2W9YA

The structure of the lipid binding protein ce-far-7 from caenorhabditis elegans
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
135
Chain Sequence
b'GAMSVASLPEVKNFFPTEQLEFSSSITADEKPVLHEVFQKHSCGEMIDEVSKKHPELGKRLATVLEGNKKRLDGLSPAAVEYAKKLIHMVTTTLCSLTVGKPIDDADAKRLHQEFQSLSSEDQAALRKNNPDIKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID/RETINOL BINDING PROTEIN PROTEIN 7, ISOFORM A, CON
publication title Fatty Acid and Retinoid Binding Proteins Have Distinct Binding Pockets for the Two Types of Cargo
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Lipid transport
total genus 52
structure length 135
sequence length 140
ec nomenclature
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05823 Gp-FAR-1 Nematode fatty acid retinoid binding protein (Gp-FAR-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1100 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w9yA00
2W9YA
chains in the Genus database with same CATH superfamily
3LAYA 2R7SA 1K05A 1YARO 2EINC 2KSFA 3U5SA 3ZC4A 1NLXA 1BDJB 1LS4A 3EZHA 2LP4A 3FMSA 3T6JA 4EBJA 3DWWA 4YL1A 5T3WA 3ZQYA 1QQ3A 3UMHA 4PFPA 3ABMC 2NUPA 4IAOA 2G3KA 2KNHA 1OR3A 2KW3C 3KMIA 3KPHA 4R32A 5JT4A 3PDMP 1ZYRF 2V26A 1LE2A 4EKWA 4E0IA 5A6AA 4MVOA 1Y6DA 1I5NA 2YL7A 1BZ4A 2XLWA 4O6MA 4PJMA 5DVWA 1C03A 1ZHYA 1HW1A 2DI3A 2GA0A 4CS8C 1K40A 1C17M 3O55A 4EUKB 3QMKA 1FFHA 5KYUA 3SXKA 3PHF2 1OR2A 1WGWA 1ORYA 3UGOA 4YL0A 4D4XA 3G4ZA 4GEHA 2EIJC 1KTMA 4MVZA 1YZCA 3T6BA 4BG0A 2R7VA 4N4WA 4CSAA 3VF0A 2ZXOA 2E87A 3OA1A 1BBHA 3ZVRA 1ZW2A 1NG1A 3AJMA 4XEVA 3NRHA 2GWWA 3AG4C 4ULVA 3T9OA 3U8VA 2NPUA 4LLCA 2YQYA 3RH3A 2GAQA 1FMWA 3N0TA 1SF8A 2VC9A 4DVYP 4G7ZF 4JW1A 2KGOA 5B3SC 1M2VB 1FFTC 1A7DA 3E70C 3H65A 4QDLA 3ABKC 3H2VA 3KL4A 4XLPF 1JPNA 2R7QA 4DJ9A 4G7HF 3JYHA 4LDKA 1BR2A 2OEXA 4FWVA 3X1OA 3ZDLA 4LERA 4XPYA 1J8YF 3TJ6A 3WODF 2J9VA 3ZIBA 2NUPB 2Q9CA 3TOMA 4O79A 2PNOA 1D0YA 1LVKA 2J7PD 3NKEA 3FAPB 1TFKB 2RSEB 1UFBA 1FMVA 4MW8A 1DOVA 2A6EF 2OCCC 1PD1A 3UGPA 3GANA 2J45A 3DE8A 3JZ0A 5T3TA 1VTMP 4MNDA 1Q0DA 2HV6A 3GM2A 3LUTB 2CW0F 3M15A 3TOLA 4U9DA 2Y3GA 2VH3A 3F46A 3K1IC 1T6IA 1V54C 4W8PA 3RFYA 4AX2A 4JJFA 2Y3BA 3KKBA 4JVSA 1FAPB 3VYWA 4PJLA 4E7ZA 5DS6A 4NTFA 3Q6NA 2CDQA 2P0NA 2C03A 4CDAA 3NKDA 4CS7A 1APCA 1S7ZA 1GM5A 2XXAA 2R7TA 3FDQA 4NTBA 4ONSA 4U5CE 4U5BE 4Z9IA 1PCXA 5JVEA 3ATPA 5L0GA 2QUPA 3RVZA 2R05A 1GQAA 1WN0A 5CI8A 4BJTA 1J8MF 2PP4A 2XRHA 3HNIA 2JX0A 1Q0MA 3EQLF 2XM4A 3U3FA 2FAPB 1CGOA 3EHNA 3RW0A 2A6HF 3GEEA 4MVUA 4CJGA 2OOCA 2HZ8A 3ZTMA 1EI7A 1V4AA 4J30B 3V5YA 3E9VA 1OXKA 1TR2A 2H7VC 1B68A 2A0UA 2IBFA 3DE9A 5GPGB 2OU6A 1JRAA 5A6BD 1YDIA 1MMGA 1YLMA 1A7VA 1WWPA 1D1BA 2J7PA 5L0FA 5HSWA 2EPMX 5KYWA 2ZXRA 3DJNB 1ORJA 1G4US 2OQMA 2X51A 3TJ5A 4BJ6C 5F28E 1NU7D 4RDAA 1Z5ZA 1LE4A 1SMYF 2L81A 4P6IC 2B0JA 4U5FE 1UG7A 1Z6AA 3SXZA 5EGYA 5L0DA 3TULA 1QZXA 1NFOA 2ZPAA 4KC9A 1VLSA 5CI9A 5KYNA 1LKXA 2QE9A 4YT4A 2KK1A 3B0PA 1G4WR 3R7CA 3RQGA 2YWAA 1NZEA 3DM5A 4J7YA 2XXAB 3C63A 2D5RB 4CS9A 1S05A 2YVKA 1YYJA 1WASA 4KI2A 1LPEA 2BL2A 4YT5A 4HEAJ 3W2WA 5JP7A 2PX3A 2LFFA 4LACB 5JUAA 1TWAA 3S9OA 4C3EA 1FR0A 2G3VA 1OCZC 3B71A 2AWYA 1LIHA 3M1CB 4BPMA 1LI5A 3AOUA 5DS4A 2HSBA 4Q4ZF 1WATA 1Z23A 4EWCA 2HS5A 3ZWIA 1H6GA 5A6KA 5IY5C 1T5OA 4WJ0A 2F22A 5JS5A 3U3BA 3I5QA 1NFNA 4E0HA 5B1BC 2A68F 1CGME 1DOWA 1IZMA 2AP3A 4H4KC 2J46A 3VAYA 1CGNA 3Q6MA 2VASA 3WAQA 5A6BA 1ORSC 1KNYA 1HW2A 3S0XA 3K33A 5KYWB 2IYLD 2WZFA 4OIPF 2B0HA 3US6A 3LS0A 4JEBA 5L0JA 1JR8A 4H54A 2YEVA 4LDQA 4OINF 2IOQA 1JAFA 1MMAA 4MVSA 1XZQA 2AU5A 2L7AA 4UDVA 1U0BB 1Q0KA 3NMIA 5A6JA 2WL8A 4D4NA 4E18A 4PJNA 2J9BA 4AL0A 1ZW3A 2PFDA 3C8GD 5E3AA 3PMRA 4OD5A 4MVQA 4WABA 4JTCB 3MX3A 2PX0A 3JYYA 2IXPA 1TWCA 3GODA 4KBLA 2KQ9A 3G4XA 4NTAA 5L0IA 1YAUO 3DZAA 4BEMJ 4OD4A 4MTGA 1NSGB 3N24A 4CBEA 3NDBB 3DXJF 1MMDA 3H2UA 3K6BA 4J32B 5COGA 1FNTc 4Z9HA 1XWJA 4BJ5C 4CS8A 5L3QA 4O6YA 1GS9A 2XM0A 2EIKC 3V7OA 3WHNA 4CIHA 2BE5F 1BR1A 1WOLA 4FAPB 2XL4A 1G5ZA 4IARA 3HTKC 3ITFA 1MQVA 2L6FA 2EPLX 2MYSA 1VMAA 4AK9A 2HV7A 3VM6A 1Z3IX 3U9JA 4U5GA 3UMKA 4OIOF 4BEJA 4JTAB 4FX5A 2W45A 2Q7RA 1ZU4A 3SXYA 2MHRA 3QVYA 1YA7O 4PACA 5KYYA 1OKKA 4YWQA 2C04A 2WVOA 2YL1A 5DQTA 2OEVA 2KJGA 4MW3A 4XLNF 4DRIB 5B1AC 4G7OF 5L0HA 1A7EA 4PJJA 1VB5A 4IJJA 2HJ3A 1ZVZA 4JURI 4NQFA 1YZAA 3GEIA 3DAGA 2YZSA 3A9CA 4XPXA 5E2QA 3IQTA 1T6UA 2VB6A 3C8GA 3U8PA 2R7OA 1K04A 1HMOA 3DMDA 3EGDA 4HE8D 4JE9A 1SYQA 1GGQA 4I1OB 1M57C 4DRJB 3NYMA 3NG1A 2H8AA 2KYHA 4L6RA 3JCUQ 3RIPA 2WVQA 4MTFA 2YRFA 1T6QA 2OJED 2OG2A 2I8BA 2YL3A 1OW6A 4PK4A 1EKYA 3HNLA 3K1IA 3QW1A 1RMVA 3BRJA 5L3VA 3GORA 4MTOA 1LM3B 5F5FA 3HKKA 1E86A 5AC4A 2R7XA 2W4BA 3MFNA 4OIRF 4Q7CA 2R7RA 2PBEA 2J0XA 1YYXA 3EZIA 4AL1A 3DM9B 5E33A 1Q0FA 3AG2C 5D91A 3RVYA 4FESA 1M56C 2Q9AA 3AG1C 3IHUA 4QI0A 1ZU5A 3S90A 2HSQA 4JZAA 3C7JA 256BA 3HNJA 1CPRA 5HV9A 2GFHA 5AGFA 5KYYB 4JJGA 4KNVA 2D4UA 2IXOA 5DQZA 1PD0A 2AVKA 2A1DD 3A11A 1KU2A 3B29A 3JRTA 3B0VC 4ZLDA 3W8IA 1ZHXA 3L1MA 1O3UA 1O87A 3HNKA 3Q7GA 4XEFA 2Y39A 2Y3DA 5AC5A 2IXMA 4X0RA 4N06A 2JD3A 3HJCA 1LS1A 3SEOA 1XZPA 4YT2A 2FGYA 3U2LA 3ZTZA 3U0CA 2KC3A 2P6VA 3CQZA 3QVZA 4N6HA 3S28A 1BR4A 1TKNA 2VCBA 2ZXWC 5D92A 3QZCA 2W4MA 1N1CA 4C3DA 3C8GB 3EFOA 4JCZA 3W8HA 2Y3HA 3EJNA 2ASRA 3EGDB 3QTHA 4JCHA 3OEOA 2R7WA 3C18A 2M4EA 3EH1A 3GWLA 1ST6A 2XL8A 1RKEA 2AWCA 2WB7A 1VLTA 3LJBA 2J0WA 4ULWA 4BJ6A 3JSZA 1QKRA 2HFIA 4XEKA 3ZG1A 1H9TA 3W2VA 3FOOA 3NMJA 3FXHA 1JOGA 2XSEA 1HMDA 2J9UA 3KH2A 3GEHA 5A69A 3V5ZA 2YLIA 2QY9A 2LSEA 4MVMA 3PCVA 1FTSA 4I44A 4CDYA 2Q00A 3CAXA 2TMVP 1VOMA 2HMZA 2IXNA 1H9GA 3C62A 2LQGA 4J7TA 4RBNA 2X0CA 2ZXPA 4DXWA 4YT8A 1JMWA 2NUTA 4DVZA 3F47A 1ZHTA 2JPUA 1OKKD 2Q9BA 2CNWA 4LDRA 5FZTA 3RQFA 1HE9A 1RXQA 1T9KA 4GQHA 3IEEA 4JTDB 2R7UA 2Q3TA 3EPVA 1QPUA 3B9QA 3JT1A 2WVNA 3MLGA 3BEHA 4E7SA 4OIQF 4DRHB 1V55C 3AQCA 3DJUB 4ZLCA 1QSPA 1I4ZA 1HE1A 2CGEA 2DYRC 4GYTA 5B3IA 5DS5A 4W8KA 3ECSA 4C3BA 3EHMA 1SZIA 4P9TA 4RD9A 1L7CA 2CYDA 1A0BA 3W4YA 1RJ9B 2EIMC 2R02A 2EPOA 3ASOC 4LLEA 4CSAC 3EFOB 2XLOA 2J8WA 1OXBA 2R9RB 4U5EE 4U5DE 1EA8A 3SYNA 5BUOA 2G62A 2UUIA 3LS1A 5JRAA 2YKZA 4IAQA 1NBBA 3EGXA 1RKEB 1U89A 3B0UX 1E2XA 1MMNA 3SP1A 1TWHA 2HKVA 3EG9A 4CIPA 2LFDA 3VRCA 3U2MA 3L0IA 3LNMB 2LIGA 1OCRC 2O9XA 2Q4FA 3M4CA 3MBGA 3TD7A 2CCYA 3I4UA 4G0HA 3MYFA 2GDCA 3RYLA 4EIYA 5EK0A 3SNHA 2R25A 5EHHA 5KYXA 1TWGA 1AUEA 2OJQA 3NMKA 2XLVA 4IB4A 4CJOA 3IQ6A 4BJ1A 2Z15A 4G78A 4U9EA 4JKVA 2PF4E 3OWTA 3C8ZA 5CIVA 4WGYA 3L34A 2V3CC 4HFKB 4N6CA 2NUTB 2YLGA 1AEPA 2P61A 1VYKA 4JC7A 3MYIA 4F4BA 2W9YA 1Z63A 2ICWG 1D0XA 1SR2A 2UUHA 3X2QC 5L0CA 2VCAA 3T6GB 3V5XA 1HY5A 4DBRA 3GM3A 3IQCA 1R4TA 1Z7Qc 1E85A 4BJ5A 4EHPA 3UMIA 1H7IA 3AQBA 1F1MA 2L6HA 1OW7A 1R5ID 5BQIA 4QI2A 4Z9JA 1W2WA 3M4BA 3RQEA 1ZHWA 2I15A 4K1OA 4MS2A 3CEXA 5F5HA 1E84A 3M79A 5COFA 2H7OA 2P1AA 2J9WA 5JSLA 1LI7A 3POVA 3LESA 3DD7A 3KYIA 4IWBA 3R2PA 3U9MA 1L3PA 3DI5A 3G50A 3AG3C 3GWNA 3LLKA 2QNLA 4JRZA 4YK5A 2L6GA 3LLIA 5BQGA 3RF3A 2XS8A 3S84A 3NYJA 2R03A 1M6TA 4NCQA 1C02A 3EGXB 3IPMO 3O6XA 3SZRA 3SXMA 2A69F 4B6IA 3J06A 3UNGC 3EG9B 3ASNC 5BQHA 1D1CA 2XLDA 5KYUB 2EILC 5T1DB 3FAJA 2DB4A 1TFOB 1WTYA 2Y69C 3DKAA 3K1HA 4HFFB 3S29A 2EPKX 3T4RA 4NC3A 3L8JA 1G8XA 4A4AA 5KYXB 1ZHZA 4IRUA 3S27A 2HMQA 1VYIA 3FHDA 4P9FA 4CDVA 2P7VA 3UR3C 1NU9C 3I5PA 3KYJA 2YL0A 4C7OA 4M63A 2XL6A 5FCLA 2CNWD 2QLAA 4O6NA 2RD9A 3RKOF 3WG7C 1PV3A 3O39A 4EBBA 2XLMA 2OKUA 1A41A 1M2OA 4PFOA 4EBKA 4YL3A 4ER9A 3Q7LA 1OCOC 1JPJA 1YVIA 4Q5SF 4AE4A 4YJWA 3GM1A 2DGJA 4CX9A 4K0DA 3JRMO 1RCPA 3CZ6A 3AGTA 5E3CA 1OCCC 4MVRA 4I3MA 2LD6A 3QW0A 2LK4A 3JTLO 1I4YA 4PR9A 3TQOA 2VCCA 3N2ZB 2WZLA 4K7BA 3ZSUA 3NYLA 2FFHA 2L9JA 1RJ9A 3HLZA 1QLEC 1YA9A 2YHSA 4NY3A 3JSEO 1IW7F 2HUJA 3LEVA 4MQ9F 2NG1A 2IM8A 1Q0GA 1MNDA 1Y4CA 1O5HA 4CS9C 1MNEA 4JIOA 4O7GA 5COMA 3ZQVA 5K0IA 4E17A 3IQ5A 2XLHA 4WGZA 1D0ZA 1U6HA 3O10A 2ZD9A 2BC5A 2NSGA 4DOZA 4XQ1A 2M64A 2QTVA 3ABLC 3FVYA 3L8IA 4KNWA 1CPQA 2ETSA 2YLDA 1OQCA 1V74B 2EPNA 3EH2A 4XWJA 2A0BA 4DBQA 2XLEA 1T01A 4I1MA 2XS1A 2H7BA 3LNRA 1YJGA 2HJMA 2NSFA 1OW8A 1E83A 1EQ1A 1D1AA 4C7OB 2MWQA 5TJ5E 3AGUA 1VK5A 3LEOA 3TK0A 3FOPA 4XTKA 2WZGA 1QVXA 4ANJA 5JLIA 4IGGA 5DLJA 1TQGA 1AVOB 1RKCA 3DAFA 4A2NB 1M2VA 2DYSC 4AE4B 2LCHA 4U5HA 3K66A 3K7DA 4JEAA 3CSKA 4YN0B 1ZZPA 4XPWA
chains in the Genus database with same CATH topology
3LAYA 2R7SA 2EINC 3ZC4A 3EZHA 3T6JA 5T3WA 3UMHA 4PFPA 3ABMC 2NUPA 4IAOA 2G3KA 2KNHA 2KW3C 3KMIA 1ZYRF 2V26A 4O6MA 4PJMA 5DVWA 1ZHYA 4CS8C 3QMKA 1FFHA 5KYUA 3PHF2 1WGWA 3UGOA 4GEHA 2EIJC 4BG0A 3T6BA 2R7VA 4CSAA 2ZXOA 2E87A 3OA1A 3ZVRA 1NG1A 3NRHA 3AG4C 4LLCA 3RH3A 1FMWA 3N0TA 1SF8A 4DVYP 4G7ZF 4JW1A 2KGOA 5B3SC 1M2VB 1FFTC 3E70C 3H65A 4QDLA 3ABKC 3KL4A 4XLPF 1JPNA 2R7QA 4G7HF 3JYHA 1BR2A 4FWVA 3X1OA 4LERA 3WODF 1J8YF 3ZIBA 2J9VA 2NUPB 2Q9CA 4O79A 1D0YA 1LVKA 2J7PD 3NKEA 1FMVA 2A6EF 2OCCC 1PD1A 3UGPA 3GANA 2J45A 5T3TA 4MNDA 2HV6A 2CW0F 2Y3GA 2VH3A 3F46A 3K1IC 1V54C 3RFYA 4AX2A 4JJFA 2Y3BA 3KKBA 4JVSA 3VYWA 4PJLA 4E7ZA 5DS6A 3Q6NA 2CDQA 2C03A 3NKDA 4CS7A 1S7ZA 2XXAA 2R7TA 3FDQA 4U5BE 4U5CE 1PCXA 5CI8A 4BJTA 1J8MF 2PP4A 2XRHA 3EQLF 3EHNA 2A6HF 4J30B 3E9VA 1TR2A 2H7VC 1MMGA 2J7PA 1D1BA 5HSWA 5KYWA 2ZXRA 3DJNB 2X51A 4BJ6C 1NU7D 4RDAA 1Z5ZA 1SMYF 2L81A 4P6IC 2B0JA 4U5FE 1Z6AA 5EGYA 1QZXA 2ZPAA 4KC9A 5CI9A 5KYNA 1LKXA 4YT4A 3B0PA 1NZEA 3DM5A 2XXAB 2D5RB 4CS9A 4KI2A 4YT5A 4HEAJ 3W2WA 2PX3A 4LACB 1TWAA 4C3EA 2G3VA 1OCZC 3M1CB 5DS4A 4Q4ZF 1Z23A 4EWCA 5IY5C 4WJ0A 3I5QA 5B1BC 2A68F 4H4KC 1IZMA 2J46A 3VAYA 3Q6MA 2VASA 3S0XA 3K33A 5KYWB 2IYLD 2WZFA 4OIPF 3LS0A 2YEVA 4OINF 2IOQA 1MMAA 2WL8A 4PJNA 2PFDA 5E3AA 3PMRA 4OD5A 3MX3A 2PX0A 2IXPA 1TWCA 3GODA 4KBLA 2KQ9A 3DZAA 4OD4A 4CBEA 3N24A 3NDBB 3DXJF 1MMDA 3K6BA 4J32B 4BJ5C 4CS8A 5L3QA 4O6YA 3V7OA 4CIHA 2EIKC 2BE5F 1BR1A 2XL4A 3HTKC 3ITFA 2MYSA 1VMAA 4AK9A 2HV7A 1Z3IX 3UMKA 4U5GA 4OIOF 4BEJA 4FX5A 2W45A 1ZU4A 5KYYA 1OKKA 4YWQA 2C04A 2WVOA 5DQTA 2KJGA 4XLNF 5B1AC 4G7OF 4PJJA 4IJJA 4JURI 3DAGA 2YZSA 5E2QA 2VB6A 2R7OA 3DMDA 3EGDA 4HE8D 4I1OB 1M57C 3NYMA 3NG1A 3RIPA 3JCUQ 2WVQA 2OG2A 2I8BA 4PK4A 5L3VA 5F5FA 2R7XA 2W4BA 4OIRF 4Q7CA 2R7RA 2J0XA 3EZIA 3DM9B 5E33A 3AG2C 5D91A 4FESA 1M56C 2Q9AA 3AG1C 4QI0A 1ZU5A 4JZAA 5KYYB 2GFHA 4JJGA 4KNVA 2IXOA 5DQZA 1PD0A 2A1DD 3JRTA 1KU2A 3B0VC 4ZLDA 3W8IA 1ZHXA 1O87A 3Q7GA 2Y39A 2Y3DA 2IXMA 4X0RA 4N06A 2JD3A 3HJCA 1LS1A 3SEOA 4YT2A 2FGYA 2P6VA 3CQZA 3S28A 1BR4A 1TKNA 2ZXWC 5D92A 3QZCA 2W4MA 1N1CA 4C3DA 3EFOA 3W8HA 2Y3HA 3EJNA 3EGDB 4JCHA 3OEOA 2R7WA 2M4EA 3EH1A 1ST6A 4ULWA 2WB7A 3LJBA 2J0WA 4BJ6A 3JSZA 3ZG1A 3W2VA 2XSEA 2J9UA 3KH2A 2QY9A 2LSEA 1FTSA 4I44A 1VOMA 2IXNA 4YT8A 4RBNA 2ZXPA 2NUTA 4DVZA 3F47A 1ZHTA 1OKKD 2Q9BA 2CNWA 3IEEA 2R7UA 2Q3TA 3EPVA 3JT1A 3B9QA 2WVNA 3MLGA 4E7SA 4OIQF 1V55C 3AQCA 3DJUB 4ZLCA 2CGEA 2DYRC 4GYTA 5DS5A 4W8KA 3ECSA 4C3BA 3EHMA 1SZIA 4RD9A 1RJ9B 2EIMC 3ASOC 4LLEA 4CSAC 3EFOB 3SYNA 4U5EE 4U5DE 5BUOA 2G62A 3LS1A 3EGXA 3B0UX 1MMNA 3SP1A 1TWHA 3EG9A 3L0IA 2O9XA 1OCRC 3TD7A 3I4UA 4G0HA 3RYLA 3SNHA 5KYXA 5EHHA 1TWGA 4BJ1A 2Z15A 2PF4E 3OWTA 3L34A 2V3CC 4HFKB 2NUTB 1VYKA 4F4BA 1Z63A 2W9YA 1D0XA 3X2QC 4DBRA 4BJ5A 3UMIA 3AQBA 4QI2A 1W2WA 1ZHWA 5F5HA 2H7OA 3POVA 2J9WA 3LESA 3DD7A 4IWBA 3LLKA 3AG3C 3LLIA 3NYJA 3EGXB 3O6XA 3SZRA 2A69F 4B6IA 3UNGC 3EG9B 3ASNC 1D1CA 5KYUB 2EILC 5T1DB 3FAJA 3K1HA 3S29A 2Y69C 3T4RA 4HFFB 5KYXB 1G8XA 1ZHZA 4IRUA 3S27A 1VYIA 3FHDA 2P7VA 3UR3C 1NU9C 3I5PA 4C7OA 4M63A 5FCLA 2CNWD 4O6NA 3WG7C 3RKOF 3O39A 4EBBA 4PFOA 1M2OA 3Q7LA 1OCOC 1JPJA 4Q5SF 4AE4A 4YJWA 2DGJA 4K0DA 3CZ6A 5E3CA 1OCCC 4I3MA 3N2ZB 2WZLA 4K7BA 3ZSUA 3NYLA 2FFHA 2L9JA 1RJ9A 3HLZA 1QLEC 2YHSA 4NY3A 1IW7F 3LEVA 4MQ9F 2NG1A 1MNDA 1O5HA 4CS9C 1MNEA 4O7GA 1D0ZA 4DOZA 2QTVA 4KNWA 3ABLC 3FVYA 3EH2A 4XWJA 4DBQA 4I1MA 2H7BA 3LNRA 1D1AA 4C7OB 2MWQA 1VK5A 4XTKA 2WZGA 4ANJA 5DLJA 3DAFA 4A2NB 1M2VA 2DYSC 4AE4B 4U5HA 3K66A 3K7DA 3CSKA 4YN0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9Y A; 
#chains in the Genus database with same CATH topology
 3LAY A;  2R7S A;  1K05 A;  1YAR O;  2EIN C;  2KSF A;  3U5S A;  3ZC4 A;  1NLX A;  1BDJ B;  1LS4 A;  3EZH A;  2LP4 A;  3FMS A;  3T6J A;  4EBJ A;  3DWW A;  4YL1 A;  5T3W A;  3ZQY A;  1QQ3 A;  3UMH A;  4PFP A;  3ABM C;  2NUP A;  4IAO A;  2G3K A;  2KNH A;  1OR3 A;  2KW3 C;  3KMI A;  3KPH A;  4R32 A;  5JT4 A;  3PDM P;  1ZYR F;  2V26 A;  1LE2 A;  4EKW A;  4E0I A;  5A6A A;  4MVO A;  1Y6D A;  1I5N A;  2YL7 A;  1BZ4 A;  2XLW A;  4O6M A;  4PJM A;  5DVW A;  1C03 A;  1ZHY A;  1HW1 A;  2DI3 A;  2GA0 A;  4CS8 C;  1K40 A;  1C17 M;  3O55 A;  4EUK B;  3QMK A;  1FFH A;  5KYU A;  3SXK A;  3PHF 2;  1OR2 A;  1WGW A;  1ORY A;  3UGO A;  4YL0 A;  4D4X A;  3G4Z A;  4GEH A;  2EIJ C;  1KTM A;  4MVZ A;  1YZC A;  3T6B A;  4BG0 A;  2R7V A;  4N4W A;  4CSA A;  3VF0 A;  2ZXO A;  2E87 A;  3OA1 A;  1BBH A;  3ZVR A;  1ZW2 A;  1NG1 A;  3AJM A;  4XEV A;  3NRH A;  2GWW A;  3AG4 C;  4ULV A;  3T9O A;  3U8V A;  2NPU A;  4LLC A;  2YQY A;  3RH3 A;  2GAQ A;  1FMW A;  3N0T A;  1SF8 A;  2VC9 A;  4DVY P;  4G7Z F;  4JW1 A;  2KGO A;  5B3S C;  1M2V B;  1FFT C;  1A7D A;  3E70 C;  3H65 A;  4QDL A;  3ABK C;  3H2V A;  3KL4 A;  4XLP F;  1JPN A;  2R7Q A;  4DJ9 A;  4G7H F;  3JYH A;  4LDK A;  1BR2 A;  2OEX A;  4FWV A;  3X1O A;  3ZDL A;  4LER A;  4XPY A;  1J8Y F;  3TJ6 A;  3WOD F;  2J9V A;  3ZIB A;  2NUP B;  2Q9C A;  3TOM A;  4O79 A;  2PNO A;  1D0Y A;  1LVK A;  2J7P D;  3NKE A;  3FAP B;  1TFK B;  2RSE B;  1UFB A;  1FMV A;  4MW8 A;  1DOV A;  2A6E F;  2OCC C;  1PD1 A;  3UGP A;  3GAN A;  2J45 A;  3DE8 A;  3JZ0 A;  5T3T A;  1VTM P;  4MND A;  1Q0D A;  2HV6 A;  3GM2 A;  3LUT B;  2CW0 F;  3M15 A;  3TOL A;  4U9D A;  2Y3G A;  2VH3 A;  3F46 A;  3K1I C;  1T6I A;  1V54 C;  4W8P A;  3RFY A;  4AX2 A;  4JJF A;  2Y3B A;  3KKB A;  4JVS A;  1FAP B;  3VYW A;  4PJL A;  4E7Z A;  5DS6 A;  4NTF A;  3Q6N A;  2CDQ A;  2P0N A;  2C03 A;  4CDA A;  3NKD A;  4CS7 A;  1APC A;  1S7Z A;  1GM5 A;  2XXA A;  2R7T A;  3FDQ A;  4NTB A;  4ONS A;  4U5C E;  4U5B E;  4Z9I A;  1PCX A;  5JVE A;  3ATP A;  5L0G A;  2QUP A;  3RVZ A;  2R05 A;  1GQA A;  1WN0 A;  5CI8 A;  4BJT A;  1J8M F;  2PP4 A;  2XRH A;  3HNI A;  2JX0 A;  1Q0M A;  3EQL F;  2XM4 A;  3U3F A;  2FAP B;  1CGO A;  3EHN A;  3RW0 A;  2A6H F;  3GEE A;  4MVU A;  4CJG A;  2OOC A;  2HZ8 A;  3ZTM A;  1EI7 A;  1V4A A;  4J30 B;  3V5Y A;  3E9V A;  1OXK A;  1TR2 A;  2H7V C;  1B68 A;  2A0U A;  2IBF A;  3DE9 A;  5GPG B;  2OU6 A;  1JRA A;  5A6B D;  1YDI A;  1MMG A;  1YLM A;  1A7V A;  1WWP A;  1D1B A;  2J7P A;  5L0F A;  5HSW A;  2EPM X;  5KYW A;  2ZXR A;  3DJN B;  1ORJ A;  1G4U S;  2OQM A;  2X51 A;  3TJ5 A;  4BJ6 C;  5F28 E;  1NU7 D;  4RDA A;  1Z5Z A;  1LE4 A;  1SMY F;  2L81 A;  4P6I C;  2B0J A;  4U5F E;  1UG7 A;  1Z6A A;  3SXZ A;  5EGY A;  5L0D A;  3TUL A;  1QZX A;  1NFO A;  2ZPA A;  4KC9 A;  1VLS A;  5CI9 A;  5KYN A;  1LKX A;  2QE9 A;  4YT4 A;  2KK1 A;  3B0P A;  1G4W R;  3R7C A;  3RQG A;  2YWA A;  1NZE A;  3DM5 A;  4J7Y A;  2XXA B;  3C63 A;  2D5R B;  4CS9 A;  1S05 A;  2YVK A;  1YYJ A;  1WAS A;  4KI2 A;  1LPE A;  2BL2 A;  4YT5 A;  4HEA J;  3W2W A;  5JP7 A;  2PX3 A;  2LFF A;  4LAC B;  5JUA A;  1TWA A;  3S9O A;  4C3E A;  1FR0 A;  2G3V A;  1OCZ C;  3B71 A;  2AWY A;  1LIH A;  3M1C B;  4BPM A;  1LI5 A;  3AOU A;  5DS4 A;  2HSB A;  4Q4Z F;  1WAT A;  1Z23 A;  4EWC A;  2HS5 A;  3ZWI A;  1H6G A;  5A6K A;  5IY5 C;  1T5O A;  4WJ0 A;  2F22 A;  5JS5 A;  3U3B A;  3I5Q A;  1NFN A;  4E0H A;  5B1B C;  2A68 F;  1CGM E;  1DOW A;  1IZM A;  2AP3 A;  4H4K C;  2J46 A;  3VAY A;  1CGN A;  3Q6M A;  2VAS A;  3WAQ A;  5A6B A;  1ORS C;  1KNY A;  1HW2 A;  3S0X A;  3K33 A;  5KYW B;  2IYL D;  2WZF A;  4OIP F;  2B0H A;  3US6 A;  3LS0 A;  4JEB A;  5L0J A;  1JR8 A;  4H54 A;  2YEV A;  4LDQ A;  4OIN F;  2IOQ A;  1JAF A;  1MMA A;  4MVS A;  1XZQ A;  2AU5 A;  2L7A A;  4UDV A;  1U0B B;  1Q0K A;  3NMI A;  5A6J A;  2WL8 A;  4D4N A;  4E18 A;  4PJN A;  2J9B A;  4AL0 A;  1ZW3 A;  2PFD A;  3C8G D;  5E3A A;  3PMR A;  4OD5 A;  4MVQ A;  4WAB A;  4JTC B;  3MX3 A;  2PX0 A;  3JYY A;  2IXP A;  1TWC A;  3GOD A;  4KBL A;  2KQ9 A;  3G4X A;  4NTA A;  5L0I A;  1YAU O;  3DZA A;  4BEM J;  4OD4 A;  4MTG A;  1NSG B;  3N24 A;  4CBE A;  3NDB B;  3DXJ F;  1MMD A;  3H2U A;  3K6B A;  4J32 B;  5COG A;  1FNT c;  4Z9H A;  1XWJ A;  4BJ5 C;  4CS8 A;  5L3Q A;  4O6Y A;  1GS9 A;  2XM0 A;  2EIK C;  3V7O A;  3WHN A;  4CIH A;  2BE5 F;  1BR1 A;  1WOL A;  4FAP B;  2XL4 A;  1G5Z A;  4IAR A;  3HTK C;  3ITF A;  1MQV A;  2L6F A;  2EPL X;  2MYS A;  1VMA A;  4AK9 A;  2HV7 A;  3VM6 A;  1Z3I X;  3U9J A;  4U5G A;  3UMK A;  4OIO F;  4BEJ A;  4JTA B;  4FX5 A;  2W45 A;  2Q7R A;  1ZU4 A;  3SXY A;  2MHR A;  3QVY A;  1YA7 O;  4PAC A;  5KYY A;  1OKK A;  4YWQ A;  2C04 A;  2WVO A;  2YL1 A;  5DQT A;  2OEV A;  2KJG A;  4MW3 A;  4XLN F;  4DRI B;  5B1A C;  4G7O F;  5L0H A;  1A7E A;  4PJJ A;  1VB5 A;  4IJJ A;  2HJ3 A;  1ZVZ A;  4JUR I;  4NQF A;  1YZA A;  3GEI A;  3DAG A;  2YZS A;  3A9C A;  4XPX A;  5E2Q A;  3IQT A;  1T6U A;  2VB6 A;  3C8G A;  3U8P A;  2R7O A;  1K04 A;  1HMO A;  3DMD A;  3EGD A;  4HE8 D;  4JE9 A;  1SYQ A;  1GGQ A;  4I1O B;  1M57 C;  4DRJ B;  3NYM A;  3NG1 A;  2H8A A;  2KYH A;  4L6R A;  3JCU Q;  3RIP A;  2WVQ A;  4MTF A;  2YRF A;  1T6Q A;  2OJE D;  2OG2 A;  2I8B A;  2YL3 A;  1OW6 A;  4PK4 A;  1EKY A;  3HNL A;  3K1I A;  3QW1 A;  1RMV A;  3BRJ A;  5L3V A;  3GOR A;  4MTO A;  1LM3 B;  5F5F A;  3HKK A;  1E86 A;  5AC4 A;  2R7X A;  2W4B A;  3MFN A;  4OIR F;  4Q7C A;  2R7R A;  2PBE A;  2J0X A;  1YYX A;  3EZI A;  4AL1 A;  3DM9 B;  5E33 A;  1Q0F A;  3AG2 C;  5D91 A;  3RVY A;  4FES A;  1M56 C;  2Q9A A;  3AG1 C;  3IHU A;  4QI0 A;  1ZU5 A;  3S90 A;  2HSQ A;  4JZA A;  3C7J A;  256B A;  3HNJ A;  1CPR A;  5HV9 A;  2GFH A;  5AGF A;  5KYY B;  4JJG A;  4KNV A;  2D4U A;  2IXO A;  5DQZ A;  1PD0 A;  2AVK A;  2A1D D;  3A11 A;  1KU2 A;  3B29 A;  3JRT A;  3B0V C;  4ZLD A;  3W8I A;  1ZHX A;  3L1M A;  1O3U A;  1O87 A;  3HNK A;  3Q7G A;  4XEF A;  2Y39 A;  2Y3D A;  5AC5 A;  2IXM A;  4X0R A;  4N06 A;  2JD3 A;  3HJC A;  1LS1 A;  3SEO A;  1XZP A;  4YT2 A;  2FGY A;  3U2L A;  3ZTZ A;  3U0C A;  2KC3 A;  2P6V A;  3CQZ A;  3QVZ A;  4N6H A;  3S28 A;  1BR4 A;  1TKN A;  2VCB A;  2ZXW C;  5D92 A;  3QZC A;  2W4M A;  1N1C A;  4C3D A;  3C8G B;  3EFO A;  4JCZ A;  3W8H A;  2Y3H A;  3EJN A;  2ASR A;  3EGD B;  3QTH A;  4JCH A;  3OEO A;  2R7W A;  3C18 A;  2M4E A;  3EH1 A;  3GWL A;  1ST6 A;  2XL8 A;  1RKE A;  2AWC A;  2WB7 A;  1VLT A;  3LJB A;  2J0W A;  4ULW A;  4BJ6 A;  3JSZ A;  1QKR A;  2HFI A;  4XEK A;  3ZG1 A;  1H9T A;  3W2V A;  3FOO A;  3NMJ A;  3FXH A;  1JOG A;  2XSE A;  1HMD A;  2J9U A;  3KH2 A;  3GEH A;  5A69 A;  3V5Z A;  2YLI A;  2QY9 A;  2LSE A;  4MVM A;  3PCV A;  1FTS A;  4I44 A;  4CDY A;  2Q00 A;  3CAX A;  2TMV P;  1VOM A;  2HMZ A;  2IXN A;  1H9G A;  3C62 A;  2LQG A;  4J7T A;  4RBN A;  2X0C A;  2ZXP A;  4DXW A;  4YT8 A;  1JMW A;  2NUT A;  4DVZ A;  3F47 A;  1ZHT A;  2JPU A;  1OKK D;  2Q9B A;  2CNW A;  4LDR A;  5FZT A;  3RQF A;  1HE9 A;  1RXQ A;  1T9K A;  4GQH A;  3IEE A;  4JTD B;  2R7U A;  2Q3T A;  3EPV A;  1QPU A;  3B9Q A;  3JT1 A;  2WVN A;  3MLG A;  3BEH A;  4E7S A;  4OIQ F;  4DRH B;  1V55 C;  3AQC A;  3DJU B;  4ZLC A;  1QSP A;  1I4Z A;  1HE1 A;  2CGE A;  2DYR C;  4GYT A;  5B3I A;  5DS5 A;  4W8K A;  3ECS A;  4C3B A;  3EHM A;  1SZI A;  4P9T A;  4RD9 A;  1L7C A;  2CYD A;  1A0B A;  3W4Y A;  1RJ9 B;  2EIM C;  2R02 A;  2EPO A;  3ASO C;  4LLE A;  4CSA C;  3EFO B;  2XLO A;  2J8W A;  1OXB A;  2R9R B;  4U5E E;  4U5D E;  1EA8 A;  3SYN A;  5BUO A;  2G62 A;  2UUI A;  3LS1 A;  5JRA A;  2YKZ A;  4IAQ A;  1NBB A;  3EGX A;  1RKE B;  1U89 A;  3B0U X;  1E2X A;  1MMN A;  3SP1 A;  1TWH A;  2HKV A;  3EG9 A;  4CIP A;  2LFD A;  3VRC A;  3U2M A;  3L0I A;  3LNM B;  2LIG A;  1OCR C;  2O9X A;  2Q4F A;  3M4C A;  3MBG A;  3TD7 A;  2CCY A;  3I4U A;  4G0H A;  3MYF A;  2GDC A;  3RYL A;  4EIY A;  5EK0 A;  3SNH A;  2R25 A;  5EHH A;  5KYX A;  1TWG A;  1AUE A;  2OJQ A;  3NMK A;  2XLV A;  4IB4 A;  4CJO A;  3IQ6 A;  4BJ1 A;  2Z15 A;  4G78 A;  4U9E A;  4JKV A;  2PF4 E;  3OWT A;  3C8Z A;  5CIV A;  4WGY A;  3L34 A;  2V3C C;  4HFK B;  4N6C A;  2NUT B;  2YLG A;  1AEP A;  2P61 A;  1VYK A;  4JC7 A;  3MYI A;  4F4B A;  2W9Y A;  1Z63 A;  2ICW G;  1D0X A;  1SR2 A;  2UUH A;  3X2Q C;  5L0C A;  2VCA A;  3T6G B;  3V5X A;  1HY5 A;  4DBR A;  3GM3 A;  3IQC A;  1R4T A;  1Z7Q c;  1E85 A;  4BJ5 A;  4EHP A;  3UMI A;  1H7I A;  3AQB A;  1F1M A;  2L6H A;  1OW7 A;  1R5I D;  5BQI A;  4QI2 A;  4Z9J A;  1W2W A;  3M4B A;  3RQE A;  1ZHW A;  2I15 A;  4K1O A;  4MS2 A;  3CEX A;  5F5H A;  1E84 A;  3M79 A;  5COF A;  2H7O A;  2P1A A;  2J9W A;  5JSL A;  1LI7 A;  3POV A;  3LES A;  3DD7 A;  3KYI A;  4IWB A;  3R2P A;  3U9M A;  1L3P A;  3DI5 A;  3G50 A;  3AG3 C;  3GWN A;  3LLK A;  2QNL A;  4JRZ A;  4YK5 A;  2L6G A;  3LLI A;  5BQG A;  3RF3 A;  2XS8 A;  3S84 A;  3NYJ A;  2R03 A;  1M6T A;  4NCQ A;  1C02 A;  3EGX B;  3IPM O;  3O6X A;  3SZR A;  3SXM A;  2A69 F;  4B6I A;  3J06 A;  3UNG C;  3EG9 B;  3ASN C;  5BQH A;  1D1C A;  2XLD A;  5KYU B;  2EIL C;  5T1D B;  3FAJ A;  2DB4 A;  1TFO B;  1WTY A;  2Y69 C;  3DKA A;  3K1H A;  4HFF B;  3S29 A;  2EPK X;  3T4R A;  4NC3 A;  3L8J A;  1G8X A;  4A4A A;  5KYX B;  1ZHZ A;  4IRU A;  3S27 A;  2HMQ A;  1VYI A;  3FHD A;  4P9F A;  4CDV A;  2P7V A;  3UR3 C;  1NU9 C;  3I5P A;  3KYJ A;  2YL0 A;  4C7O A;  4M63 A;  2XL6 A;  5FCL A;  2CNW D;  2QLA A;  4O6N A;  2RD9 A;  3RKO F;  3WG7 C;  1PV3 A;  3O39 A;  4EBB A;  2XLM A;  2OKU A;  1A41 A;  1M2O A;  4PFO A;  4EBK A;  4YL3 A;  4ER9 A;  3Q7L A;  1OCO C;  1JPJ A;  1YVI A;  4Q5S F;  4AE4 A;  4YJW A;  3GM1 A;  2DGJ A;  4CX9 A;  4K0D A;  3JRM O;  1RCP A;  3CZ6 A;  3AGT A;  5E3C A;  1OCC C;  4MVR A;  4I3M A;  2LD6 A;  3QW0 A;  2LK4 A;  3JTL O;  1I4Y A;  4PR9 A;  3TQO A;  2VCC A;  3N2Z B;  2WZL A;  4K7B A;  3ZSU A;  3NYL A;  2FFH A;  2L9J A;  1RJ9 A;  3HLZ A;  1QLE C;  1YA9 A;  2YHS A;  4NY3 A;  3JSE O;  1IW7 F;  2HUJ A;  3LEV A;  4MQ9 F;  2NG1 A;  2IM8 A;  1Q0G A;  1MND A;  1Y4C A;  1O5H A;  4CS9 C;  1MNE A;  4JIO A;  4O7G A;  5COM A;  3ZQV A;  5K0I A;  4E17 A;  3IQ5 A;  2XLH A;  4WGZ A;  1D0Z A;  1U6H A;  3O10 A;  2ZD9 A;  2BC5 A;  2NSG A;  4DOZ A;  4XQ1 A;  2M64 A;  2QTV A;  3ABL C;  3FVY A;  3L8I A;  4KNW A;  1CPQ A;  2ETS A;  2YLD A;  1OQC A;  1V74 B;  2EPN A;  3EH2 A;  4XWJ A;  2A0B A;  4DBQ A;  2XLE A;  1T01 A;  4I1M A;  2XS1 A;  2H7B A;  3LNR A;  1YJG A;  2HJM A;  2NSF A;  1OW8 A;  1E83 A;  1EQ1 A;  1D1A A;  4C7O B;  2MWQ A;  5TJ5 E;  3AGU A;  1VK5 A;  3LEO A;  3TK0 A;  3FOP A;  4XTK A;  2WZG A;  1QVX A;  4ANJ A;  5JLI A;  4IGG A;  5DLJ A;  1TQG A;  1AVO B;  1RKC A;  3DAF A;  4A2N B;  1M2V A;  2DYS C;  4AE4 B;  2LCH A;  4U5H A;  3K66 A;  3K7D A;  4JEA A;  3CSK A;  4YN0 B;  1ZZP A;  4XPW A; 
#chains in the Genus database with same CATH homology
 3LAY A;  2R7S A;  2EIN C;  3ZC4 A;  3EZH A;  3T6J A;  5T3W A;  3UMH A;  4PFP A;  3ABM C;  2NUP A;  4IAO A;  2G3K A;  2KNH A;  2KW3 C;  3KMI A;  1ZYR F;  2V26 A;  4O6M A;  4PJM A;  5DVW A;  1ZHY A;  4CS8 C;  3QMK A;  1FFH A;  5KYU A;  3PHF 2;  1WGW A;  3UGO A;  4GEH A;  2EIJ C;  4BG0 A;  3T6B A;  2R7V A;  4CSA A;  2ZXO A;  2E87 A;  3OA1 A;  3ZVR A;  1NG1 A;  3NRH A;  3AG4 C;  4LLC A;  3RH3 A;  1FMW A;  3N0T A;  1SF8 A;  4DVY P;  4G7Z F;  4JW1 A;  2KGO A;  5B3S C;  1M2V B;  1FFT C;  3E70 C;  3H65 A;  4QDL A;  3ABK C;  3KL4 A;  4XLP F;  1JPN A;  2R7Q A;  4G7H F;  3JYH A;  1BR2 A;  4FWV A;  3X1O A;  4LER A;  3WOD F;  1J8Y F;  3ZIB A;  2J9V A;  2NUP B;  2Q9C A;  4O79 A;  1D0Y A;  1LVK A;  2J7P D;  3NKE A;  1FMV A;  2A6E F;  2OCC C;  1PD1 A;  3UGP A;  3GAN A;  2J45 A;  5T3T A;  4MND A;  2HV6 A;  2CW0 F;  2Y3G A;  2VH3 A;  3F46 A;  3K1I C;  1V54 C;  3RFY A;  4AX2 A;  4JJF A;  2Y3B A;  3KKB A;  4JVS A;  3VYW A;  4PJL A;  4E7Z A;  5DS6 A;  3Q6N A;  2CDQ A;  2C03 A;  3NKD A;  4CS7 A;  1S7Z A;  2XXA A;  2R7T A;  3FDQ A;  4U5B E;  4U5C E;  1PCX A;  5CI8 A;  4BJT A;  1J8M F;  2PP4 A;  2XRH A;  3EQL F;  3EHN A;  2A6H F;  4J30 B;  3E9V A;  1TR2 A;  2H7V C;  1MMG A;  2J7P A;  1D1B A;  5HSW A;  5KYW A;  2ZXR A;  3DJN B;  2X51 A;  4BJ6 C;  1NU7 D;  4RDA A;  1Z5Z A;  1SMY F;  2L81 A;  4P6I C;  2B0J A;  4U5F E;  1Z6A A;  5EGY A;  1QZX A;  2ZPA A;  4KC9 A;  5CI9 A;  5KYN A;  1LKX A;  4YT4 A;  3B0P A;  1NZE A;  3DM5 A;  2XXA B;  2D5R B;  4CS9 A;  4KI2 A;  4YT5 A;  4HEA J;  3W2W A;  2PX3 A;  4LAC B;  1TWA A;  4C3E A;  2G3V A;  1OCZ C;  3M1C B;  5DS4 A;  4Q4Z F;  1Z23 A;  4EWC A;  5IY5 C;  4WJ0 A;  3I5Q A;  5B1B C;  2A68 F;  4H4K C;  1IZM A;  2J46 A;  3VAY A;  3Q6M A;  2VAS A;  3S0X A;  3K33 A;  5KYW B;  2IYL D;  2WZF A;  4OIP F;  3LS0 A;  2YEV A;  4OIN F;  2IOQ A;  1MMA A;  2WL8 A;  4PJN A;  2PFD A;  5E3A A;  3PMR A;  4OD5 A;  3MX3 A;  2PX0 A;  2IXP A;  1TWC A;  3GOD A;  4KBL A;  2KQ9 A;  3DZA A;  4OD4 A;  4CBE A;  3N24 A;  3NDB B;  3DXJ F;  1MMD A;  3K6B A;  4J32 B;  4BJ5 C;  4CS8 A;  5L3Q A;  4O6Y A;  3V7O A;  4CIH A;  2EIK C;  2BE5 F;  1BR1 A;  2XL4 A;  3HTK C;  3ITF A;  2MYS A;  1VMA A;  4AK9 A;  2HV7 A;  1Z3I X;  3UMK A;  4U5G A;  4OIO F;  4BEJ A;  4FX5 A;  2W45 A;  1ZU4 A;  5KYY A;  1OKK A;  4YWQ A;  2C04 A;  2WVO A;  5DQT A;  2KJG A;  4XLN F;  5B1A C;  4G7O F;  4PJJ A;  4IJJ A;  4JUR I;  3DAG A;  2YZS A;  5E2Q A;  2VB6 A;  2R7O A;  3DMD A;  3EGD A;  4HE8 D;  4I1O B;  1M57 C;  3NYM A;  3NG1 A;  3RIP A;  3JCU Q;  2WVQ A;  2OG2 A;  2I8B A;  4PK4 A;  5L3V A;  5F5F A;  2R7X A;  2W4B A;  4OIR F;  4Q7C A;  2R7R A;  2J0X A;  3EZI A;  3DM9 B;  5E33 A;  3AG2 C;  5D91 A;  4FES A;  1M56 C;  2Q9A A;  3AG1 C;  4QI0 A;  1ZU5 A;  4JZA A;  5KYY B;  2GFH A;  4JJG A;  4KNV A;  2IXO A;  5DQZ A;  1PD0 A;  2A1D D;  3JRT A;  1KU2 A;  3B0V C;  4ZLD A;  3W8I A;  1ZHX A;  1O87 A;  3Q7G A;  2Y39 A;  2Y3D A;  2IXM A;  4X0R A;  4N06 A;  2JD3 A;  3HJC A;  1LS1 A;  3SEO A;  4YT2 A;  2FGY A;  2P6V A;  3CQZ A;  3S28 A;  1BR4 A;  1TKN A;  2ZXW C;  5D92 A;  3QZC A;  2W4M A;  1N1C A;  4C3D A;  3EFO A;  3W8H A;  2Y3H A;  3EJN A;  3EGD B;  4JCH A;  3OEO A;  2R7W A;  2M4E A;  3EH1 A;  1ST6 A;  4ULW A;  2WB7 A;  3LJB A;  2J0W A;  4BJ6 A;  3JSZ A;  3ZG1 A;  3W2V A;  2XSE A;  2J9U A;  3KH2 A;  2QY9 A;  2LSE A;  1FTS A;  4I44 A;  1VOM A;  2IXN A;  4YT8 A;  4RBN A;  2ZXP A;  2NUT A;  4DVZ A;  3F47 A;  1ZHT A;  1OKK D;  2Q9B A;  2CNW A;  3IEE A;  2R7U A;  2Q3T A;  3EPV A;  3JT1 A;  3B9Q A;  2WVN A;  3MLG A;  4E7S A;  4OIQ F;  1V55 C;  3AQC A;  3DJU B;  4ZLC A;  2CGE A;  2DYR C;  4GYT A;  5DS5 A;  4W8K A;  3ECS A;  4C3B A;  3EHM A;  1SZI A;  4RD9 A;  1RJ9 B;  2EIM C;  3ASO C;  4LLE A;  4CSA C;  3EFO B;  3SYN A;  4U5E E;  4U5D E;  5BUO A;  2G62 A;  3LS1 A;  3EGX A;  3B0U X;  1MMN A;  3SP1 A;  1TWH A;  3EG9 A;  3L0I A;  2O9X A;  1OCR C;  3TD7 A;  3I4U A;  4G0H A;  3RYL A;  3SNH A;  5KYX A;  5EHH A;  1TWG A;  4BJ1 A;  2Z15 A;  2PF4 E;  3OWT A;  3L34 A;  2V3C C;  4HFK B;  2NUT B;  1VYK A;  4F4B A;  1Z63 A;  2W9Y A;  1D0X A;  3X2Q C;  4DBR A;  4BJ5 A;  3UMI A;  3AQB A;  4QI2 A;  1W2W A;  1ZHW A;  5F5H A;  2H7O A;  3POV A;  2J9W A;  3LES A;  3DD7 A;  4IWB A;  3LLK A;  3AG3 C;  3LLI A;  3NYJ A;  3EGX B;  3O6X A;  3SZR A;  2A69 F;  4B6I A;  3UNG C;  3EG9 B;  3ASN C;  1D1C A;  5KYU B;  2EIL C;  5T1D B;  3FAJ A;  3K1H A;  3S29 A;  2Y69 C;  3T4R A;  4HFF B;  5KYX B;  1G8X A;  1ZHZ A;  4IRU A;  3S27 A;  1VYI A;  3FHD A;  2P7V A;  3UR3 C;  1NU9 C;  3I5P A;  4C7O A;  4M63 A;  5FCL A;  2CNW D;  4O6N A;  3WG7 C;  3RKO F;  3O39 A;  4EBB A;  4PFO A;  1M2O A;  3Q7L A;  1OCO C;  1JPJ A;  4Q5S F;  4AE4 A;  4YJW A;  2DGJ A;  4K0D A;  3CZ6 A;  5E3C A;  1OCC C;  4I3M A;  3N2Z B;  2WZL A;  4K7B A;  3ZSU A;  3NYL A;  2FFH A;  2L9J A;  1RJ9 A;  3HLZ A;  1QLE C;  2YHS A;  4NY3 A;  1IW7 F;  3LEV A;  4MQ9 F;  2NG1 A;  1MND A;  1O5H A;  4CS9 C;  1MNE A;  4O7G A;  1D0Z A;  4DOZ A;  2QTV A;  4KNW A;  3ABL C;  3FVY A;  3EH2 A;  4XWJ A;  4DBQ A;  4I1M A;  2H7B A;  3LNR A;  1D1A A;  4C7O B;  2MWQ A;  1VK5 A;  4XTK A;  2WZG A;  4ANJ A;  5DLJ A;  3DAF A;  4A2N B;  1M2V A;  2DYS C;  4AE4 B;  4U5H A;  3K66 A;  3K7D A;  3CSK A;  4YN0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...