3M4BA

A zn-mediated tetrahedral protein lattice cage
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4bA00
4JEBA 5AGFA 1BBHA 2XM4A 4JE9A 2XM0A 1JAFA 3L1MA 3TOLA 3M79A 4ER9A 4N6HA 1M6TA 3VRCA 4D4NA 4L6RA 3HNKA 3ZQVA 1GQAA 4IAQA 4WGYA 3TOMA 4CJGA 1RCPA 1YZAA 1E85A 5JP7A 2XLOA 3ZQYA 4CJOA 2J8WA 3NMJA 3FOPA 3U8PA 2XLHA 2YL3A 5JT4A 5JRAA 3QVYA 2XL6A 4N4WA 4D4XA 1S05A 2YL7A 4CDYA 3HNLA 1CGNA 1EKYA 4U9EA 5JUAA 4EIYA 5JSLA 4JKVA 3DE9A 4WGZA 4CDAA 1QQ3A 1YZCA 1APCA 3HNIA 4CX9A 2XLDA 4NC3A 3ZTZA 5JVEA 4CIPA 4ULVA 1CGOA 2CCYA 3HNJA 3DE8A 3C63A 2QLAA 5JS5A 2XL8A 3NMKA 2YLGA 4U9DA 5JLIA 3M4BA 1MQVA 2BC5A 1QPUA 2XLVA 1LM3B 3M4CA 1E83A 3ZWIA 4IARA 1YYJA 1NBBA 2YKZA 1E84A 2XLEA 3FOOA 1CPQA 3IQ5A 256BA 3QVZA 3QW0A 5B3IA 2YLDA 2YL1A 4JEAA 1E86A 1A7VA 1CPRA 2J9BA 2XLWA 3C62A 3M15A 3ZTMA 2YL0A 3IQ6A 2YLIA 4IB4A 4CDVA 3NMIA 1YYXA 3QW1A 2XLMA
chains in the Genus database with same CATH superfamily
2CDQA 3TJ5A 5F5FA 4MVZA 5AGFA 1NU7D 1BBHA 2EILC 2P61A 3KPHA 1RKEB 3O55A 1TFKB 3W8HA 2LFFA 2H8AA 2HJMA 4JIOA 3N2ZB 2OQMA 3TOLA 5L0IA 1WWPA 3M79A 3K66A 3EG9B 4XEKA 2HFIA 4RDAA 3RYLA 2EIKC 3FDQA 1EA8A 3B9QA 4YL0A 1HW1A 3AG1C 1IZMA 2Y39A 3OEOA 5A6BD 4MTFA 4XLPF 4MTGA 1M2VB 1PCXA 3HNKA 5DQZA 4OIPF 4WJ0A 1GQAA 5K0IA 4FESA 4WGYA 5D91A 3ABLC 4PJMA 5EGYA 3FVYA 1E85A 3C8GD 1JPNA 4I1MA 3SZRA 3VM6A 3PMRA 2XL4A 4YL1A 4KBLA 3V5YA 4EKWA 3NMJA 1KNYA 4XEVA 3FOPA 2VH3A 3LNRA 4BJ1A 1MMGA 1FNTc 2UUHA 2WVNA 2XLHA 3U8PA 4ONSA 1OQCA 2C04A 5JT4A 4JW1A 3DMDA 1LI7A 1GGQA 2V26A 4K7BA 2XL6A 3CAXA 2CNWD 2J0XA 1ZW2A 3K33A 4H4KC 4NTFA 3K1IC 4D4XA 5DS4A 4UDVA 2QE9A 3SEOA 4DXWA 2EPMX 3KYJA 3GM1A 1L3PA 4E0IA 1TWHA 2WL8A 1CGNA 4JJGA 4NY3A 4G7HF 1YAUO 4XPXA 4JJFA 3DM9B 4P9TA 2HZ8A 3T6JA 1HW2A 4Q4ZF 2HV7A 4KNVA 3SP1A 2R25A 1HE1A 3DE9A 2W45A 1APCA 1N1CA 1K40A 2L6GA 4YT2A 1Q0GA 4NC3A 1H7IA 2NPUA 4GEHA 3C8GB 1OCCC 3IEEA 3LEVA 4JCZA 4Q7CA 3UNGC 5JVEA 2XXAB 4CS8C 5KYXA 3F46A 3RVZA 3RQEA 2L6HA 3WODF 3MFNA 3KL4A 1T6QA 3AQBA 3EQLF 2DYRC 4JZAA 4CBEA 1OW8A 2XRHA 1OCZC 3U3FA 2ASRA 3DE8A 1KTMA 3VAYA 1M2OA 4ZLCA 2VASA 4LERA 3V5ZA 5L0GA 2XL8A 5F5HA 5FCLA 1D1CA 3U9JA 4J32B 1KU2A 1TKNA 3C18A 3RIPA 5JLIA 4YT4A 1C17M 1OXBA 2ZXOA 3IHUA 3LLKA 4M63A 5EK0A 2EPOA 2XLVA 3NKDA 4JRZA 3K1IA 5BQGA 3AJMA 4BEMJ 3POVA 4EBJA 1YYJA 2ZPAA 4YWQA 1A41A 3S27A 3FOOA 1CPQA 1FMWA 3EPVA 3IQ5A 1G8XA 3RF3A 3GWNA 3O39A 2D5RB 3GODA 3L0IA 3QVZA 4RBNA 4MW8A 1NG1A 3DAGA 3G4XA 3H2VA 2YLDA 3ASOC 1ZU4A 2YL1A 3DJUB 1E86A 2VCAA 3MYIA 3FAPB 4BJTA 1HMDA 2Q00A 2EIMC 2ICWG 2P7VA 1WTYA 3TULA 1U6HA 2J9BA 4JC7A 3C7JA 3GM2A 3WHNA 2L9JA 2AWCA 3ZTMA 1RJ9A 5AC4A 1V74B 1RKCA 2MHRA 2AU5A 1ZYRF 4MVQA 3EHMA 4I3MA 4IWBA 4LLEA 3DZAA 3IQ6A 4OD5A 4U5CE 1LPEA 1Q0FA 3NRHA 4BJ6C 4E7ZA 1FTSA 5FZTA 1I4ZA 1NFOA 2YHSA 3NMIA 4U5EE 4NQFA 4YT8A 1FMVA 3B71A 1Z7Qc 1Z23A 3TK0A 2GDCA 1ZZPA 3QW1A 1TWAA 3RQGA 2HSBA 4EBKA 2CYDA 3U2MA 4FWVA 5COGA 5GPGB 2IXPA 2W9YA 3RKOF 3EFOA 3WG7C 1GM5A 5F28E 3U5SA 2R7RA 5EHHA 4JE9A 4WABA 3ZG1A 1O5HA 4ER9A 3KKBA 3GORA 4A4AA 3L8IA 4N6HA 3AGTA 3VRCA 3W2WA 3OA1A 3W4YA 4L6RA 5DVWA 3RW0A 2R7UA 4JCHA 1WGWA 1HY5A 3G50A 4IAQA 1PD1A 2H7VC 4KC9A 4CJGA 4G7OF 1RCPA 1ZW3A 2PNOA 1NFNA 1T5OA 1R4TA 2ZD9A 4QDLA 3J06A 1QVXA 3ZIBA 5L0HA 4BJ6A 3ZDLA 5JP7A 2XLOA 2OEVA 1Y6DA 1H9TA 1NSGB 4JTCB 2IXMA 1SZIA 1VYKA 4KNWA 2R7TA 5KYUA 5COMA 3QVYA 1PD0A 4I44A 4C3BA 4N4WA 2OJQA 2A1DD 3GEEA 2Q9AA 3SXKA 2V3CC 3CQZA 2WZFA 4JVSA 4CDYA 4N6CA 3PDMP 4HFFB 5A6JA 4CIHA 2FFHA 4K1OA 4U9EA 2IXOA 3R7CA 3IQCA 4C3EA 5JUAA 5TJ5E 4JKVA 2M4EA 2VB6A 1HE9A 2G62A 4O6MA 4XQ1A 3RVYA 2XLDA 2HUJA 1AUEA 3ECSA 2GWWA 2GA0A 3ZTZA 4N06A 4DBRA 2EPKX 3H65A 1WN0A 3NYJA 4ULVA 1E2XA 3DXJF 2IOQA 4J30B 4U5GA 3T9OA 2HMQA 4P6IC 4R32A 4XLNF 3HNJA 3FAJA 3AOUA 1WASA 3C63A 4E18A 3OWTA 4O7GA 5A6KA 2YVKA 5JS5A 3U0CA 3NMKA 2YLGA 2FGYA 4O6NA 2OG2A 1M56C 1OR3A 3AQCA 3GEIA 4X0RA 5COFA 2DI3A 4YN0B 3FMSA 5L0FA 5B3SC 1SMYF 1ZHXA 2BC5A 2P0NA 2PFDA 2Y3DA 3TJ6A 4E17A 1QPUA 1LM3B 4AK9A 1Z6AA 2CGEA 1F1MA 1VLSA 3ABKC 4IARA 3ZWIA 4C3DA 2YKZA 1D0YA 4BG0A 5A6AA 2YZSA 3ZC4A 1D0ZA 3C8ZA 2XLEA 4JURI 3S84A 4ANJA 1ZHWA 3US6A 5BUOA 4OD4A 1OCRC 2HKVA 2KQ9A 3LLIA 3K7DA 3SXZA 4XPYA 3KYIA 4JEAA 2R7XA 5DS6A 4IAOA 3UMHA 1K05A 1OCOC 2LSEA 3DJNB 2NUPA 3MBGA 4E7SA 1CPRA 4MNDA 3VYWA 1D1BA 3GEHA 1MMNA 1ST6A 2YEVA 3EHNA 4DRHB 1YDIA 1G4WR 2EIJC 3LS0A 1ZHYA 5KYXB 3T4RA 4PK4A 2J46A 5KYWA 1A0BA 3V5XA 3SNHA 4FAPB 2JD3A 3S29A 3S0XA 2YL0A 3JYHA 3DM5A 3DWWA 3LUTB 5KYNA 1Y4CA 2TMVP 3JSZA 3JTLO 4CDVA 4LDQA 1H6GA 1EQ1A 3ITFA 4MVOA 5CI9A 1O3UA 2BL2A 1T9KA 4U5HA 2AWYA 2JX0A 1ZU5A 1W2WA 1I5NA 4NCQA 3LAYA 1GS9A 1ZVZA 2PF4E 1BR2A 2O9XA 3KMIA 5T1DB 4EWCA 3R2PA 4YL3A 4OIRF 3S90A 1M57C 2R05A 2QNLA 4C7OA 1LE2A 1J8MF 1WATA 2XSEA 2XM0A 4EHPA 3UR3C 1CGME 3L1MA 1XWJA 5KYYA 2R7VA 4Z9IA 3DAFA 5A69A 4PR9A 2HS5A 4Z9HA 1M6TA 2OEXA 5CIVA 4U5FE 2JPUA 3RH3A 2IM8A 3AG3C 3EH1A 4PJLA 2NUTA 2DB4A 3V7OA 3RFYA 3BRJA 4CS7A 1JOGA 1RJ9B 4MVRA 5E3CA 5L0JA 4AE4A 1JR8A 2XS1A 4JTDB 4OINF 3AG4C 5E3AA 4EBBA 2UUIA 2J9WA 2HJ3A 2WVQA 1QSPA 4MVMA 3ZQYA 1VTMP 3N0TA 4K0DA 4XTKA 2IYLD 1D1AA 2J8WA 1C02A 1OR2A 2Y3HA 2KYHA 4XPWA 4CJOA 3GM3A 3IPMO 1LVKA 4GQHA 3ABMC 2EPLX 2LCHA 2YL3A 2HMZA 2L7AA 2OJED 3Q6NA 3DD7A 3Q7GA 3UMKA 4IGGA 2CW0F 4MVUA 4OIQF 3PCVA 3JCUQ 1S05A 2YL7A 2L6FA 2Y3BA 3NYLA 3EFOB 2QUPA 4MS2A 4DRJB 2J0WA 3JT1A 3MLGA 1EKYA 3CEXA 2J9VA 2H7OA 3F47A 2J7PA 1H9GA 1LI5A 1LS4A 4HFKB 5JSLA 2LFDA 4CDAA 4WGZA 3L34A 4PJNA 4CX9A 1OKKA 3HNIA 3NKEA 3BEHA 2VC9A 1L7CA 1K04A 1Q0DA 1QZXA 2NSGA 3MYFA 3A11A 1VLTA 1CGOA 3W8IA 2CCYA 3N24A 1Q0MA 1NZEA 5D92A 3Q7LA 2XS8A 3UGPA 4B6IA 1YVIA 4AX2A 1YA7O 5HSWA 1DOVA 1ORYA 2KGOA 1YA9A 3I5QA 4NTBA 3U2LA 4LDRA 1MMAA 3FHDA 2C03A 4MVSA 2R7OA 5E2QA 3EH2A 4AL0A 1IW7F 3M4BA 1HMOA 3GWLA 4J7YA 2R7WA 1SF8A 1MQVA 1Z5ZA 4YJWA 4Z9JA 2R9RB 1BZ4A 3K6BA 3M4CA 4HE8D 4GYTA 2A0UA 2NSFA 5KYUB 1E83A 2Z15A 1NU9C 4PFPA 4CS9C 1XZPA 1VB5A 2WVOA 1LKXA 3NDBB 3SXYA 1RKEA 3S9OA 1PV3A 4NTAA 2B0JA 2OCCC 2PP4A 2R7QA 3AGUA 3HTKC 256BA 5CI8A 1FFTC 1BDJB 3CSKA 3EG9A 4LDKA 4P9FA 4W8KA 1EI7A 1QKRA 3EZHA 3LESA 2A6HF 3ATPA 4JTAB 5B3IA 2OU6A 1A7VA 3EZIA 2LK4A 1M2VA 5HV9A 3LJBA 2IXNA 3C62A 4OIOF 1FFHA 3L8JA 1Z63A 1T01A 1R5ID 3UGOA 2BE5F 3RQFA 2P6VA 3M1CB 1B68A 2HV6A 1ORJA 2L81A 2LP4A 2OOCA 2LD6A 2WZGA 2YWAA 1VK5A 2W4MA 4O6YA 3SYNA 2KJGA 3B29A 4G7ZF 1WOLA 3A9CA 3E9VA 3JRMO 4E0HA 3TD7A 5B1BC 1Q0KA 2YLIA 2ZXWC 1OW6A 2LIGA 2RSEB 2MYSA 3GANA 3I4UA 3LNMB 4HEAJ 1DOWA 1RXQA 1TWGA 2A6EF 2ZXPA 2HSQA 3DI5A 2H7BA 4I1OB 2PX3A 4XEFA 3HJCA 4YK5A 5IY5C 1ZHTA 1YYXA 4CS9A 2XLMA 2OKUA 1JMWA 4JEBA 5A6BA 4A2NB 2RD9A 2A69F 2VCBA 4DVYP 2XM4A 4H54A 4IJJA 3UMIA 2QTVA 2MWQA 1XZQA 3ZSUA 3EGDA 1AVOB 1JAFA 2KW3C 5B1AC 3ZVRA 2Y69C 3B0VC 5L3QA 4J7TA 4LACB 2D4UA 4F4BA 1OW7A 2F22A 3C8GA 2XXAA 1QLEC 2Q9BA 4D4NA 1FR0A 1LS1A 2NUPB 3EGDB 3B0UX 2R7SA 2J45A 2NG1A 3O6XA 3ZQVA 1BR4A 2G3KA 3WAQA 5DLJA 4AL1A 2P1AA 3E70C 3TOMA 3NYMA 3SXMA 1YZAA 5KYWB 3CZ6A 4LLCA 1FAPB 2CNWA 2KC3A 3IQTA 4RD9A 4KI2A 1VMAA 4W8PA 5T3WA 4IB4A 5L0CA 4BJ5C 1T6IA 3G4ZA 5T3TA 1MNEA 5E33A 3U8VA 1LE4A 3TQOA 1U0BB 1UG7A 1VOMA 2DGJA 4MTOA 1YJGA 2X51A 3HLZA 2PBEA 5JRAA 2AVKA 2EPNA 2Y3GA 1V54C 3DKAA 3LEOA 4Q5SF 2KSFA 3JRTA 3HKKA 4BEJA 5L0DA 2LQGA 1V55C 1YLMA 2KNHA 4XWJA 1AEPA 3HNLA 4C7OB 1J8YF 2WB7A 4EIYA 4QI2A 4DVZA 1TWCA 4U5DE 1SR2A 2X0CA 2IBFA 5KYYB 1QQ3A 1YZCA 5BQIA 4CSAC 3O10A 4QI0A 2WZLA 5BQHA 1LIHA 4BPMA 4MW3A 4U5BE 3X1OA 2Q7RA 1SYQA 4G78A 4CIPA 2R03A 1UFBA 2NUTB 1I4YA 2YQYA 2G3VA 3QTHA 4EUKB 5DS5A 2J7PD 2KK1A 4CS8A 2AP3A 2B0HA 3NG1A 4ULWA 2FAPB 3W2VA 1OKKD 2QLAA 4BJ5A 1TQGA 3T6GB 4AE4B 5AC5A 2ZXRA 2I8BA 4MQ9F 3JSEO 1TR2A 4U9DA 4DOZA 4DBQA 2A68F 3QMKA 1Z3IX 1C03A 2GFHA 3VF0A 1JRAA 3JZ0A 1NBBA 3T6BA 1E84A 1ORSC 3EGXA 4DRIB 2ETSA 4PFOA 2QY9A 5L3VA 3X2QC 3K1HA 2A0BA 2Q9CA 3QW0A 1D0XA 2VCCA 4CSAA 4ZLDA 2DYSC 1O87A 3JYYA 1JPJA 1T6UA 2M64A 4PJJA 1G4US 3B0PA 3EGXB 1MMDA 2W4BA 1BR1A 4G0HA 3ASNC 2I15A 2XLWA 1OXKA 3FXHA 3PHF2 1V4AA 1TFOB 2J9UA 3M15A 1YARO 3Q6MA 3MX3A 4FX5A 3LS1A 1RMVA 2GAQA 3KH2A 1MNDA 1VYIA 3AG2C 3S28A 3U9MA 1G5ZA 2PX0A 1A7EA 1S7ZA 1U89A 2E87A 2Q3TA 4IRUA 3QZCA 1A7DA 3H2UA 1ZHZA 4O79A 3I5PA 2R02A 5DQTA 2YRFA 4DJ9A 1NLXA 2Q4FA 2EINC 4PACA 3EJNA 4YT5A 3U3BA
chains in the Genus database with same CATH topology
4JEBA 5AGFA 1BBHA 2XM4A 4JE9A 2XM0A 1JAFA 3L1MA 3TOLA 3M79A 4ER9A 4N6HA 1M6TA 3VRCA 4D4NA 4L6RA 3HNKA 3ZQVA 1GQAA 4IAQA 4WGYA 3TOMA 4CJGA 1RCPA 1YZAA 1E85A 5JP7A 2XLOA 3ZQYA 4CJOA 2J8WA 3NMJA 3FOPA 3U8PA 2XLHA 2YL3A 5JT4A 5JRAA 3QVYA 2XL6A 4N4WA 4D4XA 1S05A 2YL7A 4CDYA 3HNLA 1CGNA 1EKYA 4U9EA 5JUAA 4EIYA 5JSLA 4JKVA 3DE9A 4WGZA 4CDAA 1QQ3A 1YZCA 1APCA 3HNIA 4CX9A 2XLDA 4NC3A 3ZTZA 5JVEA 4CIPA 4ULVA 1CGOA 2CCYA 3HNJA 3DE8A 3C63A 2QLAA 5JS5A 2XL8A 3NMKA 2YLGA 4U9DA 5JLIA 3M4BA 1MQVA 2BC5A 1QPUA 2XLVA 1LM3B 3M4CA 1E83A 3ZWIA 4IARA 1YYJA 1NBBA 2YKZA 1E84A 2XLEA 3FOOA 1CPQA 3IQ5A 256BA 3QVZA 3QW0A 5B3IA 2YLDA 2YL1A 4JEAA 1E86A 1A7VA 1CPRA 2J9BA 2XLWA 3C62A 3M15A 3ZTMA 2YL0A 3IQ6A 2YLIA 4IB4A 4CDVA 3NMIA 1YYXA 3QW1A 2XLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEB A;  5AGF A;  1BBH A;  2XM4 A;  4JE9 A;  2XM0 A;  1JAF A;  3L1M A;  3TOL A;  3M79 A;  4ER9 A;  4N6H A;  1M6T A;  3VRC A;  4D4N A;  4L6R A;  3HNK A;  3ZQV A;  1GQA A;  4IAQ A;  4WGY A;  3TOM A;  4CJG A;  1RCP A;  1YZA A;  1E85 A;  5JP7 A;  2XLO A;  3ZQY A;  4CJO A;  2J8W A;  3NMJ A;  3FOP A;  3U8P A;  2XLH A;  2YL3 A;  5JT4 A;  5JRA A;  3QVY A;  2XL6 A;  4N4W A;  4D4X A;  1S05 A;  2YL7 A;  4CDY A;  3HNL A;  1CGN A;  1EKY A;  4U9E A;  5JUA A;  4EIY A;  5JSL A;  4JKV A;  3DE9 A;  4WGZ A;  4CDA A;  1QQ3 A;  1YZC A;  1APC A;  3HNI A;  4CX9 A;  2XLD A;  4NC3 A;  3ZTZ A;  5JVE A;  4CIP A;  4ULV A;  1CGO A;  2CCY A;  3HNJ A;  3DE8 A;  3C63 A;  2QLA A;  5JS5 A;  2XL8 A;  3NMK A;  2YLG A;  4U9D A;  5JLI A;  3M4B A;  1MQV A;  2BC5 A;  1QPU A;  2XLV A;  1LM3 B;  3M4C A;  1E83 A;  3ZWI A;  4IAR A;  1YYJ A;  1NBB A;  2YKZ A;  1E84 A;  2XLE A;  3FOO A;  1CPQ A;  3IQ5 A;  256B A;  3QVZ A;  3QW0 A;  5B3I A;  2YLD A;  2YL1 A;  4JEA A;  1E86 A;  1A7V A;  1CPR A;  2J9B A;  2XLW A;  3C62 A;  3M15 A;  3ZTM A;  2YL0 A;  3IQ6 A;  2YLI A;  4IB4 A;  4CDV A;  3NMI A;  1YYX A;  3QW1 A;  2XLM A; 
#chains in the Genus database with same CATH topology
 2CDQ A;  3TJ5 A;  5F5F A;  4MVZ A;  5AGF A;  1NU7 D;  1BBH A;  2EIL C;  2P61 A;  3KPH A;  1RKE B;  3O55 A;  1TFK B;  3W8H A;  2LFF A;  2H8A A;  2HJM A;  4JIO A;  3N2Z B;  2OQM A;  3TOL A;  5L0I A;  1WWP A;  3M79 A;  3K66 A;  3EG9 B;  4XEK A;  2HFI A;  4RDA A;  3RYL A;  2EIK C;  3FDQ A;  1EA8 A;  3B9Q A;  4YL0 A;  1HW1 A;  3AG1 C;  1IZM A;  2Y39 A;  3OEO A;  5A6B D;  4MTF A;  4XLP F;  4MTG A;  1M2V B;  1PCX A;  3HNK A;  5DQZ A;  4OIP F;  4WJ0 A;  1GQA A;  5K0I A;  4FES A;  4WGY A;  5D91 A;  3ABL C;  4PJM A;  5EGY A;  3FVY A;  1E85 A;  3C8G D;  1JPN A;  4I1M A;  3SZR A;  3VM6 A;  3PMR A;  2XL4 A;  4YL1 A;  4KBL A;  3V5Y A;  4EKW A;  3NMJ A;  1KNY A;  4XEV A;  3FOP A;  2VH3 A;  3LNR A;  4BJ1 A;  1MMG A;  1FNT c;  2UUH A;  2WVN A;  2XLH A;  3U8P A;  4ONS A;  1OQC A;  2C04 A;  5JT4 A;  4JW1 A;  3DMD A;  1LI7 A;  1GGQ A;  2V26 A;  4K7B A;  2XL6 A;  3CAX A;  2CNW D;  2J0X A;  1ZW2 A;  3K33 A;  4H4K C;  4NTF A;  3K1I C;  4D4X A;  5DS4 A;  4UDV A;  2QE9 A;  3SEO A;  4DXW A;  2EPM X;  3KYJ A;  3GM1 A;  1L3P A;  4E0I A;  1TWH A;  2WL8 A;  1CGN A;  4JJG A;  4NY3 A;  4G7H F;  1YAU O;  4XPX A;  4JJF A;  3DM9 B;  4P9T A;  2HZ8 A;  3T6J A;  1HW2 A;  4Q4Z F;  2HV7 A;  4KNV A;  3SP1 A;  2R25 A;  1HE1 A;  3DE9 A;  2W45 A;  1APC A;  1N1C A;  1K40 A;  2L6G A;  4YT2 A;  1Q0G A;  4NC3 A;  1H7I A;  2NPU A;  4GEH A;  3C8G B;  1OCC C;  3IEE A;  3LEV A;  4JCZ A;  4Q7C A;  3UNG C;  5JVE A;  2XXA B;  4CS8 C;  5KYX A;  3F46 A;  3RVZ A;  3RQE A;  2L6H A;  3WOD F;  3MFN A;  3KL4 A;  1T6Q A;  3AQB A;  3EQL F;  2DYR C;  4JZA A;  4CBE A;  1OW8 A;  2XRH A;  1OCZ C;  3U3F A;  2ASR A;  3DE8 A;  1KTM A;  3VAY A;  1M2O A;  4ZLC A;  2VAS A;  4LER A;  3V5Z A;  5L0G A;  2XL8 A;  5F5H A;  5FCL A;  1D1C A;  3U9J A;  4J32 B;  1KU2 A;  1TKN A;  3C18 A;  3RIP A;  5JLI A;  4YT4 A;  1C17 M;  1OXB A;  2ZXO A;  3IHU A;  3LLK A;  4M63 A;  5EK0 A;  2EPO A;  2XLV A;  3NKD A;  4JRZ A;  3K1I A;  5BQG A;  3AJM A;  4BEM J;  3POV A;  4EBJ A;  1YYJ A;  2ZPA A;  4YWQ A;  1A41 A;  3S27 A;  3FOO A;  1CPQ A;  1FMW A;  3EPV A;  3IQ5 A;  1G8X A;  3RF3 A;  3GWN A;  3O39 A;  2D5R B;  3GOD A;  3L0I A;  3QVZ A;  4RBN A;  4MW8 A;  1NG1 A;  3DAG A;  3G4X A;  3H2V A;  2YLD A;  3ASO C;  1ZU4 A;  2YL1 A;  3DJU B;  1E86 A;  2VCA A;  3MYI A;  3FAP B;  4BJT A;  1HMD A;  2Q00 A;  2EIM C;  2ICW G;  2P7V A;  1WTY A;  3TUL A;  1U6H A;  2J9B A;  4JC7 A;  3C7J A;  3GM2 A;  3WHN A;  2L9J A;  2AWC A;  3ZTM A;  1RJ9 A;  5AC4 A;  1V74 B;  1RKC A;  2MHR A;  2AU5 A;  1ZYR F;  4MVQ A;  3EHM A;  4I3M A;  4IWB A;  4LLE A;  3DZA A;  3IQ6 A;  4OD5 A;  4U5C E;  1LPE A;  1Q0F A;  3NRH A;  4BJ6 C;  4E7Z A;  1FTS A;  5FZT A;  1I4Z A;  1NFO A;  2YHS A;  3NMI A;  4U5E E;  4NQF A;  4YT8 A;  1FMV A;  3B71 A;  1Z7Q c;  1Z23 A;  3TK0 A;  2GDC A;  1ZZP A;  3QW1 A;  1TWA A;  3RQG A;  2HSB A;  4EBK A;  2CYD A;  3U2M A;  4FWV A;  5COG A;  5GPG B;  2IXP A;  2W9Y A;  3RKO F;  3EFO A;  3WG7 C;  1GM5 A;  5F28 E;  3U5S A;  2R7R A;  5EHH A;  4JE9 A;  4WAB A;  3ZG1 A;  1O5H A;  4ER9 A;  3KKB A;  3GOR A;  4A4A A;  3L8I A;  4N6H A;  3AGT A;  3VRC A;  3W2W A;  3OA1 A;  3W4Y A;  4L6R A;  5DVW A;  3RW0 A;  2R7U A;  4JCH A;  1WGW A;  1HY5 A;  3G50 A;  4IAQ A;  1PD1 A;  2H7V C;  4KC9 A;  4CJG A;  4G7O F;  1RCP A;  1ZW3 A;  2PNO A;  1NFN A;  1T5O A;  1R4T A;  2ZD9 A;  4QDL A;  3J06 A;  1QVX A;  3ZIB A;  5L0H A;  4BJ6 A;  3ZDL A;  5JP7 A;  2XLO A;  2OEV A;  1Y6D A;  1H9T A;  1NSG B;  4JTC B;  2IXM A;  1SZI A;  1VYK A;  4KNW A;  2R7T A;  5KYU A;  5COM A;  3QVY A;  1PD0 A;  4I44 A;  4C3B A;  4N4W A;  2OJQ A;  2A1D D;  3GEE A;  2Q9A A;  3SXK A;  2V3C C;  3CQZ A;  2WZF A;  4JVS A;  4CDY A;  4N6C A;  3PDM P;  4HFF B;  5A6J A;  4CIH A;  2FFH A;  4K1O A;  4U9E A;  2IXO A;  3R7C A;  3IQC A;  4C3E A;  5JUA A;  5TJ5 E;  4JKV A;  2M4E A;  2VB6 A;  1HE9 A;  2G62 A;  4O6M A;  4XQ1 A;  3RVY A;  2XLD A;  2HUJ A;  1AUE A;  3ECS A;  2GWW A;  2GA0 A;  3ZTZ A;  4N06 A;  4DBR A;  2EPK X;  3H65 A;  1WN0 A;  3NYJ A;  4ULV A;  1E2X A;  3DXJ F;  2IOQ A;  4J30 B;  4U5G A;  3T9O A;  2HMQ A;  4P6I C;  4R32 A;  4XLN F;  3HNJ A;  3FAJ A;  3AOU A;  1WAS A;  3C63 A;  4E18 A;  3OWT A;  4O7G A;  5A6K A;  2YVK A;  5JS5 A;  3U0C A;  3NMK A;  2YLG A;  2FGY A;  4O6N A;  2OG2 A;  1M56 C;  1OR3 A;  3AQC A;  3GEI A;  4X0R A;  5COF A;  2DI3 A;  4YN0 B;  3FMS A;  5L0F A;  5B3S C;  1SMY F;  1ZHX A;  2BC5 A;  2P0N A;  2PFD A;  2Y3D A;  3TJ6 A;  4E17 A;  1QPU A;  1LM3 B;  4AK9 A;  1Z6A A;  2CGE A;  1F1M A;  1VLS A;  3ABK C;  4IAR A;  3ZWI A;  4C3D A;  2YKZ A;  1D0Y A;  4BG0 A;  5A6A A;  2YZS A;  3ZC4 A;  1D0Z A;  3C8Z A;  2XLE A;  4JUR I;  3S84 A;  4ANJ A;  1ZHW A;  3US6 A;  5BUO A;  4OD4 A;  1OCR C;  2HKV A;  2KQ9 A;  3LLI A;  3K7D A;  3SXZ A;  4XPY A;  3KYI A;  4JEA A;  2R7X A;  5DS6 A;  4IAO A;  3UMH A;  1K05 A;  1OCO C;  2LSE A;  3DJN B;  2NUP A;  3MBG A;  4E7S A;  1CPR A;  4MND A;  3VYW A;  1D1B A;  3GEH A;  1MMN A;  1ST6 A;  2YEV A;  3EHN A;  4DRH B;  1YDI A;  1G4W R;  2EIJ C;  3LS0 A;  1ZHY A;  5KYX B;  3T4R A;  4PK4 A;  2J46 A;  5KYW A;  1A0B A;  3V5X A;  3SNH A;  4FAP B;  2JD3 A;  3S29 A;  3S0X A;  2YL0 A;  3JYH A;  3DM5 A;  3DWW A;  3LUT B;  5KYN A;  1Y4C A;  2TMV P;  3JSZ A;  3JTL O;  4CDV A;  4LDQ A;  1H6G A;  1EQ1 A;  3ITF A;  4MVO A;  5CI9 A;  1O3U A;  2BL2 A;  1T9K A;  4U5H A;  2AWY A;  2JX0 A;  1ZU5 A;  1W2W A;  1I5N A;  4NCQ A;  3LAY A;  1GS9 A;  1ZVZ A;  2PF4 E;  1BR2 A;  2O9X A;  3KMI A;  5T1D B;  4EWC A;  3R2P A;  4YL3 A;  4OIR F;  3S90 A;  1M57 C;  2R05 A;  2QNL A;  4C7O A;  1LE2 A;  1J8M F;  1WAT A;  2XSE A;  2XM0 A;  4EHP A;  3UR3 C;  1CGM E;  3L1M A;  1XWJ A;  5KYY A;  2R7V A;  4Z9I A;  3DAF A;  5A69 A;  4PR9 A;  2HS5 A;  4Z9H A;  1M6T A;  2OEX A;  5CIV A;  4U5F E;  2JPU A;  3RH3 A;  2IM8 A;  3AG3 C;  3EH1 A;  4PJL A;  2NUT A;  2DB4 A;  3V7O A;  3RFY A;  3BRJ A;  4CS7 A;  1JOG A;  1RJ9 B;  4MVR A;  5E3C A;  5L0J A;  4AE4 A;  1JR8 A;  2XS1 A;  4JTD B;  4OIN F;  3AG4 C;  5E3A A;  4EBB A;  2UUI A;  2J9W A;  2HJ3 A;  2WVQ A;  1QSP A;  4MVM A;  3ZQY A;  1VTM P;  3N0T A;  4K0D A;  4XTK A;  2IYL D;  1D1A A;  2J8W A;  1C02 A;  1OR2 A;  2Y3H A;  2KYH A;  4XPW A;  4CJO A;  3GM3 A;  3IPM O;  1LVK A;  4GQH A;  3ABM C;  2EPL X;  2LCH A;  2YL3 A;  2HMZ A;  2L7A A;  2OJE D;  3Q6N A;  3DD7 A;  3Q7G A;  3UMK A;  4IGG A;  2CW0 F;  4MVU A;  4OIQ F;  3PCV A;  3JCU Q;  1S05 A;  2YL7 A;  2L6F A;  2Y3B A;  3NYL A;  3EFO B;  2QUP A;  4MS2 A;  4DRJ B;  2J0W A;  3JT1 A;  3MLG A;  1EKY A;  3CEX A;  2J9V A;  2H7O A;  3F47 A;  2J7P A;  1H9G A;  1LI5 A;  1LS4 A;  4HFK B;  5JSL A;  2LFD A;  4CDA A;  4WGZ A;  3L34 A;  4PJN A;  4CX9 A;  1OKK A;  3HNI A;  3NKE A;  3BEH A;  2VC9 A;  1L7C A;  1K04 A;  1Q0D A;  1QZX A;  2NSG A;  3MYF A;  3A11 A;  1VLT A;  1CGO A;  3W8I A;  2CCY A;  3N24 A;  1Q0M A;  1NZE A;  5D92 A;  3Q7L A;  2XS8 A;  3UGP A;  4B6I A;  1YVI A;  4AX2 A;  1YA7 O;  5HSW A;  1DOV A;  1ORY A;  2KGO A;  1YA9 A;  3I5Q A;  4NTB A;  3U2L A;  4LDR A;  1MMA A;  3FHD A;  2C03 A;  4MVS A;  2R7O A;  5E2Q A;  3EH2 A;  4AL0 A;  1IW7 F;  3M4B A;  1HMO A;  3GWL A;  4J7Y A;  2R7W A;  1SF8 A;  1MQV A;  1Z5Z A;  4YJW A;  4Z9J A;  2R9R B;  1BZ4 A;  3K6B A;  3M4C A;  4HE8 D;  4GYT A;  2A0U A;  2NSF A;  5KYU B;  1E83 A;  2Z15 A;  1NU9 C;  4PFP A;  4CS9 C;  1XZP A;  1VB5 A;  2WVO A;  1LKX A;  3NDB B;  3SXY A;  1RKE A;  3S9O A;  1PV3 A;  4NTA A;  2B0J A;  2OCC C;  2PP4 A;  2R7Q A;  3AGU A;  3HTK C;  256B A;  5CI8 A;  1FFT C;  1BDJ B;  3CSK A;  3EG9 A;  4LDK A;  4P9F A;  4W8K A;  1EI7 A;  1QKR A;  3EZH A;  3LES A;  2A6H F;  3ATP A;  4JTA B;  5B3I A;  2OU6 A;  1A7V A;  3EZI A;  2LK4 A;  1M2V A;  5HV9 A;  3LJB A;  2IXN A;  3C62 A;  4OIO F;  1FFH A;  3L8J A;  1Z63 A;  1T01 A;  1R5I D;  3UGO A;  2BE5 F;  3RQF A;  2P6V A;  3M1C B;  1B68 A;  2HV6 A;  1ORJ A;  2L81 A;  2LP4 A;  2OOC A;  2LD6 A;  2WZG A;  2YWA A;  1VK5 A;  2W4M A;  4O6Y A;  3SYN A;  2KJG A;  3B29 A;  4G7Z F;  1WOL A;  3A9C A;  3E9V A;  3JRM O;  4E0H A;  3TD7 A;  5B1B C;  1Q0K A;  2YLI A;  2ZXW C;  1OW6 A;  2LIG A;  2RSE B;  2MYS A;  3GAN A;  3I4U A;  3LNM B;  4HEA J;  1DOW A;  1RXQ A;  1TWG A;  2A6E F;  2ZXP A;  2HSQ A;  3DI5 A;  2H7B A;  4I1O B;  2PX3 A;  4XEF A;  3HJC A;  4YK5 A;  5IY5 C;  1ZHT A;  1YYX A;  4CS9 A;  2XLM A;  2OKU A;  1JMW A;  4JEB A;  5A6B A;  4A2N B;  2RD9 A;  2A69 F;  2VCB A;  4DVY P;  2XM4 A;  4H54 A;  4IJJ A;  3UMI A;  2QTV A;  2MWQ A;  1XZQ A;  3ZSU A;  3EGD A;  1AVO B;  1JAF A;  2KW3 C;  5B1A C;  3ZVR A;  2Y69 C;  3B0V C;  5L3Q A;  4J7T A;  4LAC B;  2D4U A;  4F4B A;  1OW7 A;  2F22 A;  3C8G A;  2XXA A;  1QLE C;  2Q9B A;  4D4N A;  1FR0 A;  1LS1 A;  2NUP B;  3EGD B;  3B0U X;  2R7S A;  2J45 A;  2NG1 A;  3O6X A;  3ZQV A;  1BR4 A;  2G3K A;  3WAQ A;  5DLJ A;  4AL1 A;  2P1A A;  3E70 C;  3TOM A;  3NYM A;  3SXM A;  1YZA A;  5KYW B;  3CZ6 A;  4LLC A;  1FAP B;  2CNW A;  2KC3 A;  3IQT A;  4RD9 A;  4KI2 A;  1VMA A;  4W8P A;  5T3W A;  4IB4 A;  5L0C A;  4BJ5 C;  1T6I A;  3G4Z A;  5T3T A;  1MNE A;  5E33 A;  3U8V A;  1LE4 A;  3TQO A;  1U0B B;  1UG7 A;  1VOM A;  2DGJ A;  4MTO A;  1YJG A;  2X51 A;  3HLZ A;  2PBE A;  5JRA A;  2AVK A;  2EPN A;  2Y3G A;  1V54 C;  3DKA A;  3LEO A;  4Q5S F;  2KSF A;  3JRT A;  3HKK A;  4BEJ A;  5L0D A;  2LQG A;  1V55 C;  1YLM A;  2KNH A;  4XWJ A;  1AEP A;  3HNL A;  4C7O B;  1J8Y F;  2WB7 A;  4EIY A;  4QI2 A;  4DVZ A;  1TWC A;  4U5D E;  1SR2 A;  2X0C A;  2IBF A;  5KYY B;  1QQ3 A;  1YZC A;  5BQI A;  4CSA C;  3O10 A;  4QI0 A;  2WZL A;  5BQH A;  1LIH A;  4BPM A;  4MW3 A;  4U5B E;  3X1O A;  2Q7R A;  1SYQ A;  4G78 A;  4CIP A;  2R03 A;  1UFB A;  2NUT B;  1I4Y A;  2YQY A;  2G3V A;  3QTH A;  4EUK B;  5DS5 A;  2J7P D;  2KK1 A;  4CS8 A;  2AP3 A;  2B0H A;  3NG1 A;  4ULW A;  2FAP B;  3W2V A;  1OKK D;  2QLA A;  4BJ5 A;  1TQG A;  3T6G B;  4AE4 B;  5AC5 A;  2ZXR A;  2I8B A;  4MQ9 F;  3JSE O;  1TR2 A;  4U9D A;  4DOZ A;  4DBQ A;  2A68 F;  3QMK A;  1Z3I X;  1C03 A;  2GFH A;  3VF0 A;  1JRA A;  3JZ0 A;  1NBB A;  3T6B A;  1E84 A;  1ORS C;  3EGX A;  4DRI B;  2ETS A;  4PFO A;  2QY9 A;  5L3V A;  3X2Q C;  3K1H A;  2A0B A;  2Q9C A;  3QW0 A;  1D0X A;  2VCC A;  4CSA A;  4ZLD A;  2DYS C;  1O87 A;  3JYY A;  1JPJ A;  1T6U A;  2M64 A;  4PJJ A;  1G4U S;  3B0P A;  3EGX B;  1MMD A;  2W4B A;  1BR1 A;  4G0H A;  3ASN C;  2I15 A;  2XLW A;  1OXK A;  3FXH A;  3PHF 2;  1V4A A;  1TFO B;  2J9U A;  3M15 A;  1YAR O;  3Q6M A;  3MX3 A;  4FX5 A;  3LS1 A;  1RMV A;  2GAQ A;  3KH2 A;  1MND A;  1VYI A;  3AG2 C;  3S28 A;  3U9M A;  1G5Z A;  2PX0 A;  1A7E A;  1S7Z A;  1U89 A;  2E87 A;  2Q3T A;  4IRU A;  3QZC A;  1A7D A;  3H2U A;  1ZHZ A;  4O79 A;  3I5P A;  2R02 A;  5DQT A;  2YRF A;  4DJ9 A;  1NLX A;  2Q4F A;  2EIN C;  4PAC A;  3EJN A;  4YT5 A;  3U3B A; 
#chains in the Genus database with same CATH homology
 4JEB A;  5AGF A;  1BBH A;  2XM4 A;  4JE9 A;  2XM0 A;  1JAF A;  3L1M A;  3TOL A;  3M79 A;  4ER9 A;  4N6H A;  1M6T A;  3VRC A;  4D4N A;  4L6R A;  3HNK A;  3ZQV A;  1GQA A;  4IAQ A;  4WGY A;  3TOM A;  4CJG A;  1RCP A;  1YZA A;  1E85 A;  5JP7 A;  2XLO A;  3ZQY A;  4CJO A;  2J8W A;  3NMJ A;  3FOP A;  3U8P A;  2XLH A;  2YL3 A;  5JT4 A;  5JRA A;  3QVY A;  2XL6 A;  4N4W A;  4D4X A;  1S05 A;  2YL7 A;  4CDY A;  3HNL A;  1CGN A;  1EKY A;  4U9E A;  5JUA A;  4EIY A;  5JSL A;  4JKV A;  3DE9 A;  4WGZ A;  4CDA A;  1QQ3 A;  1YZC A;  1APC A;  3HNI A;  4CX9 A;  2XLD A;  4NC3 A;  3ZTZ A;  5JVE A;  4CIP A;  4ULV A;  1CGO A;  2CCY A;  3HNJ A;  3DE8 A;  3C63 A;  2QLA A;  5JS5 A;  2XL8 A;  3NMK A;  2YLG A;  4U9D A;  5JLI A;  3M4B A;  1MQV A;  2BC5 A;  1QPU A;  2XLV A;  1LM3 B;  3M4C A;  1E83 A;  3ZWI A;  4IAR A;  1YYJ A;  1NBB A;  2YKZ A;  1E84 A;  2XLE A;  3FOO A;  1CPQ A;  3IQ5 A;  256B A;  3QVZ A;  3QW0 A;  5B3I A;  2YLD A;  2YL1 A;  4JEA A;  1E86 A;  1A7V A;  1CPR A;  2J9B A;  2XLW A;  3C62 A;  3M15 A;  3ZTM A;  2YL0 A;  3IQ6 A;  2YLI A;  4IB4 A;  4CDV A;  3NMI A;  1YYX A;  3QW1 A;  2XLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...