4JCZA 2YVKA 2GWWA 2XLWA 4HEAJ 4O79A 3T6GB 4O7GA 4AL1A 1PV3A 4E0IA 3ZSUA 1JR8A 4OIRF 3V5XA 4IB4A 3TOLA 3L0IA 2VH3A 4H4KC 2Q9BA 5DLJA 1HW1A 3JYHA 1GM5A 5A6JA 1D1BA 2P7VA 4OD5A 3M15A 2I15A 2EIJC 4U9DA 2QY9A 4I44A 1EQ1A 3QW1A 1YA7O 2XM4A 2YLDA 3HJCA 1G4US 5DS5A 2NPUA 2Y3DA 1W2WA 3C18A 3GWLA 2D4UA 2EINC 4YT2A 3N2ZB 2JX0A 1PD1A 1ZU5A 3DE9A 1Z3IX 2YZSA 1YARO 2WZFA 2WZLA 4DRIB 2QTVA 3TK0A 4PJMA 1TQGA 2OEXA 1ZHTA 4AX2A 5L0GA 1HE1A 1OCZC 4LLEA 2J7PA 2XRHA 3HNJA 5JVEA 1R4TA 1HE9A 5D91A 2F22A 1KU2A 3NMIA 3C8GB 1K05A 5KYYA 1OCOC 1HW2A 3ATPA 3FOOA 5JSLA 4FAPB 1H9TA 2VCBA 4IAOA 1RCPA 1EKYA 2HSBA 4PK4A 4JTCB 3IQ5A 2H7OA 3X2QC 1KTMA 5T3TA 2H7BA 1A7DA 3LEVA 3EH2A 3LLIA 2YKZA 5TJ5E 4WJ0A 1JRAA 4Q7CA 2Q7RA 3ZG1A 1BBHA 3G50A 2L6GA 4CBEA 3RF3A 1T01A 4DRHB 4NY3A 3GM1A 2BL2A 4NTBA 5JUAA 2XXAA 4KBLA 2A68F 1MMNA 5A6BA 3IQ6A 1WOLA 3AG4C 2JPUA 4IWBA 3ABMC 4DXWA 1E83A 5F5FA 2CCYA 1Q0DA 3DM9B 3EZIA 3ZTMA 5BQHA 1ZVZA 4YT4A 4BJ6A 1LE4A 1QZXA 4KNWA 1PCXA 3QVYA 4P6IC 1WTYA 5L0FA 3J06A 2EPMX 2HKVA 2LK4A 1OXKA 3GODA 3GWNA 4ZLCA 3DE8A 2IXMA 2R02A 3C8GD 3OA1A 2IXOA 3OEOA 1YA9A 3G4XA 1G8XA 3TJ5A 2R7WA 3SZRA 3Q6MA 4PFOA 4CX9A 1SYQA 2XLEA 2I8BA 1SZIA 2OQMA 2WB7A 3JSEO 2DGJA 3CSKA 4MQ9F 4D4XA 3S0XA 1ZZPA 2ZXRA 1BZ4A 3ABKC 4XTKA 5T1DB 3RKOF 3RVYA 3SYNA 5COFA 1Z63A 4MNDA 4IRUA 1V55C 4K7BA 1XWJA 3KYIA 3M4CA 4U5DE 3U9JA 1FFTC 3RVZA 4AL0A 1CGOA 2YLIA 1V54C 1H7IA 1OCRC 4PJJA 4IJJA 4NTAA 5AGFA 4HFKB 2HZ8A 4NQFA 4C3BA 5EHHA 2XXAB 2H8AA 5HSWA 2E87A 2GA0A 1K40A 1T5OA 3EZHA 1OCCC 4PR9A 3LS1A 1YZAA 4OD4A 3DAGA 3RIPA 2LQGA 5A6AA 1LS1A 1QQ3A 3HNKA 3Q7GA 4MW8A 4J7YA 5BQGA 1QSPA 3UMHA 4CS7A 3Q6NA 4BEJA 1Q0MA 2VB6A 3RYLA 2CW0F 3GORA 2J7PD 2QLAA 4WGYA 3EG9A 1IW7F 3KH2A 3JYYA 3K1IC 3L8IA 4IARA 4FWVA 4JCHA 3I5PA 4GYTA 4OINF 2ZXWC 2M64A 3AQCA 1BR2A 3F47A 3UR3C 1YJGA 1M2VB 4XEVA 4E7ZA 3ZWIA 1D0XA 2AP3A 2FAPB 2L81A 3E9VA 3LNMB 4MW3A 5E3AA 3OWTA 1OXBA 2IOQA 3FOPA 4B6IA 3EFOB 5A6KA 2CYDA 1VYKA 2OKUA 2NUPB 1A7EA 4BPMA 3SXYA 1MNDA 2EPLX 4J30B 3T6BA 2YLGA 4A4AA 1YYJA 2HV7A 3MYFA 5K0IA 4DJ9A 1V4AA 4LDQA 2C04A 3C7JA 3WAQA 1LPEA 3LESA 2LFFA 2W45A 4U5HA 3ZC4A 4ANJA 3I5QA 5KYUA 4EUKB 1SMYF 4OIQF 2EIMC 2RD9A 4RDAA 3U8PA 5JRAA 3TULA 1V74B 2A6HF 1GQAA 3B9QA 2PFDA 4OIOF 5FZTA 4G7HF 4D4NA 3NYLA 2YQYA 1E2XA 1NFOA 3ZQVA 1VMAA 4E7SA 3UGPA 4W8KA 3HLZA 2PX0A 3A11A 4KNVA 2ASRA 1DOWA 2M4EA 1D1CA 2VASA 2VCCA 2A6EF 3C62A 2VCAA 4LERA 2AWYA 1BDJB 4JKVA 4NCQA 2Q4FA 3W8IA 2W9YA 3S27A 3CQZA 3PCVA 1TKNA 3UNGC 3WODF 5EK0A 4JJGA 1RKCA 3U3FA 5DS4A 2EIKC 1TWCA 2OJQA 1ORYA 1EA8A 1UFBA 3FMSA 1FNTc 3AJMA 3FAPB 3RW0A 3JSZA 3QZCA 4MVMA 4CS9C 4UDVA 2G62A 3ZVRA 3W2VA 1D1AA 2OCCC 3FVYA 1VB5A 3EGDB 2P6VA 3GEIA 5KYUB 1A7VA 4Z9IA 4C3DA 1QLEC 2LFDA 3EGXB 4MVSA 3SXMA 3A9CA 2A0UA 2J0XA 2R05A 5CI8A 1YZCA 4P9FA 3ZTZA 3DKAA 1OR3A 1TFKB 2WL8A 4PJLA 2AWCA 1LKXA 2L9JA 2XS8A 1U6HA 3AQBA 4K1OA 4A2NB 1S7ZA 3EQLF 2HUJA 1I5NA 1NU9C 3IHUA 1SR2A 1TWAA 1OKKA 3IQCA 4EBJA 2J8WA 3R7CA 3ZQYA 3BRJA 1T6QA 3ITFA 2C03A 3GANA 2YL0A 3U0CA 1F1MA 3V5YA 2LP4A 1A0BA 4N6HA 1CGME 4U5EE 5E2QA 4BJ5C 5L3VA 3EH1A 1LI5A 2HS5A 2FFHA 1YDIA 4MVQA 5DS6A 1MMDA 4L6RA 2J9WA 1NBBA 5JT4A 3HKKA 3KL4A 3N0TA 4MTFA 3EJNA 1CPQA 3C63A 4CDYA 5A69A 2OG2A 5DQZA 3ABLC 3K6BA 2R7SA 3WHNA 5F5HA 3DI5A 4J7TA 3KPHA 1SF8A 2J9UA 4KC9A 1D0YA 1E85A 1RMVA 1EI7A 4LLCA 1I4ZA 1OW7A 2Q3TA 2OU6A 2ZXOA 3DD7A 3L1MA 4JRZA 4FX5A 5COGA 4U5FE 3K1IA 1IZMA 3FDQA 4MVUA 4MVRA 3G4ZA 2NSGA 3W4YA 2B0HA 2J46A 3RQGA 5CI9A 4MVOA 4CIHA 3O39A 4DVYP 4ULVA 5L0IA 1R5ID 4JVSA 2YEVA 3POVA 2H7VC 4P9TA 1FMWA 2XS1A 5JS5A 3DXJF 4RBNA 1NFNA 4R32A 1TFOB 2MHRA 4CSAC 3GM3A 1M2VA 1O87A 3VF0A 1OW8A 4PJNA 1ZYRF 1WASA 3BEHA 1T6UA 1LE2A 3EFOA 2NUPA 3U2MA 2LSEA 2DYRC 1C02A 2NSFA 1VOMA 1AUEA 2XLMA 2PX3A 4J32B 2KGOA 3EHMA 1MMGA 2ETSA 1BR1A 3JTLO 5KYXA 3AGUA 3FHDA 5L3QA 1T6IA 1Y6DA 4CS8A 3JRMO 1YAUO 3VRCA 1J8MF 2NG1A 3B0UX 1KNYA 4DVZA 3S84A 4U5GA 4XPWA 3QW0A 4E17A 3DMDA 4I3MA 3NYJA 3AG3C 2R7TA 4NC3A 1APCA 3NKDA 2GFHA 3K1HA 4JW1A 5AC5A 1Y4CA 4XEKA 4AE4A 2XLOA 3NG1A 3UMIA 4C3EA 2YWAA 1M6TA 2RSEB 2DI3A 3T6JA 5D92A 4CDVA 3DWWA 2Q00A 2IM8A 3T9OA 1UG7A 3CEXA 4G78A 4CS9A 3B29A 1Z7Qc 1GGQA 2UUIA 1PD0A 2Y3BA 5T3WA 4EKWA 3MFNA 4XLPF 2XM0A 4WGZA 3AG2C 3B0PA 3NYMA 4IAQA 2A1DD 2QUPA 2Z15A 2V26A 3W8HA 1U0BB 2BE5F 3AGTA 3M4BA 1FR0A 4YL1A 1O3UA 3QMKA 3EGDA 3UMKA 1QPUA 3EGXA 1OR2A 5A6BD 3JT1A 1C17M 2DB4A 1ZHXA 3NRHA 4I1OB 4O6NA 4PFPA 3TD7A 2Q9CA 2W4MA 2XL6A 1HMOA 1TWGA 4HE8D 4DBRA 1WATA 4XPYA 3FAJA 4IGGA 3TJ6A 4AE4B 5KYWA 4HFFB 3B0VC 3PMRA 1Q0KA 2Y3HA 1LI7A 3TOMA 3S90A 4H54A 3M79A 2NUTA 4GQHA 4YN0B 1JPNA 1WN0A 1ZW2A 2PF4E 3LNRA 4YT8A 1WWPA 5B3IA 1NG1A 1U89A 2PNOA 3DJNB 4FESA 2Y69C 2CNWA 2OOCA 2XSEA 3AOUA 1L3PA 3ASNC 4JEAA 4Q5SF 3SP1A 4YL0A 4E0HA 3R2PA 2YL3A 4F4BA 1VLTA 2DYSC 3LUTB 3HNLA 2V3CC 2R7VA 1OW6A 1K04A 3NKEA 2CDQA 4XPXA 5JLIA 2HJ3A 5KYNA 4JEBA 3NDBB 5B1BC 3K33A 4MS2A 4JZAA 3L8JA 3QVZA 3U9MA 1VYIA 2P61A 4EHPA 4DBQA 3O6XA 1NSGB 3QTHA 1I4YA 5E3CA 2QNLA 2KJGA 3RQEA 2R7UA 2WVOA 5F28E 3ZIBA 5FCLA 5KYWB 1RKEA 2KQ9A 2KYHA 4CSAA 4C7OB 2VC9A 1XZQA 3DZAA 3NMJA 1BR4A 2NUTB 2WVQA 3ECSA 3JCUQ 3U2LA 1M57C 3M1CB 2XL8A 4MTGA 1Z5ZA 4BEMJ 5AC4A 2JD3A 2G3VA 4JE9A 2EPOA 2MYSA 1G5ZA 4W8PA 2Y39A 1M2OA 4N4WA 2AU5A 5L0HA 3PDMP 1YLMA 4WABA 2R9RB 1HY5A 4U5CE 1HMDA 1GS9A 3NMKA 5L0DA 2HSQA 4G0HA 3TQOA 2UUHA 1O5HA 3RH3A 1FMVA 2KK1A 1Q0GA 4XQ1A 2L7AA 2QE9A 4LDRA 4QI0A 4XEFA 3ZDLA 1WGWA 3CAXA 1ST6A 2EILC 2GAQA 4DRJB 3JRTA 1LVKA 2LD6A 3H65A 3KYJA 1S05A 1Z23A 3DM5A 2YHSA 1NU7D 4XWJA 3GEHA 1ORJA 2P1AA 4G7OF 2YRFA 2ICWG 3E70C 4BJ1A 5BQIA 2EPNA 3GM2A 4YL3A 4OIPF 1RKEB 4X0RA 2YL1A 4N06A 1CGNA 1M56C 3MBGA 1AEPA 2FGYA 1L7CA 1RJ9A 2KW3C 1Z6AA 4NTFA 4EBKA 4RD9A 4EIYA 2Y3GA 2J0WA 2X51A 3AG1C 1TR2A 3U5SA 4BG0A 5DVWA 4N6CA 4JJFA 4DOZA 2CNWD 3HTKC 4O6YA 1QKRA 3C8ZA 2Q9AA 3KKBA 4YT5A 2YL7A 1MMAA 256BA 2PBEA 2HMQA 3F46A 2X0CA 2D5RB 3O55A 5JP7A 3VM6A 2G3KA 4O6MA 2WVNA 4Q4ZF 3L34A 1DOVA 4ONSA 1B68A 2ZD9A 2ZPAA 4JC7A 3B71A 4CIPA 2AVKA 5BUOA 1E86A 3LS0A 4XLNF 1XZPA 3LLKA 3SXZA 3DAFA 5B3SC 1NLXA 2XLHA 3CZ6A 3VAYA 4EWCA 1TWHA 2R03A 4YJWA 1G4WR 3KMIA 4I1MA 3US6A 2A69F 1H6GA 1OQCA 4E18A 1OKKD 3VYWA 5KYYB 1JAFA 2BC5A 3IQTA 1MNEA 2IXNA 3IEEA 3N24A 4K0DA 4JURI 4YWQA 1JMWA 5L0CA 1ORSC 2IXPA 4ZLDA 1RJ9B 3U8VA 3X1OA 2L6FA 4G7ZF 3EPVA 3IPMO 4JIOA 3H2VA 2R7RA 2OJED 1ZHWA 4Z9JA 2W4BA 1J8YF 1VK5A 1YYXA 1CPRA 4CDAA 3RFYA 5L0JA 1E84A 1ZU4A 5DQTA 2HFIA 1ZHZA 2O9XA 3U3BA 3MLGA 3V7OA 3H2UA 2KNHA 2L6HA 2P0NA 5CIVA 2WZGA 2J9BA 2KSFA 3SXKA 2KC3A 3EHNA 4JTDB 2LCHA 1H9GA 2A0BA 2GDCA 1RXQA 2HMZA 2ZXPA 4JTAB 2XLVA 1A41A 3V5ZA 5KYXB 1FAPB 2IYLD 4ULWA 4U9EA 2R25A 3JZ0A 3K66A 4BJ6C 4QI2A 2J45A 4EBBA 2CGEA 5E33A 5EGYA 1LM3B 2R7OA 3S9OA 1ZHYA 3RQFA 4LDKA 3DJUB 3K7DA 5COMA 4BJ5A 5HV9A 4C7OA 4QDLA 1YVIA 3MX3A 3FXHA 3GEEA 3I4UA 1LS4A 3T4RA 2B0JA 1VLSA 1D0ZA
chains in the Genus database with same CATH topology
2PP4A 1NZEA 1FTSA 5B1AC 1N1CA 3SEOA 3ASOC 3LAYA 1JPJA 3W2WA 3WG7C 2MWQA 4GEHA 5IY5C 3LJBA 3Q7LA 2R7QA 4M63A 4CS8C 3SNHA 4U5BE 4BJTA 3UGOA 2XL4A 2J9VA 4KI2A 3EG9B 3S28A 2R7XA 2HV6A 4LACB 3S29A 4AK9A 3PHF2 1FFHA 4HEAJ 4O79A 4O7GA 3ZSUA 4OIRF 3L0IA 2VH3A 4H4KC 2Q9BA 5DLJA 3JYHA 1D1BA 2P7VA 4OD5A 2EIJC 2QY9A 4I44A 3HJCA 5DS5A 2Y3DA 1W2WA 2EINC 4YT2A 3N2ZB 1PD1A 1ZU5A 1Z3IX 2YZSA 2WZFA 2WZLA 2QTVA 4PJMA 4AX2A 1ZHTA 1OCZC 4LLEA 2J7PA 2XRHA 5D91A 1KU2A 5KYYA 1OCOC 4IAOA 4PK4A 2H7OA 3X2QC 5T3TA 2H7BA 3LEVA 3LLIA 3EH2A 4WJ0A 4Q7CA 3ZG1A 4CBEA 2XXAA 4NY3A 4KBLA 2A68F 1MMNA 3AG4C 4IWBA 3ABMC 5F5FA 3DM9B 3EZIA 4YT4A 4BJ6A 1QZXA 4KNWA 1PCXA 4P6IC 3GODA 4ZLCA 2IXMA 3OA1A 2IXOA 3OEOA 1G8XA 2R7WA 3SZRA 3Q6MA 4PFOA 2I8BA 1SZIA 2WB7A 2DGJA 3CSKA 4MQ9F 3S0XA 5T1DB 2ZXRA 3ABKC 4XTKA 3RKOF 3SYNA 1Z63A 4MNDA 4IRUA 1V55C 4K7BA 4U5DE 1FFTC 1V54C 1OCRC 4PJJA 4IJJA 5EHHA 2XXAB 4HFKB 4C3BA 5HSWA 2E87A 3EZHA 1OCCC 3LS1A 4OD4A 3DAGA 3RIPA 1LS1A 3Q7GA 4CS7A 3UMHA 3Q6NA 4BEJA 2VB6A 3RYLA 2CW0F 2J7PD 3EG9A 1IW7F 3KH2A 3K1IC 4JCHA 4OINF 4FWVA 3I5PA 4GYTA 2ZXWC 3AQCA 1BR2A 3F47A 3UR3C 1M2VB 4E7ZA 1D0XA 2L81A 3E9VA 5E3AA 3OWTA 2IOQA 4B6IA 3EFOB 1VYKA 2NUPB 1MNDA 4J30B 3T6BA 2HV7A 2C04A 5KYXB 3LESA 4U5HA 3ZC4A 2W45A 4ANJA 3I5QA 5KYUA 4OIQF 1SMYF 2EIMC 4RDAA 2A6HF 3B9QA 2PFDA 4OIOF 4G7HF 3NYLA 4E7SA 1VMAA 3UGPA 4W8KA 3HLZA 2PX0A 4KNVA 2M4EA 1D1CA 2VASA 2A6EF 4LERA 3W8IA 2W9YA 3S27A 3CQZA 1TKNA 3UNGC 3WODF 4JJGA 5DS4A 2EIKC 1TWCA 3JSZA 3QZCA 4CS9C 2G62A 3ZVRA 3W2VA 1D1AA 2OCCC 3FVYA 3EGDB 2P6VA 5KYUB 4C3DA 1QLEC 3EGXB 2J0XA 5CI8A 4PJLA 2WL8A 1LKXA 2L9JA 3AQBA 4A2NB 1S7ZA 3EQLF 1NU9C 1TWAA 1OKKA 3ITFA 2C03A 3GANA 4U5EE 5E2QA 4BJ5C 5L3VA 3EH1A 2FFHA 5DS6A 1MMDA 2J9WA 3KL4A 3N0TA 3EJNA 2OG2A 5DQZA 3ABLC 3K6BA 2R7SA 5F5HA 1SF8A 2J9UA 4KC9A 1D0YA 4LLCA 2Q3TA 2ZXOA 3DD7A 4FX5A 4U5FE 1IZMA 3FDQA 2J46A 5CI9A 4CIHA 3O39A 4DVYP 3POVA 4JVSA 2YEVA 2H7VC 1FMWA 3DXJF 4RBNA 4CSAC 1M2VA 1O87A 4PJNA 1ZYRF 3EFOA 2NUPA 2LSEA 2DYRC 1VOMA 2PX3A 4J32B 2KGOA 3EHMA 1MMGA 1BR1A 5KYXA 3FHDA 5L3QA 4CS8A 1J8MF 2NG1A 3B0UX 4DVZA 4U5GA 2R7TA 3DMDA 4I3MA 3NYJA 3AG3C 3NKDA 2GFHA 3K1HA 4JW1A 4AE4A 3NG1A 3UMIA 4C3EA 3T6JA 5D92A 4CS9A 1PD0A 2Y3BA 5T3WA 4XLPF 3AG2C 3B0PA 3NYMA 3W8HA 2A1DD 2Z15A 2V26A 2BE5F 3QMKA 3EGDA 3UMKA 3EGXA 3JT1A 3TD7A 1ZHXA 3NRHA 4I1OB 4O6NA 4PFPA 2Q9CA 2W4MA 1TWGA 4HE8D 4DBRA 3FAJA 4AE4B 5KYWA 3B0VC 4HFFB 3PMRA 2Y3HA 2NUTA 4YN0B 1JPNA 2PF4E 3LNRA 4YT8A 1NG1A 3DJNB 4FESA 2Y69C 2CNWA 2XSEA 3ASNC 4Q5SF 3SP1A 4F4BA 2DYSC 2V3CC 2R7VA 3NKEA 2CDQA 5KYNA 3NDBB 5B1BC 3K33A 4JZAA 1VYIA 4DBQA 3O6XA 5E3CA 2KJGA 2R7UA 2WVOA 3ZIBA 5FCLA 5KYWB 4CSAA 2KQ9A 4C7OB 3DZAA 1BR4A 2NUTB 2WVQA 3ECSA 3JCUQ 1M57C 3M1CB 1Z5ZA 2JD3A 2G3VA 2MYSA 2Y39A 1M2OA 4U5CE 4G0HA 1O5HA 3RH3A 1FMVA 4QI0A 1WGWA 1ST6A 2EILC 3JRTA 1LVKA 3H65A 1Z23A 3DM5A 2YHSA 1NU7D 4XWJA 4G7OF 3E70C 4BJ1A 4OIPF 4X0RA 4N06A 1M56C 2FGYA 1RJ9A 2KW3C 1Z6AA 4RD9A 2Y3GA 2J0WA 2X51A 3AG1C 1TR2A 4BG0A 5DVWA 4JJFA 4DOZA 2CNWD 3HTKC 4O6YA 2Q9AA 3KKBA 4YT5A 1MMAA 3F46A 2D5RB 2G3KA 4O6MA 2WVNA 4Q4ZF 3L34A 2ZPAA 5BUOA 3LS0A 4XLNF 3LLKA 5B3SC 3DAFA 3CZ6A 3VAYA 4EWCA 1TWHA 4YJWA 3KMIA 4I1MA 2A69F 1OKKD 3VYWA 5KYYB 1MNEA 2IXNA 3IEEA 3N24A 4K0DA 4JURI 4YWQA 2IXPA 4ZLDA 1RJ9B 3X1OA 4G7ZF 3EPVA 2R7RA 1ZHWA 2W4BA 1J8YF 1VK5A 3RFYA 1ZU4A 5DQTA 1ZHZA 2O9XA 3MLGA 3V7OA 2KNHA 2WZGA 3EHNA 2ZXPA 2IYLD 4ULWA 3K66A 4BJ6C 4QI2A 2J45A 4EBBA 2CGEA 5E33A 5EGYA 2R7OA 1ZHYA 3DJUB 3K7DA 4BJ5A 4C7OA 4QDLA 3MX3A 3I4UA 3T4RA 2B0JA 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9Y A; 
#chains in the Genus database with same CATH topology
 1C03 A;  2PP4 A;  1NZE A;  1FTS A;  3O10 A;  1N1C A;  5B1A C;  1T9K A;  3SEO A;  2OEV A;  4CJG A;  4ER9 A;  4PAC A;  3ASO C;  3LAY A;  1JPJ A;  2TMV P;  4MVZ A;  3W2W A;  1AVO B;  1Q0F A;  3WG7 C;  2MWQ A;  4GEH A;  5IY5 C;  1LIH A;  3LJB A;  3Q7L A;  2R7Q A;  3LEO A;  3HNI A;  2IBF A;  4M63 A;  4CS8 C;  1ZW3 A;  2LIG A;  3SNH A;  2HJM A;  4U5B E;  4BJT A;  3UGO A;  1MQV A;  2XL4 A;  2J9V A;  2EPK X;  4KI2 A;  3EG9 B;  3MYI A;  1JOG A;  1QVX A;  2XLD A;  5GPG B;  4YK5 A;  3S28 A;  2R7X A;  2HV6 A;  4LAC B;  1VTM P;  4Z9H A;  3S29 A;  4AK9 A;  3C8G A;  4CJO A;  3PHF 2;  1FFH A;  4MTO A;  4JCZ A;  2YVK A;  2GWW A;  2XLW A;  4HEA J;  4O79 A;  3T6G B;  4O7G A;  4AL1 A;  1PV3 A;  4E0I A;  3ZSU A;  1JR8 A;  4OIR F;  3V5X A;  4IB4 A;  3TOL A;  3L0I A;  2VH3 A;  4H4K C;  2Q9B A;  5DLJ A;  1HW1 A;  3JYH A;  1GM5 A;  5A6J A;  1D1B A;  2P7V A;  4OD5 A;  3M15 A;  2I15 A;  2EIJ C;  4U9D A;  2QY9 A;  4I44 A;  1EQ1 A;  3QW1 A;  1YA7 O;  2XM4 A;  2YLD A;  3HJC A;  1G4U S;  5DS5 A;  2NPU A;  2Y3D A;  1W2W A;  3C18 A;  3GWL A;  2D4U A;  2EIN C;  4YT2 A;  3N2Z B;  2JX0 A;  1PD1 A;  1ZU5 A;  3DE9 A;  1Z3I X;  2YZS A;  1YAR O;  2WZF A;  2WZL A;  4DRI B;  2QTV A;  3TK0 A;  4PJM A;  1TQG A;  2OEX A;  1ZHT A;  4AX2 A;  5L0G A;  1HE1 A;  1OCZ C;  4LLE A;  2J7P A;  2XRH A;  3HNJ A;  5JVE A;  1R4T A;  1HE9 A;  5D91 A;  2F22 A;  1KU2 A;  3NMI A;  3C8G B;  1K05 A;  5KYY A;  1OCO C;  1HW2 A;  3ATP A;  3FOO A;  5JSL A;  4FAP B;  1H9T A;  2VCB A;  4IAO A;  1RCP A;  1EKY A;  2HSB A;  4PK4 A;  4JTC B;  3IQ5 A;  2H7O A;  3X2Q C;  1KTM A;  5T3T A;  2H7B A;  1A7D A;  3LEV A;  3EH2 A;  3LLI A;  2YKZ A;  5TJ5 E;  4WJ0 A;  1JRA A;  4Q7C A;  2Q7R A;  3ZG1 A;  1BBH A;  3G50 A;  2L6G A;  4CBE A;  3RF3 A;  1T01 A;  4DRH B;  4NY3 A;  3GM1 A;  2BL2 A;  4NTB A;  5JUA A;  2XXA A;  4KBL A;  2A68 F;  1MMN A;  5A6B A;  3IQ6 A;  1WOL A;  3AG4 C;  2JPU A;  4IWB A;  3ABM C;  4DXW A;  1E83 A;  5F5F A;  2CCY A;  1Q0D A;  3DM9 B;  3EZI A;  3ZTM A;  5BQH A;  1ZVZ A;  4YT4 A;  4BJ6 A;  1LE4 A;  1QZX A;  4KNW A;  1PCX A;  3QVY A;  4P6I C;  1WTY A;  5L0F A;  3J06 A;  2EPM X;  2HKV A;  2LK4 A;  1OXK A;  3GOD A;  3GWN A;  4ZLC A;  3DE8 A;  2IXM A;  2R02 A;  3C8G D;  3OA1 A;  2IXO A;  3OEO A;  1YA9 A;  3G4X A;  1G8X A;  3TJ5 A;  2R7W A;  3SZR A;  3Q6M A;  4PFO A;  4CX9 A;  1SYQ A;  2XLE A;  2I8B A;  1SZI A;  2OQM A;  2WB7 A;  3JSE O;  2DGJ A;  3CSK A;  4MQ9 F;  4D4X A;  3S0X A;  1ZZP A;  2ZXR A;  1BZ4 A;  3ABK C;  4XTK A;  5T1D B;  3RKO F;  3RVY A;  3SYN A;  5COF A;  1Z63 A;  4MND A;  4IRU A;  1V55 C;  4K7B A;  1XWJ A;  3KYI A;  3M4C A;  4U5D E;  3U9J A;  1FFT C;  3RVZ A;  4AL0 A;  1CGO A;  2YLI A;  1V54 C;  1H7I A;  1OCR C;  4PJJ A;  4IJJ A;  4NTA A;  5AGF A;  4HFK B;  2HZ8 A;  4NQF A;  4C3B A;  5EHH A;  2XXA B;  2H8A A;  5HSW A;  2E87 A;  2GA0 A;  1K40 A;  1T5O A;  3EZH A;  1OCC C;  4PR9 A;  3LS1 A;  1YZA A;  4OD4 A;  3DAG A;  3RIP A;  2LQG A;  5A6A A;  1LS1 A;  1QQ3 A;  3HNK A;  3Q7G A;  4MW8 A;  4J7Y A;  5BQG A;  1QSP A;  3UMH A;  4CS7 A;  3Q6N A;  4BEJ A;  1Q0M A;  2VB6 A;  3RYL A;  2CW0 F;  3GOR A;  2J7P D;  2QLA A;  4WGY A;  3EG9 A;  1IW7 F;  3KH2 A;  3JYY A;  3K1I C;  3L8I A;  4IAR A;  4FWV A;  4JCH A;  3I5P A;  4GYT A;  4OIN F;  2ZXW C;  2M64 A;  3AQC A;  1BR2 A;  3F47 A;  3UR3 C;  1YJG A;  1M2V B;  4XEV A;  4E7Z A;  3ZWI A;  1D0X A;  2AP3 A;  2FAP B;  2L81 A;  3E9V A;  3LNM B;  4MW3 A;  5E3A A;  3OWT A;  1OXB A;  2IOQ A;  3FOP A;  4B6I A;  3EFO B;  5A6K A;  2CYD A;  1VYK A;  2OKU A;  2NUP B;  1A7E A;  4BPM A;  3SXY A;  1MND A;  2EPL X;  4J30 B;  3T6B A;  2YLG A;  4A4A A;  1YYJ A;  2HV7 A;  3MYF A;  5K0I A;  4DJ9 A;  1V4A A;  4LDQ A;  2C04 A;  3C7J A;  3WAQ A;  1LPE A;  3LES A;  2LFF A;  2W45 A;  4U5H A;  3ZC4 A;  4ANJ A;  3I5Q A;  5KYU A;  4EUK B;  1SMY F;  4OIQ F;  2EIM C;  2RD9 A;  4RDA A;  3U8P A;  5JRA A;  3TUL A;  1V74 B;  2A6H F;  1GQA A;  3B9Q A;  2PFD A;  4OIO F;  5FZT A;  4G7H F;  4D4N A;  3NYL A;  2YQY A;  1E2X A;  1NFO A;  3ZQV A;  1VMA A;  4E7S A;  3UGP A;  4W8K A;  3HLZ A;  2PX0 A;  3A11 A;  4KNV A;  2ASR A;  1DOW A;  2M4E A;  1D1C A;  2VAS A;  2VCC A;  2A6E F;  3C62 A;  2VCA A;  4LER A;  2AWY A;  1BDJ B;  4JKV A;  4NCQ A;  2Q4F A;  3W8I A;  2W9Y A;  3S27 A;  3CQZ A;  3PCV A;  1TKN A;  3UNG C;  3WOD F;  5EK0 A;  4JJG A;  1RKC A;  3U3F A;  5DS4 A;  2EIK C;  1TWC A;  2OJQ A;  1ORY A;  1EA8 A;  1UFB A;  3FMS A;  1FNT c;  3AJM A;  3FAP B;  3RW0 A;  3JSZ A;  3QZC A;  4MVM A;  4CS9 C;  4UDV A;  2G62 A;  3ZVR A;  3W2V A;  1D1A A;  2OCC C;  3FVY A;  1VB5 A;  3EGD B;  2P6V A;  3GEI A;  5KYU B;  1A7V A;  4Z9I A;  4C3D A;  1QLE C;  2LFD A;  3EGX B;  4MVS A;  3SXM A;  3A9C A;  2A0U A;  2J0X A;  2R05 A;  5CI8 A;  1YZC A;  4P9F A;  3ZTZ A;  3DKA A;  1OR3 A;  1TFK B;  2WL8 A;  4PJL A;  2AWC A;  1LKX A;  2L9J A;  2XS8 A;  1U6H A;  3AQB A;  4K1O A;  4A2N B;  1S7Z A;  3EQL F;  2HUJ A;  1I5N A;  1NU9 C;  3IHU A;  1SR2 A;  1TWA A;  1OKK A;  3IQC A;  4EBJ A;  2J8W A;  3R7C A;  3ZQY A;  3BRJ A;  1T6Q A;  3ITF A;  2C03 A;  3GAN A;  2YL0 A;  3U0C A;  1F1M A;  3V5Y A;  2LP4 A;  1A0B A;  4N6H A;  1CGM E;  4U5E E;  5E2Q A;  4BJ5 C;  5L3V A;  3EH1 A;  1LI5 A;  2HS5 A;  2FFH A;  1YDI A;  4MVQ A;  5DS6 A;  1MMD A;  4L6R A;  2J9W A;  1NBB A;  5JT4 A;  3HKK A;  3KL4 A;  3N0T A;  4MTF A;  3EJN A;  1CPQ A;  3C63 A;  4CDY A;  5A69 A;  2OG2 A;  5DQZ A;  3ABL C;  3K6B A;  2R7S A;  3WHN A;  5F5H A;  3DI5 A;  4J7T A;  3KPH A;  1SF8 A;  2J9U A;  4KC9 A;  1D0Y A;  1E85 A;  1RMV A;  1EI7 A;  4LLC A;  1I4Z A;  1OW7 A;  2Q3T A;  2OU6 A;  2ZXO A;  3DD7 A;  3L1M A;  4JRZ A;  4FX5 A;  5COG A;  4U5F E;  3K1I A;  1IZM A;  3FDQ A;  4MVU A;  4MVR A;  3G4Z A;  2NSG A;  3W4Y A;  2B0H A;  2J46 A;  3RQG A;  5CI9 A;  4MVO A;  4CIH A;  3O39 A;  4DVY P;  4ULV A;  5L0I A;  1R5I D;  4JVS A;  2YEV A;  3POV A;  2H7V C;  4P9T A;  1FMW A;  2XS1 A;  5JS5 A;  3DXJ F;  4RBN A;  1NFN A;  4R32 A;  1TFO B;  2MHR A;  4CSA C;  3GM3 A;  1M2V A;  1O87 A;  3VF0 A;  1OW8 A;  4PJN A;  1ZYR F;  1WAS A;  3BEH A;  1T6U A;  1LE2 A;  3EFO A;  2NUP A;  3U2M A;  2LSE A;  2DYR C;  1C02 A;  2NSF A;  1VOM A;  1AUE A;  2XLM A;  2PX3 A;  4J32 B;  2KGO A;  3EHM A;  1MMG A;  2ETS A;  1BR1 A;  3JTL O;  5KYX A;  3AGU A;  3FHD A;  5L3Q A;  1T6I A;  1Y6D A;  4CS8 A;  3JRM O;  1YAU O;  3VRC A;  1J8M F;  2NG1 A;  3B0U X;  1KNY A;  4DVZ A;  3S84 A;  4U5G A;  4XPW A;  3QW0 A;  4E17 A;  3DMD A;  4I3M A;  3NYJ A;  3AG3 C;  2R7T A;  4NC3 A;  1APC A;  3NKD A;  2GFH A;  3K1H A;  4JW1 A;  5AC5 A;  1Y4C A;  4XEK A;  4AE4 A;  2XLO A;  3NG1 A;  3UMI A;  4C3E A;  2YWA A;  1M6T A;  2RSE B;  2DI3 A;  3T6J A;  5D92 A;  4CDV A;  3DWW A;  2Q00 A;  2IM8 A;  3T9O A;  1UG7 A;  3CEX A;  4G78 A;  4CS9 A;  3B29 A;  1Z7Q c;  1GGQ A;  2UUI A;  1PD0 A;  2Y3B A;  5T3W A;  4EKW A;  3MFN A;  4XLP F;  2XM0 A;  4WGZ A;  3AG2 C;  3B0P A;  3NYM A;  4IAQ A;  2A1D D;  2QUP A;  2Z15 A;  2V26 A;  3W8H A;  1U0B B;  2BE5 F;  3AGT A;  3M4B A;  1FR0 A;  4YL1 A;  1O3U A;  3QMK A;  3EGD A;  3UMK A;  1QPU A;  3EGX A;  1OR2 A;  5A6B D;  3JT1 A;  1C17 M;  2DB4 A;  1ZHX A;  3NRH A;  4I1O B;  4O6N A;  4PFP A;  3TD7 A;  2Q9C A;  2W4M A;  2XL6 A;  1HMO A;  1TWG A;  4HE8 D;  4DBR A;  1WAT A;  4XPY A;  3FAJ A;  4IGG A;  3TJ6 A;  4AE4 B;  5KYW A;  4HFF B;  3B0V C;  3PMR A;  1Q0K A;  2Y3H A;  1LI7 A;  3TOM A;  3S90 A;  4H54 A;  3M79 A;  2NUT A;  4GQH A;  4YN0 B;  1JPN A;  1WN0 A;  1ZW2 A;  2PF4 E;  3LNR A;  4YT8 A;  1WWP A;  5B3I A;  1NG1 A;  1U89 A;  2PNO A;  3DJN B;  4FES A;  2Y69 C;  2CNW A;  2OOC A;  2XSE A;  3AOU A;  1L3P A;  3ASN C;  4JEA A;  4Q5S F;  3SP1 A;  4YL0 A;  4E0H A;  3R2P A;  2YL3 A;  4F4B A;  1VLT A;  2DYS C;  3LUT B;  3HNL A;  2V3C C;  2R7V A;  1OW6 A;  1K04 A;  3NKE A;  2CDQ A;  4XPX A;  5JLI A;  2HJ3 A;  5KYN A;  4JEB A;  3NDB B;  5B1B C;  3K33 A;  4MS2 A;  4JZA A;  3L8J A;  3QVZ A;  3U9M A;  1VYI A;  2P61 A;  4EHP A;  4DBQ A;  3O6X A;  1NSG B;  3QTH A;  1I4Y A;  5E3C A;  2QNL A;  2KJG A;  3RQE A;  2R7U A;  2WVO A;  5F28 E;  3ZIB A;  5FCL A;  5KYW B;  1RKE A;  2KQ9 A;  2KYH A;  4CSA A;  4C7O B;  2VC9 A;  1XZQ A;  3DZA A;  3NMJ A;  1BR4 A;  2NUT B;  2WVQ A;  3ECS A;  3JCU Q;  3U2L A;  1M57 C;  3M1C B;  2XL8 A;  4MTG A;  1Z5Z A;  4BEM J;  5AC4 A;  2JD3 A;  2G3V A;  4JE9 A;  2EPO A;  2MYS A;  1G5Z A;  4W8P A;  2Y39 A;  1M2O A;  4N4W A;  2AU5 A;  5L0H A;  3PDM P;  1YLM A;  4WAB A;  2R9R B;  1HY5 A;  4U5C E;  1HMD A;  1GS9 A;  3NMK A;  5L0D A;  2HSQ A;  4G0H A;  3TQO A;  2UUH A;  1O5H A;  3RH3 A;  1FMV A;  2KK1 A;  1Q0G A;  4XQ1 A;  2L7A A;  2QE9 A;  4LDR A;  4QI0 A;  4XEF A;  3ZDL A;  1WGW A;  3CAX A;  1ST6 A;  2EIL C;  2GAQ A;  4DRJ B;  3JRT A;  1LVK A;  2LD6 A;  3H65 A;  3KYJ A;  1S05 A;  1Z23 A;  3DM5 A;  2YHS A;  1NU7 D;  4XWJ A;  3GEH A;  1ORJ A;  2P1A A;  4G7O F;  2YRF A;  2ICW G;  3E70 C;  4BJ1 A;  5BQI A;  2EPN A;  3GM2 A;  4YL3 A;  4OIP F;  1RKE B;  4X0R A;  2YL1 A;  4N06 A;  1CGN A;  1M56 C;  3MBG A;  1AEP A;  2FGY A;  1L7C A;  1RJ9 A;  2KW3 C;  1Z6A A;  4NTF A;  4EBK A;  4RD9 A;  4EIY A;  2Y3G A;  2J0W A;  2X51 A;  3AG1 C;  1TR2 A;  3U5S A;  4BG0 A;  5DVW A;  4N6C A;  4JJF A;  4DOZ A;  2CNW D;  3HTK C;  4O6Y A;  1QKR A;  3C8Z A;  2Q9A A;  3KKB A;  4YT5 A;  2YL7 A;  1MMA A;  256B A;  2PBE A;  2HMQ A;  3F46 A;  2X0C A;  2D5R B;  3O55 A;  5JP7 A;  3VM6 A;  2G3K A;  4O6M A;  2WVN A;  4Q4Z F;  3L34 A;  1DOV A;  4ONS A;  1B68 A;  2ZD9 A;  2ZPA A;  4JC7 A;  3B71 A;  4CIP A;  2AVK A;  5BUO A;  1E86 A;  3LS0 A;  4XLN F;  1XZP A;  3LLK A;  3SXZ A;  3DAF A;  5B3S C;  1NLX A;  2XLH A;  3CZ6 A;  3VAY A;  4EWC A;  1TWH A;  2R03 A;  4YJW A;  1G4W R;  3KMI A;  4I1M A;  3US6 A;  2A69 F;  1H6G A;  1OQC A;  4E18 A;  1OKK D;  3VYW A;  5KYY B;  1JAF A;  2BC5 A;  3IQT A;  1MNE A;  2IXN A;  3IEE A;  3N24 A;  4K0D A;  4JUR I;  4YWQ A;  1JMW A;  5L0C A;  1ORS C;  2IXP A;  4ZLD A;  1RJ9 B;  3U8V A;  3X1O A;  2L6F A;  4G7Z F;  3EPV A;  3IPM O;  4JIO A;  3H2V A;  2R7R A;  2OJE D;  1ZHW A;  4Z9J A;  2W4B A;  1J8Y F;  1VK5 A;  1YYX A;  1CPR A;  4CDA A;  3RFY A;  5L0J A;  1E84 A;  1ZU4 A;  5DQT A;  2HFI A;  1ZHZ A;  2O9X A;  3U3B A;  3MLG A;  3V7O A;  3H2U A;  2KNH A;  2L6H A;  2P0N A;  5CIV A;  2WZG A;  2J9B A;  2KSF A;  3SXK A;  2KC3 A;  3EHN A;  4JTD B;  2LCH A;  1H9G A;  2A0B A;  2GDC A;  1RXQ A;  2HMZ A;  2ZXP A;  4JTA B;  2XLV A;  1A41 A;  3V5Z A;  5KYX B;  1FAP B;  2IYL D;  4ULW A;  4U9E A;  2R25 A;  3JZ0 A;  3K66 A;  4BJ6 C;  4QI2 A;  2J45 A;  4EBB A;  2CGE A;  5E33 A;  5EGY A;  1LM3 B;  2R7O A;  3S9O A;  1ZHY A;  3RQF A;  4LDK A;  3DJU B;  3K7D A;  5COM A;  4BJ5 A;  5HV9 A;  4C7O A;  4QDL A;  1YVI A;  3MX3 A;  3FXH A;  3GEE A;  3I4U A;  1LS4 A;  3T4R A;  2B0J A;  1VLS A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 2PP4 A;  1NZE A;  1FTS A;  5B1A C;  1N1C A;  3SEO A;  3ASO C;  3LAY A;  1JPJ A;  3W2W A;  3WG7 C;  2MWQ A;  4GEH A;  5IY5 C;  3LJB A;  3Q7L A;  2R7Q A;  4M63 A;  4CS8 C;  3SNH A;  4U5B E;  4BJT A;  3UGO A;  2XL4 A;  2J9V A;  4KI2 A;  3EG9 B;  3S28 A;  2R7X A;  2HV6 A;  4LAC B;  3S29 A;  4AK9 A;  3PHF 2;  1FFH A;  4HEA J;  4O79 A;  4O7G A;  3ZSU A;  4OIR F;  3L0I A;  2VH3 A;  4H4K C;  2Q9B A;  5DLJ A;  3JYH A;  1D1B A;  2P7V A;  4OD5 A;  2EIJ C;  2QY9 A;  4I44 A;  3HJC A;  5DS5 A;  2Y3D A;  1W2W A;  2EIN C;  4YT2 A;  3N2Z B;  1PD1 A;  1ZU5 A;  1Z3I X;  2YZS A;  2WZF A;  2WZL A;  2QTV A;  4PJM A;  4AX2 A;  1ZHT A;  1OCZ C;  4LLE A;  2J7P A;  2XRH A;  5D91 A;  1KU2 A;  5KYY A;  1OCO C;  4IAO A;  4PK4 A;  2H7O A;  3X2Q C;  5T3T A;  2H7B A;  3LEV A;  3LLI A;  3EH2 A;  4WJ0 A;  4Q7C A;  3ZG1 A;  4CBE A;  2XXA A;  4NY3 A;  4KBL A;  2A68 F;  1MMN A;  3AG4 C;  4IWB A;  3ABM C;  5F5F A;  3DM9 B;  3EZI A;  4YT4 A;  4BJ6 A;  1QZX A;  4KNW A;  1PCX A;  4P6I C;  3GOD A;  4ZLC A;  2IXM A;  3OA1 A;  2IXO A;  3OEO A;  1G8X A;  2R7W A;  3SZR A;  3Q6M A;  4PFO A;  2I8B A;  1SZI A;  2WB7 A;  2DGJ A;  3CSK A;  4MQ9 F;  3S0X A;  5T1D B;  2ZXR A;  3ABK C;  4XTK A;  3RKO F;  3SYN A;  1Z63 A;  4MND A;  4IRU A;  1V55 C;  4K7B A;  4U5D E;  1FFT C;  1V54 C;  1OCR C;  4PJJ A;  4IJJ A;  5EHH A;  2XXA B;  4HFK B;  4C3B A;  5HSW A;  2E87 A;  3EZH A;  1OCC C;  3LS1 A;  4OD4 A;  3DAG A;  3RIP A;  1LS1 A;  3Q7G A;  4CS7 A;  3UMH A;  3Q6N A;  4BEJ A;  2VB6 A;  3RYL A;  2CW0 F;  2J7P D;  3EG9 A;  1IW7 F;  3KH2 A;  3K1I C;  4JCH A;  4OIN F;  4FWV A;  3I5P A;  4GYT A;  2ZXW C;  3AQC A;  1BR2 A;  3F47 A;  3UR3 C;  1M2V B;  4E7Z A;  1D0X A;  2L81 A;  3E9V A;  5E3A A;  3OWT A;  2IOQ A;  4B6I A;  3EFO B;  1VYK A;  2NUP B;  1MND A;  4J30 B;  3T6B A;  2HV7 A;  2C04 A;  5KYX B;  3LES A;  4U5H A;  3ZC4 A;  2W45 A;  4ANJ A;  3I5Q A;  5KYU A;  4OIQ F;  1SMY F;  2EIM C;  4RDA A;  2A6H F;  3B9Q A;  2PFD A;  4OIO F;  4G7H F;  3NYL A;  4E7S A;  1VMA A;  3UGP A;  4W8K A;  3HLZ A;  2PX0 A;  4KNV A;  2M4E A;  1D1C A;  2VAS A;  2A6E F;  4LER A;  3W8I A;  2W9Y A;  3S27 A;  3CQZ A;  1TKN A;  3UNG C;  3WOD F;  4JJG A;  5DS4 A;  2EIK C;  1TWC A;  3JSZ A;  3QZC A;  4CS9 C;  2G62 A;  3ZVR A;  3W2V A;  1D1A A;  2OCC C;  3FVY A;  3EGD B;  2P6V A;  5KYU B;  4C3D A;  1QLE C;  3EGX B;  2J0X A;  5CI8 A;  4PJL A;  2WL8 A;  1LKX A;  2L9J A;  3AQB A;  4A2N B;  1S7Z A;  3EQL F;  1NU9 C;  1TWA A;  1OKK A;  3ITF A;  2C03 A;  3GAN A;  4U5E E;  5E2Q A;  4BJ5 C;  5L3V A;  3EH1 A;  2FFH A;  5DS6 A;  1MMD A;  2J9W A;  3KL4 A;  3N0T A;  3EJN A;  2OG2 A;  5DQZ A;  3ABL C;  3K6B A;  2R7S A;  5F5H A;  1SF8 A;  2J9U A;  4KC9 A;  1D0Y A;  4LLC A;  2Q3T A;  2ZXO A;  3DD7 A;  4FX5 A;  4U5F E;  1IZM A;  3FDQ A;  2J46 A;  5CI9 A;  4CIH A;  3O39 A;  4DVY P;  3POV A;  4JVS A;  2YEV A;  2H7V C;  1FMW A;  3DXJ F;  4RBN A;  4CSA C;  1M2V A;  1O87 A;  4PJN A;  1ZYR F;  3EFO A;  2NUP A;  2LSE A;  2DYR C;  1VOM A;  2PX3 A;  4J32 B;  2KGO A;  3EHM A;  1MMG A;  1BR1 A;  5KYX A;  3FHD A;  5L3Q A;  4CS8 A;  1J8M F;  2NG1 A;  3B0U X;  4DVZ A;  4U5G A;  2R7T A;  3DMD A;  4I3M A;  3NYJ A;  3AG3 C;  3NKD A;  2GFH A;  3K1H A;  4JW1 A;  4AE4 A;  3NG1 A;  3UMI A;  4C3E A;  3T6J A;  5D92 A;  4CS9 A;  1PD0 A;  2Y3B A;  5T3W A;  4XLP F;  3AG2 C;  3B0P A;  3NYM A;  3W8H A;  2A1D D;  2Z15 A;  2V26 A;  2BE5 F;  3QMK A;  3EGD A;  3UMK A;  3EGX A;  3JT1 A;  3TD7 A;  1ZHX A;  3NRH A;  4I1O B;  4O6N A;  4PFP A;  2Q9C A;  2W4M A;  1TWG A;  4HE8 D;  4DBR A;  3FAJ A;  4AE4 B;  5KYW A;  3B0V C;  4HFF B;  3PMR A;  2Y3H A;  2NUT A;  4YN0 B;  1JPN A;  2PF4 E;  3LNR A;  4YT8 A;  1NG1 A;  3DJN B;  4FES A;  2Y69 C;  2CNW A;  2XSE A;  3ASN C;  4Q5S F;  3SP1 A;  4F4B A;  2DYS C;  2V3C C;  2R7V A;  3NKE A;  2CDQ A;  5KYN A;  3NDB B;  5B1B C;  3K33 A;  4JZA A;  1VYI A;  4DBQ A;  3O6X A;  5E3C A;  2KJG A;  2R7U A;  2WVO A;  3ZIB A;  5FCL A;  5KYW B;  4CSA A;  2KQ9 A;  4C7O B;  3DZA A;  1BR4 A;  2NUT B;  2WVQ A;  3ECS A;  3JCU Q;  1M57 C;  3M1C B;  1Z5Z A;  2JD3 A;  2G3V A;  2MYS A;  2Y39 A;  1M2O A;  4U5C E;  4G0H A;  1O5H A;  3RH3 A;  1FMV A;  4QI0 A;  1WGW A;  1ST6 A;  2EIL C;  3JRT A;  1LVK A;  3H65 A;  1Z23 A;  3DM5 A;  2YHS A;  1NU7 D;  4XWJ A;  4G7O F;  3E70 C;  4BJ1 A;  4OIP F;  4X0R A;  4N06 A;  1M56 C;  2FGY A;  1RJ9 A;  2KW3 C;  1Z6A A;  4RD9 A;  2Y3G A;  2J0W A;  2X51 A;  3AG1 C;  1TR2 A;  4BG0 A;  5DVW A;  4JJF A;  4DOZ A;  2CNW D;  3HTK C;  4O6Y A;  2Q9A A;  3KKB A;  4YT5 A;  1MMA A;  3F46 A;  2D5R B;  2G3K A;  4O6M A;  2WVN A;  4Q4Z F;  3L34 A;  2ZPA A;  5BUO A;  3LS0 A;  4XLN F;  3LLK A;  5B3S C;  3DAF A;  3CZ6 A;  3VAY A;  4EWC A;  1TWH A;  4YJW A;  3KMI A;  4I1M A;  2A69 F;  1OKK D;  3VYW A;  5KYY B;  1MNE A;  2IXN A;  3IEE A;  3N24 A;  4K0D A;  4JUR I;  4YWQ A;  2IXP A;  4ZLD A;  1RJ9 B;  3X1O A;  4G7Z F;  3EPV A;  2R7R A;  1ZHW A;  2W4B A;  1J8Y F;  1VK5 A;  3RFY A;  1ZU4 A;  5DQT A;  1ZHZ A;  2O9X A;  3MLG A;  3V7O A;  2KNH A;  2WZG A;  3EHN A;  2ZXP A;  2IYL D;  4ULW A;  3K66 A;  4BJ6 C;  4QI2 A;  2J45 A;  4EBB A;  2CGE A;  5E33 A;  5EGY A;  2R7O A;  1ZHY A;  3DJU B;  3K7D A;  4BJ5 A;  4C7O A;  4QDL A;  3MX3 A;  3I4U A;  3T4R A;  2B0J A;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...