3M4BA

A zn-mediated tetrahedral protein lattice cage
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4bA00
3IQ6A 2XLDA 2XLVA 4WGYA 5JLIA 2CCYA 3M4BA 1NBBA 3C62A 2BC5A 2XM4A 3ZWIA 3HNIA 5JS5A 3DE8A 2XLHA 256BA 1LM3B 3QVZA 2YL3A 5JVEA 3FOOA 1YZAA 3FOPA 5JSLA 4JEBA 1QPUA 2XLWA 1GQAA 1YYXA 3QVYA 3VRCA 1E84A 2XLOA 4CX9A 1CGNA 1E85A 3C63A 3DE9A 2XLEA 2YL0A 3HNKA 4D4XA 4IB4A 4CDVA 2YKZA 4CDAA 4CJOA 4N6HA 1RCPA 2J9BA 3ZQYA 1S05A 4CJGA 5B3IA 1E83A 1CGOA 4JKVA 5JUAA 2YL1A 1APCA 5JP7A 2YL7A 3ZTMA 4ER9A 1YYJA 1BBHA 4ULVA 4EIYA 4NC3A 1QQ3A 1EKYA 2YLIA 2J8WA 3QW1A 3HNJA 2XL6A 3QW0A 2QLAA 5JT4A 3IQ5A 1MQVA 3M79A 3ZQVA 4L6RA 4D4NA 1A7VA 4JEAA 5AGFA 4WGZA 4IAQA 3NMJA 1CPRA 4JE9A 3NMIA 3M15A 4N4WA 3U8PA 1CPQA 3M4CA 2XM0A 3L1MA 1M6TA 2XL8A 4U9DA 2YLGA 4U9EA 2YLDA 4CDYA 2XLMA 1YZCA 3NMKA 1E86A 4IARA 3TOLA 3ZTZA 3TOMA 4CIPA 3HNLA 5JRAA 1JAFA
chains in the Genus database with same CATH superfamily
2HMZA 3U2LA 5L0DA 1KTMA 4WGYA 4G7OF 3N0TA 5KYXA 1BR2A 1U89A 1J8MF 1ZW3A 2BE5F 3C62A 4AL1A 1DOWA 3SXKA 3DXJF 5A6AA 3HNIA 4U5HA 2WL8A 4FESA 4BJ6C 1WASA 5L3QA 4HEAJ 3M1CB 2NPUA 3T6BA 4LERA 1D1CA 4U5CE 5BUOA 3FOOA 1Q0GA 3IQCA 4W8PA 1LS1A 5JSLA 3RKOF 1VK5A 2A1DD 3EHNA 1NFNA 3NYMA 3T6JA 2IOQA 4DRHB 1WGWA 1FFHA 2FAPB 1VTMP 3U3FA 1YARO 1TKNA 3MX3A 2LK4A 5CIVA 3RFYA 1E84A 2OQMA 1QLEC 3KL4A 3KYIA 1EKYA 4KBLA 3GM3A 3K1HA 2IXNA 2J0WA 3JYYA 4DRJB 2XXAB 3FDQA 1CGNA 4JTDB 4JCHA 3HLZA 3DE9A 3I5QA 2XLEA 2UUHA 4MVUA 1B68A 3I4UA 3W4YA 1A0BA 1OR2A 2YL0A 3AG4C 3DAGA 1TFKB 3HNKA 1VMAA 3UR3C 5DQTA 4D4XA 1R5ID 2XXAA 1A41A 2EIMC 3FXHA 4JC7A 4OD4A 5A6KA 3EPVA 1OR3A 4LDQA 4C3DA 4BJ5C 2EPOA 3SP1A 3Q7LA 1OW7A 3RVYA 2EIJC 4N6CA 2Z15A 3BEHA 2V26A 3FAPB 1OKKA 5L0GA 2VCBA 5L0CA 5F5FA 1CGME 1RJ9B 1ZYRF 5COFA 1MMAA 5AC5A 3KPHA 2VCCA 4CS9A 4ULVA 3DKAA 3WHNA 1QSPA 4I44A 4F4BA 3FMSA 3AGUA 3WAQA 1NU7D 2QE9A 1RJ9A 1VB5A 2R7OA 2YLIA 3Q7GA 3ABLC 3VF0A 3AG2C 3QW1A 4A2NB 2V3CC 3DJNB 2HUJA 2IYLD 3ABKC 2QY9A 2LCHA 3HNJA 2WZFA 3QW0A 4JIOA 4C7OB 1WATA 3O6XA 2HV6A 1OCCC 1R4TA 4PACA 3U8PA 4L6RA 4DXWA 4D4NA 3ASOC 3K7DA 5AGFA 3JSEO 4BG0A 3S27A 1ORJA 2H8AA 4BJ1A 3U8VA 3B29A 1CPRA 1PV3A 2J46A 4C7OA 2A0BA 5KYNA 2Q3TA 3M15A 2IM8A 2KYHA 1C17M 1K05A 1L7CA 1T5OA 2L6GA 2OJED 3EZIA 2R7QA 1D0ZA 2EPNA 2DB4A 3H2VA 1GGQA 2FGYA 3U3BA 4BPMA 3GODA 5EK0A 4EUKB 1ZZPA 2W4MA 1FNTc 1TWCA 4U5BE 3M4CA 4XQ1A 1ORSC 2KQ9A 3E70C 5DLJA 4U9DA 1G5ZA 1SMYF 2YLGA 4UDVA 5L0FA 5KYUB 1HE1A 1LS4A 1XWJA 4U9EA 3N24A 1OCZC 4O79A 3RVZA 3ITFA 3JCUQ 4AL0A 1C02A 3NMKA 2ZXOA 4MQ9F 4R32A 2IBFA 3TQOA 3L0IA 3NRHA 3RQEA 2JD3A 4J30B 3TOLA 1NU9C 5KYUA 3JRMO 3MLGA 2P6VA 4U5DE 2LP4A 3G4XA 2AWYA 3A9CA 2YWAA 3HNLA 2R7RA 1D0XA 2J9VA 3LLKA 5F5HA 4EBJA 4O6MA 1NG1A 2OEXA 4I1OB 2GA0A 4JZAA 1RKCA 4MVSA 2CCYA 1Z5ZA 4QI2A 4YN0B 2IXMA 4BJ5A 1O87A 1PD1A 4DRIB 4DBQA 1D1AA 1U6HA 2CYDA 3GORA 3B0UX 2DYSC 4ULWA 3LJBA 1ZVZA 2OJQA 1V55C 2CNWD 2MWQA 3AQCA 3NYLA 1ZHXA 2J9WA 4XPXA 2Q9AA 1T6UA 4M63A 2L7AA 2ZXPA 3UNGC 2CW0F 2MYSA 2KJGA 3C18A 3IEEA 1D0YA 2PBEA 5D92A 4JEBA 3C7JA 2HZ8A 3EHMA 1O5HA 4CSAC 3SXZA 3PDMP 1OQCA 1VOMA 3S90A 4NCQA 3DI5A 2XLOA 2R7WA 2Y3HA 3GEHA 1JPNA 4G7ZF 2P1AA 2B0HA 2C03A 2H7VC 2KC3A 3AG1C 2W4BA 3G50A 4MTOA 1N1CA 4MVRA 5E3CA 3B0PA 3QTHA 3AJMA 3EFOB 4PJMA 2VCAA 3ZDLA 1PD0A 3LESA 3U5SA 2M64A 1K40A 2A68F 4MNDA 2A0UA 2YKZA 4PJJA 1H9GA 2CGEA 2WVOA 2YVKA 1YLMA 1LKXA 1Q0FA 4I1MA 3H65A 2AVKA 2NUTB 4G78A 2ZXWC 1OXKA 3FVYA 3EFOA 5GPGB 2H7OA 2OG2A 1S05A 1TFOB 2L6HA 1HMOA 3AG3C 4XEFA 3TULA 4RDAA 2NG1A 2OU6A 2YQYA 4YL1A 1JMWA 3JRTA 5CI9A 3PMRA 1FFTC 4Z9HA 4CJGA 5B3IA 3LS1A 1E83A 2PF4E 1G8XA 3LEOA 3K6BA 1ZHTA 2NUTA 3X2QC 4G7HF 1ZW2A 3ZTMA 4C3EA 1YYJA 4E0HA 3W2WA 4ER9A 1H7IA 5L0JA 1T6IA 3I5PA 2HMQA 4EIYA 1JR8A 2R25A 3MYFA 3NKEA 1BR1A 1G4US 4KI2A 2WZGA 1MMGA 1NSGB 3RIPA 1LPEA 3K33A 4HE8D 2J7PA 1OW6A 2J8WA 1OW8A 2X0CA 2XL6A 3EZHA 5F28E 1TQGA 4NTFA 5T3TA 2QLAA 1QKRA 4JRZA 2VB6A 5A69A 2IXPA 1VYIA 1XZPA 3K1IC 4IJJA 4MTGA 3IHUA 1WWPA 4NQFA 3ZQVA 4A4AA 3T4RA 3V5XA 2O9XA 5BQHA 1PCXA 1ST6A 1FMVA 2MHRA 4JJFA 2AP3A 4LACB 4CS8C 2R7SA 3GEEA 2GWWA 1QVXA 1YJGA 2XSEA 2VC9A 4N4WA 1IZMA 5K0IA 3IQTA 4HFKB 1W2WA 1UG7A 2GFHA 2FFHA 3C8GB 1Z23A 4XEKA 4XLPF 3GM2A 4NTBA 2XL8A 1AVOB 1BR4A 3GANA 5T1DB 4XTKA 3VYWA 2Q4FA 3KMIA 3CQZA 3HTKC 1T6QA 3C8GA 5L3VA 1S7ZA 1FTSA 4IARA 1YA9A 3MBGA 2Q00A 4LDKA 1V54C 3GWNA 3L8JA 2ZD9A 5JRAA 2QUPA 3VAYA 4J7TA 3IQ6A 3JYHA 2PX3A 2XLDA 2XLVA 3RW0A 2NSGA 4H54A 3W8HA 3X1OA 3ZC4A 5JLIA 2EPMX 4BJ6A 4QDLA 2QTVA 3M4BA 4YJWA 4RD9A 2HSBA 2M4EA 4AK9A 1NBBA 2Y69C 4JVSA 1JOGA 2BC5A 5TJ5E 1SR2A 3SEOA 1EI7A 2HJMA 3MFNA 2J0XA 4J32B 2Q7RA 3ZWIA 3U0CA 2KK1A 2R7XA 2LD6A 2ETSA 5DQZA 2XLHA 2Y39A 256BA 1LM3B 3DM9B 1OCOC 4IWBA 3O55A 3NKDA 1NLXA 1FMWA 2HFIA 2CDQA 1YZAA 2R7VA 5CI8A 2ZPAA 3ECSA 3AQBA 3E9VA 4YL3A 5DS4A 1TR2A 2PFDA 2ZXRA 3S0XA 5A6BD 3POVA 1SZIA 3W2VA 3QVYA 4JJGA 5B1AC 1YVIA 4CIHA 4GQHA 1VLSA 1Z3IX 4N06A 3VRCA 2EIKC 1OXBA 4CBEA 1LI7A 3NDBB 3B0VC 1KU2A 4U5FE 3LEVA 3WG7C 4CX9A 3S28A 5BQIA 4MTFA 4U5GA 3US6A 1TWAA 2EPLX 2ICWG 2NSFA 4X0RA 1E85A 2G3KA 2RD9A 3C63A 3FHDA 4KNVA 4O6NA 2HJ3A 2WZLA 3PHF2 5E2QA 3CZ6A 4O7GA 4XLNF 1FAPB 4MVOA 1U0BB 1AEPA 2TMVP 1TWGA 3O10A 4Q7CA 3UMHA 3GWLA 2OOCA 4OD5A 5KYWB 3PCVA 4P6IC 1SYQA 4CDAA 3U9JA 4CJOA 4N6HA 3L34A 2WVNA 3CEXA 3NG1A 1ORYA 4EBBA 3DD7A 2YEVA 1XZQA 1HW2A 4WJ0A 2LIGA 4E7SA 5KYWA 3EH2A 5DS5A 3OWTA 2H7BA 3RQFA 5HSWA 2R7TA 3IPMO 1BZ4A 4JKVA 2W9YA 4B6IA 2YL1A 4K7BA 2X51A 1APCA 2YL7A 3DAFA 4JTAB 2P0NA 1WN0A 4YWQA 3EQLF 4PK4A 3ZSUA 2A6EF 3KYJA 5E33A 3VM6A 4YT8A 1G4WR 4NC3A 2LQGA 2Q9BA 4MS2A 2GAQA 4W8KA 3HJCA 1Z63A 3U9MA 5BQGA 3UGOA 3ASNC 3GEIA 2E87A 4Q4ZF 1FR0A 5IY5C 4CS9C 4PJNA 2DYRC 4XPWA 3KKBA 1QZXA 5JT4A 5COMA 4HFFB 2VASA 4PFPA 1MQVA 2P61A 2KNHA 3CAXA 4E18A 3M79A 2AWCA 2LSEA 3DMDA 4WABA 3JSZA 3V7OA 4XEVA 3DWWA 1VYKA 2J9UA 2KSFA 2L6FA 3NMJA 3Q6NA 3SXYA 2LFDA 2F22A 1ZHWA 3F47A 4U5EE 3TJ5A 5COGA 4Q5SF 5B3SC 1I4ZA 4K1OA 2I15A 1CPQA 3B71A 1ZU5A 3U2MA 1ZHZA 3LNRA 1H6GA 3L1MA 3NYJA 1IW7F 1M6TA 1BDJB 2HV7A 1NZEA 3SZRA 4MW8A 2R02A 2YLDA 4CDYA 4EHPA 1YZCA 4DBRA 4Z9IA 4E17A 2EILC 3DZAA 3G4ZA 5L0HA 1I4YA 4E0IA 4IAOA 3EGDB 4P9TA 3QZCA 3TOMA 3ZTZA 3OEOA 4CIPA 1HMDA 3N2ZB 3T6GB 4GYTA 4MVMA 1JPJA 2XL4A 1EQ1A 2BL2A 2R05A 2UUIA 1RKEB 3EG9B 3R2PA 4GEHA 1A7DA 5KYYB 3EH1A 3MYIA 1D1BA 4FAPB 2EINC 3EGDA 1H9TA 4DVZA 3TJ6A 2VH3A 1M2VB 1Z7Qc 1M2OA 4KC9A 4XPYA 1VLTA 2RSEB 2WVQA 1SF8A 2D5RB 2QNLA 2PNOA 3EG9A 2PX0A 1RKEA 2XM4A 1T01A 2J7PD 4LLCA 1YA7O 4JCZA 5AC4A 1I5NA 5KYYA 1HY5A 2Y3DA 3DE8A 4EWCA 5JS5A 4FX5A 4NTAA 4AX2A 4ONSA 1M2VA 4MVZA 3QVZA 4CSAA 2HS5A 2A6HF 1GS9A 1ZHYA 2A69F 2W45A 2YL3A 3ZG1A 5JVEA 4ZLDA 1RMVA 4NY3A 3V5ZA 3FOPA 3H2UA 5E3AA 1QPUA 4QI0A 5T3WA 2XLWA 1GQAA 4LDRA 1YYXA 2P7VA 1RXQA 4CS7A 1OKKD 4P9FA 1ZU4A 4EKWA 5L0IA 2YZSA 4K0DA 4O6YA 3RQGA 3DM5A 3DJUB 4JW1A 2J45A 4OIOF 3UGPA 4YT5A 3JZ0A 1JRAA 1V74B 1LIHA 2AU5A 2HSQA 3UMKA 3K66A 2DGJA 3V5YA 2KW3C 2XS8A 3F46A 2XS1A 2YHSA 3RYLA 4YT4A 4MW3A 2OCCC 2R03A 4JTCB 4BEJA 4IB4A 2Y3GA 4IRUA 1Q0DA 1V4AA 3LS0A 4CDVA 3J06A 4G0HA 3C8GD 4XWJA 2R7UA 1EA8A 3LNMB 3SNHA 3ABMC 3SXMA 1Q0MA 2ASRA 1MMDA 3OA1A 1RCPA 1Y4CA 3CSKA 2B0JA 2G62A 2Q9CA 2J9BA 3RF3A 3ZQYA 4BJTA 4C3BA 5A6JA 3S84A 1Y6DA 5A6BA 2IXOA 4PJLA 3EGXB 5EHHA 3LAYA 2NUPB 4OIRF 4YT2A 1CGOA 3HKKA 2Y3BA 3UMIA 5JUAA 4YL0A 5JP7A 3EJNA 4KNWA 1K04A 1MNEA 4RBNA 1E2XA 1F1MA 1BBHA 3SYNA 3TK0A 1WTYA 5EGYA 3WODF 3EGXA 3Q6MA 1QQ3A 2NUPA 3K1IA 1Q0KA 3BRJA 1LVKA 3L8IA 3ATPA 4DJ9A 1UFBA 4FWVA 2XRHA 1YAUO 4I3MA 2I8BA 4CS8A 1L3PA 2CNWA 3O39A 2DI3A 3C8ZA 4BEMJ 3GM1A 2C04A 2OEVA 3IQ5A 4AE4B 1OCRC 2OKUA 3JTLO 4J7YA 1LI5A 2YRFA 1A7VA 4JEAA 1YDIA 3KH2A 2L9JA 4WGZA 4YK5A 4OINF 3R7CA 2L81A 1LE2A 3AGTA 3B9QA 2D4UA 4IAQA 4OIPF 3ZIBA 2JX0A 1A7EA 2G3VA 4JE9A 3AOUA 4AE4A 3NMIA 5DVWA 1TWHA 3S9OA 4ANJA 5FZTA 1AUEA 3S29A 1C03A 1M56C 1HE9A 3ZVRA 4E7ZA 3RH3A 3FAJA 4IGGA 3LUTB 5FCLA 1T9KA 5B1BC 3A11A 1HW1A 2XM0A 4JURI 1LE4A 4MVQA 1WOLA 4DVYP 5D91A 2PP4A 3JT1A 4H4KC 2EPKX 2GDCA 2HKVA 2JPUA 5DS6A 2KGOA 4PR9A 2XLMA 4Z9JA 1E86A 5HV9A 1KNYA 1O3UA 3LLIA 3W8IA 4OIQF 1DOVA 4EBKA 4PFOA 1GM5A 3TD7A 2R9RB 1NFOA 3T9OA 4DOZA 4ZLCA 2WB7A 5KYXB 1Z6AA 2LFFA 4LLEA 1M57C 1MNDA 3QMKA 1J8YF 1MMNA 1JAFA
chains in the Genus database with same CATH topology
3IQ6A 2XLDA 2XLVA 4WGYA 5JLIA 2CCYA 3M4BA 1NBBA 3C62A 2BC5A 2XM4A 3ZWIA 3HNIA 5JS5A 3DE8A 2XLHA 256BA 1LM3B 3QVZA 2YL3A 5JVEA 3FOOA 1YZAA 3FOPA 5JSLA 4JEBA 1QPUA 2XLWA 1GQAA 1YYXA 3QVYA 3VRCA 1E84A 2XLOA 4CX9A 1CGNA 1E85A 3C63A 3DE9A 2XLEA 2YL0A 3HNKA 4D4XA 4IB4A 4CDVA 2YKZA 4CDAA 4CJOA 4N6HA 1RCPA 2J9BA 3ZQYA 1S05A 4CJGA 5B3IA 1E83A 1CGOA 4JKVA 5JUAA 2YL1A 1APCA 5JP7A 2YL7A 3ZTMA 4ER9A 1YYJA 1BBHA 4ULVA 4EIYA 4NC3A 1QQ3A 1EKYA 2YLIA 2J8WA 3QW1A 3HNJA 2XL6A 3QW0A 2QLAA 5JT4A 3IQ5A 1MQVA 3M79A 3ZQVA 4L6RA 4D4NA 1A7VA 4JEAA 5AGFA 4WGZA 4IAQA 3NMJA 1CPRA 4JE9A 3NMIA 3M15A 4N4WA 3U8PA 1CPQA 3M4CA 2XM0A 3L1MA 1M6TA 2XL8A 4U9DA 2YLGA 4U9EA 2YLDA 4CDYA 2XLMA 1YZCA 3NMKA 1E86A 4IARA 3TOLA 3ZTZA 3TOMA 4CIPA 3HNLA 5JRAA 1JAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ6 A;  2XLD A;  2XLV A;  4WGY A;  5JLI A;  2CCY A;  3M4B A;  1NBB A;  3C62 A;  2BC5 A;  2XM4 A;  3ZWI A;  3HNI A;  5JS5 A;  3DE8 A;  2XLH A;  256B A;  1LM3 B;  3QVZ A;  2YL3 A;  5JVE A;  3FOO A;  1YZA A;  3FOP A;  5JSL A;  4JEB A;  1QPU A;  2XLW A;  1GQA A;  1YYX A;  3QVY A;  3VRC A;  1E84 A;  2XLO A;  4CX9 A;  1CGN A;  1E85 A;  3C63 A;  3DE9 A;  2XLE A;  2YL0 A;  3HNK A;  4D4X A;  4IB4 A;  4CDV A;  2YKZ A;  4CDA A;  4CJO A;  4N6H A;  1RCP A;  2J9B A;  3ZQY A;  1S05 A;  4CJG A;  5B3I A;  1E83 A;  1CGO A;  4JKV A;  5JUA A;  2YL1 A;  1APC A;  5JP7 A;  2YL7 A;  3ZTM A;  4ER9 A;  1YYJ A;  1BBH A;  4ULV A;  4EIY A;  4NC3 A;  1QQ3 A;  1EKY A;  2YLI A;  2J8W A;  3QW1 A;  3HNJ A;  2XL6 A;  3QW0 A;  2QLA A;  5JT4 A;  3IQ5 A;  1MQV A;  3M79 A;  3ZQV A;  4L6R A;  4D4N A;  1A7V A;  4JEA A;  5AGF A;  4WGZ A;  4IAQ A;  3NMJ A;  1CPR A;  4JE9 A;  3NMI A;  3M15 A;  4N4W A;  3U8P A;  1CPQ A;  3M4C A;  2XM0 A;  3L1M A;  1M6T A;  2XL8 A;  4U9D A;  2YLG A;  4U9E A;  2YLD A;  4CDY A;  2XLM A;  1YZC A;  3NMK A;  1E86 A;  4IAR A;  3TOL A;  3ZTZ A;  3TOM A;  4CIP A;  3HNL A;  5JRA A;  1JAF A; 
#chains in the Genus database with same CATH topology
 2HMZ A;  3U2L A;  5L0D A;  1KTM A;  4WGY A;  4G7O F;  3N0T A;  5KYX A;  1BR2 A;  1U89 A;  1J8M F;  1ZW3 A;  2BE5 F;  3C62 A;  4AL1 A;  1DOW A;  3SXK A;  3DXJ F;  5A6A A;  3HNI A;  4U5H A;  2WL8 A;  4FES A;  4BJ6 C;  1WAS A;  5L3Q A;  4HEA J;  3M1C B;  2NPU A;  3T6B A;  4LER A;  1D1C A;  4U5C E;  5BUO A;  3FOO A;  1Q0G A;  3IQC A;  4W8P A;  1LS1 A;  5JSL A;  3RKO F;  1VK5 A;  2A1D D;  3EHN A;  1NFN A;  3NYM A;  3T6J A;  2IOQ A;  4DRH B;  1WGW A;  1FFH A;  2FAP B;  1VTM P;  3U3F A;  1YAR O;  1TKN A;  3MX3 A;  2LK4 A;  5CIV A;  3RFY A;  1E84 A;  2OQM A;  1QLE C;  3KL4 A;  3KYI A;  1EKY A;  4KBL A;  3GM3 A;  3K1H A;  2IXN A;  2J0W A;  3JYY A;  4DRJ B;  2XXA B;  3FDQ A;  1CGN A;  4JTD B;  4JCH A;  3HLZ A;  3DE9 A;  3I5Q A;  2XLE A;  2UUH A;  4MVU A;  1B68 A;  3I4U A;  3W4Y A;  1A0B A;  1OR2 A;  2YL0 A;  3AG4 C;  3DAG A;  1TFK B;  3HNK A;  1VMA A;  3UR3 C;  5DQT A;  4D4X A;  1R5I D;  2XXA A;  1A41 A;  2EIM C;  3FXH A;  4JC7 A;  4OD4 A;  5A6K A;  3EPV A;  1OR3 A;  4LDQ A;  4C3D A;  4BJ5 C;  2EPO A;  3SP1 A;  3Q7L A;  1OW7 A;  3RVY A;  2EIJ C;  4N6C A;  2Z15 A;  3BEH A;  2V26 A;  3FAP B;  1OKK A;  5L0G A;  2VCB A;  5L0C A;  5F5F A;  1CGM E;  1RJ9 B;  1ZYR F;  5COF A;  1MMA A;  5AC5 A;  3KPH A;  2VCC A;  4CS9 A;  4ULV A;  3DKA A;  3WHN A;  1QSP A;  4I44 A;  4F4B A;  3FMS A;  3AGU A;  3WAQ A;  1NU7 D;  2QE9 A;  1RJ9 A;  1VB5 A;  2R7O A;  2YLI A;  3Q7G A;  3ABL C;  3VF0 A;  3AG2 C;  3QW1 A;  4A2N B;  2V3C C;  3DJN B;  2HUJ A;  2IYL D;  3ABK C;  2QY9 A;  2LCH A;  3HNJ A;  2WZF A;  3QW0 A;  4JIO A;  4C7O B;  1WAT A;  3O6X A;  2HV6 A;  1OCC C;  1R4T A;  4PAC A;  3U8P A;  4L6R A;  4DXW A;  4D4N A;  3ASO C;  3K7D A;  5AGF A;  3JSE O;  4BG0 A;  3S27 A;  1ORJ A;  2H8A A;  4BJ1 A;  3U8V A;  3B29 A;  1CPR A;  1PV3 A;  2J46 A;  4C7O A;  2A0B A;  5KYN A;  2Q3T A;  3M15 A;  2IM8 A;  2KYH A;  1C17 M;  1K05 A;  1L7C A;  1T5O A;  2L6G A;  2OJE D;  3EZI A;  2R7Q A;  1D0Z A;  2EPN A;  2DB4 A;  3H2V A;  1GGQ A;  2FGY A;  3U3B A;  4BPM A;  3GOD A;  5EK0 A;  4EUK B;  1ZZP A;  2W4M A;  1FNT c;  1TWC A;  4U5B E;  3M4C A;  4XQ1 A;  1ORS C;  2KQ9 A;  3E70 C;  5DLJ A;  4U9D A;  1G5Z A;  1SMY F;  2YLG A;  4UDV A;  5L0F A;  5KYU B;  1HE1 A;  1LS4 A;  1XWJ A;  4U9E A;  3N24 A;  1OCZ C;  4O79 A;  3RVZ A;  3ITF A;  3JCU Q;  4AL0 A;  1C02 A;  3NMK A;  2ZXO A;  4MQ9 F;  4R32 A;  2IBF A;  3TQO A;  3L0I A;  3NRH A;  3RQE A;  2JD3 A;  4J30 B;  3TOL A;  1NU9 C;  5KYU A;  3JRM O;  3MLG A;  2P6V A;  4U5D E;  2LP4 A;  3G4X A;  2AWY A;  3A9C A;  2YWA A;  3HNL A;  2R7R A;  1D0X A;  2J9V A;  3LLK A;  5F5H A;  4EBJ A;  4O6M A;  1NG1 A;  2OEX A;  4I1O B;  2GA0 A;  4JZA A;  1RKC A;  4MVS A;  2CCY A;  1Z5Z A;  4QI2 A;  4YN0 B;  2IXM A;  4BJ5 A;  1O87 A;  1PD1 A;  4DRI B;  4DBQ A;  1D1A A;  1U6H A;  2CYD A;  3GOR A;  3B0U X;  2DYS C;  4ULW A;  3LJB A;  1ZVZ A;  2OJQ A;  1V55 C;  2CNW D;  2MWQ A;  3AQC A;  3NYL A;  1ZHX A;  2J9W A;  4XPX A;  2Q9A A;  1T6U A;  4M63 A;  2L7A A;  2ZXP A;  3UNG C;  2CW0 F;  2MYS A;  2KJG A;  3C18 A;  3IEE A;  1D0Y A;  2PBE A;  5D92 A;  4JEB A;  3C7J A;  2HZ8 A;  3EHM A;  1O5H A;  4CSA C;  3SXZ A;  3PDM P;  1OQC A;  1VOM A;  3S90 A;  4NCQ A;  3DI5 A;  2XLO A;  2R7W A;  2Y3H A;  3GEH A;  1JPN A;  4G7Z F;  2P1A A;  2B0H A;  2C03 A;  2H7V C;  2KC3 A;  3AG1 C;  2W4B A;  3G50 A;  4MTO A;  1N1C A;  4MVR A;  5E3C A;  3B0P A;  3QTH A;  3AJM A;  3EFO B;  4PJM A;  2VCA A;  3ZDL A;  1PD0 A;  3LES A;  3U5S A;  2M64 A;  1K40 A;  2A68 F;  4MND A;  2A0U A;  2YKZ A;  4PJJ A;  1H9G A;  2CGE A;  2WVO A;  2YVK A;  1YLM A;  1LKX A;  1Q0F A;  4I1M A;  3H65 A;  2AVK A;  2NUT B;  4G78 A;  2ZXW C;  1OXK A;  3FVY A;  3EFO A;  5GPG B;  2H7O A;  2OG2 A;  1S05 A;  1TFO B;  2L6H A;  1HMO A;  3AG3 C;  4XEF A;  3TUL A;  4RDA A;  2NG1 A;  2OU6 A;  2YQY A;  4YL1 A;  1JMW A;  3JRT A;  5CI9 A;  3PMR A;  1FFT C;  4Z9H A;  4CJG A;  5B3I A;  3LS1 A;  1E83 A;  2PF4 E;  1G8X A;  3LEO A;  3K6B A;  1ZHT A;  2NUT A;  3X2Q C;  4G7H F;  1ZW2 A;  3ZTM A;  4C3E A;  1YYJ A;  4E0H A;  3W2W A;  4ER9 A;  1H7I A;  5L0J A;  1T6I A;  3I5P A;  2HMQ A;  4EIY A;  1JR8 A;  2R25 A;  3MYF A;  3NKE A;  1BR1 A;  1G4U S;  4KI2 A;  2WZG A;  1MMG A;  1NSG B;  3RIP A;  1LPE A;  3K33 A;  4HE8 D;  2J7P A;  1OW6 A;  2J8W A;  1OW8 A;  2X0C A;  2XL6 A;  3EZH A;  5F28 E;  1TQG A;  4NTF A;  5T3T A;  2QLA A;  1QKR A;  4JRZ A;  2VB6 A;  5A69 A;  2IXP A;  1VYI A;  1XZP A;  3K1I C;  4IJJ A;  4MTG A;  3IHU A;  1WWP A;  4NQF A;  3ZQV A;  4A4A A;  3T4R A;  3V5X A;  2O9X A;  5BQH A;  1PCX A;  1ST6 A;  1FMV A;  2MHR A;  4JJF A;  2AP3 A;  4LAC B;  4CS8 C;  2R7S A;  3GEE A;  2GWW A;  1QVX A;  1YJG A;  2XSE A;  2VC9 A;  4N4W A;  1IZM A;  5K0I A;  3IQT A;  4HFK B;  1W2W A;  1UG7 A;  2GFH A;  2FFH A;  3C8G B;  1Z23 A;  4XEK A;  4XLP F;  3GM2 A;  4NTB A;  2XL8 A;  1AVO B;  1BR4 A;  3GAN A;  5T1D B;  4XTK A;  3VYW A;  2Q4F A;  3KMI A;  3CQZ A;  3HTK C;  1T6Q A;  3C8G A;  5L3V A;  1S7Z A;  1FTS A;  4IAR A;  1YA9 A;  3MBG A;  2Q00 A;  4LDK A;  1V54 C;  3GWN A;  3L8J A;  2ZD9 A;  5JRA A;  2QUP A;  3VAY A;  4J7T A;  3IQ6 A;  3JYH A;  2PX3 A;  2XLD A;  2XLV A;  3RW0 A;  2NSG A;  4H54 A;  3W8H A;  3X1O A;  3ZC4 A;  5JLI A;  2EPM X;  4BJ6 A;  4QDL A;  2QTV A;  3M4B A;  4YJW A;  4RD9 A;  2HSB A;  2M4E A;  4AK9 A;  1NBB A;  2Y69 C;  4JVS A;  1JOG A;  2BC5 A;  5TJ5 E;  1SR2 A;  3SEO A;  1EI7 A;  2HJM A;  3MFN A;  2J0X A;  4J32 B;  2Q7R A;  3ZWI A;  3U0C A;  2KK1 A;  2R7X A;  2LD6 A;  2ETS A;  5DQZ A;  2XLH A;  2Y39 A;  256B A;  1LM3 B;  3DM9 B;  1OCO C;  4IWB A;  3O55 A;  3NKD A;  1NLX A;  1FMW A;  2HFI A;  2CDQ A;  1YZA A;  2R7V A;  5CI8 A;  2ZPA A;  3ECS A;  3AQB A;  3E9V A;  4YL3 A;  5DS4 A;  1TR2 A;  2PFD A;  2ZXR A;  3S0X A;  5A6B D;  3POV A;  1SZI A;  3W2V A;  3QVY A;  4JJG A;  5B1A C;  1YVI A;  4CIH A;  4GQH A;  1VLS A;  1Z3I X;  4N06 A;  3VRC A;  2EIK C;  1OXB A;  4CBE A;  1LI7 A;  3NDB B;  3B0V C;  1KU2 A;  4U5F E;  3LEV A;  3WG7 C;  4CX9 A;  3S28 A;  5BQI A;  4MTF A;  4U5G A;  3US6 A;  1TWA A;  2EPL X;  2ICW G;  2NSF A;  4X0R A;  1E85 A;  2G3K A;  2RD9 A;  3C63 A;  3FHD A;  4KNV A;  4O6N A;  2HJ3 A;  2WZL A;  3PHF 2;  5E2Q A;  3CZ6 A;  4O7G A;  4XLN F;  1FAP B;  4MVO A;  1U0B B;  1AEP A;  2TMV P;  1TWG A;  3O10 A;  4Q7C A;  3UMH A;  3GWL A;  2OOC A;  4OD5 A;  5KYW B;  3PCV A;  4P6I C;  1SYQ A;  4CDA A;  3U9J A;  4CJO A;  4N6H A;  3L34 A;  2WVN A;  3CEX A;  3NG1 A;  1ORY A;  4EBB A;  3DD7 A;  2YEV A;  1XZQ A;  1HW2 A;  4WJ0 A;  2LIG A;  4E7S A;  5KYW A;  3EH2 A;  5DS5 A;  3OWT A;  2H7B A;  3RQF A;  5HSW A;  2R7T A;  3IPM O;  1BZ4 A;  4JKV A;  2W9Y A;  4B6I A;  2YL1 A;  4K7B A;  2X51 A;  1APC A;  2YL7 A;  3DAF A;  4JTA B;  2P0N A;  1WN0 A;  4YWQ A;  3EQL F;  4PK4 A;  3ZSU A;  2A6E F;  3KYJ A;  5E33 A;  3VM6 A;  4YT8 A;  1G4W R;  4NC3 A;  2LQG A;  2Q9B A;  4MS2 A;  2GAQ A;  4W8K A;  3HJC A;  1Z63 A;  3U9M A;  5BQG A;  3UGO A;  3ASN C;  3GEI A;  2E87 A;  4Q4Z F;  1FR0 A;  5IY5 C;  4CS9 C;  4PJN A;  2DYR C;  4XPW A;  3KKB A;  1QZX A;  5JT4 A;  5COM A;  4HFF B;  2VAS A;  4PFP A;  1MQV A;  2P61 A;  2KNH A;  3CAX A;  4E18 A;  3M79 A;  2AWC A;  2LSE A;  3DMD A;  4WAB A;  3JSZ A;  3V7O A;  4XEV A;  3DWW A;  1VYK A;  2J9U A;  2KSF A;  2L6F A;  3NMJ A;  3Q6N A;  3SXY A;  2LFD A;  2F22 A;  1ZHW A;  3F47 A;  4U5E E;  3TJ5 A;  5COG A;  4Q5S F;  5B3S C;  1I4Z A;  4K1O A;  2I15 A;  1CPQ A;  3B71 A;  1ZU5 A;  3U2M A;  1ZHZ A;  3LNR A;  1H6G A;  3L1M A;  3NYJ A;  1IW7 F;  1M6T A;  1BDJ B;  2HV7 A;  1NZE A;  3SZR A;  4MW8 A;  2R02 A;  2YLD A;  4CDY A;  4EHP A;  1YZC A;  4DBR A;  4Z9I A;  4E17 A;  2EIL C;  3DZA A;  3G4Z A;  5L0H A;  1I4Y A;  4E0I A;  4IAO A;  3EGD B;  4P9T A;  3QZC A;  3TOM A;  3ZTZ A;  3OEO A;  4CIP A;  1HMD A;  3N2Z B;  3T6G B;  4GYT A;  4MVM A;  1JPJ A;  2XL4 A;  1EQ1 A;  2BL2 A;  2R05 A;  2UUI A;  1RKE B;  3EG9 B;  3R2P A;  4GEH A;  1A7D A;  5KYY B;  3EH1 A;  3MYI A;  1D1B A;  4FAP B;  2EIN C;  3EGD A;  1H9T A;  4DVZ A;  3TJ6 A;  2VH3 A;  1M2V B;  1Z7Q c;  1M2O A;  4KC9 A;  4XPY A;  1VLT A;  2RSE B;  2WVQ A;  1SF8 A;  2D5R B;  2QNL A;  2PNO A;  3EG9 A;  2PX0 A;  1RKE A;  2XM4 A;  1T01 A;  2J7P D;  4LLC A;  1YA7 O;  4JCZ A;  5AC4 A;  1I5N A;  5KYY A;  1HY5 A;  2Y3D A;  3DE8 A;  4EWC A;  5JS5 A;  4FX5 A;  4NTA A;  4AX2 A;  4ONS A;  1M2V A;  4MVZ A;  3QVZ A;  4CSA A;  2HS5 A;  2A6H F;  1GS9 A;  1ZHY A;  2A69 F;  2W45 A;  2YL3 A;  3ZG1 A;  5JVE A;  4ZLD A;  1RMV A;  4NY3 A;  3V5Z A;  3FOP A;  3H2U A;  5E3A A;  1QPU A;  4QI0 A;  5T3W A;  2XLW A;  1GQA A;  4LDR A;  1YYX A;  2P7V A;  1RXQ A;  4CS7 A;  1OKK D;  4P9F A;  1ZU4 A;  4EKW A;  5L0I A;  2YZS A;  4K0D A;  4O6Y A;  3RQG A;  3DM5 A;  3DJU B;  4JW1 A;  2J45 A;  4OIO F;  3UGP A;  4YT5 A;  3JZ0 A;  1JRA A;  1V74 B;  1LIH A;  2AU5 A;  2HSQ A;  3UMK A;  3K66 A;  2DGJ A;  3V5Y A;  2KW3 C;  2XS8 A;  3F46 A;  2XS1 A;  2YHS A;  3RYL A;  4YT4 A;  4MW3 A;  2OCC C;  2R03 A;  4JTC B;  4BEJ A;  4IB4 A;  2Y3G A;  4IRU A;  1Q0D A;  1V4A A;  3LS0 A;  4CDV A;  3J06 A;  4G0H A;  3C8G D;  4XWJ A;  2R7U A;  1EA8 A;  3LNM B;  3SNH A;  3ABM C;  3SXM A;  1Q0M A;  2ASR A;  1MMD A;  3OA1 A;  1RCP A;  1Y4C A;  3CSK A;  2B0J A;  2G62 A;  2Q9C A;  2J9B A;  3RF3 A;  3ZQY A;  4BJT A;  4C3B A;  5A6J A;  3S84 A;  1Y6D A;  5A6B A;  2IXO A;  4PJL A;  3EGX B;  5EHH A;  3LAY A;  2NUP B;  4OIR F;  4YT2 A;  1CGO A;  3HKK A;  2Y3B A;  3UMI A;  5JUA A;  4YL0 A;  5JP7 A;  3EJN A;  4KNW A;  1K04 A;  1MNE A;  4RBN A;  1E2X A;  1F1M A;  1BBH A;  3SYN A;  3TK0 A;  1WTY A;  5EGY A;  3WOD F;  3EGX A;  3Q6M A;  1QQ3 A;  2NUP A;  3K1I A;  1Q0K A;  3BRJ A;  1LVK A;  3L8I A;  3ATP A;  4DJ9 A;  1UFB A;  4FWV A;  2XRH A;  1YAU O;  4I3M A;  2I8B A;  4CS8 A;  1L3P A;  2CNW A;  3O39 A;  2DI3 A;  3C8Z A;  4BEM J;  3GM1 A;  2C04 A;  2OEV A;  3IQ5 A;  4AE4 B;  1OCR C;  2OKU A;  3JTL O;  4J7Y A;  1LI5 A;  2YRF A;  1A7V A;  4JEA A;  1YDI A;  3KH2 A;  2L9J A;  4WGZ A;  4YK5 A;  4OIN F;  3R7C A;  2L81 A;  1LE2 A;  3AGT A;  3B9Q A;  2D4U A;  4IAQ A;  4OIP F;  3ZIB A;  2JX0 A;  1A7E A;  2G3V A;  4JE9 A;  3AOU A;  4AE4 A;  3NMI A;  5DVW A;  1TWH A;  3S9O A;  4ANJ A;  5FZT A;  1AUE A;  3S29 A;  1C03 A;  1M56 C;  1HE9 A;  3ZVR A;  4E7Z A;  3RH3 A;  3FAJ A;  4IGG A;  3LUT B;  5FCL A;  1T9K A;  5B1B C;  3A11 A;  1HW1 A;  2XM0 A;  4JUR I;  1LE4 A;  4MVQ A;  1WOL A;  4DVY P;  5D91 A;  2PP4 A;  3JT1 A;  4H4K C;  2EPK X;  2GDC A;  2HKV A;  2JPU A;  5DS6 A;  2KGO A;  4PR9 A;  2XLM A;  4Z9J A;  1E86 A;  5HV9 A;  1KNY A;  1O3U A;  3LLI A;  3W8I A;  4OIQ F;  1DOV A;  4EBK A;  4PFO A;  1GM5 A;  3TD7 A;  2R9R B;  1NFO A;  3T9O A;  4DOZ A;  4ZLC A;  2WB7 A;  5KYX B;  1Z6A A;  2LFF A;  4LLE A;  1M57 C;  1MND A;  3QMK A;  1J8Y F;  1MMN A;  1JAF A; 
#chains in the Genus database with same CATH homology
 3IQ6 A;  2XLD A;  2XLV A;  4WGY A;  5JLI A;  2CCY A;  3M4B A;  1NBB A;  3C62 A;  2BC5 A;  2XM4 A;  3ZWI A;  3HNI A;  5JS5 A;  3DE8 A;  2XLH A;  256B A;  1LM3 B;  3QVZ A;  2YL3 A;  5JVE A;  3FOO A;  1YZA A;  3FOP A;  5JSL A;  4JEB A;  1QPU A;  2XLW A;  1GQA A;  1YYX A;  3QVY A;  3VRC A;  1E84 A;  2XLO A;  4CX9 A;  1CGN A;  1E85 A;  3C63 A;  3DE9 A;  2XLE A;  2YL0 A;  3HNK A;  4D4X A;  4IB4 A;  4CDV A;  2YKZ A;  4CDA A;  4CJO A;  4N6H A;  1RCP A;  2J9B A;  3ZQY A;  1S05 A;  4CJG A;  5B3I A;  1E83 A;  1CGO A;  4JKV A;  5JUA A;  2YL1 A;  1APC A;  5JP7 A;  2YL7 A;  3ZTM A;  4ER9 A;  1YYJ A;  1BBH A;  4ULV A;  4EIY A;  4NC3 A;  1QQ3 A;  1EKY A;  2YLI A;  2J8W A;  3QW1 A;  3HNJ A;  2XL6 A;  3QW0 A;  2QLA A;  5JT4 A;  3IQ5 A;  1MQV A;  3M79 A;  3ZQV A;  4L6R A;  4D4N A;  1A7V A;  4JEA A;  5AGF A;  4WGZ A;  4IAQ A;  3NMJ A;  1CPR A;  4JE9 A;  3NMI A;  3M15 A;  4N4W A;  3U8P A;  1CPQ A;  3M4C A;  2XM0 A;  3L1M A;  1M6T A;  2XL8 A;  4U9D A;  2YLG A;  4U9E A;  2YLD A;  4CDY A;  2XLM A;  1YZC A;  3NMK A;  1E86 A;  4IAR A;  3TOL A;  3ZTZ A;  3TOM A;  4CIP A;  3HNL A;  5JRA A;  1JAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...