3M4BA

A zn-mediated tetrahedral protein lattice cage
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4bA00
2XLVA 4JKVA 4JEBA 4CX9A 1E85A 1MQVA 1YZCA 1M6TA 3QW1A 4JE9A 2XLMA 5AGFA 5JRAA 1LM3B 4NC3A 1YYXA 3HNKA 3QW0A 1JAFA 2XLWA 4EIYA 4JEAA 1CPQA 3IQ5A 4D4XA 3M79A 5JS5A 4N4WA 3M4BA 2YKZA 1QQ3A 3ZQYA 2XL8A 3NMJA 5JSLA 4CDVA 3ZQVA 3HNLA 2XM0A 2YLDA 3VRCA 2BC5A 3ZWIA 4WGZA 4L6RA 3ZTZA 2QLAA 3ZTMA 4N6HA 2J8WA 3QVZA 1GQAA 2YL0A 1E84A 2XL6A 1CGNA 1CGOA 2CCYA 1RCPA 3TOMA 1E86A 1APCA 3TOLA 1BBHA 4CDAA 1CPRA 5B3IA 3M15A 3DE8A 4CJGA 4ULVA 4WGYA 3HNJA 3IQ6A 3L1MA 4CDYA 1S05A 4CJOA 5JUAA 3M4CA 3FOPA 3U8PA 3DE9A 5JVEA 1YYJA 2YL1A 2YLGA 3HNIA 256BA 2XLDA 2YL7A 1EKYA 4IAQA 5JT4A 4D4NA 1QPUA 3NMIA 4CIPA 2YL3A 1E83A 3NMKA 5JP7A 4ER9A 5JLIA 1YZAA 2YLIA 2XM4A 3C62A 3FOOA 2XLHA 1NBBA 3C63A 4U9DA 2XLOA 4IARA 4IB4A 3QVYA 4U9EA 1A7VA 2XLEA 2J9BA
chains in the Genus database with same CATH superfamily
3MFNA 5L0JA 2XLVA 2PF4E 4LLCA 4XQ1A 2KK1A 3POVA 1FMWA 3LNRA 2A0UA 4CX9A 3ASNC 4QI0A 1I4YA 1NFOA 3KMIA 4I1OB 1YZCA 1PD1A 2VB6A 4U5CE 1PD0A 3TJ6A 2OG2A 3QW1A 1V4AA 2TMVP 2OEVA 4XEKA 3QTHA 4HEAJ 3S0XA 4P9FA 2NPUA 4EBKA 1AEPA 4NC3A 4MVRA 5COMA 3SXKA 5KYWB 3O55A 2QNLA 1JAFA 3X1OA 5HSWA 3S28A 1CPQA 1ZW2A 2KQ9A 4C7OB 2Q9CA 3V5YA 3LS0A 2M64A 2EPLX 4HFFB 4UDVA 3ITFA 3KL4A 4O6YA 5JS5A 4N4WA 1ZW3A 3M4BA 4CS8A 4Z9JA 2G3VA 5KYXB 5K0IA 1KU2A 1JPNA 2AWYA 5JSLA 4YT5A 3PHF2 4PFPA 5CI9A 2XXAB 2EIJC 2HSBA 2W9YA 2P6VA 4MS2A 5F28E 1Y4CA 4IJJA 4U5HA 3VRCA 2LQGA 1QLEC 3UGPA 5L0CA 3GWLA 4WGZA 2D4UA 5E3CA 3ZTZA 4BJ6C 4A2NB 1OCCC 2EINC 2LK4A 2R05A 4E18A 4E7ZA 3TULA 2I8BA 2AU5A 2H7BA 2VCBA 4N6HA 2W4MA 3KYJA 5CI8A 1WTYA 5DS4A 2HS5A 4AX2A 1CGME 2XL6A 1CGNA 2CW0F 3UMIA 4CJGA 5A69A 2R7VA 1SZIA 3W8IA 3LEVA 3VYWA 5F5FA 2NG1A 3RQGA 2I15A 4X0RA 1TWGA 3RFYA 1U89A 4JTDB 1BBHA 4F4BA 3HJCA 1CPRA 5HV9A 3BEHA 1FMVA 2YWAA 4H4KC 3NYMA 1JMWA 2LIGA 3VM6A 1H9GA 1M56C 2FFHA 2KW3C 5FZTA 3ZVRA 1TFKB 2HMZA 1V74B 5FCLA 5IY5C 1NSGB 1SMYF 2Q3TA 1T01A 3JSZA 3HNJA 4JW1A 4LDRA 2Q4FA 4AL1A 3L1MA 3B0VC 2DYRC 5T3TA 3EG9B 4W8PA 3DZAA 1MMDA 1QVXA 2HUJA 3M4CA 3R7CA 3RQFA 4BJ5C 4K0DA 4PFOA 3B0UX 3NRHA 3AG1C 2P0NA 3DE9A 1Z23A 1YYJA 1ZHTA 4AL0A 2CNWD 3CQZA 1WASA 4RD9A 2H8AA 4FAPB 4QDLA 4U5DE 256BA 5E33A 4DOZA 2CGEA 2YHSA 2YL7A 2IOQA 2WL8A 2FGYA 2Y3HA 3MYIA 3B71A 2OKUA 1M2VB 1BR4A 4ONSA 1AVOB 5JT4A 4D4NA 1WATA 2R7QA 5COGA 1I5NA 3NKEA 3C8GA 4JTAB 3DWWA 1OW6A 1RKCA 4YL0A 2J46A 4G7OF 1E83A 3CZ6A 4LLEA 1GM5A 3SXZA 2KGOA 5JLIA 5BQIA 1YZAA 2XM4A 3MYFA 4LACB 2B0JA 2Y3DA 1ZVZA 3DMDA 5GPGB 5E2QA 3V5ZA 1HMDA 1C17M 3FOOA 4O6NA 3W2VA 1QSPA 4EUKB 3FDQA 4CSAC 1LS1A 1LS4A 3Q7LA 2L7AA 3C63A 3EGXB 2XSEA 1OR3A 3EGDA 5DQZA 1T6UA 4IARA 5E3AA 4IB4A 5B1AC 5EGYA 2XL4A 1SF8A 2L9JA 2R02A 3OA1A 1ORJA 3AG4C 3F46A 2YQYA 4DXWA 2J9BA 4PK4A 4K1OA 1OW7A 2GFHA 3GEHA 4C7OA 3U0CA 2HFIA 5B1BC 3FVYA 2G62A 3GM1A 1D1CA 1Z5ZA 3H2VA 1V54C 4YT2A 2R7SA 4XPYA 1MQVA 4GEHA 3EHMA 3K1IC 4AK9A 1LI7A 3WAQA 1M6TA 2XXAA 3EFOB 2O9XA 1D1BA 1RKEB 1W2WA 2VH3A 4JE9A 3AQBA 4C3BA 3UNGC 1GS9A 1YAUO 2YRFA 3OWTA 2EIKC 2HZ8A 2AWCA 2JPUA 4JJFA 4KNVA 4MVQA 2VASA 2DB4A 4JURI 3VF0A 5A6JA 4U5BE 2HKVA 3ABLC 1WOLA 3W2WA 3ZQYA 3EH1A 3HKKA 1TKNA 2ETSA 3DM9B 1WWPA 4J7TA 4FESA 4JC7A 1WN0A 2C03A 3HNLA 1ORYA 2XM0A 3B0PA 3ZWIA 3MLGA 1TWCA 3C18A 3DXJF 2ZXPA 2Y3BA 4MNDA 2W45A 1FAPB 1TR2A 3SZRA 1T6QA 1RMVA 1LVKA 1T9KA 2P61A 1ST6A 2YVKA 3Q7GA 4M63A 2J8WA 1NG1A 1GQAA 1Q0FA 2OU6A 2YL0A 4J7YA 3QMKA 1OKKD 2BL2A 1TFOB 1F1MA 3MBGA 3JRTA 3ZG1A 1E84A 2CCYA 1H7IA 3K6BA 4I1MA 2R7XA 1E86A 1VMAA 3TOLA 5EHHA 3PDMP 4IWBA 4JRZA 4Q4ZF 5A6KA 1O87A 1ORSC 3GM2A 3GWNA 4U5FE 4G7ZF 3I5QA 1YVIA 3NYLA 4HFKB 3FAPB 4BJTA 4XLPF 1N1CA 3DJUB 1EA8A 1C03A 2HJ3A 2ZD9A 3SXMA 3IQ6A 3SEOA 1JR8A 1LKXA 1S7ZA 3ZSUA 2ZXRA 4CJOA 5JUAA 1XZQA 3AG2C 3ATPA 4MTFA 1K05A 3ASOC 3U8PA 1FFTC 3JZ0A 5A6BD 5A6AA 2ASRA 4YWQA 4I3MA 2YL1A 2YLGA 1V55C 2G3KA 3DJNB 4LDKA 2L6GA 4NTFA 1HY5A 1LE2A 3N2ZB 1OR2A 2QUPA 1ZHWA 2W4BA 2WB7A 2XLDA 4IRUA 5D91A 1RJ9B 1D1AA 4WJ0A 3T6GB 3TQOA 3WHNA 1L3PA 3K33A 4E0HA 1EKYA 1IZMA 3FAJA 1OCOC 2R9RB 2WVOA 5KYUA 1QPUA 3CAXA 3F47A 4B6IA 1MMGA 3VAYA 4CS9C 2ZPAA 3RW0A 3NKDA 3R2PA 1VLTA 1ZHYA 5COFA 2D5RB 3CSKA 4O79A 1RXQA 4EBJA 4ZLDA 2XS1A 4YT4A 2YLIA 1T5OA 4OIRF 1BZ4A 4BJ6A 1OCZC 3C62A 3O10A 4P9TA 4U5GA 3UMKA 4C3EA 1G4WR 3U3BA 1NU7D 3EFOA 2ZXWC 1NBBA 1RKEA 1VB5A 2OEXA 4XLNF 4AE4B 5L0GA 2P7VA 5KYYA 4MQ9F 3U9JA 4MW8A 3A9CA 3AJMA 1A41A 3BRJA 2LFDA 1D0YA 2KJGA 2QTVA 1VYIA 3ABMC 3EJNA 4P6IC 4U9EA 3B9QA 3N0TA 2XLEA 3SYNA 1M57C 4Z9HA 3JRMO 3JYHA 5DS5A 2J7PA 2R7TA 5DLJA 1T6IA 1U6HA 3AGTA 2R25A 3L8IA 3G4ZA 4JKVA 2J9VA 2E87A 1O5HA 2EPMX 1O3UA 2UUIA 3IQCA 4J32B 4JZAA 4R32A 3U2LA 2Q9BA 2VCAA 4OD5A 3PCVA 3AGUA 4DRHB 1E85A 3JCUQ 2A68F 3MX3A 3T6JA 3UGOA 1MNDA 3S9OA 2KSFA 1VOMA 2YZSA 1GGQA 2LCHA 2MWQA 2Y3GA 3FHDA 3Q6NA 3SP1A 3V5XA 1TWHA 2IBFA 1D0XA 1HW1A 2AVKA 2LFFA 2XLMA 2JX0A 4BJ5A 2R7RA 5AGFA 3AG3C 5JRAA 1K04A 4RDAA 2X0CA 1YYXA 1MNEA 3E70C 1DOVA 3W8HA 3ABKC 1HE9A 1YJGA 2XLWA 4OIQF 4EIYA 2PX0A 2J0XA 1R5ID 2JD3A 1U0BB 2L6HA 2QY9A 1EI7A 3ECSA 3IQ5A 3U3FA 2DI3A 2A69F 1BR1A 3LLKA 2GAQA 2KNHA 3M79A 2XRHA 3RH3A 5KYWA 2VCCA 2KC3A 3GEIA 1YARO 3GODA 1QQ3A 1UFBA 1ZU5A 2XL8A 2J9UA 3RIPA 4KC9A 4CDVA 5F5HA 2RD9A 2HMQA 2VC9A 2WVNA 2QE9A 3ZQVA 5KYXA 2YLDA 3SXYA 4DRJB 4XPWA 2EIMC 1OXKA 2BC5A 4O6MA 1Q0KA 1SR2A 4H54A 2LD6A 4DBRA 3LNMB 4L6RA 4XWJA 4LDQA 1UG7A 1VYKA 4KNWA 3FXHA 4OINF 4CSAA 4ZLCA 2B0HA 2NSGA 5L0FA 3G50A 3EPVA 4YT8A 3W4YA 3K1HA 2YEVA 1CGOA 3LJBA 4U5EE 3U9MA 1VTMP 1H6GA 4YL1A 3JT1A 3TOMA 4I44A 1APCA 1BR2A 3GM3A 2RSEB 2J45A 4CDAA 3IHUA 3K7DA 1IW7F 2IXOA 4PJNA 5B3IA 5KYNA 4JIOA 3DE8A 1YA9A 1G4US 2DGJA 3TD7A 2A1DD 1RJ9A 1NFNA 2NUPB 2Y69C 4IGGA 4MVSA 2PX3A 4LERA 3WODF 4JJGA 3K1IA 4ULVA 2FAPB 2Z15A 1KNYA 4O7GA 4WGYA 2HV6A 4NY3A 3UR3C 4ANJA 5L3QA 1ZYRF 4DRIB 4CDYA 1MMNA 4YL3A 3US6A 1OXBA 4PJLA 2XS8A 5L0IA 4OIOF 3EHNA 4BEJA 3S90A 1BDJB 3FMSA 2J7PD 5T3WA 5DVWA 1NU9C 1JRAA 3LESA 5JVEA 3EG9A 3G4XA 3HNIA 3C8GD 4NTAA 3LLIA 3A11A 3UMHA 3E9VA 3T4RA 5B3SC 4IAOA 4BJ1A 3DI5A 4N6CA 2H7OA 4QI2A 1L7CA 2AP3A 2KYHA 4E17A 4A4AA 3ZDLA 2X51A 4CS8C 4JCHA 2A6EF 2V3CC 2L81A 2CNWA 2OQMA 1J8MF 4PJJA 1Q0DA 3PMRA 3NMIA 3U2MA 4CBEA 1VK5A 3DAGA 4KBLA 4BPMA 1M2VA 3NDBB 1B68A 4YK5A 3RVZA 4NTBA 5JP7A 2PNOA 3RYLA 3EGDB 1OCRC 1YDIA 4G7HF 1EQ1A 1TQGA 1FFHA 1D0ZA 3U8VA 2OCCC 3O39A 4YJWA 2LSEA 5D92A 2IYLD 1G5ZA 3I4UA 1QKRA 4PACA 4U9DA 2XLOA 2WVQA 3EZHA 3IEEA 3GEEA 3DM5A 4PJMA 5CIVA 4MVOA 3EGXA 4EHPA 2BE5F 2L6FA 1VLSA 5DS6A 4DVZA 2PFDA 2MYSA 1A7DA 1AUEA 1OW8A 4C3DA 4JEBA 3IPMO 4XTKA 1Q0GA 1PV3A 1ZHXA 2A6HF 1HMOA 3S27A 4BG0A 3L0IA 1M2OA 4MVUA 4YN0B 1LIHA 3H2UA 1HE1A 4NCQA 3TJ5A 4XEFA 1QZXA 1NZEA 2WZGA 3J06A 3ZC4A 1KTMA 4CIHA 4OD4A 1R4TA 1DOWA 1LM3B 3HNKA 4ULWA 5BQGA 3QW0A 4DBQA 2OJED 1A7EA 2EPNA 4JEAA 1C02A 3GORA 3QZCA 2A0BA 3L34A 2HV7A 2Q00A 2HJMA 2J9WA 4Z9IA 2EPOA 3LAYA 4D4XA 4DVYP 4BEMJ 5L3VA 3LEOA 2IXMA 1ZHZA 3DD7A 2YKZA 3AQCA 4NQFA 5TJ5E 2WZFA 3NMJA 5AC4A 3HTKC 3T6BA 4N06A 4FWVA 1MMAA 1LPEA 4CS9A 1I4ZA 3GANA 3S84A 4FX5A 1FTSA 4PR9A 2R7WA 2F22A 1LE4A 2NUPA 2WZLA 2HSQA 3JTLO 3IQTA 3K66A 3U5SA 4E0IA 3JSEO 4WABA 2QLAA 4J30B 1SYQA 4E7SA 3ZTMA 3NYJA 2DYSC 5BUOA 3QVZA 2MHRA 3EZIA 1JOGA 2IXNA 3RQEA 2CDQA 4W8KA 2R03A 3RF3A 1ZZPA 3JYYA 3HLZA 2Y39A 1RCPA 4MVMA 5L0DA 1Z7Qc 4CS7A 1YLMA 1E2XA 3EQLF 3NG1A 4JCZA 4JVSA 3OEOA 1PCXA 3O6XA 1OKKA 1Y6DA 1Z3IX 3M15A 4MTOA 3I5PA 1NLXA 4MTGA 2P1AA 3V7OA 3X2QC 1A0BA 4EWCA 3KPHA 3B29A 3AOUA 3M1CB 2OJQA 1J8YF 5T1DB 1S05A 2NUTA 2GDCA 3KYIA 5BQHA 3FOPA 2Q9AA 3T9OA 2PBEA 2R7UA 2PP4A 3DAFA 2J0WA 3Q6MA 3TK0A 4RBNA 1ZU4A 1XZPA 4MVZA 4KI2A 4XEVA 3DKAA 2CYDA 4G78A 3SNHA 5KYUB 3EH2A 1K40A 2EPKX 3S29A 4OIPF 4HE8D 2M4EA 4GYTA 5A6BA 2GA0A 1LI5A 2UUHA 5EK0A 4IAQA 4MW3A 3H65A 1JPJA 5AC5A 5DQTA 1Q0MA 4XPXA 4GQHA 2Q7RA 3LS1A 4CIPA 1FR0A 1G8XA 2YL3A 3NMKA 3KH2A 3CEXA 3KKBA 4DJ9A 2IM8A 4ER9A 5L0HA 1HW2A 1XWJA 1WGWA 2ZXOA 1Z6AA 3L8JA 1TWAA 4Q7CA 5KYYB 2NUTB 2V26A 3ZIBA 2IXPA 2R7OA 1FNTc 1Z63A 3RKOF 2XLHA 1OQCA 3LUTB 2ICWG 4K7BA 2C04A 4JTCB 1H9TA 3C7JA 2H7VC 3C8ZA 3WG7C 4EBBA 4EKWA 1YA7O 2GWWA 1A7VA 3QVYA 3RVYA 4AE4A 4G0HA 3N24A 2EILC 3C8GB 2NSFA 2LP4A 2OOCA 4Q5SF
chains in the Genus database with same CATH topology
2XLVA 4JKVA 4JEBA 4CX9A 1E85A 1MQVA 1YZCA 1M6TA 3QW1A 4JE9A 2XLMA 5AGFA 5JRAA 1LM3B 4NC3A 1YYXA 3HNKA 3QW0A 1JAFA 2XLWA 4EIYA 4JEAA 1CPQA 3IQ5A 4D4XA 3M79A 5JS5A 4N4WA 3M4BA 2YKZA 1QQ3A 3ZQYA 2XL8A 3NMJA 5JSLA 4CDVA 3ZQVA 3HNLA 2XM0A 2YLDA 3VRCA 2BC5A 3ZWIA 4WGZA 4L6RA 3ZTZA 2QLAA 3ZTMA 4N6HA 2J8WA 3QVZA 1GQAA 2YL0A 1E84A 2XL6A 1CGNA 1CGOA 2CCYA 1RCPA 3TOMA 1E86A 1APCA 3TOLA 1BBHA 4CDAA 1CPRA 5B3IA 3M15A 3DE8A 4CJGA 4ULVA 4WGYA 3HNJA 3IQ6A 3L1MA 4CDYA 1S05A 4CJOA 5JUAA 3M4CA 3FOPA 3U8PA 3DE9A 5JVEA 1YYJA 2YL1A 2YLGA 3HNIA 256BA 2XLDA 2YL7A 1EKYA 4IAQA 5JT4A 4D4NA 1QPUA 3NMIA 4CIPA 2YL3A 1E83A 3NMKA 5JP7A 4ER9A 5JLIA 1YZAA 2YLIA 2XM4A 3C62A 3FOOA 2XLHA 1NBBA 3C63A 4U9DA 2XLOA 4IARA 4IB4A 3QVYA 4U9EA 1A7VA 2XLEA 2J9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  4JKV A;  4JEB A;  4CX9 A;  1E85 A;  1MQV A;  1YZC A;  1M6T A;  3QW1 A;  4JE9 A;  2XLM A;  5AGF A;  5JRA A;  1LM3 B;  4NC3 A;  1YYX A;  3HNK A;  3QW0 A;  1JAF A;  2XLW A;  4EIY A;  4JEA A;  1CPQ A;  3IQ5 A;  4D4X A;  3M79 A;  5JS5 A;  4N4W A;  3M4B A;  2YKZ A;  1QQ3 A;  3ZQY A;  2XL8 A;  3NMJ A;  5JSL A;  4CDV A;  3ZQV A;  3HNL A;  2XM0 A;  2YLD A;  3VRC A;  2BC5 A;  3ZWI A;  4WGZ A;  4L6R A;  3ZTZ A;  2QLA A;  3ZTM A;  4N6H A;  2J8W A;  3QVZ A;  1GQA A;  2YL0 A;  1E84 A;  2XL6 A;  1CGN A;  1CGO A;  2CCY A;  1RCP A;  3TOM A;  1E86 A;  1APC A;  3TOL A;  1BBH A;  4CDA A;  1CPR A;  5B3I A;  3M15 A;  3DE8 A;  4CJG A;  4ULV A;  4WGY A;  3HNJ A;  3IQ6 A;  3L1M A;  4CDY A;  1S05 A;  4CJO A;  5JUA A;  3M4C A;  3FOP A;  3U8P A;  3DE9 A;  5JVE A;  1YYJ A;  2YL1 A;  2YLG A;  3HNI A;  256B A;  2XLD A;  2YL7 A;  1EKY A;  4IAQ A;  5JT4 A;  4D4N A;  1QPU A;  3NMI A;  4CIP A;  2YL3 A;  1E83 A;  3NMK A;  5JP7 A;  4ER9 A;  5JLI A;  1YZA A;  2YLI A;  2XM4 A;  3C62 A;  3FOO A;  2XLH A;  1NBB A;  3C63 A;  4U9D A;  2XLO A;  4IAR A;  4IB4 A;  3QVY A;  4U9E A;  1A7V A;  2XLE A;  2J9B A; 
#chains in the Genus database with same CATH topology
 3MFN A;  5L0J A;  2XLV A;  2PF4 E;  4LLC A;  4XQ1 A;  2KK1 A;  3POV A;  1FMW A;  3LNR A;  2A0U A;  4CX9 A;  3ASN C;  4QI0 A;  1I4Y A;  1NFO A;  3KMI A;  4I1O B;  1YZC A;  1PD1 A;  2VB6 A;  4U5C E;  1PD0 A;  3TJ6 A;  2OG2 A;  3QW1 A;  1V4A A;  2TMV P;  2OEV A;  4XEK A;  3QTH A;  4HEA J;  3S0X A;  4P9F A;  2NPU A;  4EBK A;  1AEP A;  4NC3 A;  4MVR A;  5COM A;  3SXK A;  5KYW B;  3O55 A;  2QNL A;  1JAF A;  3X1O A;  5HSW A;  3S28 A;  1CPQ A;  1ZW2 A;  2KQ9 A;  4C7O B;  2Q9C A;  3V5Y A;  3LS0 A;  2M64 A;  2EPL X;  4HFF B;  4UDV A;  3ITF A;  3KL4 A;  4O6Y A;  5JS5 A;  4N4W A;  1ZW3 A;  3M4B A;  4CS8 A;  4Z9J A;  2G3V A;  5KYX B;  5K0I A;  1KU2 A;  1JPN A;  2AWY A;  5JSL A;  4YT5 A;  3PHF 2;  4PFP A;  5CI9 A;  2XXA B;  2EIJ C;  2HSB A;  2W9Y A;  2P6V A;  4MS2 A;  5F28 E;  1Y4C A;  4IJJ A;  4U5H A;  3VRC A;  2LQG A;  1QLE C;  3UGP A;  5L0C A;  3GWL A;  4WGZ A;  2D4U A;  5E3C A;  3ZTZ A;  4BJ6 C;  4A2N B;  1OCC C;  2EIN C;  2LK4 A;  2R05 A;  4E18 A;  4E7Z A;  3TUL A;  2I8B A;  2AU5 A;  2H7B A;  2VCB A;  4N6H A;  2W4M A;  3KYJ A;  5CI8 A;  1WTY A;  5DS4 A;  2HS5 A;  4AX2 A;  1CGM E;  2XL6 A;  1CGN A;  2CW0 F;  3UMI A;  4CJG A;  5A69 A;  2R7V A;  1SZI A;  3W8I A;  3LEV A;  3VYW A;  5F5F A;  2NG1 A;  3RQG A;  2I15 A;  4X0R A;  1TWG A;  3RFY A;  1U89 A;  4JTD B;  1BBH A;  4F4B A;  3HJC A;  1CPR A;  5HV9 A;  3BEH A;  1FMV A;  2YWA A;  4H4K C;  3NYM A;  1JMW A;  2LIG A;  3VM6 A;  1H9G A;  1M56 C;  2FFH A;  2KW3 C;  5FZT A;  3ZVR A;  1TFK B;  2HMZ A;  1V74 B;  5FCL A;  5IY5 C;  1NSG B;  1SMY F;  2Q3T A;  1T01 A;  3JSZ A;  3HNJ A;  4JW1 A;  4LDR A;  2Q4F A;  4AL1 A;  3L1M A;  3B0V C;  2DYR C;  5T3T A;  3EG9 B;  4W8P A;  3DZA A;  1MMD A;  1QVX A;  2HUJ A;  3M4C A;  3R7C A;  3RQF A;  4BJ5 C;  4K0D A;  4PFO A;  3B0U X;  3NRH A;  3AG1 C;  2P0N A;  3DE9 A;  1Z23 A;  1YYJ A;  1ZHT A;  4AL0 A;  2CNW D;  3CQZ A;  1WAS A;  4RD9 A;  2H8A A;  4FAP B;  4QDL A;  4U5D E;  256B A;  5E33 A;  4DOZ A;  2CGE A;  2YHS A;  2YL7 A;  2IOQ A;  2WL8 A;  2FGY A;  2Y3H A;  3MYI A;  3B71 A;  2OKU A;  1M2V B;  1BR4 A;  4ONS A;  1AVO B;  5JT4 A;  4D4N A;  1WAT A;  2R7Q A;  5COG A;  1I5N A;  3NKE A;  3C8G A;  4JTA B;  3DWW A;  1OW6 A;  1RKC A;  4YL0 A;  2J46 A;  4G7O F;  1E83 A;  3CZ6 A;  4LLE A;  1GM5 A;  3SXZ A;  2KGO A;  5JLI A;  5BQI A;  1YZA A;  2XM4 A;  3MYF A;  4LAC B;  2B0J A;  2Y3D A;  1ZVZ A;  3DMD A;  5GPG B;  5E2Q A;  3V5Z A;  1HMD A;  1C17 M;  3FOO A;  4O6N A;  3W2V A;  1QSP A;  4EUK B;  3FDQ A;  4CSA C;  1LS1 A;  1LS4 A;  3Q7L A;  2L7A A;  3C63 A;  3EGX B;  2XSE A;  1OR3 A;  3EGD A;  5DQZ A;  1T6U A;  4IAR A;  5E3A A;  4IB4 A;  5B1A C;  5EGY A;  2XL4 A;  1SF8 A;  2L9J A;  2R02 A;  3OA1 A;  1ORJ A;  3AG4 C;  3F46 A;  2YQY A;  4DXW A;  2J9B A;  4PK4 A;  4K1O A;  1OW7 A;  2GFH A;  3GEH A;  4C7O A;  3U0C A;  2HFI A;  5B1B C;  3FVY A;  2G62 A;  3GM1 A;  1D1C A;  1Z5Z A;  3H2V A;  1V54 C;  4YT2 A;  2R7S A;  4XPY A;  1MQV A;  4GEH A;  3EHM A;  3K1I C;  4AK9 A;  1LI7 A;  3WAQ A;  1M6T A;  2XXA A;  3EFO B;  2O9X A;  1D1B A;  1RKE B;  1W2W A;  2VH3 A;  4JE9 A;  3AQB A;  4C3B A;  3UNG C;  1GS9 A;  1YAU O;  2YRF A;  3OWT A;  2EIK C;  2HZ8 A;  2AWC A;  2JPU A;  4JJF A;  4KNV A;  4MVQ A;  2VAS A;  2DB4 A;  4JUR I;  3VF0 A;  5A6J A;  4U5B E;  2HKV A;  3ABL C;  1WOL A;  3W2W A;  3ZQY A;  3EH1 A;  3HKK A;  1TKN A;  2ETS A;  3DM9 B;  1WWP A;  4J7T A;  4FES A;  4JC7 A;  1WN0 A;  2C03 A;  3HNL A;  1ORY A;  2XM0 A;  3B0P A;  3ZWI A;  3MLG A;  1TWC A;  3C18 A;  3DXJ F;  2ZXP A;  2Y3B A;  4MND A;  2W45 A;  1FAP B;  1TR2 A;  3SZR A;  1T6Q A;  1RMV A;  1LVK A;  1T9K A;  2P61 A;  1ST6 A;  2YVK A;  3Q7G A;  4M63 A;  2J8W A;  1NG1 A;  1GQA A;  1Q0F A;  2OU6 A;  2YL0 A;  4J7Y A;  3QMK A;  1OKK D;  2BL2 A;  1TFO B;  1F1M A;  3MBG A;  3JRT A;  3ZG1 A;  1E84 A;  2CCY A;  1H7I A;  3K6B A;  4I1M A;  2R7X A;  1E86 A;  1VMA A;  3TOL A;  5EHH A;  3PDM P;  4IWB A;  4JRZ A;  4Q4Z F;  5A6K A;  1O87 A;  1ORS C;  3GM2 A;  3GWN A;  4U5F E;  4G7Z F;  3I5Q A;  1YVI A;  3NYL A;  4HFK B;  3FAP B;  4BJT A;  4XLP F;  1N1C A;  3DJU B;  1EA8 A;  1C03 A;  2HJ3 A;  2ZD9 A;  3SXM A;  3IQ6 A;  3SEO A;  1JR8 A;  1LKX A;  1S7Z A;  3ZSU A;  2ZXR A;  4CJO A;  5JUA A;  1XZQ A;  3AG2 C;  3ATP A;  4MTF A;  1K05 A;  3ASO C;  3U8P A;  1FFT C;  3JZ0 A;  5A6B D;  5A6A A;  2ASR A;  4YWQ A;  4I3M A;  2YL1 A;  2YLG A;  1V55 C;  2G3K A;  3DJN B;  4LDK A;  2L6G A;  4NTF A;  1HY5 A;  1LE2 A;  3N2Z B;  1OR2 A;  2QUP A;  1ZHW A;  2W4B A;  2WB7 A;  2XLD A;  4IRU A;  5D91 A;  1RJ9 B;  1D1A A;  4WJ0 A;  3T6G B;  3TQO A;  3WHN A;  1L3P A;  3K33 A;  4E0H A;  1EKY A;  1IZM A;  3FAJ A;  1OCO C;  2R9R B;  2WVO A;  5KYU A;  1QPU A;  3CAX A;  3F47 A;  4B6I A;  1MMG A;  3VAY A;  4CS9 C;  2ZPA A;  3RW0 A;  3NKD A;  3R2P A;  1VLT A;  1ZHY A;  5COF A;  2D5R B;  3CSK A;  4O79 A;  1RXQ A;  4EBJ A;  4ZLD A;  2XS1 A;  4YT4 A;  2YLI A;  1T5O A;  4OIR F;  1BZ4 A;  4BJ6 A;  1OCZ C;  3C62 A;  3O10 A;  4P9T A;  4U5G A;  3UMK A;  4C3E A;  1G4W R;  3U3B A;  1NU7 D;  3EFO A;  2ZXW C;  1NBB A;  1RKE A;  1VB5 A;  2OEX A;  4XLN F;  4AE4 B;  5L0G A;  2P7V A;  5KYY A;  4MQ9 F;  3U9J A;  4MW8 A;  3A9C A;  3AJM A;  1A41 A;  3BRJ A;  2LFD A;  1D0Y A;  2KJG A;  2QTV A;  1VYI A;  3ABM C;  3EJN A;  4P6I C;  4U9E A;  3B9Q A;  3N0T A;  2XLE A;  3SYN A;  1M57 C;  4Z9H A;  3JRM O;  3JYH A;  5DS5 A;  2J7P A;  2R7T A;  5DLJ A;  1T6I A;  1U6H A;  3AGT A;  2R25 A;  3L8I A;  3G4Z A;  4JKV A;  2J9V A;  2E87 A;  1O5H A;  2EPM X;  1O3U A;  2UUI A;  3IQC A;  4J32 B;  4JZA A;  4R32 A;  3U2L A;  2Q9B A;  2VCA A;  4OD5 A;  3PCV A;  3AGU A;  4DRH B;  1E85 A;  3JCU Q;  2A68 F;  3MX3 A;  3T6J A;  3UGO A;  1MND A;  3S9O A;  2KSF A;  1VOM A;  2YZS A;  1GGQ A;  2LCH A;  2MWQ A;  2Y3G A;  3FHD A;  3Q6N A;  3SP1 A;  3V5X A;  1TWH A;  2IBF A;  1D0X A;  1HW1 A;  2AVK A;  2LFF A;  2XLM A;  2JX0 A;  4BJ5 A;  2R7R A;  5AGF A;  3AG3 C;  5JRA A;  1K04 A;  4RDA A;  2X0C A;  1YYX A;  1MNE A;  3E70 C;  1DOV A;  3W8H A;  3ABK C;  1HE9 A;  1YJG A;  2XLW A;  4OIQ F;  4EIY A;  2PX0 A;  2J0X A;  1R5I D;  2JD3 A;  1U0B B;  2L6H A;  2QY9 A;  1EI7 A;  3ECS A;  3IQ5 A;  3U3F A;  2DI3 A;  2A69 F;  1BR1 A;  3LLK A;  2GAQ A;  2KNH A;  3M79 A;  2XRH A;  3RH3 A;  5KYW A;  2VCC A;  2KC3 A;  3GEI A;  1YAR O;  3GOD A;  1QQ3 A;  1UFB A;  1ZU5 A;  2XL8 A;  2J9U A;  3RIP A;  4KC9 A;  4CDV A;  5F5H A;  2RD9 A;  2HMQ A;  2VC9 A;  2WVN A;  2QE9 A;  3ZQV A;  5KYX A;  2YLD A;  3SXY A;  4DRJ B;  4XPW A;  2EIM C;  1OXK A;  2BC5 A;  4O6M A;  1Q0K A;  1SR2 A;  4H54 A;  2LD6 A;  4DBR A;  3LNM B;  4L6R A;  4XWJ A;  4LDQ A;  1UG7 A;  1VYK A;  4KNW A;  3FXH A;  4OIN F;  4CSA A;  4ZLC A;  2B0H A;  2NSG A;  5L0F A;  3G50 A;  3EPV A;  4YT8 A;  3W4Y A;  3K1H A;  2YEV A;  1CGO A;  3LJB A;  4U5E E;  3U9M A;  1VTM P;  1H6G A;  4YL1 A;  3JT1 A;  3TOM A;  4I44 A;  1APC A;  1BR2 A;  3GM3 A;  2RSE B;  2J45 A;  4CDA A;  3IHU A;  3K7D A;  1IW7 F;  2IXO A;  4PJN A;  5B3I A;  5KYN A;  4JIO A;  3DE8 A;  1YA9 A;  1G4U S;  2DGJ A;  3TD7 A;  2A1D D;  1RJ9 A;  1NFN A;  2NUP B;  2Y69 C;  4IGG A;  4MVS A;  2PX3 A;  4LER A;  3WOD F;  4JJG A;  3K1I A;  4ULV A;  2FAP B;  2Z15 A;  1KNY A;  4O7G A;  4WGY A;  2HV6 A;  4NY3 A;  3UR3 C;  4ANJ A;  5L3Q A;  1ZYR F;  4DRI B;  4CDY A;  1MMN A;  4YL3 A;  3US6 A;  1OXB A;  4PJL A;  2XS8 A;  5L0I A;  4OIO F;  3EHN A;  4BEJ A;  3S90 A;  1BDJ B;  3FMS A;  2J7P D;  5T3W A;  5DVW A;  1NU9 C;  1JRA A;  3LES A;  5JVE A;  3EG9 A;  3G4X A;  3HNI A;  3C8G D;  4NTA A;  3LLI A;  3A11 A;  3UMH A;  3E9V A;  3T4R A;  5B3S C;  4IAO A;  4BJ1 A;  3DI5 A;  4N6C A;  2H7O A;  4QI2 A;  1L7C A;  2AP3 A;  2KYH A;  4E17 A;  4A4A A;  3ZDL A;  2X51 A;  4CS8 C;  4JCH A;  2A6E F;  2V3C C;  2L81 A;  2CNW A;  2OQM A;  1J8M F;  4PJJ A;  1Q0D A;  3PMR A;  3NMI A;  3U2M A;  4CBE A;  1VK5 A;  3DAG A;  4KBL A;  4BPM A;  1M2V A;  3NDB B;  1B68 A;  4YK5 A;  3RVZ A;  4NTB A;  5JP7 A;  2PNO A;  3RYL A;  3EGD B;  1OCR C;  1YDI A;  4G7H F;  1EQ1 A;  1TQG A;  1FFH A;  1D0Z A;  3U8V A;  2OCC C;  3O39 A;  4YJW A;  2LSE A;  5D92 A;  2IYL D;  1G5Z A;  3I4U A;  1QKR A;  4PAC A;  4U9D A;  2XLO A;  2WVQ A;  3EZH A;  3IEE A;  3GEE A;  3DM5 A;  4PJM A;  5CIV A;  4MVO A;  3EGX A;  4EHP A;  2BE5 F;  2L6F A;  1VLS A;  5DS6 A;  4DVZ A;  2PFD A;  2MYS A;  1A7D A;  1AUE A;  1OW8 A;  4C3D A;  4JEB A;  3IPM O;  4XTK A;  1Q0G A;  1PV3 A;  1ZHX A;  2A6H F;  1HMO A;  3S27 A;  4BG0 A;  3L0I A;  1M2O A;  4MVU A;  4YN0 B;  1LIH A;  3H2U A;  1HE1 A;  4NCQ A;  3TJ5 A;  4XEF A;  1QZX A;  1NZE A;  2WZG A;  3J06 A;  3ZC4 A;  1KTM A;  4CIH A;  4OD4 A;  1R4T A;  1DOW A;  1LM3 B;  3HNK A;  4ULW A;  5BQG A;  3QW0 A;  4DBQ A;  2OJE D;  1A7E A;  2EPN A;  4JEA A;  1C02 A;  3GOR A;  3QZC A;  2A0B A;  3L34 A;  2HV7 A;  2Q00 A;  2HJM A;  2J9W A;  4Z9I A;  2EPO A;  3LAY A;  4D4X A;  4DVY P;  4BEM J;  5L3V A;  3LEO A;  2IXM A;  1ZHZ A;  3DD7 A;  2YKZ A;  3AQC A;  4NQF A;  5TJ5 E;  2WZF A;  3NMJ A;  5AC4 A;  3HTK C;  3T6B A;  4N06 A;  4FWV A;  1MMA A;  1LPE A;  4CS9 A;  1I4Z A;  3GAN A;  3S84 A;  4FX5 A;  1FTS A;  4PR9 A;  2R7W A;  2F22 A;  1LE4 A;  2NUP A;  2WZL A;  2HSQ A;  3JTL O;  3IQT A;  3K66 A;  3U5S A;  4E0I A;  3JSE O;  4WAB A;  2QLA A;  4J30 B;  1SYQ A;  4E7S A;  3ZTM A;  3NYJ A;  2DYS C;  5BUO A;  3QVZ A;  2MHR A;  3EZI A;  1JOG A;  2IXN A;  3RQE A;  2CDQ A;  4W8K A;  2R03 A;  3RF3 A;  1ZZP A;  3JYY A;  3HLZ A;  2Y39 A;  1RCP A;  4MVM A;  5L0D A;  1Z7Q c;  4CS7 A;  1YLM A;  1E2X A;  3EQL F;  3NG1 A;  4JCZ A;  4JVS A;  3OEO A;  1PCX A;  3O6X A;  1OKK A;  1Y6D A;  1Z3I X;  3M15 A;  4MTO A;  3I5P A;  1NLX A;  4MTG A;  2P1A A;  3V7O A;  3X2Q C;  1A0B A;  4EWC A;  3KPH A;  3B29 A;  3AOU A;  3M1C B;  2OJQ A;  1J8Y F;  5T1D B;  1S05 A;  2NUT A;  2GDC A;  3KYI A;  5BQH A;  3FOP A;  2Q9A A;  3T9O A;  2PBE A;  2R7U A;  2PP4 A;  3DAF A;  2J0W A;  3Q6M A;  3TK0 A;  4RBN A;  1ZU4 A;  1XZP A;  4MVZ A;  4KI2 A;  4XEV A;  3DKA A;  2CYD A;  4G78 A;  3SNH A;  5KYU B;  3EH2 A;  1K40 A;  2EPK X;  3S29 A;  4OIP F;  4HE8 D;  2M4E A;  4GYT A;  5A6B A;  2GA0 A;  1LI5 A;  2UUH A;  5EK0 A;  4IAQ A;  4MW3 A;  3H65 A;  1JPJ A;  5AC5 A;  5DQT A;  1Q0M A;  4XPX A;  4GQH A;  2Q7R A;  3LS1 A;  4CIP A;  1FR0 A;  1G8X A;  2YL3 A;  3NMK A;  3KH2 A;  3CEX A;  3KKB A;  4DJ9 A;  2IM8 A;  4ER9 A;  5L0H A;  1HW2 A;  1XWJ A;  1WGW A;  2ZXO A;  1Z6A A;  3L8J A;  1TWA A;  4Q7C A;  5KYY B;  2NUT B;  2V26 A;  3ZIB A;  2IXP A;  2R7O A;  1FNT c;  1Z63 A;  3RKO F;  2XLH A;  1OQC A;  3LUT B;  2ICW G;  4K7B A;  2C04 A;  4JTC B;  1H9T A;  3C7J A;  2H7V C;  3C8Z A;  3WG7 C;  4EBB A;  4EKW A;  1YA7 O;  2GWW A;  1A7V A;  3QVY A;  3RVY A;  4AE4 A;  4G0H A;  3N24 A;  2EIL C;  3C8G B;  2NSF A;  2LP4 A;  2OOC A;  4Q5S F; 
#chains in the Genus database with same CATH homology
 2XLV A;  4JKV A;  4JEB A;  4CX9 A;  1E85 A;  1MQV A;  1YZC A;  1M6T A;  3QW1 A;  4JE9 A;  2XLM A;  5AGF A;  5JRA A;  1LM3 B;  4NC3 A;  1YYX A;  3HNK A;  3QW0 A;  1JAF A;  2XLW A;  4EIY A;  4JEA A;  1CPQ A;  3IQ5 A;  4D4X A;  3M79 A;  5JS5 A;  4N4W A;  3M4B A;  2YKZ A;  1QQ3 A;  3ZQY A;  2XL8 A;  3NMJ A;  5JSL A;  4CDV A;  3ZQV A;  3HNL A;  2XM0 A;  2YLD A;  3VRC A;  2BC5 A;  3ZWI A;  4WGZ A;  4L6R A;  3ZTZ A;  2QLA A;  3ZTM A;  4N6H A;  2J8W A;  3QVZ A;  1GQA A;  2YL0 A;  1E84 A;  2XL6 A;  1CGN A;  1CGO A;  2CCY A;  1RCP A;  3TOM A;  1E86 A;  1APC A;  3TOL A;  1BBH A;  4CDA A;  1CPR A;  5B3I A;  3M15 A;  3DE8 A;  4CJG A;  4ULV A;  4WGY A;  3HNJ A;  3IQ6 A;  3L1M A;  4CDY A;  1S05 A;  4CJO A;  5JUA A;  3M4C A;  3FOP A;  3U8P A;  3DE9 A;  5JVE A;  1YYJ A;  2YL1 A;  2YLG A;  3HNI A;  256B A;  2XLD A;  2YL7 A;  1EKY A;  4IAQ A;  5JT4 A;  4D4N A;  1QPU A;  3NMI A;  4CIP A;  2YL3 A;  1E83 A;  3NMK A;  5JP7 A;  4ER9 A;  5JLI A;  1YZA A;  2YLI A;  2XM4 A;  3C62 A;  3FOO A;  2XLH A;  1NBB A;  3C63 A;  4U9D A;  2XLO A;  4IAR A;  4IB4 A;  3QVY A;  4U9E A;  1A7V A;  2XLE A;  2J9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...