3E9VA

Crystal structure of human b-cell translocation gene 2 (btg2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Protein BTG2
publication title Crystal structure of human B-cell Translocation Gene 2 (BTG2)
rcsb
source organism Homo sapiens
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e9vA00
3DJNB 2Z15A 3DJUB 3E9VA 2D5RB 5CI9A 5CI8A
chains in the Genus database with same CATH superfamily
3DE9A 2JPUA 3BEHA 3TOMA 2Y3HA 1LM3B 1QVXA 2WL8A 2IYLD 1HY5A 1TWAA 3IEEA 3SXYA 1HE1A 1LS4A 1S05A 1Z63A 1ZHWA 3QTHA 4MTFA 1E2XA 5KYUA 4I44A 4DBRA 1EQ1A 3TD7A 3ZQYA 1VLSA 2IXNA 1Z7Qc 4BJ6C 4JC7A 4CIPA 1ZHXA 3GM1A 1D1AA 5EGYA 3B29A 1JMWA 3RYLA 4D4NA 5KYXB 3V5ZA 2J9BA 1BR1A 3RFYA 4G0HA 3JT1A 3GM2A 3K1IC 3U2LA 5L0DA 3FXHA 1B68A 1NU9C 1WOLA 2VCAA 5EK0A 3W8IA 3WODF 3NKEA 4JE9A 3C8GB 3R2PA 2PFDA 3QVYA 2QE9A 1CGNA 1V4AA 2Q3TA 3MLGA 3RKOF 1T6QA 2Z15A 4AE4A 4UDVA 3S0XA 4GQHA 1M2VA 1RJ9B 1ZW2A 2M4EA 2EIKC 2WVNA 5K0IA 5B1AC 4CBEA 4CSAA 2JX0A 2J8WA 4DRJB 3KL4A 4EBJA 3DAGA 2G3KA 3A9CA 3CQZA 3UMIA 3S27A 4B6IA 2I15A 1JR8A 3A11A 1WASA 4CS7A 4U9EA 4DOZA 3UR3C 4YK5A 3SXMA 2NPUA 3POVA 5A6BD 2A0UA 2ZXPA 3AQBA 4O79A 1LPEA 1RXQA 1TFKB 2HMQA 2OCCC 2YEVA 2EPKX 5A6JA 2KNHA 3QMKA 1EI7A 4KNVA 3I5PA 3M4CA 5B1BC 3J06A 2B0HA 3TQOA 2ICWG 3PHF2 4YL3A 1FFTC 3ATPA 2HZ8A 2R25A 2A69F 2IBFA 1XZPA 2JD3A 2XS8A 3GORA 3M15A 2YLGA 4P6IC 4U5BE 2J46A 3H2UA 3V7OA 3HNLA 1WGWA 3KKBA 4O6YA 5KYNA 4NC3A 3UMHA 1ZW3A 3AJMA 1EA8A 2EIMC 2ZXWC 3FOPA 4H4KC 4LACB 2A68F 1MMNA 2HSQA 3NYLA 3FAPB 1OKKD 1QLEC 2WVOA 3BRJA 3ZSUA 4E7ZA 2YL3A 2UUIA 2RD9A 2GDCA 2QTVA 4BG0A 3EZIA 4NTFA 4Q7CA 1Z23A 1TWCA 4ULWA 2XXAB 3HNJA 3VRCA 4AL0A 2L6HA 1S7ZA 2AP3A 2LQGA 4H54A 4JZAA 1I4YA 4YN0B 3RVYA 4DXWA 2NUTA 4PJMA 4BJ5A 4U5DE 1U6HA 2DGJA 3E70C 1LE4A 1VB5A 2MYSA 3DZAA 3JYHA 4YT5A 2XLOA 1DOWA 1Q0FA 1SZIA 3NKDA 2YL7A 4JTDB 3VAYA 1I4ZA 2IOQA 3K33A 1L7CA 2FGYA 1CGME 1C03A 3EHMA 2KW3C 5DS4A 1ZU5A 2Y3GA 3F47A 1YZAA 4MVQA 4IWBA 4YT2A 3NMKA 3O10A 4FWVA 2E87A 3L8IA 5CI9A 4PJLA 3CAXA 4NY3A 1LS1A 2EPMX 2CCYA 4E18A 1ZHYA 2WVQA 4W8KA 3MYIA 1LKXA 2ZPAA 4PFPA 2R7XA 3T6JA 3ZC4A 1GM5A 2Q9AA 3HLZA 3L8JA 4JTAB 2DB4A 3LUTB 5JP7A 1TKNA 2DI3A 1U0BB 2DYRC 1NU7D 1A0BA 3OA1A 2NUPB 4JEBA 4JJFA 4EKWA 2HFIA 2LIGA 3NMIA 4EBBA 4JCZA 3JCUQ 3UGOA 1ZYRF 4OIPF 2MHRA 1FTSA 1CPQA 3EJNA 2P0NA 3X2QC 1YA9A 5T1DB 1OCZC 5JVEA 1FR0A 2GAQA 3DKAA 3EFOB 1SYQA 1N1CA 2PX3A 3C63A 5COMA 4R32A 4CDAA 1Y6DA 2ZD9A 4XPWA 1ORJA 1MQVA 2J0WA 4BJ1A 2OQMA 3B9QA 3G4ZA 3ZTMA 4C3DA 1NLXA 4BPMA 2P1AA 1XWJA 5A6KA 4XEFA 1NBBA 2AU5A 2KJGA 1Q0DA 3EGXB 3VM6A 3H65A 4CIHA 3V5YA 2J9WA 3B0UX 3AG4C 3L0IA 3EZHA 4KBLA 3DJNB 3TJ5A 2KYHA 5JSLA 3K1IA 3K7DA 3F46A 1OXKA 2B0JA 4ONSA 1HW1A 4BEJA 256BA 4RDAA 5DQZA 2X0CA 5KYYB 1H9TA 1WN0A 5COGA 1OW7A 1LI7A 2KGOA 2R02A 3O55A 4YJWA 1A7EA 2Y3DA 3UGPA 2L81A 2C03A 2LFDA 3OEOA 1O5HA 5DVWA 3TOLA 4C7OA 1O3UA 2FFHA 4KC9A 3R7CA 1QQ3A 2F22A 4GYTA 4E17A 2L6GA 2ZXRA 4D4XA 1LVKA 3GANA 2YKZA 3LS0A 1XZQA 3DXJF 3Q6MA 4F4BA 5L0FA 3LEVA 3VF0A 3UMKA 2XS1A 1JPJA 1SF8A 5A69A 4P9TA 1MMAA 3FAJA 1HMDA 4G78A 2VH3A 3RVZA 5IY5C 5KYUB 1YA7O 5T3TA 1Y4CA 1FMVA 2YL1A 3LNRA 4KNWA 4ANJA 2BC5A 2KK1A 3IQCA 2A1DD 2Q7RA 3DJUB 1A7VA 2YLDA 3GEEA 5E3CA 2GFHA 5F28E 3W8HA 5BQHA 4A4AA 3G4XA 5AC4A 1HMOA 2XLVA 2HV7A 5L0HA 4U5GA 4XTKA 2EPOA 3I4UA 2CNWA 1FFHA 4MW3A 4Z9IA 5CIVA 3N2ZB 4I1OB 1DOVA 3U2MA 2R7WA 1JAFA 1M57C 4AE4B 4DVZA 1U89A 4AX2A 4EHPA 4LDQA 1M2VB 1V74B 1TWGA 2G62A 2XLHA 3PCVA 1NZEA 4CS9C 1ORYA 2Y69C 2XL6A 3FMSA 5JLIA 5F5FA 1TFOB 5T3WA 3GM3A 1FMWA 3V5XA 5B3SC 3WG7C 1AVOB 4PACA 2CGEA 4AL1A 3GWNA 3FVYA 1ZU4A 1APCA 4O7GA 3NYJA 1FNTc 1QPUA 2VB6A 3RF3A 3FDQA 4G7OF 4HEAJ 2L9JA 2R7UA 1WATA 4DRHB 1D1BA 2M64A 2YWAA 1OCOC 3W4YA 2J7PA 4J7TA 1NFOA 3KH2A 2QY9A 3MFNA 3RQFA 1SR2A 5DQTA 4W8PA 3U0CA 4XLPF 1IZMA 1OR3A 3JRMO 1VMAA 2C04A 5AC5A 3M79A 1GGQA 4JKVA 1OXBA 1OCCC 5JT4A 3DE8A 3AG2C 1UFBA 4NCQA 1YYXA 2HSBA 3ZDLA 4FAPB 1KTMA 1YYJA 2HJMA 4RD9A 4WGZA 1V54C 4XWJA 3EQLF 5E33A 4IAOA 3W2WA 4WGYA 1PCXA 3WAQA 3DM9B 3KYJA 4Z9HA 3S29A 3FOOA 4DVYP 1RKEA 4YT8A 1QSPA 4MS2A 3RQEA 4WABA 2NUTB 4XLNF 4CX9A 2YQYA 2BL2A 3FHDA 4K7BA 2MWQA 4LDKA 3M4BA 2EPLX 3N24A 4OIRF 2QLAA 2AWCA 1ZVZA 3Q6NA 1CPRA 3IPMO 1TR2A 1YAUO 5L0CA 4JJGA 2GWWA 2IXPA 1V55C 2BE5F 2HKVA 2XM4A 1VOMA 1Z6AA 3LLKA 4O6MA 2CDQA 2XM0A 5AGFA 5D91A 4G7ZF 4ZLDA 3S84A 5B3IA 1BZ4A 2O9XA 3HNKA 2CNWD 3SZRA 2YVKA 4HFKB 4MTOA 1LI5A 4K0DA 4JIOA 1H7IA 1Q0GA 4OD4A 4U5CE 3IQ5A 1JPNA 4BJTA 5L3VA 2XRHA 3U8VA 5HSWA 2YHSA 4MVRA 1M6TA 2IXMA 2A0BA 3WHNA 1NG1A 1MNDA 3LEOA 4MVUA 2HJ3A 3ZWIA 4MVOA 2OJED 3NYMA 1WWPA 4MTGA 3C7JA 1M2OA 3B0VC 1VK5A 2L6FA 3AG1C 3S90A 1J8MF 4NTBA 4AK9A 4U9DA 5KYWA 4PFOA 1D0YA 3LJBA 1PV3A 1AEPA 1OW6A 3C62A 4XPYA 1YARO 3U9MA 4CJOA 4OD5A 3LESA 5A6AA 4G7HF 4XPXA 2I8BA 2J7PD 3I5QA 5D92A 2W9YA 3DI5A 3X1OA 1WTYA 4O6NA 2OU6A 4FX5A 1E86A 2H7VC 3NG1A 1A7DA 2HMZA 2R7TA 2VC9A 1LIHA 2DYSC 4QDLA 3B0PA 4BJ6A 3O6XA 2PNOA 3PDMP 3U3BA 2XLDA 5JS5A 3L1MA 3VYWA 3JYYA 3EG9A 1CGOA 1KNYA 1H6GA 1O87A 3TK0A 3HKKA 3G50A 4NTAA 2TMVP 1K04A 3QVZA 2WZFA 1LE2A 1ZHZA 3GWLA 3UNGC 1PD0A 4IGGA 1D0XA 2OJQA 4E0IA 4C7OB 1HW2A 1RCPA 3AGUA 2OKUA 1E83A 2PP4A 2OEVA 4JVSA 3TULA 1Z5ZA 1KU2A 2YZSA 4N4WA 2LP4A 2YRFA 4EWCA 1D1CA 4U5HA 4N6HA 1OCRC 4CS9A 3N0TA 2EILC 5E2QA 1ST6A 1RKCA 4QI0A 3GEHA 5DS5A 4MW8A 3SXZA 3SNHA 3EH2A 4KI2A 1T6UA 2UUHA 1FAPB 2P6VA 2Y39A 4L6RA 3ZG1A 2W4BA 1BR2A 3K6BA 4X0RA 1EKYA 4CS8C 4IJJA 1BBHA 3SXKA 5JUAA 4MNDA 3LNMB 3GEIA 4YL0A 2A6EF 5FCLA 2RSEB 2J45A 3AOUA 2R7VA 2WZLA 2YL0A 3EGDA 4JRZA 3T9OA 3H2VA 1YJGA 3QZCA 3ASOC 3PMRA 1Q0MA 3GODA 4CJGA 3ABKC 3ABMC 5CI8A 2NG1A 1ZHTA 4LDRA 4JW1A 4C3EA 5EHHA 3ZQVA 4GEHA 5L0GA 3IQTA 2V3CC 5BUOA 2KC3A 3KPHA 4NQFA 3CEXA 4IAQA 3NMJA 5L3QA 3AQCA 3L34A 3LLIA 3Q7GA 1K05A 2R05A 2EINC 3ABLC 1NSGB 4J32B 2Y3BA 4U5FE 5BQGA 4U5EE 4ER9A 4LLCA 2X51A 2VASA 3U3FA 3KMIA 4DBQA 1VYIA 2EIJC 3RIPA 3SP1A 4FESA 3M1CB 5KYXA 3JSZA 2A6HF 1SMYF 2FAPB 2H8AA 5DLJA 4EIYA 2PF4E 3HJCA 4ULVA 4OIQF 1GQAA 2OEXA 1W2WA 2AWYA 2D5RB 2P7VA 3C8GA 2GA0A 2XL8A 4J7YA 4M63A 2HV6A 1HE9A 3TJ6A 2Q9BA 4Q5SF 2LCHA 4PJNA 2NSFA 4PR9A 2KSFA 3U5SA 4N6CA 3T6GB 1RJ9A 3MX3A 1G8XA 1D0ZA 1H9GA 3HTKC 2YLIA 2HUJA 3ZIBA 4YWQA 2J9UA 1T9KA 2CYDA 2OG2A 4JURI 3SEOA 5E3AA 4MVZA 5L0IA 2ZXOA 1C17M 4DJ9A 1RKEB 3DWWA 1I5NA 4XEKA 5COFA 1QZXA 2Q9CA 4IB4A 4K1OA 5BQIA 2HS5A 1AUEA 1G5ZA 1NFNA 1Q0KA 2LSEA 3IQ6A 2CW0F 4Q4ZF 2XLEA 1OW8A 3QW0A 1E84A 3AGTA 1T6IA 4BEMJ 5HV9A 3K66A 3QW1A 2WB7A 2Q4FA 4XEVA 1K40A 4I3MA 3JSEO 3U9JA 4P9FA 3RW0A 5L0JA 3NDBB 1JRAA 2PX0A 4CSAC 3IHUA 4JCHA 4LLEA 4J30B 2ETSA 1QKRA 1VTMP 3OWTA 4OIOF 3JTLO 1OR2A 1ZZPA 5DS6A 5JRAA 2R7RA 2R03A 4RBNA 4LERA 4JEAA 2XXAA 2NSGA 2IXOA 2OOCA 5GPGB 4PK4A 2XSEA 4IRUA 4N06A 1OQCA 1RMVA 3C18A 3LS1A 2W4MA 2V26A 4QI2A 3E9VA 4MVSA 5KYWB 2QNLA 3US6A 3ECSA 3JRTA 2R7QA 3LAYA 1J8YF 1L3PA 3EH1A 2D4UA 4CDVA 2J9VA 1IW7F 1MMDA 3JZ0A 1MMGA 1YZCA 3ASNC 3DD7A 4EBKA 1C02A 3RH3A 3CSKA 1UG7A 1G4US 3DAFA 5FZTA 3C8GD 4PJJA 2KQ9A 4CS8A 2LK4A 1G4WR 1ORSC 4XQ1A 1PD1A 2R7OA 2XLMA 4A2NB 2AVKA 3DM5A 4EUKB 3EG9B 3Q7LA 4HE8D 2R9RB 3MBGA 1JOGA 1BDJB 3W2VA 1VLTA 2NUPA 3EHNA 4WJ0A 1A41A 4YT4A 2H7BA 1YLMA 3O39A 3AG3C 2J0XA 1T5OA 3B71A 2XL4A 4MVMA 1BR4A 3T4RA 3S9OA 4BJ5C 2G3VA 2P61A 3EFOA 3KYIA 1TWHA 3RQGA 3CZ6A 4E7SA 3SYNA 4MQ9F 2IM8A 3S28A 2ASRA 4JTCB 4Z9JA 5F5HA 4YL1A 1Z3IX 3ZVRA 1MNEA 2XLWA 5A6BA 3NRHA 2W45A 3ITFA 4I1MA 2H7OA 4C3BA 4HFFB 1R4TA 1YDIA 1R5ID 2VCCA 4IARA 3EGXA 4CDYA 1YVIA 3K1HA 3MYFA 4OINF 3T6BA 2QUPA 2Q00A 2VCBA 3DMDA 3C8ZA 3EGDB 3EPVA 1TQGA 2PBEA 1VYKA 5TJ5E 2WZGA 4DRIB 1E85A 1M56C 2EPNA 1F1MA 5KYYA 4E0HA 4ZLCA 3HNIA 3ZTZA 2L7AA 1GS9A 2R7SA 2LFFA 2LD6A 1OKKA 1T01A 3U8PA
chains in the Genus database with same CATH topology
2Y3HA 2WL8A 2IYLD 1TWAA 3IEEA 1Z63A 1ZHWA 5KYUA 4I44A 4DBRA 3TD7A 4BJ6C 2IXNA 1ZHXA 1D1AA 5EGYA 3RYLA 5KYXB 3RFYA 1BR1A 4G0HA 3JT1A 3K1IC 3W8IA 1NU9C 3WODF 3NKEA 2PFDA 2Q3TA 3MLGA 3RKOF 2Z15A 4AE4A 3S0XA 1M2VA 1RJ9B 2M4EA 2EIKC 2WVNA 5B1AC 4CBEA 4CSAA 3KL4A 2G3KA 3CQZA 3UMIA 3S27A 4B6IA 4CS7A 4DOZA 3UR3C 3POVA 2ZXPA 3AQBA 2YEVA 2OCCC 2KNHA 3QMKA 4KNVA 3I5PA 5B1BC 3PHF2 1FFTC 2A69F 2JD3A 4P6IC 4U5BE 2J46A 3V7OA 1WGWA 3KKBA 4O6YA 5KYNA 3UMHA 4H4KC 2EIMC 4LACB 2ZXWC 2A68F 1MMNA 3NYLA 3ZSUA 1OKKD 1QLEC 2WVOA 4E7ZA 2QTVA 4BG0A 3EZIA 4Q7CA 1Z23A 1TWCA 4ULWA 2XXAB 1S7ZA 4JZAA 4YN0B 2NUTA 4PJMA 4BJ5A 4U5DE 3E70C 2DGJA 3JYHA 2MYSA 3DZAA 4YT5A 1SZIA 3NKDA 3VAYA 2IOQA 3K33A 2FGYA 3EHMA 5DS4A 2KW3C 1ZU5A 2Y3GA 3F47A 4IWBA 4YT2A 4FWVA 2E87A 5CI9A 4PJLA 4NY3A 1LS1A 1ZHYA 2WVQA 4W8KA 1LKXA 2ZPAA 4PFPA 3T6JA 3ZC4A 2Q9AA 3HLZA 1TKNA 2DYRC 1NU7D 3OA1A 4JJFA 2NUPB 4EBBA 4OIPF 3JCUQ 3UGOA 1ZYRF 1FTSA 3EJNA 3X2QC 5T1DB 1OCZC 3EFOB 1N1CA 2PX3A 2J0WA 4BJ1A 3B9QA 4C3DA 2KJGA 3EGXB 4CIHA 3H65A 2J9WA 3B0UX 3AG4C 3L0IA 3EZHA 4KBLA 3DJNB 3K7DA 3F46A 2B0JA 4BEJA 4RDAA 5DQZA 5KYYB 2KGOA 4YJWA 3UGPA 2Y3DA 2L81A 2C03A 3OEOA 5DVWA 1O5HA 4C7OA 2FFHA 4KC9A 4GYTA 2ZXRA 1LVKA 3GANA 3LS0A 3Q6MA 3DXJF 4F4BA 3LEVA 3UMKA 1JPJA 1SF8A 1MMAA 3FAJA 2VH3A 5KYUB 5IY5C 5T3TA 1FMVA 3LNRA 4KNWA 4ANJA 2A1DD 3DJUB 3W8HA 5E3CA 2GFHA 2HV7A 4U5GA 4XTKA 3I4UA 2CNWA 1FFHA 3N2ZB 4I1OB 2R7WA 1M57C 4AE4B 4DVZA 4AX2A 1M2VB 2G62A 1TWGA 1NZEA 4CS9C 2Y69C 1OKKA 5F5FA 5T3WA 1FMWA 5B3SC 3WG7C 2CGEA 3FVYA 1ZU4A 4O7GA 3NYJA 2VB6A 3FDQA 4G7OF 2R7UA 4HEAJ 2L9JA 1D1BA 1OCOC 2J7PA 3KH2A 2QY9A 5DQTA 4XLPF 1IZMA 1VMAA 2C04A 1OCCC 3AG2C 4RD9A 1V54C 4XWJA 3EQLF 5E33A 4IAOA 3W2WA 1PCXA 3DM9B 4DVYP 3S29A 4YT8A 4XLNF 2NUTB 3FHDA 4K7BA 2MWQA 3N24A 4OIRF 3Q6NA 1TR2A 4JJGA 4O6MA 2IXPA 1V55C 2BE5F 3LLKA 1VOMA 1Z6AA 5D91A 4G7ZF 2CDQA 4ZLDA 2O9XA 2CNWD 3SZRA 4HFKB 4K0DA 4OD4A 4U5CE 1JPNA 4BJTA 5L3VA 2XRHA 5HSWA 2YHSA 2IXMA 1NG1A 1MNDA 3NYMA 1M2OA 3B0VC 1VK5A 3AG1C 1J8MF 4AK9A 5KYWA 4PFOA 1D0YA 3LJBA 4OD5A 3LESA 4G7HF 2I8BA 2J7PD 3I5QA 5D92A 2W9YA 3X1OA 4O6NA 4FX5A 2H7VC 3NG1A 2R7TA 2DYSC 4QDLA 3B0PA 4BJ6A 3O6XA 3VYWA 3EG9A 1O87A 2WZFA 1ZHZA 3UNGC 1PD0A 4C7OB 1D0XA 2PP4A 4JVSA 1Z5ZA 1KU2A 2YZSA 4EWCA 1D1CA 4U5HA 4CS9A 1OCRC 3N0TA 2EILC 5E2QA 1ST6A 5DS5A 4QI0A 3SNHA 3EH2A 4KI2A 2P6VA 2Y39A 3ZG1A 2W4BA 1BR2A 3K6BA 4X0RA 4CS8C 4IJJA 4MNDA 5FCLA 2A6EF 2R7VA 2J45A 2WZLA 3EGDA 3QZCA 3ASOC 3PMRA 3GODA 3ABKC 3ABMC 5CI8A 2NG1A 1ZHTA 5EHHA 4JW1A 4C3EA 4GEHA 2V3CC 5BUOA 5L3QA 3AQCA 3L34A 3LLIA 3Q7GA 3ABLC 4O79A 2EINC 4J32B 2R7XA 2Y3BA 4U5FE 4U5EE 4LLCA 2X51A 2VASA 3KMIA 4DBQA 1VYIA 2EIJC 3RIPA 3SP1A 4FESA 3M1CB 5KYXA 3JSZA 2A6HF 1SMYF 5DLJA 2PF4E 3HJCA 4OIQF 1W2WA 2D5RB 2P7VA 4M63A 2HV6A 2Q9BA 4Q5SF 4PJNA 1RJ9A 3MX3A 1G8XA 1D0ZA 3HTKC 3ZIBA 4YWQA 2J9UA 2OG2A 3SEOA 4JURI 5E3AA 2ZXOA 1QZXA 2Q9CA 2LSEA 2CW0F 4Q4ZF 3K66A 2WB7A 4I3MA 3NDBB 2PX0A 4CSAC 4JCHA 4LLEA 4J30B 3OWTA 4OIOF 5DS6A 2R7RA 4RBNA 4LERA 2XXAA 2IXOA 4PK4A 2XSEA 4IRUA 4N06A 3LS1A 2W4MA 2V26A 4QI2A 3E9VA 5KYWB 3ECSA 3JRTA 2R7QA 3LAYA 1J8YF 3EH1A 2J9VA 1IW7F 1MMDA 1MMGA 3ASNC 3DD7A 3RH3A 3CSKA 3DAFA 4PJJA 2KQ9A 4CS8A 1PD1A 2R7OA 4A2NB 3DM5A 3EG9B 3Q7LA 4HE8D 3W2VA 2NUPA 3EHNA 4WJ0A 4YT4A 2H7BA 3O39A 3AG3C 2J0XA 4BJ5C 2XL4A 3T4RA 1BR4A 2G3VA 3EFOA 1TWHA 4E7SA 3CZ6A 3SYNA 4MQ9F 3S28A 5F5HA 1Z3IX 3ZVRA 1MNEA 3NRHA 2W45A 3ITFA 4I1MA 2H7OA 4C3BA 4HFFB 3EGXA 3K1HA 3T6BA 4OINF 3DMDA 3EGDB 3EPVA 1VYKA 2WZGA 1M56C 5KYYA 4ZLCA 2R7SA 3DAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJN B;  2Z15 A;  3DJU B;  3E9V A;  2D5R B;  5CI9 A;  5CI8 A; 
#chains in the Genus database with same CATH topology
 3DE9 A;  2JPU A;  3BEH A;  3TOM A;  2Y3H A;  1LM3 B;  1QVX A;  2WL8 A;  2IYL D;  1HY5 A;  1TWA A;  3IEE A;  3SXY A;  1HE1 A;  1LS4 A;  1S05 A;  1Z63 A;  1ZHW A;  3QTH A;  4MTF A;  1E2X A;  5KYU A;  4I44 A;  4DBR A;  1EQ1 A;  3TD7 A;  3ZQY A;  1VLS A;  2IXN A;  1Z7Q c;  4BJ6 C;  4JC7 A;  4CIP A;  1ZHX A;  3GM1 A;  1D1A A;  5EGY A;  3B29 A;  1JMW A;  3RYL A;  4D4N A;  5KYX B;  3V5Z A;  2J9B A;  1BR1 A;  3RFY A;  4G0H A;  3JT1 A;  3GM2 A;  3K1I C;  3U2L A;  5L0D A;  3FXH A;  1B68 A;  1NU9 C;  1WOL A;  2VCA A;  5EK0 A;  3W8I A;  3WOD F;  3NKE A;  4JE9 A;  3C8G B;  3R2P A;  2PFD A;  3QVY A;  2QE9 A;  1CGN A;  1V4A A;  2Q3T A;  3MLG A;  3RKO F;  1T6Q A;  2Z15 A;  4AE4 A;  4UDV A;  3S0X A;  4GQH A;  1M2V A;  1RJ9 B;  1ZW2 A;  2M4E A;  2EIK C;  2WVN A;  5K0I A;  5B1A C;  4CBE A;  4CSA A;  2JX0 A;  2J8W A;  4DRJ B;  3KL4 A;  4EBJ A;  3DAG A;  2G3K A;  3A9C A;  3CQZ A;  3UMI A;  3S27 A;  4B6I A;  2I15 A;  1JR8 A;  3A11 A;  1WAS A;  4CS7 A;  4U9E A;  4DOZ A;  3UR3 C;  4YK5 A;  3SXM A;  2NPU A;  3POV A;  5A6B D;  2A0U A;  2ZXP A;  3AQB A;  4O79 A;  1LPE A;  1RXQ A;  1TFK B;  2HMQ A;  2OCC C;  2YEV A;  2EPK X;  5A6J A;  2KNH A;  3QMK A;  1EI7 A;  4KNV A;  3I5P A;  3M4C A;  5B1B C;  3J06 A;  2B0H A;  3TQO A;  2ICW G;  3PHF 2;  4YL3 A;  1FFT C;  3ATP A;  2HZ8 A;  2R25 A;  2A69 F;  2IBF A;  1XZP A;  2JD3 A;  2XS8 A;  3GOR A;  3M15 A;  2YLG A;  4P6I C;  4U5B E;  2J46 A;  3H2U A;  3V7O A;  3HNL A;  1WGW A;  3KKB A;  4O6Y A;  5KYN A;  4NC3 A;  3UMH A;  1ZW3 A;  3AJM A;  1EA8 A;  2EIM C;  2ZXW C;  3FOP A;  4H4K C;  4LAC B;  2A68 F;  1MMN A;  2HSQ A;  3NYL A;  3FAP B;  1OKK D;  1QLE C;  2WVO A;  3BRJ A;  3ZSU A;  4E7Z A;  2YL3 A;  2UUI A;  2RD9 A;  2GDC A;  2QTV A;  4BG0 A;  3EZI A;  4NTF A;  4Q7C A;  1Z23 A;  1TWC A;  4ULW A;  2XXA B;  3HNJ A;  3VRC A;  4AL0 A;  2L6H A;  1S7Z A;  2AP3 A;  2LQG A;  4H54 A;  4JZA A;  1I4Y A;  4YN0 B;  3RVY A;  4DXW A;  2NUT A;  4PJM A;  4BJ5 A;  4U5D E;  1U6H A;  2DGJ A;  3E70 C;  1LE4 A;  1VB5 A;  2MYS A;  3DZA A;  3JYH A;  4YT5 A;  2XLO A;  1DOW A;  1Q0F A;  1SZI A;  3NKD A;  2YL7 A;  4JTD B;  3VAY A;  1I4Z A;  2IOQ A;  3K33 A;  1L7C A;  2FGY A;  1CGM E;  1C03 A;  3EHM A;  2KW3 C;  5DS4 A;  1ZU5 A;  2Y3G A;  3F47 A;  1YZA A;  4MVQ A;  4IWB A;  4YT2 A;  3NMK A;  3O10 A;  4FWV A;  2E87 A;  3L8I A;  5CI9 A;  4PJL A;  3CAX A;  4NY3 A;  1LS1 A;  2EPM X;  2CCY A;  4E18 A;  1ZHY A;  2WVQ A;  4W8K A;  3MYI A;  1LKX A;  2ZPA A;  4PFP A;  2R7X A;  3T6J A;  3ZC4 A;  1GM5 A;  2Q9A A;  3HLZ A;  3L8J A;  4JTA B;  2DB4 A;  3LUT B;  5JP7 A;  1TKN A;  2DI3 A;  1U0B B;  2DYR C;  1NU7 D;  1A0B A;  3OA1 A;  2NUP B;  4JEB A;  4JJF A;  4EKW A;  2HFI A;  2LIG A;  3NMI A;  4EBB A;  4JCZ A;  3JCU Q;  3UGO A;  1ZYR F;  4OIP F;  2MHR A;  1FTS A;  1CPQ A;  3EJN A;  2P0N A;  3X2Q C;  1YA9 A;  5T1D B;  1OCZ C;  5JVE A;  1FR0 A;  2GAQ A;  3DKA A;  3EFO B;  1SYQ A;  1N1C A;  2PX3 A;  3C63 A;  5COM A;  4R32 A;  4CDA A;  1Y6D A;  2ZD9 A;  4XPW A;  1ORJ A;  1MQV A;  2J0W A;  4BJ1 A;  2OQM A;  3B9Q A;  3G4Z A;  3ZTM A;  4C3D A;  1NLX A;  4BPM A;  2P1A A;  1XWJ A;  5A6K A;  4XEF A;  1NBB A;  2AU5 A;  2KJG A;  1Q0D A;  3EGX B;  3VM6 A;  3H65 A;  4CIH A;  3V5Y A;  2J9W A;  3B0U X;  3AG4 C;  3L0I A;  3EZH A;  4KBL A;  3DJN B;  3TJ5 A;  2KYH A;  5JSL A;  3K1I A;  3K7D A;  3F46 A;  1OXK A;  2B0J A;  4ONS A;  1HW1 A;  4BEJ A;  256B A;  4RDA A;  5DQZ A;  2X0C A;  5KYY B;  1H9T A;  1WN0 A;  5COG A;  1OW7 A;  1LI7 A;  2KGO A;  2R02 A;  3O55 A;  4YJW A;  1A7E A;  2Y3D A;  3UGP A;  2L81 A;  2C03 A;  2LFD A;  3OEO A;  1O5H A;  5DVW A;  3TOL A;  4C7O A;  1O3U A;  2FFH A;  4KC9 A;  3R7C A;  1QQ3 A;  2F22 A;  4GYT A;  4E17 A;  2L6G A;  2ZXR A;  4D4X A;  1LVK A;  3GAN A;  2YKZ A;  3LS0 A;  1XZQ A;  3DXJ F;  3Q6M A;  4F4B A;  5L0F A;  3LEV A;  3VF0 A;  3UMK A;  2XS1 A;  1JPJ A;  1SF8 A;  5A69 A;  4P9T A;  1MMA A;  3FAJ A;  1HMD A;  4G78 A;  2VH3 A;  3RVZ A;  5IY5 C;  5KYU B;  1YA7 O;  5T3T A;  1Y4C A;  1FMV A;  2YL1 A;  3LNR A;  4KNW A;  4ANJ A;  2BC5 A;  2KK1 A;  3IQC A;  2A1D D;  2Q7R A;  3DJU B;  1A7V A;  2YLD A;  3GEE A;  5E3C A;  2GFH A;  5F28 E;  3W8H A;  5BQH A;  4A4A A;  3G4X A;  5AC4 A;  1HMO A;  2XLV A;  2HV7 A;  5L0H A;  4U5G A;  4XTK A;  2EPO A;  3I4U A;  2CNW A;  1FFH A;  4MW3 A;  4Z9I A;  5CIV A;  3N2Z B;  4I1O B;  1DOV A;  3U2M A;  2R7W A;  1JAF A;  1M57 C;  4AE4 B;  4DVZ A;  1U89 A;  4AX2 A;  4EHP A;  4LDQ A;  1M2V B;  1V74 B;  1TWG A;  2G62 A;  2XLH A;  3PCV A;  1NZE A;  4CS9 C;  1ORY A;  2Y69 C;  2XL6 A;  3FMS A;  5JLI A;  5F5F A;  1TFO B;  5T3W A;  3GM3 A;  1FMW A;  3V5X A;  5B3S C;  3WG7 C;  1AVO B;  4PAC A;  2CGE A;  4AL1 A;  3GWN A;  3FVY A;  1ZU4 A;  1APC A;  4O7G A;  3NYJ A;  1FNT c;  1QPU A;  2VB6 A;  3RF3 A;  3FDQ A;  4G7O F;  4HEA J;  2L9J A;  2R7U A;  1WAT A;  4DRH B;  1D1B A;  2M64 A;  2YWA A;  1OCO C;  3W4Y A;  2J7P A;  4J7T A;  1NFO A;  3KH2 A;  2QY9 A;  3MFN A;  3RQF A;  1SR2 A;  5DQT A;  4W8P A;  3U0C A;  4XLP F;  1IZM A;  1OR3 A;  3JRM O;  1VMA A;  2C04 A;  5AC5 A;  3M79 A;  1GGQ A;  4JKV A;  1OXB A;  1OCC C;  5JT4 A;  3DE8 A;  3AG2 C;  1UFB A;  4NCQ A;  1YYX A;  2HSB A;  3ZDL A;  4FAP B;  1KTM A;  1YYJ A;  2HJM A;  4RD9 A;  4WGZ A;  1V54 C;  4XWJ A;  3EQL F;  5E33 A;  4IAO A;  3W2W A;  4WGY A;  1PCX A;  3WAQ A;  3DM9 B;  3KYJ A;  4Z9H A;  3S29 A;  3FOO A;  4DVY P;  1RKE A;  4YT8 A;  1QSP A;  4MS2 A;  3RQE A;  4WAB A;  2NUT B;  4XLN F;  4CX9 A;  2YQY A;  2BL2 A;  3FHD A;  4K7B A;  2MWQ A;  4LDK A;  3M4B A;  2EPL X;  3N24 A;  4OIR F;  2QLA A;  2AWC A;  1ZVZ A;  3Q6N A;  1CPR A;  3IPM O;  1TR2 A;  1YAU O;  5L0C A;  4JJG A;  2GWW A;  2IXP A;  1V55 C;  2BE5 F;  2HKV A;  2XM4 A;  1VOM A;  1Z6A A;  3LLK A;  4O6M A;  2CDQ A;  2XM0 A;  5AGF A;  5D91 A;  4G7Z F;  4ZLD A;  3S84 A;  5B3I A;  1BZ4 A;  2O9X A;  3HNK A;  2CNW D;  3SZR A;  2YVK A;  4HFK B;  4MTO A;  1LI5 A;  4K0D A;  4JIO A;  1H7I A;  1Q0G A;  4OD4 A;  4U5C E;  3IQ5 A;  1JPN A;  4BJT A;  5L3V A;  2XRH A;  3U8V A;  5HSW A;  2YHS A;  4MVR A;  1M6T A;  2IXM A;  2A0B A;  3WHN A;  1NG1 A;  1MND A;  3LEO A;  4MVU A;  2HJ3 A;  3ZWI A;  4MVO A;  2OJE D;  3NYM A;  1WWP A;  4MTG A;  3C7J A;  1M2O A;  3B0V C;  1VK5 A;  2L6F A;  3AG1 C;  3S90 A;  1J8M F;  4NTB A;  4AK9 A;  4U9D A;  5KYW A;  4PFO A;  1D0Y A;  3LJB A;  1PV3 A;  1AEP A;  1OW6 A;  3C62 A;  4XPY A;  1YAR O;  3U9M A;  4CJO A;  4OD5 A;  3LES A;  5A6A A;  4G7H F;  4XPX A;  2I8B A;  2J7P D;  3I5Q A;  5D92 A;  2W9Y A;  3DI5 A;  3X1O A;  1WTY A;  4O6N A;  2OU6 A;  4FX5 A;  1E86 A;  2H7V C;  3NG1 A;  1A7D A;  2HMZ A;  2R7T A;  2VC9 A;  1LIH A;  2DYS C;  4QDL A;  3B0P A;  4BJ6 A;  3O6X A;  2PNO A;  3PDM P;  3U3B A;  2XLD A;  5JS5 A;  3L1M A;  3VYW A;  3JYY A;  3EG9 A;  1CGO A;  1KNY A;  1H6G A;  1O87 A;  3TK0 A;  3HKK A;  3G50 A;  4NTA A;  2TMV P;  1K04 A;  3QVZ A;  2WZF A;  1LE2 A;  1ZHZ A;  3GWL A;  3UNG C;  1PD0 A;  4IGG A;  1D0X A;  2OJQ A;  4E0I A;  4C7O B;  1HW2 A;  1RCP A;  3AGU A;  2OKU A;  1E83 A;  2PP4 A;  2OEV A;  4JVS A;  3TUL A;  1Z5Z A;  1KU2 A;  2YZS A;  4N4W A;  2LP4 A;  2YRF A;  4EWC A;  1D1C A;  4U5H A;  4N6H A;  1OCR C;  4CS9 A;  3N0T A;  2EIL C;  5E2Q A;  1ST6 A;  1RKC A;  4QI0 A;  3GEH A;  5DS5 A;  4MW8 A;  3SXZ A;  3SNH A;  3EH2 A;  4KI2 A;  1T6U A;  2UUH A;  1FAP B;  2P6V A;  2Y39 A;  4L6R A;  3ZG1 A;  2W4B A;  1BR2 A;  3K6B A;  4X0R A;  1EKY A;  4CS8 C;  4IJJ A;  1BBH A;  3SXK A;  5JUA A;  4MND A;  3LNM B;  3GEI A;  4YL0 A;  2A6E F;  5FCL A;  2RSE B;  2J45 A;  3AOU A;  2R7V A;  2WZL A;  2YL0 A;  3EGD A;  4JRZ A;  3T9O A;  3H2V A;  1YJG A;  3QZC A;  3ASO C;  3PMR A;  1Q0M A;  3GOD A;  4CJG A;  3ABK C;  3ABM C;  5CI8 A;  2NG1 A;  1ZHT A;  4LDR A;  4JW1 A;  4C3E A;  5EHH A;  3ZQV A;  4GEH A;  5L0G A;  3IQT A;  2V3C C;  5BUO A;  2KC3 A;  3KPH A;  4NQF A;  3CEX A;  4IAQ A;  3NMJ A;  5L3Q A;  3AQC A;  3L34 A;  3LLI A;  3Q7G A;  1K05 A;  2R05 A;  2EIN C;  3ABL C;  1NSG B;  4J32 B;  2Y3B A;  4U5F E;  5BQG A;  4U5E E;  4ER9 A;  4LLC A;  2X51 A;  2VAS A;  3U3F A;  3KMI A;  4DBQ A;  1VYI A;  2EIJ C;  3RIP A;  3SP1 A;  4FES A;  3M1C B;  5KYX A;  3JSZ A;  2A6H F;  1SMY F;  2FAP B;  2H8A A;  5DLJ A;  4EIY A;  2PF4 E;  3HJC A;  4ULV A;  4OIQ F;  1GQA A;  2OEX A;  1W2W A;  2AWY A;  2D5R B;  2P7V A;  3C8G A;  2GA0 A;  2XL8 A;  4J7Y A;  4M63 A;  2HV6 A;  1HE9 A;  3TJ6 A;  2Q9B A;  4Q5S F;  2LCH A;  4PJN A;  2NSF A;  4PR9 A;  2KSF A;  3U5S A;  4N6C A;  3T6G B;  1RJ9 A;  3MX3 A;  1G8X A;  1D0Z A;  1H9G A;  3HTK C;  2YLI A;  2HUJ A;  3ZIB A;  4YWQ A;  2J9U A;  1T9K A;  2CYD A;  2OG2 A;  4JUR I;  3SEO A;  5E3A A;  4MVZ A;  5L0I A;  2ZXO A;  1C17 M;  4DJ9 A;  1RKE B;  3DWW A;  1I5N A;  4XEK A;  5COF A;  1QZX A;  2Q9C A;  4IB4 A;  4K1O A;  5BQI A;  2HS5 A;  1AUE A;  1G5Z A;  1NFN A;  1Q0K A;  2LSE A;  3IQ6 A;  2CW0 F;  4Q4Z F;  2XLE A;  1OW8 A;  3QW0 A;  1E84 A;  3AGT A;  1T6I A;  4BEM J;  5HV9 A;  3K66 A;  3QW1 A;  2WB7 A;  2Q4F A;  4XEV A;  1K40 A;  4I3M A;  3JSE O;  3U9J A;  4P9F A;  3RW0 A;  5L0J A;  3NDB B;  1JRA A;  2PX0 A;  4CSA C;  3IHU A;  4JCH A;  4LLE A;  4J30 B;  2ETS A;  1QKR A;  1VTM P;  3OWT A;  4OIO F;  3JTL O;  1OR2 A;  1ZZP A;  5DS6 A;  5JRA A;  2R7R A;  2R03 A;  4RBN A;  4LER A;  4JEA A;  2XXA A;  2NSG A;  2IXO A;  2OOC A;  5GPG B;  4PK4 A;  2XSE A;  4IRU A;  4N06 A;  1OQC A;  1RMV A;  3C18 A;  3LS1 A;  2W4M A;  2V26 A;  4QI2 A;  3E9V A;  4MVS A;  5KYW B;  2QNL A;  3US6 A;  3ECS A;  3JRT A;  2R7Q A;  3LAY A;  1J8Y F;  1L3P A;  3EH1 A;  2D4U A;  4CDV A;  2J9V A;  1IW7 F;  1MMD A;  3JZ0 A;  1MMG A;  1YZC A;  3ASN C;  3DD7 A;  4EBK A;  1C02 A;  3RH3 A;  3CSK A;  1UG7 A;  1G4U S;  3DAF A;  5FZT A;  3C8G D;  4PJJ A;  2KQ9 A;  4CS8 A;  2LK4 A;  1G4W R;  1ORS C;  4XQ1 A;  1PD1 A;  2R7O A;  2XLM A;  4A2N B;  2AVK A;  3DM5 A;  4EUK B;  3EG9 B;  3Q7L A;  4HE8 D;  2R9R B;  3MBG A;  1JOG A;  1BDJ B;  3W2V A;  1VLT A;  2NUP A;  3EHN A;  4WJ0 A;  1A41 A;  4YT4 A;  2H7B A;  1YLM A;  3O39 A;  3AG3 C;  2J0X A;  1T5O A;  3B71 A;  2XL4 A;  4MVM A;  1BR4 A;  3T4R A;  3S9O A;  4BJ5 C;  2G3V A;  2P61 A;  3EFO A;  3KYI A;  1TWH A;  3RQG A;  3CZ6 A;  4E7S A;  3SYN A;  4MQ9 F;  2IM8 A;  3S28 A;  2ASR A;  4JTC B;  4Z9J A;  5F5H A;  4YL1 A;  1Z3I X;  3ZVR A;  1MNE A;  2XLW A;  5A6B A;  3NRH A;  2W45 A;  3ITF A;  4I1M A;  2H7O A;  4C3B A;  4HFF B;  1R4T A;  1YDI A;  1R5I D;  2VCC A;  4IAR A;  3EGX A;  4CDY A;  1YVI A;  3K1H A;  3MYF A;  4OIN F;  3T6B A;  2QUP A;  2Q00 A;  2VCB A;  3DMD A;  3C8Z A;  3EGD B;  3EPV A;  1TQG A;  2PBE A;  1VYK A;  5TJ5 E;  2WZG A;  4DRI B;  1E85 A;  1M56 C;  2EPN A;  1F1M A;  5KYY A;  4E0H A;  4ZLC A;  3HNI A;  3ZTZ A;  2L7A A;  1GS9 A;  2R7S A;  2LFF A;  2LD6 A;  1OKK A;  1T01 A;  3U8P A; 
#chains in the Genus database with same CATH homology
 2Y3H A;  2WL8 A;  2IYL D;  1TWA A;  3IEE A;  1Z63 A;  1ZHW A;  5KYU A;  4I44 A;  4DBR A;  3TD7 A;  4BJ6 C;  2IXN A;  1ZHX A;  1D1A A;  5EGY A;  3RYL A;  5KYX B;  3RFY A;  1BR1 A;  4G0H A;  3JT1 A;  3K1I C;  3W8I A;  1NU9 C;  3WOD F;  3NKE A;  2PFD A;  2Q3T A;  3MLG A;  3RKO F;  2Z15 A;  4AE4 A;  3S0X A;  1M2V A;  1RJ9 B;  2M4E A;  2EIK C;  2WVN A;  5B1A C;  4CBE A;  4CSA A;  3KL4 A;  2G3K A;  3CQZ A;  3UMI A;  3S27 A;  4B6I A;  4CS7 A;  4DOZ A;  3UR3 C;  3POV A;  2ZXP A;  3AQB A;  2YEV A;  2OCC C;  2KNH A;  3QMK A;  4KNV A;  3I5P A;  5B1B C;  3PHF 2;  1FFT C;  2A69 F;  2JD3 A;  4P6I C;  4U5B E;  2J46 A;  3V7O A;  1WGW A;  3KKB A;  4O6Y A;  5KYN A;  3UMH A;  4H4K C;  2EIM C;  4LAC B;  2ZXW C;  2A68 F;  1MMN A;  3NYL A;  3ZSU A;  1OKK D;  1QLE C;  2WVO A;  4E7Z A;  2QTV A;  4BG0 A;  3EZI A;  4Q7C A;  1Z23 A;  1TWC A;  4ULW A;  2XXA B;  1S7Z A;  4JZA A;  4YN0 B;  2NUT A;  4PJM A;  4BJ5 A;  4U5D E;  3E70 C;  2DGJ A;  3JYH A;  2MYS A;  3DZA A;  4YT5 A;  1SZI A;  3NKD A;  3VAY A;  2IOQ A;  3K33 A;  2FGY A;  3EHM A;  5DS4 A;  2KW3 C;  1ZU5 A;  2Y3G A;  3F47 A;  4IWB A;  4YT2 A;  4FWV A;  2E87 A;  5CI9 A;  4PJL A;  4NY3 A;  1LS1 A;  1ZHY A;  2WVQ A;  4W8K A;  1LKX A;  2ZPA A;  4PFP A;  3T6J A;  3ZC4 A;  2Q9A A;  3HLZ A;  1TKN A;  2DYR C;  1NU7 D;  3OA1 A;  4JJF A;  2NUP B;  4EBB A;  4OIP F;  3JCU Q;  3UGO A;  1ZYR F;  1FTS A;  3EJN A;  3X2Q C;  5T1D B;  1OCZ C;  3EFO B;  1N1C A;  2PX3 A;  2J0W A;  4BJ1 A;  3B9Q A;  4C3D A;  2KJG A;  3EGX B;  4CIH A;  3H65 A;  2J9W A;  3B0U X;  3AG4 C;  3L0I A;  3EZH A;  4KBL A;  3DJN B;  3K7D A;  3F46 A;  2B0J A;  4BEJ A;  4RDA A;  5DQZ A;  5KYY B;  2KGO A;  4YJW A;  3UGP A;  2Y3D A;  2L81 A;  2C03 A;  3OEO A;  5DVW A;  1O5H A;  4C7O A;  2FFH A;  4KC9 A;  4GYT A;  2ZXR A;  1LVK A;  3GAN A;  3LS0 A;  3Q6M A;  3DXJ F;  4F4B A;  3LEV A;  3UMK A;  1JPJ A;  1SF8 A;  1MMA A;  3FAJ A;  2VH3 A;  5KYU B;  5IY5 C;  5T3T A;  1FMV A;  3LNR A;  4KNW A;  4ANJ A;  2A1D D;  3DJU B;  3W8H A;  5E3C A;  2GFH A;  2HV7 A;  4U5G A;  4XTK A;  3I4U A;  2CNW A;  1FFH A;  3N2Z B;  4I1O B;  2R7W A;  1M57 C;  4AE4 B;  4DVZ A;  4AX2 A;  1M2V B;  2G62 A;  1TWG A;  1NZE A;  4CS9 C;  2Y69 C;  1OKK A;  5F5F A;  5T3W A;  1FMW A;  5B3S C;  3WG7 C;  2CGE A;  3FVY A;  1ZU4 A;  4O7G A;  3NYJ A;  2VB6 A;  3FDQ A;  4G7O F;  2R7U A;  4HEA J;  2L9J A;  1D1B A;  1OCO C;  2J7P A;  3KH2 A;  2QY9 A;  5DQT A;  4XLP F;  1IZM A;  1VMA A;  2C04 A;  1OCC C;  3AG2 C;  4RD9 A;  1V54 C;  4XWJ A;  3EQL F;  5E33 A;  4IAO A;  3W2W A;  1PCX A;  3DM9 B;  4DVY P;  3S29 A;  4YT8 A;  4XLN F;  2NUT B;  3FHD A;  4K7B A;  2MWQ A;  3N24 A;  4OIR F;  3Q6N A;  1TR2 A;  4JJG A;  4O6M A;  2IXP A;  1V55 C;  2BE5 F;  3LLK A;  1VOM A;  1Z6A A;  5D91 A;  4G7Z F;  2CDQ A;  4ZLD A;  2O9X A;  2CNW D;  3SZR A;  4HFK B;  4K0D A;  4OD4 A;  4U5C E;  1JPN A;  4BJT A;  5L3V A;  2XRH A;  5HSW A;  2YHS A;  2IXM A;  1NG1 A;  1MND A;  3NYM A;  1M2O A;  3B0V C;  1VK5 A;  3AG1 C;  1J8M F;  4AK9 A;  5KYW A;  4PFO A;  1D0Y A;  3LJB A;  4OD5 A;  3LES A;  4G7H F;  2I8B A;  2J7P D;  3I5Q A;  5D92 A;  2W9Y A;  3X1O A;  4O6N A;  4FX5 A;  2H7V C;  3NG1 A;  2R7T A;  2DYS C;  4QDL A;  3B0P A;  4BJ6 A;  3O6X A;  3VYW A;  3EG9 A;  1O87 A;  2WZF A;  1ZHZ A;  3UNG C;  1PD0 A;  4C7O B;  1D0X A;  2PP4 A;  4JVS A;  1Z5Z A;  1KU2 A;  2YZS A;  4EWC A;  1D1C A;  4U5H A;  4CS9 A;  1OCR C;  3N0T A;  2EIL C;  5E2Q A;  1ST6 A;  5DS5 A;  4QI0 A;  3SNH A;  3EH2 A;  4KI2 A;  2P6V A;  2Y39 A;  3ZG1 A;  2W4B A;  1BR2 A;  3K6B A;  4X0R A;  4CS8 C;  4IJJ A;  4MND A;  5FCL A;  2A6E F;  2R7V A;  2J45 A;  2WZL A;  3EGD A;  3QZC A;  3ASO C;  3PMR A;  3GOD A;  3ABK C;  3ABM C;  5CI8 A;  2NG1 A;  1ZHT A;  5EHH A;  4JW1 A;  4C3E A;  4GEH A;  2V3C C;  5BUO A;  5L3Q A;  3AQC A;  3L34 A;  3LLI A;  3Q7G A;  3ABL C;  4O79 A;  2EIN C;  4J32 B;  2R7X A;  2Y3B A;  4U5F E;  4U5E E;  4LLC A;  2X51 A;  2VAS A;  3KMI A;  4DBQ A;  1VYI A;  2EIJ C;  3RIP A;  3SP1 A;  4FES A;  3M1C B;  5KYX A;  3JSZ A;  2A6H F;  1SMY F;  5DLJ A;  2PF4 E;  3HJC A;  4OIQ F;  1W2W A;  2D5R B;  2P7V A;  4M63 A;  2HV6 A;  2Q9B A;  4Q5S F;  4PJN A;  1RJ9 A;  3MX3 A;  1G8X A;  1D0Z A;  3HTK C;  3ZIB A;  4YWQ A;  2J9U A;  2OG2 A;  3SEO A;  4JUR I;  5E3A A;  2ZXO A;  1QZX A;  2Q9C A;  2LSE A;  2CW0 F;  4Q4Z F;  3K66 A;  2WB7 A;  4I3M A;  3NDB B;  2PX0 A;  4CSA C;  4JCH A;  4LLE A;  4J30 B;  3OWT A;  4OIO F;  5DS6 A;  2R7R A;  4RBN A;  4LER A;  2XXA A;  2IXO A;  4PK4 A;  2XSE A;  4IRU A;  4N06 A;  3LS1 A;  2W4M A;  2V26 A;  4QI2 A;  3E9V A;  5KYW B;  3ECS A;  3JRT A;  2R7Q A;  3LAY A;  1J8Y F;  3EH1 A;  2J9V A;  1IW7 F;  1MMD A;  1MMG A;  3ASN C;  3DD7 A;  3RH3 A;  3CSK A;  3DAF A;  4PJJ A;  2KQ9 A;  4CS8 A;  1PD1 A;  2R7O A;  4A2N B;  3DM5 A;  3EG9 B;  3Q7L A;  4HE8 D;  3W2V A;  2NUP A;  3EHN A;  4WJ0 A;  4YT4 A;  2H7B A;  3O39 A;  3AG3 C;  2J0X A;  4BJ5 C;  2XL4 A;  3T4R A;  1BR4 A;  2G3V A;  3EFO A;  1TWH A;  4E7S A;  3CZ6 A;  3SYN A;  4MQ9 F;  3S28 A;  5F5H A;  1Z3I X;  3ZVR A;  1MNE A;  3NRH A;  2W45 A;  3ITF A;  4I1M A;  2H7O A;  4C3B A;  4HFF B;  3EGX A;  3K1H A;  3T6B A;  4OIN F;  3DMD A;  3EGD B;  3EPV A;  1VYK A;  2WZG A;  1M56 C;  5KYY A;  4ZLC A;  2R7S A;  3DAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...