3M4BA

A zn-mediated tetrahedral protein lattice cage
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4bA00
3VRCA 2QLAA 1E84A 4IB4A 4CX9A 1CPQA 2CCYA 3C62A 5JLIA 4D4XA 4CDYA 2XM4A 3HNIA 2YL0A 3FOOA 3HNJA 5JSLA 1LM3B 3IQ5A 2XLOA 4D4NA 4JE9A 4NC3A 2XLHA 2XLEA 1APCA 3TOLA 3NMIA 5JP7A 1CGNA 4ER9A 4CIPA 4EIYA 3HNKA 1MQVA 3DE8A 1YZAA 3M4CA 3L1MA 3QW1A 2YL7A 3ZQYA 1CGOA 1E85A 4N4WA 3ZTMA 2YLDA 1CPRA 3QW0A 2YL3A 3M79A 5JT4A 1YYXA 4U9DA 2XLMA 4WGZA 3TOMA 4CDAA 4CDVA 4CJOA 5JUAA 256BA 1EKYA 4IAQA 4N6HA 3ZQVA 3ZWIA 2XL6A 1E86A 2YLGA 3DE9A 3C63A 3NMKA 1QQ3A 2YKZA 4IARA 3IQ6A 4WGYA 3ZTZA 2XLDA 4ULVA 4CJGA 2J9BA 5JVEA 1QPUA 1YZCA 1BBHA 2XL8A 3QVYA 1S05A 1YYJA 3FOPA 4JKVA 3NMJA 5JS5A 4L6RA 5B3IA 4JEBA 3M4BA 1JAFA 1A7VA 2YLIA 2XM0A 5AGFA 1RCPA 3M15A 4U9EA 4JEAA 2BC5A 1E83A 3QVZA 5JRAA 1GQAA 2J8WA 2YL1A 3U8PA 1NBBA 1M6TA 2XLVA 2XLWA 3HNLA
chains in the Genus database with same CATH superfamily
1YDIA 5A6JA 2HV7A 2HMQA 3GODA 3NYMA 4WABA 4XQ1A 3SYNA 4IB4A 3TJ6A 3U8VA 2JX0A 4W8KA 1SZIA 2CCYA 4D4XA 4LLCA 3CAXA 2AP3A 1FAPB 1MNDA 3RYLA 3DXJF 2W4BA 2ZPAA 3LLKA 1V54C 2VC9A 3U5SA 1FTSA 5DQZA 4C3BA 3KPHA 1ZZPA 4BJ5A 2LQGA 2Y3HA 3S28A 3DD7A 5L0FA 4AX2A 3JSZA 1V74B 4DJ9A 4D4NA 4E18A 3EHNA 3AQBA 3SZRA 2FAPB 5CIVA 5BQHA 4LDRA 1QLEC 4Q4ZF 4ER9A 3WHNA 4EIYA 1U0BB 3HNKA 5COMA 4QI0A 2O9XA 4ZLCA 5L3QA 1HW2A 1ZHWA 3V5YA 4P9FA 2DB4A 3OWTA 3QW1A 2G62A 5B1AC 3ZQYA 5EGYA 1ZHXA 1G8XA 4LACB 1XZQA 2D4UA 3KH2A 4J32B 2J9WA 3B29A 1B68A 1Q0FA 3MX3A 4Z9JA 2WVNA 2DYRC 3KKBA 3QW0A 4J7YA 4HFFB 4CS9A 4RBNA 1VYIA 2YL3A 1WGWA 4EHPA 4N06A 3QMKA 4JTCB 2LIGA 1Y4CA 3TJ5A 3CSKA 2V3CC 3ASNC 2GA0A 5T3TA 4AL0A 2XLMA 1QKRA 4LDKA 3H2VA 1M2VB 1PD1A 2J7PA 4CDVA 1I5NA 5AC4A 2R03A 3W2VA 2HSQA 3SXKA 1YAUO 2OJQA 1TKNA 2V26A 5DLJA 3DM9B 2PBEA 4G7ZF 1JMWA 1Q0DA 1SYQA 3K1IA 2IOQA 1YA7O 1YARO 1LIHA 2Y39A 3GEEA 3KYJA 1PCXA 2DYSC 2W9YA 5A6AA 1U89A 4CS8A 4CSAC 4PJNA 2P6VA 2XSEA 2R7XA 5E3AA 3O39A 1OR3A 2JPUA 5HV9A 4QDLA 3IQCA 3U3FA 3N24A 4MTFA 1VMAA 3JSEO 2ETSA 5JVEA 5GPGB 2GWWA 3C8ZA 2LFFA 1BR2A 4YT4A 3T6BA 2H7OA 4KBLA 5D91A 3UMHA 4K7BA 4FAPB 1S05A 3K33A 3S9OA 1NZEA 3RFYA 4ZLDA 2LK4A 4PJMA 5JS5A 3PDMP 1L3PA 1Z63A 2LCHA 1XZPA 2VCBA 2XS1A 5K0IA 4JEBA 3AG1C 4XPYA 1MMAA 1MMNA 2I15A 2RSEB 4JZAA 3W4YA 4CIHA 5AC5A 1O5HA 2A1DD 4LDQA 2HJ3A 3RQFA 4XTKA 1NSGB 5COGA 4DRHB 4AK9A 3Q6NA 5CI8A 4E0IA 2L6FA 5E33A 2ZXOA 3ECSA 1NU7D 3FHDA 3OA1A 4NY3A 3EHMA 3PHF2 4F4BA 3LEOA 4U5EE 2EPLX 4R32A 4ANJA 1TQGA 2YHSA 4BJ6C 2G3VA 3UMIA 2B0JA 3RQGA 1LI5A 1VB5A 1DOVA 3SXZA 2PFDA 4G78A 2HJMA 2QLAA 3U9JA 5KYYA 4LERA 1ZU4A 1FR0A 2XS8A 5KYYB 2L9JA 2OOCA 3EGXA 1GS9A 2VCAA 4IJJA 1KU2A 1NU9C 4MW3A 2OU6A 1Z5ZA 2OJED 3EGXB 1OW6A 2WZLA 2CGEA 2XM4A 4PACA 2R02A 1LVKA 3EH2A 2CDQA 4MVUA 3C8GA 2P7VA 3EH1A 2IXNA 3MYFA 3C8GB 5L0GA 3N0TA 2HKVA 2R25A 1LM3B 1FMWA 3AJMA 2KGOA 3UNGC 3CEXA 1UFBA 2QE9A 4U5GA 3X1OA 3L0IA 4DRJB 3FXHA 3FVYA 1TR2A 5DVWA 2HUJA 4MW8A 2C04A 4ULWA 3LAYA 1T6UA 4XLNF 3VAYA 4EBKA 1APCA 2I8BA 2KK1A 2VH3A 3TOLA 5JP7A 1CGNA 1ZYRF 2A68F 3JCUQ 3SEOA 2EINC 2D5RB 1ZU5A 2OEXA 2ICWG 3ZIBA 1M57C 4FX5A 3DE8A 1YZAA 3M4CA 1ORYA 2DGJA 2NUPB 4DRIB 4Q5SF 2IYLD 1EA8A 3MFNA 1O87A 2YL7A 2YEVA 4BJ5C 3UR3C 1G4US 1CGOA 1NFNA 2Q9CA 4IGGA 2PX3A 4N4WA 4I1OB 1K04A 4JCHA 1PV3A 5F28E 1F1MA 5TJ5E 1J8YF 3RVZA 4HFKB 1RKEA 1IZMA 2A69F 1GGQA 3V5ZA 5B1BC 1RKEB 1YYXA 3S0XA 3BRJA 3EFOA 4N6CA 3DWWA 1JOGA 1M2OA 2J9UA 3ZG1A 3EFOB 1XWJA 3S90A 1FFTC 3Q7GA 1RKCA 4J30B 3TOMA 4CDAA 2NSFA 2ZXPA 4Z9HA 5JUAA 3FAPB 3T4RA 3LJBA 4EUKB 4BEMJ 4P6IC 5A6BD 3ZQVA 4XLPF 3FDQA 1I4YA 2XL6A 4DBRA 2R05A 2W45A 5L0HA 4A2NB 1AEPA 2Q3TA 4CS9C 5A69A 2YLGA 4GEHA 1IW7F 4XEFA 3W8HA 1E86A 3DJUB 4OIRF 3C63A 4IWBA 1G5ZA 3NMKA 3HKKA 3LESA 2BE5F 2OEVA 3UGOA 3IQ6A 4U5HA 1NG1A 1S7ZA 4MVQA 4YT8A 4BJTA 1RJ9A 4C7OA 2W4MA 1RJ9B 1OXKA 3A11A 4C7OB 5T3WA 1V4AA 4O6NA 2WVQA 1M2VA 1VYKA 1TWAA 3K1IC 4MVMA 3E9VA 2WVOA 4NTAA 2YZSA 1T01A 5DS4A 3VM6A 2GDCA 1D1CA 1BBHA 3US6A 2R7RA 2AU5A 4O6MA 3K66A 3DAFA 3FOPA 3LNRA 1ZHTA 4CS8C 3O6XA 3L8IA 1MMDA 1Z6AA 4H54A 4UDVA 2R7OA 2J45A 1TFOB 3GM2A 4MVOA 5B3IA 4PFPA 4I44A 3M4BA 1JAFA 5KYUA 5HSWA 4NQFA 5KYUB 2IXMA 4NTFA 1D1AA 2Y3GA 1LE2A 3JZ0A 3MYIA 2TMVP 4EBBA 4OIPF 3UMKA 3WAQA 3M15A 4EBJA 1R4TA 4DOZA 3T6JA 1NFOA 1BZ4A 3JYYA 1VLSA 2EIKC 3F46A 3Q7LA 4YK5A 3VF0A 2OCCC 4OIOF 4I3MA 2J8WA 2YL1A 3RQEA 3AGUA 3ITFA 2J46A 4X0RA 3U8PA 1NBBA 2XLVA 3HNLA 3RVYA 1YLMA 1VOMA 3CZ6A 1E84A 5L0JA 1QZXA 4CX9A 3C62A 4CDYA 1J8MF 4O6YA 4XPWA 3JYHA 1LE4A 3R7CA 1C03A 2EPNA 3TQOA 1ST6A 3I5PA 2KNHA 3M1CB 4M63A 2G3KA 5COFA 2YL0A 2HS5A 1K40A 3HNJA 4HE8D 4JC7A 3JT1A 2YVKA 1BR4A 2OQMA 2KQ9A 5JSLA 2IXOA 3DKAA 4W8PA 3JRMO 4ONSA 4E7SA 4O7GA 1RXQA 5E3CA 2WB7A 4KI2A 4MVZA 1LS4A 4AE4A 4OINF 4FESA 2AWYA 2XLHA 4NC3A 1FMVA 4YT2A 2HZ8A 4AE4B 1HMDA 3NMIA 2PP4A 1BDJB 2IM8A 2H8AA 2CW0F 1I4ZA 4PFOA 1MQVA 4GQHA 1TWCA 3SXYA 2YWAA 2J9VA 3L1MA 1U6HA 1VLTA 5F5FA 3F47A 4KNWA 2R9RB 5DS6A 4U5BE 5FCLA 3L34A 3GM1A 1AVOB 2J0XA 1E85A 3JRTA 5BQIA 5EK0A 1OW8A 1OCCC 4NTBA 3S27A 2FGYA 3HLZA 3WG7C 2YLDA 1CPRA 2WZFA 4DVYP 2PX0A 4QI2A 2MYSA 3N2ZB 2FFHA 5FZTA 4U9DA 3TULA 4BG0A 1ORSC 1C02A 3L8JA 1TFKB 4B6IA 1TWHA 4CBEA 4G7OF 3QTHA 4KC9A 3U2MA 1JPJA 1L7CA 256BA 2OKUA 1HE9A 4IAQA 4N6HA 4XEKA 4CJOA 5L0DA 1D0XA 4KNVA 2QNLA 2ZXRA 1WASA 1ZHZA 3LS0A 3V5XA 1WATA 2GAQA 2VB6A 3ZWIA 2M64A 1VTMP 2A6EF 3GEHA 3G4ZA 2HFIA 3NKEA 3U0CA 1SF8A 4YWQA 1HMOA 1JRAA 2NUPA 2VASA 3DE9A 3ABMC 1Y6DA 4YT5A 4XWJA 1LKXA 1QQ3A 1JR8A 2HMZA 2YKZA 2Y3BA 4IARA 3PCVA 3S84A 2QUPA 4BJ1A 3MBGA 3C18A 2P0NA 1BR1A 2Y3DA 4G7HF 1M56C 2WZGA 2B0HA 2EIJC 2GFHA 3DZAA 3B9QA 3ZTZA 2UUIA 2ASRA 1A41A 1OCRC 3IQTA 2XLDA 1OCZC 4JTDB 1SR2A 4JJFA 2WL8A 3S29A 2Q7RA 2NPUA 2Z15A 1SMYF 1Z7Qc 2IBFA 1Q0KA 2OG2A 4HEAJ 3SP1A 3GORA 3H2UA 5BUOA 4JIOA 3V7OA 1LS1A 3G50A 3ABKC 1GM5A 4C3EA 2Q9AA 1YZCA 2C03A 1UG7A 3ABLC 3IHUA 4OD5A 2L6HA 2A6HF 1MNEA 2QTVA 4JCZA 2BL2A 4Q7CA 1YYJA 4XPXA 4YL0A 1MMGA 3AOUA 2JD3A 1QSPA 2R7SA 2PF4E 3NYJA 5A6BA 3DAGA 1N1CA 3K1HA 3NMJA 3BEHA 4JKVA 4JVSA 2CYDA 2UUHA 3DI5A 3EJNA 1Z23A 4L6RA 4LLEA 1OKKD 1Q0GA 3K6BA 4XEVA 1AUEA 2KC3A 4MVRA 3ZSUA 1LPEA 2YQYA 1OKKA 2KYHA 1A7DA 2LFDA 3EGDA 1WTYA 4YL3A 3RKOF 1A7VA 1PD0A 1NLXA 3GEIA 3GWLA 1KNYA 2R7QA 3EGDB 2YLIA 3JTLO 4O79A 4Z9IA 2XM0A 3IPMO 4OD4A 2X0CA 5KYXB 1RCPA 4IAOA 4U5CE 3DM5A 2H7VC 1LI7A 2YRFA 3OEOA 4U9EA 4E17A 5DS5A 4JEAA 2BC5A 3EPVA 2IXPA 4RDAA 1D1BA 2HV6A 3W2WA 3QVZA 4K0DA 4JURI 3W8IA 3B0VC 4MS2A 3A9CA 3ZVRA 3K7DA 1T6IA 2R7UA 3NG1A 4EWCA 3AG2C 3EZHA 2XLWA 3X2QC 3TD7A 1EQ1A 1QVXA 3VRCA 3I4UA 5E2QA 5L0CA 1ZHYA 1RMVA 1CPQA 1ZVZA 1FFHA 3O55A 5JLIA 2EPOA 1YJGA 1FNTc 2H7BA 1HE1A 3O10A 4PJLA 3RF3A 2F22A 4U5DE 4AL1A 4K1OA 2M4EA 3HNIA 5IY5C 2P1AA 3FOOA 3MLGA 4NCQA 3G4XA 3B0UX 3I5QA 1JPNA 4YN0B 1OXBA 3CQZA 1T9KA 1ZW2A 2RD9A 3SXMA 1VK5A 2J7PD 4EKWA 3SNHA 2MWQA 5A6KA 4PR9A 4RD9A 2QY9A 2XLOA 3IQ5A 3J06A 4DVZA 3ASOC 3GWNA 4JE9A 1OW7A 1KTMA 3LNMB 3B0PA 2XLEA 4MTGA 1V55C 2LD6A 2EPKX 3ATPA 3AQCA 4IRUA 2Q00A 3B71A 4WJ0A 4CIPA 3POVA 3DJNB 4E0HA 3NKDA 5B3SC 4CS7A 4JJGA 2Q4FA 3EZIA 1H9TA 1E2XA 2VCCA 1WWPA 4FWVA 4G0HA 1OQCA 2A0BA 4MTOA 3T6GB 3NDBB 2MHRA 3ZTMA 3FAJA 4JW1A 3FMSA 1A7EA 2XL4A 2XXAA 3T9OA 2CNWD 4P9TA 2KSFA 4MNDA 1G4WR 5L0IA 3H65A 3M79A 1Z3IX 2CNWA 5JT4A 2XXAB 4OIQF 2LP4A 2EILC 5DQTA 2EPMX 3IEEA 1D0ZA 3NYLA 2P61A 3HTKC 3RIPA 1YVIA 2XRHA 4WGZA 4CSAA 3UGPA 3GANA 3TK0A 4PK4A 3ZC4A 5L3VA 1EKYA 2R7WA 2R7TA 2ZD9A 3EG9A 1T6QA 3AG3C 3RW0A 5KYNA 3EG9B 2E87A 3ZDLA 1OR2A 2Q9BA 2L81A 2EIMC 1Q0MA 2AVKA 2ZXWC 4U5FE 2A0UA 3VYWA 5KYXA 2L6GA 3U9MA 2LSEA 1H9GA 3Q6MA 1HW1A 4WGYA 3WODF 1A0BA 3LUTB 4A4AA 1H7IA 3U3BA 3DMDA 1R5ID 4ULVA 5EHHA 5CI9A 1TWGA 4CJGA 4JTAB 3QZCA 5KYWA 1OCOC 2J9BA 5KYWB 1K05A 2Y69C 3GM3A 3U2LA 1QPUA 2HSBA 5BQGA 1YA9A 3LEVA 3RH3A 1EI7A 2NSGA 2XL8A 3KYIA 4YJWA 4YL1A 3QVYA 4MVSA 1W2WA 3C7JA 3EQLF 3KL4A 4BPMA 1D0YA 5T1DB 4JRZA 3E70C 3R2PA 4BJ6A 2J0WA 1T5OA 4BEJA 2KW3C 1ORJA 2AWCA 5D92A 3C8GD 1H6GA 2KJGA 4DBQA 1ZW3A 1HY5A 3NRHA 3PMRA 4C3DA 5F5HA 2L7AA 4DXWA 2X51A 5AGFA 1WOLA 1CGME 2DI3A 4H4KC 3KMIA 4I1MA 3LLIA 4PJJA 2NUTA 1E83A 3LS1A 5JRAA 1WN0A 3AG4C 2NUTB 1O3UA 1DOWA 1GQAA 4MQ9F 2NG1A 4GYTA 4E7ZA 2R7VA 1M6TA 4J7TA 1C17M 3HJCA 2PNOA 3AGTA
chains in the Genus database with same CATH topology
3VRCA 2QLAA 1E84A 4IB4A 4CX9A 1CPQA 2CCYA 3C62A 5JLIA 4D4XA 4CDYA 2XM4A 3HNIA 2YL0A 3FOOA 3HNJA 5JSLA 1LM3B 3IQ5A 2XLOA 4D4NA 4JE9A 4NC3A 2XLHA 2XLEA 1APCA 3TOLA 3NMIA 5JP7A 1CGNA 4ER9A 4CIPA 4EIYA 3HNKA 1MQVA 3DE8A 1YZAA 3M4CA 3L1MA 3QW1A 2YL7A 3ZQYA 1CGOA 1E85A 4N4WA 3ZTMA 2YLDA 1CPRA 3QW0A 2YL3A 3M79A 5JT4A 1YYXA 4U9DA 2XLMA 4WGZA 3TOMA 4CDAA 4CDVA 4CJOA 5JUAA 256BA 1EKYA 4IAQA 4N6HA 3ZQVA 3ZWIA 2XL6A 1E86A 2YLGA 3DE9A 3C63A 3NMKA 1QQ3A 2YKZA 4IARA 3IQ6A 4WGYA 3ZTZA 2XLDA 4ULVA 4CJGA 2J9BA 5JVEA 1QPUA 1YZCA 1BBHA 2XL8A 3QVYA 1S05A 1YYJA 3FOPA 4JKVA 3NMJA 5JS5A 4L6RA 5B3IA 4JEBA 3M4BA 1JAFA 1A7VA 2YLIA 2XM0A 5AGFA 1RCPA 3M15A 4U9EA 4JEAA 2BC5A 1E83A 3QVZA 5JRAA 1GQAA 2J8WA 2YL1A 3U8PA 1NBBA 1M6TA 2XLVA 2XLWA 3HNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRC A;  2QLA A;  1E84 A;  4IB4 A;  4CX9 A;  1CPQ A;  2CCY A;  3C62 A;  5JLI A;  4D4X A;  4CDY A;  2XM4 A;  3HNI A;  2YL0 A;  3FOO A;  3HNJ A;  5JSL A;  1LM3 B;  3IQ5 A;  2XLO A;  4D4N A;  4JE9 A;  4NC3 A;  2XLH A;  2XLE A;  1APC A;  3TOL A;  3NMI A;  5JP7 A;  1CGN A;  4ER9 A;  4CIP A;  4EIY A;  3HNK A;  1MQV A;  3DE8 A;  1YZA A;  3M4C A;  3L1M A;  3QW1 A;  2YL7 A;  3ZQY A;  1CGO A;  1E85 A;  4N4W A;  3ZTM A;  2YLD A;  1CPR A;  3QW0 A;  2YL3 A;  3M79 A;  5JT4 A;  1YYX A;  4U9D A;  2XLM A;  4WGZ A;  3TOM A;  4CDA A;  4CDV A;  4CJO A;  5JUA A;  256B A;  1EKY A;  4IAQ A;  4N6H A;  3ZQV A;  3ZWI A;  2XL6 A;  1E86 A;  2YLG A;  3DE9 A;  3C63 A;  3NMK A;  1QQ3 A;  2YKZ A;  4IAR A;  3IQ6 A;  4WGY A;  3ZTZ A;  2XLD A;  4ULV A;  4CJG A;  2J9B A;  5JVE A;  1QPU A;  1YZC A;  1BBH A;  2XL8 A;  3QVY A;  1S05 A;  1YYJ A;  3FOP A;  4JKV A;  3NMJ A;  5JS5 A;  4L6R A;  5B3I A;  4JEB A;  3M4B A;  1JAF A;  1A7V A;  2YLI A;  2XM0 A;  5AGF A;  1RCP A;  3M15 A;  4U9E A;  4JEA A;  2BC5 A;  1E83 A;  3QVZ A;  5JRA A;  1GQA A;  2J8W A;  2YL1 A;  3U8P A;  1NBB A;  1M6T A;  2XLV A;  2XLW A;  3HNL A; 
#chains in the Genus database with same CATH topology
 1YDI A;  5A6J A;  2HV7 A;  2HMQ A;  3GOD A;  3NYM A;  4WAB A;  4XQ1 A;  3SYN A;  4IB4 A;  3TJ6 A;  3U8V A;  2JX0 A;  4W8K A;  1SZI A;  2CCY A;  4D4X A;  4LLC A;  3CAX A;  2AP3 A;  1FAP B;  1MND A;  3RYL A;  3DXJ F;  2W4B A;  2ZPA A;  3LLK A;  1V54 C;  2VC9 A;  3U5S A;  1FTS A;  5DQZ A;  4C3B A;  3KPH A;  1ZZP A;  4BJ5 A;  2LQG A;  2Y3H A;  3S28 A;  3DD7 A;  5L0F A;  4AX2 A;  3JSZ A;  1V74 B;  4DJ9 A;  4D4N A;  4E18 A;  3EHN A;  3AQB A;  3SZR A;  2FAP B;  5CIV A;  5BQH A;  4LDR A;  1QLE C;  4Q4Z F;  4ER9 A;  3WHN A;  4EIY A;  1U0B B;  3HNK A;  5COM A;  4QI0 A;  2O9X A;  4ZLC A;  5L3Q A;  1HW2 A;  1ZHW A;  3V5Y A;  4P9F A;  2DB4 A;  3OWT A;  3QW1 A;  2G62 A;  5B1A C;  3ZQY A;  5EGY A;  1ZHX A;  1G8X A;  4LAC B;  1XZQ A;  2D4U A;  3KH2 A;  4J32 B;  2J9W A;  3B29 A;  1B68 A;  1Q0F A;  3MX3 A;  4Z9J A;  2WVN A;  2DYR C;  3KKB A;  3QW0 A;  4J7Y A;  4HFF B;  4CS9 A;  4RBN A;  1VYI A;  2YL3 A;  1WGW A;  4EHP A;  4N06 A;  3QMK A;  4JTC B;  2LIG A;  1Y4C A;  3TJ5 A;  3CSK A;  2V3C C;  3ASN C;  2GA0 A;  5T3T A;  4AL0 A;  2XLM A;  1QKR A;  4LDK A;  3H2V A;  1M2V B;  1PD1 A;  2J7P A;  4CDV A;  1I5N A;  5AC4 A;  2R03 A;  3W2V A;  2HSQ A;  3SXK A;  1YAU O;  2OJQ A;  1TKN A;  2V26 A;  5DLJ A;  3DM9 B;  2PBE A;  4G7Z F;  1JMW A;  1Q0D A;  1SYQ A;  3K1I A;  2IOQ A;  1YA7 O;  1YAR O;  1LIH A;  2Y39 A;  3GEE A;  3KYJ A;  1PCX A;  2DYS C;  2W9Y A;  5A6A A;  1U89 A;  4CS8 A;  4CSA C;  4PJN A;  2P6V A;  2XSE A;  2R7X A;  5E3A A;  3O39 A;  1OR3 A;  2JPU A;  5HV9 A;  4QDL A;  3IQC A;  3U3F A;  3N24 A;  4MTF A;  1VMA A;  3JSE O;  2ETS A;  5JVE A;  5GPG B;  2GWW A;  3C8Z A;  2LFF A;  1BR2 A;  4YT4 A;  3T6B A;  2H7O A;  4KBL A;  5D91 A;  3UMH A;  4K7B A;  4FAP B;  1S05 A;  3K33 A;  3S9O A;  1NZE A;  3RFY A;  4ZLD A;  2LK4 A;  4PJM A;  5JS5 A;  3PDM P;  1L3P A;  1Z63 A;  2LCH A;  1XZP A;  2VCB A;  2XS1 A;  5K0I A;  4JEB A;  3AG1 C;  4XPY A;  1MMA A;  1MMN A;  2I15 A;  2RSE B;  4JZA A;  3W4Y A;  4CIH A;  5AC5 A;  1O5H A;  2A1D D;  4LDQ A;  2HJ3 A;  3RQF A;  4XTK A;  1NSG B;  5COG A;  4DRH B;  4AK9 A;  3Q6N A;  5CI8 A;  4E0I A;  2L6F A;  5E33 A;  2ZXO A;  3ECS A;  1NU7 D;  3FHD A;  3OA1 A;  4NY3 A;  3EHM A;  3PHF 2;  4F4B A;  3LEO A;  4U5E E;  2EPL X;  4R32 A;  4ANJ A;  1TQG A;  2YHS A;  4BJ6 C;  2G3V A;  3UMI A;  2B0J A;  3RQG A;  1LI5 A;  1VB5 A;  1DOV A;  3SXZ A;  2PFD A;  4G78 A;  2HJM A;  2QLA A;  3U9J A;  5KYY A;  4LER A;  1ZU4 A;  1FR0 A;  2XS8 A;  5KYY B;  2L9J A;  2OOC A;  3EGX A;  1GS9 A;  2VCA A;  4IJJ A;  1KU2 A;  1NU9 C;  4MW3 A;  2OU6 A;  1Z5Z A;  2OJE D;  3EGX B;  1OW6 A;  2WZL A;  2CGE A;  2XM4 A;  4PAC A;  2R02 A;  1LVK A;  3EH2 A;  2CDQ A;  4MVU A;  3C8G A;  2P7V A;  3EH1 A;  2IXN A;  3MYF A;  3C8G B;  5L0G A;  3N0T A;  2HKV A;  2R25 A;  1LM3 B;  1FMW A;  3AJM A;  2KGO A;  3UNG C;  3CEX A;  1UFB A;  2QE9 A;  4U5G A;  3X1O A;  3L0I A;  4DRJ B;  3FXH A;  3FVY A;  1TR2 A;  5DVW A;  2HUJ A;  4MW8 A;  2C04 A;  4ULW A;  3LAY A;  1T6U A;  4XLN F;  3VAY A;  4EBK A;  1APC A;  2I8B A;  2KK1 A;  2VH3 A;  3TOL A;  5JP7 A;  1CGN A;  1ZYR F;  2A68 F;  3JCU Q;  3SEO A;  2EIN C;  2D5R B;  1ZU5 A;  2OEX A;  2ICW G;  3ZIB A;  1M57 C;  4FX5 A;  3DE8 A;  1YZA A;  3M4C A;  1ORY A;  2DGJ A;  2NUP B;  4DRI B;  4Q5S F;  2IYL D;  1EA8 A;  3MFN A;  1O87 A;  2YL7 A;  2YEV A;  4BJ5 C;  3UR3 C;  1G4U S;  1CGO A;  1NFN A;  2Q9C A;  4IGG A;  2PX3 A;  4N4W A;  4I1O B;  1K04 A;  4JCH A;  1PV3 A;  5F28 E;  1F1M A;  5TJ5 E;  1J8Y F;  3RVZ A;  4HFK B;  1RKE A;  1IZM A;  2A69 F;  1GGQ A;  3V5Z A;  5B1B C;  1RKE B;  1YYX A;  3S0X A;  3BRJ A;  3EFO A;  4N6C A;  3DWW A;  1JOG A;  1M2O A;  2J9U A;  3ZG1 A;  3EFO B;  1XWJ A;  3S90 A;  1FFT C;  3Q7G A;  1RKC A;  4J30 B;  3TOM A;  4CDA A;  2NSF A;  2ZXP A;  4Z9H A;  5JUA A;  3FAP B;  3T4R A;  3LJB A;  4EUK B;  4BEM J;  4P6I C;  5A6B D;  3ZQV A;  4XLP F;  3FDQ A;  1I4Y A;  2XL6 A;  4DBR A;  2R05 A;  2W45 A;  5L0H A;  4A2N B;  1AEP A;  2Q3T A;  4CS9 C;  5A69 A;  2YLG A;  4GEH A;  1IW7 F;  4XEF A;  3W8H A;  1E86 A;  3DJU B;  4OIR F;  3C63 A;  4IWB A;  1G5Z A;  3NMK A;  3HKK A;  3LES A;  2BE5 F;  2OEV A;  3UGO A;  3IQ6 A;  4U5H A;  1NG1 A;  1S7Z A;  4MVQ A;  4YT8 A;  4BJT A;  1RJ9 A;  4C7O A;  2W4M A;  1RJ9 B;  1OXK A;  3A11 A;  4C7O B;  5T3W A;  1V4A A;  4O6N A;  2WVQ A;  1M2V A;  1VYK A;  1TWA A;  3K1I C;  4MVM A;  3E9V A;  2WVO A;  4NTA A;  2YZS A;  1T01 A;  5DS4 A;  3VM6 A;  2GDC A;  1D1C A;  1BBH A;  3US6 A;  2R7R A;  2AU5 A;  4O6M A;  3K66 A;  3DAF A;  3FOP A;  3LNR A;  1ZHT A;  4CS8 C;  3O6X A;  3L8I A;  1MMD A;  1Z6A A;  4H54 A;  4UDV A;  2R7O A;  2J45 A;  1TFO B;  3GM2 A;  4MVO A;  5B3I A;  4PFP A;  4I44 A;  3M4B A;  1JAF A;  5KYU A;  5HSW A;  4NQF A;  5KYU B;  2IXM A;  4NTF A;  1D1A A;  2Y3G A;  1LE2 A;  3JZ0 A;  3MYI A;  2TMV P;  4EBB A;  4OIP F;  3UMK A;  3WAQ A;  3M15 A;  4EBJ A;  1R4T A;  4DOZ A;  3T6J A;  1NFO A;  1BZ4 A;  3JYY A;  1VLS A;  2EIK C;  3F46 A;  3Q7L A;  4YK5 A;  3VF0 A;  2OCC C;  4OIO F;  4I3M A;  2J8W A;  2YL1 A;  3RQE A;  3AGU A;  3ITF A;  2J46 A;  4X0R A;  3U8P A;  1NBB A;  2XLV A;  3HNL A;  3RVY A;  1YLM A;  1VOM A;  3CZ6 A;  1E84 A;  5L0J A;  1QZX A;  4CX9 A;  3C62 A;  4CDY A;  1J8M F;  4O6Y A;  4XPW A;  3JYH A;  1LE4 A;  3R7C A;  1C03 A;  2EPN A;  3TQO A;  1ST6 A;  3I5P A;  2KNH A;  3M1C B;  4M63 A;  2G3K A;  5COF A;  2YL0 A;  2HS5 A;  1K40 A;  3HNJ A;  4HE8 D;  4JC7 A;  3JT1 A;  2YVK A;  1BR4 A;  2OQM A;  2KQ9 A;  5JSL A;  2IXO A;  3DKA A;  4W8P A;  3JRM O;  4ONS A;  4E7S A;  4O7G A;  1RXQ A;  5E3C A;  2WB7 A;  4KI2 A;  4MVZ A;  1LS4 A;  4AE4 A;  4OIN F;  4FES A;  2AWY A;  2XLH A;  4NC3 A;  1FMV A;  4YT2 A;  2HZ8 A;  4AE4 B;  1HMD A;  3NMI A;  2PP4 A;  1BDJ B;  2IM8 A;  2H8A A;  2CW0 F;  1I4Z A;  4PFO A;  1MQV A;  4GQH A;  1TWC A;  3SXY A;  2YWA A;  2J9V A;  3L1M A;  1U6H A;  1VLT A;  5F5F A;  3F47 A;  4KNW A;  2R9R B;  5DS6 A;  4U5B E;  5FCL A;  3L34 A;  3GM1 A;  1AVO B;  2J0X A;  1E85 A;  3JRT A;  5BQI A;  5EK0 A;  1OW8 A;  1OCC C;  4NTB A;  3S27 A;  2FGY A;  3HLZ A;  3WG7 C;  2YLD A;  1CPR A;  2WZF A;  4DVY P;  2PX0 A;  4QI2 A;  2MYS A;  3N2Z B;  2FFH A;  5FZT A;  4U9D A;  3TUL A;  4BG0 A;  1ORS C;  1C02 A;  3L8J A;  1TFK B;  4B6I A;  1TWH A;  4CBE A;  4G7O F;  3QTH A;  4KC9 A;  3U2M A;  1JPJ A;  1L7C A;  256B A;  2OKU A;  1HE9 A;  4IAQ A;  4N6H A;  4XEK A;  4CJO A;  5L0D A;  1D0X A;  4KNV A;  2QNL A;  2ZXR A;  1WAS A;  1ZHZ A;  3LS0 A;  3V5X A;  1WAT A;  2GAQ A;  2VB6 A;  3ZWI A;  2M64 A;  1VTM P;  2A6E F;  3GEH A;  3G4Z A;  2HFI A;  3NKE A;  3U0C A;  1SF8 A;  4YWQ A;  1HMO A;  1JRA A;  2NUP A;  2VAS A;  3DE9 A;  3ABM C;  1Y6D A;  4YT5 A;  4XWJ A;  1LKX A;  1QQ3 A;  1JR8 A;  2HMZ A;  2YKZ A;  2Y3B A;  4IAR A;  3PCV A;  3S84 A;  2QUP A;  4BJ1 A;  3MBG A;  3C18 A;  2P0N A;  1BR1 A;  2Y3D A;  4G7H F;  1M56 C;  2WZG A;  2B0H A;  2EIJ C;  2GFH A;  3DZA A;  3B9Q A;  3ZTZ A;  2UUI A;  2ASR A;  1A41 A;  1OCR C;  3IQT A;  2XLD A;  1OCZ C;  4JTD B;  1SR2 A;  4JJF A;  2WL8 A;  3S29 A;  2Q7R A;  2NPU A;  2Z15 A;  1SMY F;  1Z7Q c;  2IBF A;  1Q0K A;  2OG2 A;  4HEA J;  3SP1 A;  3GOR A;  3H2U A;  5BUO A;  4JIO A;  3V7O A;  1LS1 A;  3G50 A;  3ABK C;  1GM5 A;  4C3E A;  2Q9A A;  1YZC A;  2C03 A;  1UG7 A;  3ABL C;  3IHU A;  4OD5 A;  2L6H A;  2A6H F;  1MNE A;  2QTV A;  4JCZ A;  2BL2 A;  4Q7C A;  1YYJ A;  4XPX A;  4YL0 A;  1MMG A;  3AOU A;  2JD3 A;  1QSP A;  2R7S A;  2PF4 E;  3NYJ A;  5A6B A;  3DAG A;  1N1C A;  3K1H A;  3NMJ A;  3BEH A;  4JKV A;  4JVS A;  2CYD A;  2UUH A;  3DI5 A;  3EJN A;  1Z23 A;  4L6R A;  4LLE A;  1OKK D;  1Q0G A;  3K6B A;  4XEV A;  1AUE A;  2KC3 A;  4MVR A;  3ZSU A;  1LPE A;  2YQY A;  1OKK A;  2KYH A;  1A7D A;  2LFD A;  3EGD A;  1WTY A;  4YL3 A;  3RKO F;  1A7V A;  1PD0 A;  1NLX A;  3GEI A;  3GWL A;  1KNY A;  2R7Q A;  3EGD B;  2YLI A;  3JTL O;  4O79 A;  4Z9I A;  2XM0 A;  3IPM O;  4OD4 A;  2X0C A;  5KYX B;  1RCP A;  4IAO A;  4U5C E;  3DM5 A;  2H7V C;  1LI7 A;  2YRF A;  3OEO A;  4U9E A;  4E17 A;  5DS5 A;  4JEA A;  2BC5 A;  3EPV A;  2IXP A;  4RDA A;  1D1B A;  2HV6 A;  3W2W A;  3QVZ A;  4K0D A;  4JUR I;  3W8I A;  3B0V C;  4MS2 A;  3A9C A;  3ZVR A;  3K7D A;  1T6I A;  2R7U A;  3NG1 A;  4EWC A;  3AG2 C;  3EZH A;  2XLW A;  3X2Q C;  3TD7 A;  1EQ1 A;  1QVX A;  3VRC A;  3I4U A;  5E2Q A;  5L0C A;  1ZHY A;  1RMV A;  1CPQ A;  1ZVZ A;  1FFH A;  3O55 A;  5JLI A;  2EPO A;  1YJG A;  1FNT c;  2H7B A;  1HE1 A;  3O10 A;  4PJL A;  3RF3 A;  2F22 A;  4U5D E;  4AL1 A;  4K1O A;  2M4E A;  3HNI A;  5IY5 C;  2P1A A;  3FOO A;  3MLG A;  4NCQ A;  3G4X A;  3B0U X;  3I5Q A;  1JPN A;  4YN0 B;  1OXB A;  3CQZ A;  1T9K A;  1ZW2 A;  2RD9 A;  3SXM A;  1VK5 A;  2J7P D;  4EKW A;  3SNH A;  2MWQ A;  5A6K A;  4PR9 A;  4RD9 A;  2QY9 A;  2XLO A;  3IQ5 A;  3J06 A;  4DVZ A;  3ASO C;  3GWN A;  4JE9 A;  1OW7 A;  1KTM A;  3LNM B;  3B0P A;  2XLE A;  4MTG A;  1V55 C;  2LD6 A;  2EPK X;  3ATP A;  3AQC A;  4IRU A;  2Q00 A;  3B71 A;  4WJ0 A;  4CIP A;  3POV A;  3DJN B;  4E0H A;  3NKD A;  5B3S C;  4CS7 A;  4JJG A;  2Q4F A;  3EZI A;  1H9T A;  1E2X A;  2VCC A;  1WWP A;  4FWV A;  4G0H A;  1OQC A;  2A0B A;  4MTO A;  3T6G B;  3NDB B;  2MHR A;  3ZTM A;  3FAJ A;  4JW1 A;  3FMS A;  1A7E A;  2XL4 A;  2XXA A;  3T9O A;  2CNW D;  4P9T A;  2KSF A;  4MND A;  1G4W R;  5L0I A;  3H65 A;  3M79 A;  1Z3I X;  2CNW A;  5JT4 A;  2XXA B;  4OIQ F;  2LP4 A;  2EIL C;  5DQT A;  2EPM X;  3IEE A;  1D0Z A;  3NYL A;  2P61 A;  3HTK C;  3RIP A;  1YVI A;  2XRH A;  4WGZ A;  4CSA A;  3UGP A;  3GAN A;  3TK0 A;  4PK4 A;  3ZC4 A;  5L3V A;  1EKY A;  2R7W A;  2R7T A;  2ZD9 A;  3EG9 A;  1T6Q A;  3AG3 C;  3RW0 A;  5KYN A;  3EG9 B;  2E87 A;  3ZDL A;  1OR2 A;  2Q9B A;  2L81 A;  2EIM C;  1Q0M A;  2AVK A;  2ZXW C;  4U5F E;  2A0U A;  3VYW A;  5KYX A;  2L6G A;  3U9M A;  2LSE A;  1H9G A;  3Q6M A;  1HW1 A;  4WGY A;  3WOD F;  1A0B A;  3LUT B;  4A4A A;  1H7I A;  3U3B A;  3DMD A;  1R5I D;  4ULV A;  5EHH A;  5CI9 A;  1TWG A;  4CJG A;  4JTA B;  3QZC A;  5KYW A;  1OCO C;  2J9B A;  5KYW B;  1K05 A;  2Y69 C;  3GM3 A;  3U2L A;  1QPU A;  2HSB A;  5BQG A;  1YA9 A;  3LEV A;  3RH3 A;  1EI7 A;  2NSG A;  2XL8 A;  3KYI A;  4YJW A;  4YL1 A;  3QVY A;  4MVS A;  1W2W A;  3C7J A;  3EQL F;  3KL4 A;  4BPM A;  1D0Y A;  5T1D B;  4JRZ A;  3E70 C;  3R2P A;  4BJ6 A;  2J0W A;  1T5O A;  4BEJ A;  2KW3 C;  1ORJ A;  2AWC A;  5D92 A;  3C8G D;  1H6G A;  2KJG A;  4DBQ A;  1ZW3 A;  1HY5 A;  3NRH A;  3PMR A;  4C3D A;  5F5H A;  2L7A A;  4DXW A;  2X51 A;  5AGF A;  1WOL A;  1CGM E;  2DI3 A;  4H4K C;  3KMI A;  4I1M A;  3LLI A;  4PJJ A;  2NUT A;  1E83 A;  3LS1 A;  5JRA A;  1WN0 A;  3AG4 C;  2NUT B;  1O3U A;  1DOW A;  1GQA A;  4MQ9 F;  2NG1 A;  4GYT A;  4E7Z A;  2R7V A;  1M6T A;  4J7T A;  1C17 M;  3HJC A;  2PNO A;  3AGT A; 
#chains in the Genus database with same CATH homology
 3VRC A;  2QLA A;  1E84 A;  4IB4 A;  4CX9 A;  1CPQ A;  2CCY A;  3C62 A;  5JLI A;  4D4X A;  4CDY A;  2XM4 A;  3HNI A;  2YL0 A;  3FOO A;  3HNJ A;  5JSL A;  1LM3 B;  3IQ5 A;  2XLO A;  4D4N A;  4JE9 A;  4NC3 A;  2XLH A;  2XLE A;  1APC A;  3TOL A;  3NMI A;  5JP7 A;  1CGN A;  4ER9 A;  4CIP A;  4EIY A;  3HNK A;  1MQV A;  3DE8 A;  1YZA A;  3M4C A;  3L1M A;  3QW1 A;  2YL7 A;  3ZQY A;  1CGO A;  1E85 A;  4N4W A;  3ZTM A;  2YLD A;  1CPR A;  3QW0 A;  2YL3 A;  3M79 A;  5JT4 A;  1YYX A;  4U9D A;  2XLM A;  4WGZ A;  3TOM A;  4CDA A;  4CDV A;  4CJO A;  5JUA A;  256B A;  1EKY A;  4IAQ A;  4N6H A;  3ZQV A;  3ZWI A;  2XL6 A;  1E86 A;  2YLG A;  3DE9 A;  3C63 A;  3NMK A;  1QQ3 A;  2YKZ A;  4IAR A;  3IQ6 A;  4WGY A;  3ZTZ A;  2XLD A;  4ULV A;  4CJG A;  2J9B A;  5JVE A;  1QPU A;  1YZC A;  1BBH A;  2XL8 A;  3QVY A;  1S05 A;  1YYJ A;  3FOP A;  4JKV A;  3NMJ A;  5JS5 A;  4L6R A;  5B3I A;  4JEB A;  3M4B A;  1JAF A;  1A7V A;  2YLI A;  2XM0 A;  5AGF A;  1RCP A;  3M15 A;  4U9E A;  4JEA A;  2BC5 A;  1E83 A;  3QVZ A;  5JRA A;  1GQA A;  2J8W A;  2YL1 A;  3U8P A;  1NBB A;  1M6T A;  2XLV A;  2XLW A;  3HNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...