3E9VA

Crystal structure of human b-cell translocation gene 2 (btg2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structure of human B-cell Translocation Gene 2 (BTG2)
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e9vA00
2Z15A 3DJNB 5CI8A 2D5RB 3DJUB 3E9VA 5CI9A
chains in the Genus database with same CATH superfamily
4NTBA 1FMWA 1MMNA 2NSFA 5JSLA 4JIOA 1T6QA 1H7IA 1TWHA 2Y39A 2R05A 3LESA 4MQ9F 4MVUA 1EI7A 4ANJA 1PCXA 4MW3A 5T3TA 1YYJA 1XZPA 2OJQA 1VYKA 1ZHXA 2OEVA 4U9EA 3U3FA 5KYWB 2EPMX 3JYYA 4BJ6A 4OIOF 3IHUA 2YL1A 5CIVA 4E7SA 3QZCA 3ZQYA 2IXNA 4J7YA 2R7TA 4G7HF 4A4AA 3LNRA 2B0HA 2P1AA 4LACB 3RF3A 5BQIA 4DRHB 2OEXA 1SR2A 3K1HA 1HW1A 2IXOA 4C3BA 3U9MA 1OKKA 3US6A 4U5HA 3ZTMA 3PHF2 3C8GD 4LDKA 4F4BA 3E9VA 2GWWA 4MNDA 3UGPA 1CPRA 1LIHA 4XLPF 3EGDA 2L6FA 1JPJA 1L7CA 3NRHA 3S27A 3WAQA 1C17M 5COMA 2ZXRA 2OG2A 5COGA 3AG4C 4D4XA 5A6KA 3C63A 3ASNC 2WZFA 5JS5A 2OCCC 2QUPA 1R4TA 3E70C 2L6GA 2J9BA 3EG9B 1BBHA 3R2PA 4HEAJ 4CS8C 3RYLA 1MQVA 4MVSA 4CS7A 4DRJB 2P7VA 3CAXA 2J45A 1A7EA 1D1CA 2EIJC 3EZHA 2XLWA 4IJJA 5FZTA 2EPKX 2XLDA 5L0DA 4YT4A 3L0IA 2DB4A 2AU5A 4KNWA 2YL0A 3GODA 3MX3A 4G78A 4QI0A 3TJ5A 2HFIA 4CDVA 4C7OB 1A41A 2GAQA 5B1AC 5B1BC 3EGDB 4EBJA 5HSWA 1OCZC 4K7BA 3R7CA 1YAUO 4CS8A 2XS8A 3DAFA 4JEBA 1WN0A 2NG1A 4I1OB 1WGWA 1ORSC 2E87A 4Q5SF 4DBRA 3MBGA 2IXPA 3FOOA 3U8VA 2KSFA 4R32A 1H6GA 4Q7CA 3W2WA 3S28A 2V3CC 1AVOB 2ZPAA 1I4ZA 1OW8A 2R7OA 3GEHA 3M4BA 1CGOA 4XPXA 3CEXA 3TJ6A 1SZIA 1SMYF 3FOPA 2YLDA 3DMDA 1D0ZA 3TOMA 4BJ5C 2J9VA 4W8KA 2IBFA 4DOZA 5BQHA 4DVYP 5IY5C 5L0GA 4LDRA 1CPQA 2EILC 4DBQA 1QLEC 5BUOA 3NKDA 1V4AA 4AE4A 4RBNA 1KTMA 1VOMA 2W45A 3O10A 4EBKA 5L3QA 1YARO 1NFNA 2QTVA 3B29A 3UR3C 2R7SA 1TWCA 1R5ID 4JTCB 2JPUA 3C8GA 2GA0A 1QQ3A 2ICWG 1JOGA 5F5HA 1UG7A 4FAPB 3I5PA 2A1DD 2D4UA 3DE9A 4BJ5A 2NUTB 3GEEA 4UDVA 3IQ5A 1D0YA 3IQ6A 2OOCA 2LSEA 4PACA 5GPGB 2R7WA 5FCLA 2KQ9A 4YT2A 1T6IA 3CQZA 1OQCA 3ASOC 2TMVP 2YKZA 1OCRC 3L1MA 1OKKD 4I3MA 4JJGA 2I15A 2P6VA 2CGEA 2LFFA 1M57C 4AE4B 3POVA 1HE9A 1C03A 2LFDA 4O79A 2NSGA 1FNTc 1CGME 1ZHYA 2CYDA 1LE2A 3B0VC 3OWTA 1FTSA 3NYJA 2A6EF 4C3EA 3C8GB 1U0BB 2FGYA 4U5DE 4MTGA 2H8AA 1RXQA 1LPEA 3EFOA 4FESA 1EA8A 3V5XA 4FX5A 3BRJA 1UFBA 3HJCA 3U2MA 3GORA 5A6BA 1FFTC 2YL3A 3LEVA 2C04A 3EHMA 4AL0A 3U8PA 3L34A 3ZTZA 5DVWA 3H2UA 5KYWA 2XXAA 3ZWIA 1PD0A 4W8PA 1A0BA 2VCAA 3HNLA 2LQGA 2NUPA 3RVZA 5L0IA 4WABA 4IAQA 4YL0A 2R7UA 1GS9A 1MMDA 1O5HA 2M4EA 2A0BA 3JSZA 2XLHA 4XEVA 1WWPA 3HNJA 1JRAA 2QY9A 4U5BE 2ETSA 3M79A 3S90A 1FFHA 1MNDA 1W2WA 1ZZPA 3JRMO 3O55A 3AGTA 3VF0A 5EK0A 4HFFB 2FFHA 3EFOB 5DS4A 1ZHZA 1GQAA 1FMVA 4RDAA 2I8BA 3TQOA 2Q3TA 4N4WA 1HMOA 4NTAA 3PMRA 4J30B 3IQCA 4MVRA 1V55C 2XXAB 3EPVA 3FVYA 4MVOA 2J8WA 1GM5A 3AQBA 2Y69C 1LS4A 2L9JA 3EG9A 4G7OF 2NUPB 4OIQF 4CSAA 2MYSA 5BQGA 1PV3A 3RKOF 2JD3A 5JT4A 1D0XA 4E17A 4EBBA 1WATA 4HFKB 3A9CA 4PFPA 2BL2A 2KC3A 4X0RA 3CSKA 2D5RB 4YT8A 2YHSA 2GDCA 2RSEB 1ZHTA 4C7OA 2Q9BA 2WB7A 3HKKA 4OD5A 3S84A 3UGOA 5TJ5E 5E2QA 4WJ0A 2CDQA 1Z5ZA 4JC7A 3T6JA 3JT1A 1ZW3A 3KYJA 4JZAA 3V5ZA 4BPMA 3KL4A 1F1MA 2ZXPA 4G7ZF 5JP7A 3B9QA 1O87A 3FAJA 1NFOA 2C03A 2HSQA 2DGJA 3VYWA 1K04A 5DQZA 2YLGA 2HJMA 5L0CA 3W4YA 1OR3A 1LI5A 4E0IA 4ZLCA 5HV9A 2WVNA 2AWCA 3PDMP 1B68A 3JCUQ 1DOVA 5JVEA 1XZQA 3S9OA 3EGXA 3ZDLA 1LM3B 4OIPF 1MMAA 4CS9C 1OR2A 4KC9A 4E7ZA 4B6IA 4JURI 1I4YA 2KW3C 4ULVA 2XRHA 2RD9A 2XM0A 3DWWA 1Z6AA 2G62A 1QSPA 1HY5A 1JMWA 1WTYA 4ULWA 5KYYA 1LKXA 4O6YA 3DZAA 3LNMB 1RKCA 3C8ZA 5A6BD 3KMIA 2VC9A 3GWNA 1T5OA 4MS2A 1N1CA 1RJ9A 4AX2A 5CI9A 2KYHA 1QKRA 2LIGA 4PR9A 1TR2A 1YZAA 3AG3C 3RFYA 4BEJA 3MYFA 1RKEB 4ONSA 4ZLDA 1WASA 3RQEA 3ECSA 4LERA 3IQTA 4JTAB 4NTFA 2LK4A 2NUTA 2R9RB 4CJGA 2Q00A 3H2VA 2QLAA 1BDJB 3ITFA 2MWQA 2W4BA 3JTLO 4IRUA 3EH1A 3EGXB 3KPHA 5DLJA 3JSEO 3UMIA 2PP4A 3HNIA 1Q0GA 3GANA 2OKUA 3L8IA 4JEAA 5L0FA 3N0TA 5KYYB 3SXKA 3N24A 4JE9A 2WVQA 2WL8A 3HLZA 1RCPA 1YA7O 1QVXA 5T3WA 3FHDA 4OINF 2J7PD 1RJ9B 2MHRA 4L6RA 3T9OA 3O6XA 3ZC4A 4DVZA 2R7XA 3C7JA 4CJOA 2VCBA 1HMDA 3DI5A 4AK9A 2KK1A 1G8XA 3MYIA 3SXZA 2L7AA 4GYTA 4EHPA 4YWQA 4Z9HA 4CIHA 2M64A 4JCHA 1TKNA 3AJMA 4XPWA 2XSEA 1J8YF 4GQHA 2HZ8A 3EJNA 2XL4A 5A69A 3NMKA 1OW6A 4JKVA 2EPNA 3ZG1A 4Q4ZF 5F5FA 3U3BA 1DOWA 4NC3A 2XLVA 3MLGA 1VLTA 2PFDA 3AQCA 4IB4A 1PD1A 4DJ9A 5A6AA 4XEFA 2HV6A 1D1BA 3QW1A 2XLEA 1I5NA 1Z7Qc 3GM3A 2QNLA 1U89A 4P6IC 1SF8A 3AG2C 2BE5F 1FAPB 1Z63A 1M6TA 3IPMO 2PF4E 2OU6A 4ER9A 2H7BA 4XQ1A 3S29A 4E18A 1T9KA 2EPLX 2YQYA 1WOLA 3K1IC 4MW8A 4YT5A 3U2LA 3SP1A 3ZIBA 1VMAA 3U5SA 4JW1A 2B0JA 1M56C 2A68F 2IOQA 1ZU4A 2J46A 2Z15A 3DJUB 1VTMP 3KKBA 1BR4A 1YJGA 3EHNA 1NU9C 3DJNB 2EIMC 3N2ZB 1A7DA 4C3DA 3U0CA 3TD7A 1G4WR 2A6HF 3DAGA 2Q4FA 3GEIA 4IWBA 4P9TA 1T01A 2V26A 3V7OA 2DYSC 2J9UA 3VAYA 1TFKB 1ZVZA 1NLXA 4Z9JA 2UUHA 3ABMC 3OEOA 5JRAA 2H7VC 4YJWA 4LLCA 3UMHA 4XEKA 4LLEA 3GWLA 4YL1A 3W2VA 1BZ4A 3ZSUA 4EUKB 1E85A 4XTKA 1D1AA 3QTHA 2J7PA 4EIYA 3B0UX 2W4MA 1ST6A 5B3SC 5JLIA 1ORJA 1LVKA 3M1CB 4I44A 1O3UA 1Q0FA 3K6BA 1E84A 4JRZA 4U5GA 4JJFA 4EWCA 1K40A 1OXBA 4U9DA 1V74B 4N6CA 4BJTA 3LUTB 1CGNA 3EZIA 1E2XA 1U6HA 4YK5A 3RVYA 4D4NA 2Y3BA 5A6JA 5KYNA 1HW2A 2OQMA 3ATPA 1C02A 4IGGA 5DS6A 5E3CA 2ZXWC 1TWGA 2EPOA 1YYXA 1MNEA 1OXKA 3M15A 2YZSA 3NMJA 4O7GA 2KGOA 4LDQA 5D92A 3NKEA 5KYXA 2A69F 2Q9AA 4N6HA 1ORYA 1YZCA 3ABKC 3DM5A 4OIRF 1NU7D 3Q6MA 4I1MA 4MVZA 1EQ1A 3WHNA 4M63A 2HUJA 3QMKA 2Q7RA 2HV7A 3RQGA 1G5ZA 1SYQA 2XLMA 5E33A 2F22A 1RKEA 3NMIA 1Z23A 2HJ3A 2IYLD 1LI7A 3NG1A 4MTFA 3W8IA 1NSGB 2LP4A 3BEHA 2G3VA 4Z9IA 3S0XA 1G4US 4MTOA 4E0HA 3JYHA 3LEOA 5JUAA 1APCA 4YL3A 3MFNA 3KYIA 4WGZA 3K66A 3V5YA 4QI2A 1IZMA 4MVQA 4DXWA 2OJED 2QE9A 5CI8A 3RW0A 3O39A 2YRFA 4DRIB 3HTKC 5KYXB 2VCCA 3LS1A 2YWAA 3DE8A 2FAPB 1H9TA 4U5CE 2EINC 3NYLA 1V54C 2NPUA 3K33A 2CCYA 2PX3A 2R25A 5KYUA 1A7VA 3QVZA 2WZLA 1Q0DA 3Q7LA 2AWYA 3WODF 5L0JA 1E83A 4EKWA 3C62A 2CW0F 4CDYA 4CX9A 4WGYA 4PJMA 1ZW2A 1OCCC 3SXMA 1OW7A 3AOUA 3G4ZA 4RD9A 2BC5A 1TQGA 4CS9A 1KNYA 1M2VA 2P61A 2XL6A 2LD6A 2R02A 2ZD9A 2YLIA 3VRCA 1Q0KA 1OCOC 1BR2A 2R03A 3GM1A 4OD4A 1E86A 4AL1A 2JX0A 4BG0A 3NYMA 2WVOA 3I5QA 4PFOA 4K1OA 3RH3A 1S7ZA 1YLMA 2W9YA 3F47A 3PCVA 5D91A 5F28E 1GGQA 1NBBA 3AGUA 2Y3HA 4PJNA 3SZRA 4P9FA 5KYUB 4IAOA 2PX0A 3SYNA 1L3PA 2IM8A 1JR8A 1NZEA 1Z3IX 2O9XA 2R7QA 4FWVA 3T6GB 3TULA 2YEVA 4K0DA 1FR0A 1Y4CA 5COFA 1JAFA 1LE4A 4JVSA 2CNWD 1ZYRF 1YDIA 3G50A 2YL7A 2Q9CA 3LLKA 4PK4A 2Y3GA 4QDLA 2DI3A 3UNGC 4CDAA 2HMQA 1M2VB 3FXHA 1QZXA 3UMKA 1EKYA 1NG1A 3DKAA 3SNHA 1K05A 3DXJF 2A0UA 2AVKA 5AC5A 2PBEA 3FAPB 4N06A 3NDBB 3FDQA 1IW7F 256BA 1VYIA 2XM4A 3IEEA 5DQTA 3ZVRA 2HS5A 2XL8A 4PJLA 3TK0A 1YVIA 5B3IA 3EH2A 3WG7C 2L6HA 2KNHA 3A11A 1ZU5A 4J7TA 3K7DA 1T6UA 2XLOA 5K0IA 2XS1A 3OA1A 1VB5A 2PNOA 4G0HA 4U5FE 3LLIA 3X2QC 2ASRA 1H9GA 2HSBA 4BEMJ 4JCZA 1KU2A 5EHHA 2X51A 3VM6A 4KI2A 3LS0A 3M4CA 4O6MA 3T6BA 5DS5A 4NQFA 1BR1A 2VASA 2VB6A 3H65A 5EGYA 3B0PA 3EQLF 3JRTA 3LJBA 3Q7GA 3Q6NA 4XPYA 1Y6DA 2LCHA 3RIPA 4BJ1A 2DYRC 4A2NB 1ZHWA 2KJGA 4KBLA 4NCQA 4J32B 2G3KA 2Y3DA 3KH2A 3W8HA 3AG1C 4KNVA 4NY3A 5L0HA 1VLSA 4HE8D 5E3AA 2J9WA 3RQFA 3L8JA 1TFOB 5T1DB 1JPNA 3ABLC 4CIPA 1VK5A 3SXYA 4IARA 4U5EE 4CBEA 1XWJA 2VH3A 2L81A 1RMVA 3HNKA 3QW0A 5L3VA 2P0NA 3B71A 2R7VA 1MMGA 1S05A 1TWAA 3CZ6A 4H54A 4H4KC 2YVKA 2EIKC 1J8MF 3K1IA 1AUEA 2HMZA 4XWJA 4YN0B 3TOLA 3DM9B 3F46A 3ZQVA 2HKVA 4PJJA 5AGFA 3I4UA 1Q0MA 2AP3A 2GFHA 4GEHA 1HE1A 1YA9A 2H7OA 3FMSA 3GM2A 3T4RA 3C18A 3G4XA 2R7RA 2X0CA 5AC4A 2ZXOA 3LAYA 4O6NA 2CNWA 2J0XA 2J0WA 4BJ6C 2IXMA 3QVYA 3X1OA 3SEOA 1AEPA 1M2OA 4JTDB 4XLNF 4CSAC 1LS1A 1QPUA 2UUIA 3JZ0A 4MVMA 3U9JA 2WZGA 3DD7A 3J06A
chains in the Genus database with same CATH topology
1FMWA 1MMNA 1TWHA 2Y39A 3LESA 4MQ9F 4ANJA 1PCXA 5T3TA 1VYKA 1ZHXA 5KYWB 4BJ6A 4OIOF 4E7SA 3QZCA 2IXNA 2R7TA 4G7HF 3LNRA 4LACB 3K1HA 2IXOA 4C3BA 1OKKA 4U5HA 3PHF2 4F4BA 3E9VA 4MNDA 3UGPA 4XLPF 3EGDA 1JPJA 3NRHA 3S27A 2ZXRA 2OG2A 3AG4C 3ASNC 2WZFA 2OCCC 3E70C 3EG9B 4HEAJ 4CS8C 3RYLA 4CS7A 2P7VA 2J45A 1D1CA 2EIJC 3EZHA 4IJJA 4YT4A 3L0IA 4KNWA 3GODA 3MX3A 4QI0A 4C7OB 5B1AC 5B1BC 3EGDB 5HSWA 1OCZC 4K7BA 4CS8A 3DAFA 2NG1A 4I1OB 1WGWA 2E87A 4DBRA 2IXPA 2V3CC 4Q7CA 3W2WA 3S28A 2ZPAA 2R7OA 1SZIA 1SMYF 3DMDA 1D0ZA 4BJ5C 2J9VA 4W8KA 4DOZA 4DVYP 5IY5C 2EILC 4DBQA 1QLEC 5BUOA 3NKDA 4AE4A 4RBNA 1VOMA 2W45A 5L3QA 2QTVA 3UR3C 2R7SA 1TWCA 5F5HA 3I5PA 2A1DD 4BJ5A 2NUTB 1D0YA 2LSEA 2R7WA 5FCLA 2KQ9A 4YT2A 3CQZA 3ASOC 1OCRC 4JJGA 1OKKD 4I3MA 2P6VA 2CGEA 3POVA 1M57C 4AE4B 4O79A 1ZHYA 3B0VC 3OWTA 1FTSA 3NYJA 2A6EF 4C3EA 2FGYA 4U5DE 3EFOA 4FESA 4FX5A 3HJCA 1FFTC 3LEVA 2C04A 3EHMA 3L34A 2XXAA 5DVWA 5KYWA 1PD0A 2NUPA 2R7UA 1MMDA 1O5HA 2M4EA 3JSZA 2QY9A 4U5BE 1FFHA 1MNDA 1W2WA 4HFFB 2FFHA 3EFOB 5DS4A 1ZHZA 1FMVA 4RDAA 2I8BA 2Q3TA 3PMRA 4J30B 2XXAB 1V55C 3EPVA 3FVYA 3AQBA 2Y69C 2L9JA 3EG9A 4G7OF 2NUPB 4OIQF 4CSAA 2MYSA 3RKOF 2JD3A 1D0XA 4EBBA 4HFKB 4PFPA 4X0RA 3CSKA 2D5RB 4YT8A 2YHSA 1ZHTA 4C7OA 2Q9BA 2WB7A 4OD5A 3UGOA 5E2QA 4WJ0A 2CDQA 1Z5ZA 3T6JA 3JT1A 4JZAA 3KL4A 2ZXPA 4G7ZF 3B9QA 1O87A 3FAJA 2C03A 2DGJA 3VYWA 5DQZA 4ZLCA 2WVNA 3JCUQ 3EGXA 4OIPF 1MMAA 4CS9C 4KC9A 4E7ZA 4B6IA 4JURI 2KW3C 2XRHA 1Z6AA 2G62A 4ULWA 5KYYA 1LKXA 4O6YA 3DZAA 3KMIA 1N1CA 1RJ9A 4AX2A 5CI9A 3RFYA 1TR2A 3AG3C 4ZLDA 4BEJA 3ECSA 4LERA 2NUTA 3ITFA 2MWQA 2W4BA 4IRUA 3EH1A 3EGXB 5DLJA 3UMIA 2PP4A 3GANA 3N0TA 5KYYB 3N24A 2WVQA 2WL8A 3HLZA 5T3WA 3FHDA 4OINF 2J7PD 1RJ9B 3O6XA 3ZC4A 4DVZA 2R7XA 4AK9A 1G8XA 4GYTA 4YWQA 4CIHA 4JCHA 1TKNA 2XSEA 1J8YF 3EJNA 2XL4A 3ZG1A 4Q4ZF 5F5FA 3MLGA 2PFDA 3AQCA 1PD1A 2HV6A 1D1BA 4P6IC 1SF8A 3AG2C 2BE5F 1Z63A 2PF4E 2H7BA 3S29A 3K1IC 4YT5A 3ZIBA 3SP1A 1VMAA 4JW1A 2B0JA 1M56C 2A68F 2IOQA 1ZU4A 2J46A 2Z15A 3DJUB 3KKBA 1BR4A 3EHNA 1NU9C 3DJNB 2EIMC 3N2ZB 4C3DA 3TD7A 2A6HF 3DAGA 4IWBA 2V26A 3V7OA 2DYSC 2J9UA 3VAYA 3ABMC 3OEOA 2H7VC 4YJWA 4LLCA 3UMHA 4LLEA 3W2VA 3ZSUA 4XTKA 1D1AA 2J7PA 3B0UX 2W4MA 1ST6A 5B3SC 1LVKA 3M1CB 4I44A 3K6BA 4U5GA 4JJFA 4EWCA 4BJTA 3EZIA 4Q5SF 2Y3BA 5KYNA 5DS6A 5E3CA 2ZXWC 1TWGA 1MNEA 4O7GA 2YZSA 5D92A 2KGOA 5KYXA 3NKEA 2A69F 2Q9AA 3ABKC 4OIRF 3DM5A 1NU7D 3Q6MA 4I1MA 4M63A 3QMKA 2HV7A 5E33A 1Z23A 2IYLD 3NG1A 3W8IA 2G3VA 3S0XA 3JYHA 3K66A 4QI2A 1IZMA 5CI8A 3O39A 3HTKC 5KYXB 3LS1A 4U5CE 2EINC 3NYLA 1V54C 3K33A 2PX3A 5KYUA 2WZLA 3Q7LA 3WODF 2CW0F 4PJMA 1OCCC 4RD9A 4CS9A 1M2VA 1OCOC 1BR2A 4OD4A 4BG0A 3NYMA 2WVOA 3I5QA 4PFOA 3RH3A 1S7ZA 2W9YA 3F47A 5D91A 2Y3HA 4PJNA 3SZRA 5KYUB 4IAOA 2PX0A 3SYNA 1NZEA 1Z3IX 2O9XA 2R7QA 4FWVA 2YEVA 4K0DA 4JVSA 2CNWD 1ZYRF 4PK4A 2Q9CA 3LLKA 2Y3GA 4QDLA 3UNGC 1M2VB 1QZXA 3UMKA 1NG1A 3SNHA 3DXJF 4N06A 3NDBB 3FDQA 1IW7F 1VYIA 3IEEA 5DQTA 3ZVRA 4PJLA 3EH2A 3WG7C 2KNHA 1ZU5A 3K7DA 3OA1A 4U5FE 3X2QC 4G0HA 3LLIA 5EHHA 4KI2A 1KU2A 2X51A 3LS0A 4O6MA 5DS5A 3T6BA 1BR1A 2VASA 2VB6A 3H65A 5EGYA 3B0PA 3EQLF 3JRTA 3LJBA 3Q7GA 3Q6NA 3RIPA 4BJ1A 2DYRC 4A2NB 1ZHWA 2KJGA 4KBLA 4J32B 2G3KA 2Y3DA 3KH2A 3W8HA 3AG1C 4KNVA 4NY3A 5E3AA 4HE8D 2J9WA 5T1DB 1JPNA 3ABLC 1VK5A 4CBEA 4U5EE 2VH3A 2L81A 5L3VA 2R7VA 1MMGA 3CZ6A 1TWAA 4H4KC 2EIKC 1J8MF 4YN0B 4XWJA 3DM9B 3F46A 4PJJA 3I4UA 2GFHA 4GEHA 2H7OA 3T4RA 2R7RA 2ZXOA 3LAYA 4O6NA 2CNWA 2J0XA 2J0WA 4BJ6C 2IXMA 3X1OA 3SEOA 1M2OA 4XLNF 4CSAC 1LS1A 2WZGA 3DD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z15 A;  3DJN B;  5CI8 A;  2D5R B;  3DJU B;  3E9V A;  5CI9 A; 
#chains in the Genus database with same CATH topology
 4NTB A;  1FMW A;  1MMN A;  2NSF A;  5JSL A;  4JIO A;  1T6Q A;  1H7I A;  1TWH A;  2Y39 A;  2R05 A;  3LES A;  4MQ9 F;  4MVU A;  1EI7 A;  4ANJ A;  1PCX A;  4MW3 A;  5T3T A;  1YYJ A;  1XZP A;  2OJQ A;  1VYK A;  1ZHX A;  2OEV A;  4U9E A;  3U3F A;  5KYW B;  2EPM X;  3JYY A;  4BJ6 A;  4OIO F;  3IHU A;  2YL1 A;  5CIV A;  4E7S A;  3QZC A;  3ZQY A;  2IXN A;  4J7Y A;  2R7T A;  4G7H F;  4A4A A;  3LNR A;  2B0H A;  2P1A A;  4LAC B;  3RF3 A;  5BQI A;  4DRH B;  2OEX A;  1SR2 A;  3K1H A;  1HW1 A;  2IXO A;  4C3B A;  3U9M A;  1OKK A;  3US6 A;  4U5H A;  3ZTM A;  3PHF 2;  3C8G D;  4LDK A;  4F4B A;  3E9V A;  2GWW A;  4MND A;  3UGP A;  1CPR A;  1LIH A;  4XLP F;  3EGD A;  2L6F A;  1JPJ A;  1L7C A;  3NRH A;  3S27 A;  3WAQ A;  1C17 M;  5COM A;  2ZXR A;  2OG2 A;  5COG A;  3AG4 C;  4D4X A;  5A6K A;  3C63 A;  3ASN C;  2WZF A;  5JS5 A;  2OCC C;  2QUP A;  1R4T A;  3E70 C;  2L6G A;  2J9B A;  3EG9 B;  1BBH A;  3R2P A;  4HEA J;  4CS8 C;  3RYL A;  1MQV A;  4MVS A;  4CS7 A;  4DRJ B;  2P7V A;  3CAX A;  2J45 A;  1A7E A;  1D1C A;  2EIJ C;  3EZH A;  2XLW A;  4IJJ A;  5FZT A;  2EPK X;  2XLD A;  5L0D A;  4YT4 A;  3L0I A;  2DB4 A;  2AU5 A;  4KNW A;  2YL0 A;  3GOD A;  3MX3 A;  4G78 A;  4QI0 A;  3TJ5 A;  2HFI A;  4CDV A;  4C7O B;  1A41 A;  2GAQ A;  5B1A C;  5B1B C;  3EGD B;  4EBJ A;  5HSW A;  1OCZ C;  4K7B A;  3R7C A;  1YAU O;  4CS8 A;  2XS8 A;  3DAF A;  4JEB A;  1WN0 A;  2NG1 A;  4I1O B;  1WGW A;  1ORS C;  2E87 A;  4Q5S F;  4DBR A;  3MBG A;  2IXP A;  3FOO A;  3U8V A;  2KSF A;  4R32 A;  1H6G A;  4Q7C A;  3W2W A;  3S28 A;  2V3C C;  1AVO B;  2ZPA A;  1I4Z A;  1OW8 A;  2R7O A;  3GEH A;  3M4B A;  1CGO A;  4XPX A;  3CEX A;  3TJ6 A;  1SZI A;  1SMY F;  3FOP A;  2YLD A;  3DMD A;  1D0Z A;  3TOM A;  4BJ5 C;  2J9V A;  4W8K A;  2IBF A;  4DOZ A;  5BQH A;  4DVY P;  5IY5 C;  5L0G A;  4LDR A;  1CPQ A;  2EIL C;  4DBQ A;  1QLE C;  5BUO A;  3NKD A;  1V4A A;  4AE4 A;  4RBN A;  1KTM A;  1VOM A;  2W45 A;  3O10 A;  4EBK A;  5L3Q A;  1YAR O;  1NFN A;  2QTV A;  3B29 A;  3UR3 C;  2R7S A;  1TWC A;  1R5I D;  4JTC B;  2JPU A;  3C8G A;  2GA0 A;  1QQ3 A;  2ICW G;  1JOG A;  5F5H A;  1UG7 A;  4FAP B;  3I5P A;  2A1D D;  2D4U A;  3DE9 A;  4BJ5 A;  2NUT B;  3GEE A;  4UDV A;  3IQ5 A;  1D0Y A;  3IQ6 A;  2OOC A;  2LSE A;  4PAC A;  5GPG B;  2R7W A;  5FCL A;  2KQ9 A;  4YT2 A;  1T6I A;  3CQZ A;  1OQC A;  3ASO C;  2TMV P;  2YKZ A;  1OCR C;  3L1M A;  1OKK D;  4I3M A;  4JJG A;  2I15 A;  2P6V A;  2CGE A;  2LFF A;  1M57 C;  4AE4 B;  3POV A;  1HE9 A;  1C03 A;  2LFD A;  4O79 A;  2NSG A;  1FNT c;  1CGM E;  1ZHY A;  2CYD A;  1LE2 A;  3B0V C;  3OWT A;  1FTS A;  3NYJ A;  2A6E F;  4C3E A;  3C8G B;  1U0B B;  2FGY A;  4U5D E;  4MTG A;  2H8A A;  1RXQ A;  1LPE A;  3EFO A;  4FES A;  1EA8 A;  3V5X A;  4FX5 A;  3BRJ A;  1UFB A;  3HJC A;  3U2M A;  3GOR A;  5A6B A;  1FFT C;  2YL3 A;  3LEV A;  2C04 A;  3EHM A;  4AL0 A;  3U8P A;  3L34 A;  3ZTZ A;  5DVW A;  3H2U A;  5KYW A;  2XXA A;  3ZWI A;  1PD0 A;  4W8P A;  1A0B A;  2VCA A;  3HNL A;  2LQG A;  2NUP A;  3RVZ A;  5L0I A;  4WAB A;  4IAQ A;  4YL0 A;  2R7U A;  1GS9 A;  1MMD A;  1O5H A;  2M4E A;  2A0B A;  3JSZ A;  2XLH A;  4XEV A;  1WWP A;  3HNJ A;  1JRA A;  2QY9 A;  4U5B E;  2ETS A;  3M79 A;  3S90 A;  1FFH A;  1MND A;  1W2W A;  1ZZP A;  3JRM O;  3O55 A;  3AGT A;  3VF0 A;  5EK0 A;  4HFF B;  2FFH A;  3EFO B;  5DS4 A;  1ZHZ A;  1GQA A;  1FMV A;  4RDA A;  2I8B A;  3TQO A;  2Q3T A;  4N4W A;  1HMO A;  4NTA A;  3PMR A;  4J30 B;  3IQC A;  4MVR A;  1V55 C;  2XXA B;  3EPV A;  3FVY A;  4MVO A;  2J8W A;  1GM5 A;  3AQB A;  2Y69 C;  1LS4 A;  2L9J A;  3EG9 A;  4G7O F;  2NUP B;  4OIQ F;  4CSA A;  2MYS A;  5BQG A;  1PV3 A;  3RKO F;  2JD3 A;  5JT4 A;  1D0X A;  4E17 A;  4EBB A;  1WAT A;  4HFK B;  3A9C A;  4PFP A;  2BL2 A;  2KC3 A;  4X0R A;  3CSK A;  2D5R B;  4YT8 A;  2YHS A;  2GDC A;  2RSE B;  1ZHT A;  4C7O A;  2Q9B A;  2WB7 A;  3HKK A;  4OD5 A;  3S84 A;  3UGO A;  5TJ5 E;  5E2Q A;  4WJ0 A;  2CDQ A;  1Z5Z A;  4JC7 A;  3T6J A;  3JT1 A;  1ZW3 A;  3KYJ A;  4JZA A;  3V5Z A;  4BPM A;  3KL4 A;  1F1M A;  2ZXP A;  4G7Z F;  5JP7 A;  3B9Q A;  1O87 A;  3FAJ A;  1NFO A;  2C03 A;  2HSQ A;  2DGJ A;  3VYW A;  1K04 A;  5DQZ A;  2YLG A;  2HJM A;  5L0C A;  3W4Y A;  1OR3 A;  1LI5 A;  4E0I A;  4ZLC A;  5HV9 A;  2WVN A;  2AWC A;  3PDM P;  1B68 A;  3JCU Q;  1DOV A;  5JVE A;  1XZQ A;  3S9O A;  3EGX A;  3ZDL A;  1LM3 B;  4OIP F;  1MMA A;  4CS9 C;  1OR2 A;  4KC9 A;  4E7Z A;  4B6I A;  4JUR I;  1I4Y A;  2KW3 C;  4ULV A;  2XRH A;  2RD9 A;  2XM0 A;  3DWW A;  1Z6A A;  2G62 A;  1QSP A;  1HY5 A;  1JMW A;  1WTY A;  4ULW A;  5KYY A;  1LKX A;  4O6Y A;  3DZA A;  3LNM B;  1RKC A;  3C8Z A;  5A6B D;  3KMI A;  2VC9 A;  3GWN A;  1T5O A;  4MS2 A;  1N1C A;  1RJ9 A;  4AX2 A;  5CI9 A;  2KYH A;  1QKR A;  2LIG A;  4PR9 A;  1TR2 A;  1YZA A;  3AG3 C;  3RFY A;  4BEJ A;  3MYF A;  1RKE B;  4ONS A;  4ZLD A;  1WAS A;  3RQE A;  3ECS A;  4LER A;  3IQT A;  4JTA B;  4NTF A;  2LK4 A;  2NUT A;  2R9R B;  4CJG A;  2Q00 A;  3H2V A;  2QLA A;  1BDJ B;  3ITF A;  2MWQ A;  2W4B A;  3JTL O;  4IRU A;  3EH1 A;  3EGX B;  3KPH A;  5DLJ A;  3JSE O;  3UMI A;  2PP4 A;  3HNI A;  1Q0G A;  3GAN A;  2OKU A;  3L8I A;  4JEA A;  5L0F A;  3N0T A;  5KYY B;  3SXK A;  3N24 A;  4JE9 A;  2WVQ A;  2WL8 A;  3HLZ A;  1RCP A;  1YA7 O;  1QVX A;  5T3W A;  3FHD A;  4OIN F;  2J7P D;  1RJ9 B;  2MHR A;  4L6R A;  3T9O A;  3O6X A;  3ZC4 A;  4DVZ A;  2R7X A;  3C7J A;  4CJO A;  2VCB A;  1HMD A;  3DI5 A;  4AK9 A;  2KK1 A;  1G8X A;  3MYI A;  3SXZ A;  2L7A A;  4GYT A;  4EHP A;  4YWQ A;  4Z9H A;  4CIH A;  2M64 A;  4JCH A;  1TKN A;  3AJM A;  4XPW A;  2XSE A;  1J8Y F;  4GQH A;  2HZ8 A;  3EJN A;  2XL4 A;  5A69 A;  3NMK A;  1OW6 A;  4JKV A;  2EPN A;  3ZG1 A;  4Q4Z F;  5F5F A;  3U3B A;  1DOW A;  4NC3 A;  2XLV A;  3MLG A;  1VLT A;  2PFD A;  3AQC A;  4IB4 A;  1PD1 A;  4DJ9 A;  5A6A A;  4XEF A;  2HV6 A;  1D1B A;  3QW1 A;  2XLE A;  1I5N A;  1Z7Q c;  3GM3 A;  2QNL A;  1U89 A;  4P6I C;  1SF8 A;  3AG2 C;  2BE5 F;  1FAP B;  1Z63 A;  1M6T A;  3IPM O;  2PF4 E;  2OU6 A;  4ER9 A;  2H7B A;  4XQ1 A;  3S29 A;  4E18 A;  1T9K A;  2EPL X;  2YQY A;  1WOL A;  3K1I C;  4MW8 A;  4YT5 A;  3U2L A;  3SP1 A;  3ZIB A;  1VMA A;  3U5S A;  4JW1 A;  2B0J A;  1M56 C;  2A68 F;  2IOQ A;  1ZU4 A;  2J46 A;  2Z15 A;  3DJU B;  1VTM P;  3KKB A;  1BR4 A;  1YJG A;  3EHN A;  1NU9 C;  3DJN B;  2EIM C;  3N2Z B;  1A7D A;  4C3D A;  3U0C A;  3TD7 A;  1G4W R;  2A6H F;  3DAG A;  2Q4F A;  3GEI A;  4IWB A;  4P9T A;  1T01 A;  2V26 A;  3V7O A;  2DYS C;  2J9U A;  3VAY A;  1TFK B;  1ZVZ A;  1NLX A;  4Z9J A;  2UUH A;  3ABM C;  3OEO A;  5JRA A;  2H7V C;  4YJW A;  4LLC A;  3UMH A;  4XEK A;  4LLE A;  3GWL A;  4YL1 A;  3W2V A;  1BZ4 A;  3ZSU A;  4EUK B;  1E85 A;  4XTK A;  1D1A A;  3QTH A;  2J7P A;  4EIY A;  3B0U X;  2W4M A;  1ST6 A;  5B3S C;  5JLI A;  1ORJ A;  1LVK A;  3M1C B;  4I44 A;  1O3U A;  1Q0F A;  3K6B A;  1E84 A;  4JRZ A;  4U5G A;  4JJF A;  4EWC A;  1K40 A;  1OXB A;  4U9D A;  1V74 B;  4N6C A;  4BJT A;  3LUT B;  1CGN A;  3EZI A;  1E2X A;  1U6H A;  4YK5 A;  3RVY A;  4D4N A;  2Y3B A;  5A6J A;  5KYN A;  1HW2 A;  2OQM A;  3ATP A;  1C02 A;  4IGG A;  5DS6 A;  5E3C A;  2ZXW C;  1TWG A;  2EPO A;  1YYX A;  1MNE A;  1OXK A;  3M15 A;  2YZS A;  3NMJ A;  4O7G A;  2KGO A;  4LDQ A;  5D92 A;  3NKE A;  5KYX A;  2A69 F;  2Q9A A;  4N6H A;  1ORY A;  1YZC A;  3ABK C;  3DM5 A;  4OIR F;  1NU7 D;  3Q6M A;  4I1M A;  4MVZ A;  1EQ1 A;  3WHN A;  4M63 A;  2HUJ A;  3QMK A;  2Q7R A;  2HV7 A;  3RQG A;  1G5Z A;  1SYQ A;  2XLM A;  5E33 A;  2F22 A;  1RKE A;  3NMI A;  1Z23 A;  2HJ3 A;  2IYL D;  1LI7 A;  3NG1 A;  4MTF A;  3W8I A;  1NSG B;  2LP4 A;  3BEH A;  2G3V A;  4Z9I A;  3S0X A;  1G4U S;  4MTO A;  4E0H A;  3JYH A;  3LEO A;  5JUA A;  1APC A;  4YL3 A;  3MFN A;  3KYI A;  4WGZ A;  3K66 A;  3V5Y A;  4QI2 A;  1IZM A;  4MVQ A;  4DXW A;  2OJE D;  2QE9 A;  5CI8 A;  3RW0 A;  3O39 A;  2YRF A;  4DRI B;  3HTK C;  5KYX B;  2VCC A;  3LS1 A;  2YWA A;  3DE8 A;  2FAP B;  1H9T A;  4U5C E;  2EIN C;  3NYL A;  1V54 C;  2NPU A;  3K33 A;  2CCY A;  2PX3 A;  2R25 A;  5KYU A;  1A7V A;  3QVZ A;  2WZL A;  1Q0D A;  3Q7L A;  2AWY A;  3WOD F;  5L0J A;  1E83 A;  4EKW A;  3C62 A;  2CW0 F;  4CDY A;  4CX9 A;  4WGY A;  4PJM A;  1ZW2 A;  1OCC C;  3SXM A;  1OW7 A;  3AOU A;  3G4Z A;  4RD9 A;  2BC5 A;  1TQG A;  4CS9 A;  1KNY A;  1M2V A;  2P61 A;  2XL6 A;  2LD6 A;  2R02 A;  2ZD9 A;  2YLI A;  3VRC A;  1Q0K A;  1OCO C;  1BR2 A;  2R03 A;  3GM1 A;  4OD4 A;  1E86 A;  4AL1 A;  2JX0 A;  4BG0 A;  3NYM A;  2WVO A;  3I5Q A;  4PFO A;  4K1O A;  3RH3 A;  1S7Z A;  1YLM A;  2W9Y A;  3F47 A;  3PCV A;  5D91 A;  5F28 E;  1GGQ A;  1NBB A;  3AGU A;  2Y3H A;  4PJN A;  3SZR A;  4P9F A;  5KYU B;  4IAO A;  2PX0 A;  3SYN A;  1L3P A;  2IM8 A;  1JR8 A;  1NZE A;  1Z3I X;  2O9X A;  2R7Q A;  4FWV A;  3T6G B;  3TUL A;  2YEV A;  4K0D A;  1FR0 A;  1Y4C A;  5COF A;  1JAF A;  1LE4 A;  4JVS A;  2CNW D;  1ZYR F;  1YDI A;  3G50 A;  2YL7 A;  2Q9C A;  3LLK A;  4PK4 A;  2Y3G A;  4QDL A;  2DI3 A;  3UNG C;  4CDA A;  2HMQ A;  1M2V B;  3FXH A;  1QZX A;  3UMK A;  1EKY A;  1NG1 A;  3DKA A;  3SNH A;  1K05 A;  3DXJ F;  2A0U A;  2AVK A;  5AC5 A;  2PBE A;  3FAP B;  4N06 A;  3NDB B;  3FDQ A;  1IW7 F;  256B A;  1VYI A;  2XM4 A;  3IEE A;  5DQT A;  3ZVR A;  2HS5 A;  2XL8 A;  4PJL A;  3TK0 A;  1YVI A;  5B3I A;  3EH2 A;  3WG7 C;  2L6H A;  2KNH A;  3A11 A;  1ZU5 A;  4J7T A;  3K7D A;  1T6U A;  2XLO A;  5K0I A;  2XS1 A;  3OA1 A;  1VB5 A;  2PNO A;  4G0H A;  4U5F E;  3LLI A;  3X2Q C;  2ASR A;  1H9G A;  2HSB A;  4BEM J;  4JCZ A;  1KU2 A;  5EHH A;  2X51 A;  3VM6 A;  4KI2 A;  3LS0 A;  3M4C A;  4O6M A;  3T6B A;  5DS5 A;  4NQF A;  1BR1 A;  2VAS A;  2VB6 A;  3H65 A;  5EGY A;  3B0P A;  3EQL F;  3JRT A;  3LJB A;  3Q7G A;  3Q6N A;  4XPY A;  1Y6D A;  2LCH A;  3RIP A;  4BJ1 A;  2DYR C;  4A2N B;  1ZHW A;  2KJG A;  4KBL A;  4NCQ A;  4J32 B;  2G3K A;  2Y3D A;  3KH2 A;  3W8H A;  3AG1 C;  4KNV A;  4NY3 A;  5L0H A;  1VLS A;  4HE8 D;  5E3A A;  2J9W A;  3RQF A;  3L8J A;  1TFO B;  5T1D B;  1JPN A;  3ABL C;  4CIP A;  1VK5 A;  3SXY A;  4IAR A;  4U5E E;  4CBE A;  1XWJ A;  2VH3 A;  2L81 A;  1RMV A;  3HNK A;  3QW0 A;  5L3V A;  2P0N A;  3B71 A;  2R7V A;  1MMG A;  1S05 A;  1TWA A;  3CZ6 A;  4H54 A;  4H4K C;  2YVK A;  2EIK C;  1J8M F;  3K1I A;  1AUE A;  2HMZ A;  4XWJ A;  4YN0 B;  3TOL A;  3DM9 B;  3F46 A;  3ZQV A;  2HKV A;  4PJJ A;  5AGF A;  3I4U A;  1Q0M A;  2AP3 A;  2GFH A;  4GEH A;  1HE1 A;  1YA9 A;  2H7O A;  3FMS A;  3GM2 A;  3T4R A;  3C18 A;  3G4X A;  2R7R A;  2X0C A;  5AC4 A;  2ZXO A;  3LAY A;  4O6N A;  2CNW A;  2J0X A;  2J0W A;  4BJ6 C;  2IXM A;  3QVY A;  3X1O A;  3SEO A;  1AEP A;  1M2O A;  4JTD B;  4XLN F;  4CSA C;  1LS1 A;  1QPU A;  2UUI A;  3JZ0 A;  4MVM A;  3U9J A;  2WZG A;  3DD7 A;  3J06 A; 
#chains in the Genus database with same CATH homology
 1FMW A;  1MMN A;  1TWH A;  2Y39 A;  3LES A;  4MQ9 F;  4ANJ A;  1PCX A;  5T3T A;  1VYK A;  1ZHX A;  5KYW B;  4BJ6 A;  4OIO F;  4E7S A;  3QZC A;  2IXN A;  2R7T A;  4G7H F;  3LNR A;  4LAC B;  3K1H A;  2IXO A;  4C3B A;  1OKK A;  4U5H A;  3PHF 2;  4F4B A;  3E9V A;  4MND A;  3UGP A;  4XLP F;  3EGD A;  1JPJ A;  3NRH A;  3S27 A;  2ZXR A;  2OG2 A;  3AG4 C;  3ASN C;  2WZF A;  2OCC C;  3E70 C;  3EG9 B;  4HEA J;  4CS8 C;  3RYL A;  4CS7 A;  2P7V A;  2J45 A;  1D1C A;  2EIJ C;  3EZH A;  4IJJ A;  4YT4 A;  3L0I A;  4KNW A;  3GOD A;  3MX3 A;  4QI0 A;  4C7O B;  5B1A C;  5B1B C;  3EGD B;  5HSW A;  1OCZ C;  4K7B A;  4CS8 A;  3DAF A;  2NG1 A;  4I1O B;  1WGW A;  2E87 A;  4DBR A;  2IXP A;  2V3C C;  4Q7C A;  3W2W A;  3S28 A;  2ZPA A;  2R7O A;  1SZI A;  1SMY F;  3DMD A;  1D0Z A;  4BJ5 C;  2J9V A;  4W8K A;  4DOZ A;  4DVY P;  5IY5 C;  2EIL C;  4DBQ A;  1QLE C;  5BUO A;  3NKD A;  4AE4 A;  4RBN A;  1VOM A;  2W45 A;  5L3Q A;  2QTV A;  3UR3 C;  2R7S A;  1TWC A;  5F5H A;  3I5P A;  2A1D D;  4BJ5 A;  2NUT B;  1D0Y A;  2LSE A;  2R7W A;  5FCL A;  2KQ9 A;  4YT2 A;  3CQZ A;  3ASO C;  1OCR C;  4JJG A;  1OKK D;  4I3M A;  2P6V A;  2CGE A;  3POV A;  1M57 C;  4AE4 B;  4O79 A;  1ZHY A;  3B0V C;  3OWT A;  1FTS A;  3NYJ A;  2A6E F;  4C3E A;  2FGY A;  4U5D E;  3EFO A;  4FES A;  4FX5 A;  3HJC A;  1FFT C;  3LEV A;  2C04 A;  3EHM A;  3L34 A;  2XXA A;  5DVW A;  5KYW A;  1PD0 A;  2NUP A;  2R7U A;  1MMD A;  1O5H A;  2M4E A;  3JSZ A;  2QY9 A;  4U5B E;  1FFH A;  1MND A;  1W2W A;  4HFF B;  2FFH A;  3EFO B;  5DS4 A;  1ZHZ A;  1FMV A;  4RDA A;  2I8B A;  2Q3T A;  3PMR A;  4J30 B;  2XXA B;  1V55 C;  3EPV A;  3FVY A;  3AQB A;  2Y69 C;  2L9J A;  3EG9 A;  4G7O F;  2NUP B;  4OIQ F;  4CSA A;  2MYS A;  3RKO F;  2JD3 A;  1D0X A;  4EBB A;  4HFK B;  4PFP A;  4X0R A;  3CSK A;  2D5R B;  4YT8 A;  2YHS A;  1ZHT A;  4C7O A;  2Q9B A;  2WB7 A;  4OD5 A;  3UGO A;  5E2Q A;  4WJ0 A;  2CDQ A;  1Z5Z A;  3T6J A;  3JT1 A;  4JZA A;  3KL4 A;  2ZXP A;  4G7Z F;  3B9Q A;  1O87 A;  3FAJ A;  2C03 A;  2DGJ A;  3VYW A;  5DQZ A;  4ZLC A;  2WVN A;  3JCU Q;  3EGX A;  4OIP F;  1MMA A;  4CS9 C;  4KC9 A;  4E7Z A;  4B6I A;  4JUR I;  2KW3 C;  2XRH A;  1Z6A A;  2G62 A;  4ULW A;  5KYY A;  1LKX A;  4O6Y A;  3DZA A;  3KMI A;  1N1C A;  1RJ9 A;  4AX2 A;  5CI9 A;  3RFY A;  1TR2 A;  3AG3 C;  4ZLD A;  4BEJ A;  3ECS A;  4LER A;  2NUT A;  3ITF A;  2MWQ A;  2W4B A;  4IRU A;  3EH1 A;  3EGX B;  5DLJ A;  3UMI A;  2PP4 A;  3GAN A;  3N0T A;  5KYY B;  3N24 A;  2WVQ A;  2WL8 A;  3HLZ A;  5T3W A;  3FHD A;  4OIN F;  2J7P D;  1RJ9 B;  3O6X A;  3ZC4 A;  4DVZ A;  2R7X A;  4AK9 A;  1G8X A;  4GYT A;  4YWQ A;  4CIH A;  4JCH A;  1TKN A;  2XSE A;  1J8Y F;  3EJN A;  2XL4 A;  3ZG1 A;  4Q4Z F;  5F5F A;  3MLG A;  2PFD A;  3AQC A;  1PD1 A;  2HV6 A;  1D1B A;  4P6I C;  1SF8 A;  3AG2 C;  2BE5 F;  1Z63 A;  2PF4 E;  2H7B A;  3S29 A;  3K1I C;  4YT5 A;  3ZIB A;  3SP1 A;  1VMA A;  4JW1 A;  2B0J A;  1M56 C;  2A68 F;  2IOQ A;  1ZU4 A;  2J46 A;  2Z15 A;  3DJU B;  3KKB A;  1BR4 A;  3EHN A;  1NU9 C;  3DJN B;  2EIM C;  3N2Z B;  4C3D A;  3TD7 A;  2A6H F;  3DAG A;  4IWB A;  2V26 A;  3V7O A;  2DYS C;  2J9U A;  3VAY A;  3ABM C;  3OEO A;  2H7V C;  4YJW A;  4LLC A;  3UMH A;  4LLE A;  3W2V A;  3ZSU A;  4XTK A;  1D1A A;  2J7P A;  3B0U X;  2W4M A;  1ST6 A;  5B3S C;  1LVK A;  3M1C B;  4I44 A;  3K6B A;  4U5G A;  4JJF A;  4EWC A;  4BJT A;  3EZI A;  4Q5S F;  2Y3B A;  5KYN A;  5DS6 A;  5E3C A;  2ZXW C;  1TWG A;  1MNE A;  4O7G A;  2YZS A;  5D92 A;  2KGO A;  5KYX A;  3NKE A;  2A69 F;  2Q9A A;  3ABK C;  4OIR F;  3DM5 A;  1NU7 D;  3Q6M A;  4I1M A;  4M63 A;  3QMK A;  2HV7 A;  5E33 A;  1Z23 A;  2IYL D;  3NG1 A;  3W8I A;  2G3V A;  3S0X A;  3JYH A;  3K66 A;  4QI2 A;  1IZM A;  5CI8 A;  3O39 A;  3HTK C;  5KYX B;  3LS1 A;  4U5C E;  2EIN C;  3NYL A;  1V54 C;  3K33 A;  2PX3 A;  5KYU A;  2WZL A;  3Q7L A;  3WOD F;  2CW0 F;  4PJM A;  1OCC C;  4RD9 A;  4CS9 A;  1M2V A;  1OCO C;  1BR2 A;  4OD4 A;  4BG0 A;  3NYM A;  2WVO A;  3I5Q A;  4PFO A;  3RH3 A;  1S7Z A;  2W9Y A;  3F47 A;  5D91 A;  2Y3H A;  4PJN A;  3SZR A;  5KYU B;  4IAO A;  2PX0 A;  3SYN A;  1NZE A;  1Z3I X;  2O9X A;  2R7Q A;  4FWV A;  2YEV A;  4K0D A;  4JVS A;  2CNW D;  1ZYR F;  4PK4 A;  2Q9C A;  3LLK A;  2Y3G A;  4QDL A;  3UNG C;  1M2V B;  1QZX A;  3UMK A;  1NG1 A;  3SNH A;  3DXJ F;  4N06 A;  3NDB B;  3FDQ A;  1IW7 F;  1VYI A;  3IEE A;  5DQT A;  3ZVR A;  4PJL A;  3EH2 A;  3WG7 C;  2KNH A;  1ZU5 A;  3K7D A;  3OA1 A;  4U5F E;  3X2Q C;  4G0H A;  3LLI A;  5EHH A;  4KI2 A;  1KU2 A;  2X51 A;  3LS0 A;  4O6M A;  5DS5 A;  3T6B A;  1BR1 A;  2VAS A;  2VB6 A;  3H65 A;  5EGY A;  3B0P A;  3EQL F;  3JRT A;  3LJB A;  3Q7G A;  3Q6N A;  3RIP A;  4BJ1 A;  2DYR C;  4A2N B;  1ZHW A;  2KJG A;  4KBL A;  4J32 B;  2G3K A;  2Y3D A;  3KH2 A;  3W8H A;  3AG1 C;  4KNV A;  4NY3 A;  5E3A A;  4HE8 D;  2J9W A;  5T1D B;  1JPN A;  3ABL C;  1VK5 A;  4CBE A;  4U5E E;  2VH3 A;  2L81 A;  5L3V A;  2R7V A;  1MMG A;  3CZ6 A;  1TWA A;  4H4K C;  2EIK C;  1J8M F;  4YN0 B;  4XWJ A;  3DM9 B;  3F46 A;  4PJJ A;  3I4U A;  2GFH A;  4GEH A;  2H7O A;  3T4R A;  2R7R A;  2ZXO A;  3LAY A;  4O6N A;  2CNW A;  2J0X A;  2J0W A;  4BJ6 C;  2IXM A;  3X1O A;  3SEO A;  1M2O A;  4XLN F;  4CSA C;  1LS1 A;  2WZG A;  3DD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...