3E9VA

Crystal structure of human b-cell translocation gene 2 (btg2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
b'DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structure of human B-cell Translocation Gene 2 (BTG2)
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e9vA00
5CI8A 3DJNB 2D5RB 3DJUB 5CI9A 2Z15A 3E9VA
chains in the Genus database with same CATH superfamily
4EIYA 4J7YA 2OG2A 3NKEA 4IAOA 1ZU4A 4DJ9A 4U9DA 4G78A 4E17A 4LDRA 3AGTA 4RBNA 3X2QC 4E7SA 4HFKB 3VYWA 1V54C 4FESA 2HV7A 3PCVA 3HKKA 3SEOA 3V5ZA 4OD4A 2EIMC 2OU6A 1WN0A 4OIQF 3Q6MA 3U3FA 1FMVA 4HFFB 2KJGA 2XL8A 3JRMO 3RH3A 2XXAA 3SZRA 3L0IA 4DVZA 1J8MF 4U5EE 1M57C 3PHF2 2NUTB 1M2VB 2LK4A 3O6XA 4YT2A 4CJGA 4JTAB 3T6GB 4C3EA 2FFHA 2OEVA 3T6BA 1QKRA 2ETSA 3PMRA 4MTGA 1FR0A 4IARA 2IXNA 2G62A 3ABLC 5KYYA 1LPEA 4MVOA 4BEMJ 1VYKA 3W2WA 4E7ZA 5JUAA 2OCCC 3RFYA 5GPGB 1O5HA 1WATA 3ZQVA 1T5OA 1YDIA 2VCBA 2Y3HA 4LLCA 3M4CA 3MLGA 2M64A 3B29A 4I1OB 4KNWA 4O6YA 2IOQA 1O3UA 4AE4A 4YWQA 2R7WA 2XXAB 2XS1A 1VK5A 4DBQA 5A6BA 3GANA 4A4AA 5KYNA 1VLSA 3N2ZB 3OWTA 2RSEB 4JEAA 1Z5ZA 1XZPA 4IWBA 3UMHA 3UMIA 2BL2A 1AEPA 2H7OA 1VOMA 3C8GA 1JMWA 1NG1A 5COMA 4ULVA 5KYUA 1T9KA 2MHRA 1UFBA 5KYYB 5A6AA 1LS4A 2JPUA 1JRAA 2A6HF 2WZFA 4E0IA 4DRIB 4R32A 2EPLX 2L6HA 4JCZA 2P61A 3G50A 4CS9C 1BR4A 1XZQA 4Z9HA 2J0XA 5FCLA 4C3DA 1KTMA 1PV3A 1SZIA 4PJJA 2F22A 4XQ1A 2R7OA 4WABA 4AE4B 1ZVZA 2RD9A 1YYJA 3LS1A 3RQGA 4NTAA 1R4TA 1E83A 2QTVA 1QLEC 1K05A 1U89A 3L1MA 2HJMA 1ZHXA 3GEIA 4PJNA 2NUPA 4J30B 4FWVA 3ZTZA 2UUHA 3C8GB 5JT4A 5A6KA 5KYUB 3JZ0A 3KH2A 1GQAA 4EHPA 4GYTA 3TD7A 3K7DA 4CS9A 1QZXA 1A41A 1CGNA 4J7TA 2QUPA 1M56C 2OQMA 1C02A 2LFDA 4MVRA 3UMKA 3TK0A 2Y3GA 3R2PA 2TMVP 1KNYA 2KSFA 3RVYA 4JC7A 1G5ZA 2WZLA 2Z15A 4MVMA 2EIKC 4DVYP 3W8IA 2LP4A 2R7RA 1ZHYA 5BUOA 2VC9A 1D1AA 2L9JA 4F4BA 4CBEA 3ZG1A 1T01A 2NUPB 2WZGA 1JR8A 2DYRC 2Q4FA 3GWLA 4XTKA 3VRCA 2EPNA 1RMVA 1TWGA 4WGZA 1YZCA 3H2VA 3FVYA 2C03A 4JURI 3GEHA 3K66A 2J8WA 5JSLA 4IJJA 4HE8D 2YHSA 3QTHA 2XLWA 1TFKB 1ORJA 1OCRC 2YL7A 3NYJA 5E3CA 1LIHA 2YEVA 4B6IA 3FOOA 1OCCC 1RCPA 4MTOA 1A7DA 4N4WA 2QY9A 4CSAC 3AOUA 1EQ1A 4PK4A 3ZDLA 3A9CA 3E70C 3VF0A 1Z3IX 3K33A 3GM2A 4IGGA 4JKVA 3LLKA 3DZAA 3Q7LA 1SYQA 3G4XA 3C62A 4YT5A 3FXHA 3KPHA 2J7PA 3O10A 2KYHA 2R03A 4OD5A 1Q0DA 1HW1A 2J9UA 4XPWA 2R02A 1TKNA 3M4BA 3U8PA 2O9XA 3U5SA 5B3SC 1V55C 2P6VA 1NFNA 3DJUB 2VH3A 2NG1A 2YVKA 2EPMX 3EJNA 3R7CA 4CSAA 3CZ6A 2G3KA 1YA7O 4XEVA 3S84A 4I1MA 3I5QA 2A68F 2YL3A 2IM8A 3N24A 2W4MA 3CAXA 5T3TA 1L3PA 3EH1A 4O79A 1NSGB 5E33A 3M79A 1Q0KA 4L6RA 2GDCA 4PR9A 3S9OA 3FOPA 3OA1A 2HUJA 2XM0A 3L34A 1EA8A 4MVQA 4DRHB 4EKWA 2ZD9A 3US6A 4NTFA 2Y3DA 3POVA 5E2QA 2OJQA 1IZMA 2DGJA 2PX0A 1YAUO 4XEFA 1HMOA 2H7VC 4JJGA 1TWAA 4MQ9F 4ZLDA 1ZW2A 3BRJA 4EUKB 3MYIA 4H4KC 2KK1A 1CPQA 3W8HA 2OOCA 4N06A 3O39A 2EIJC 1VB5A 2EPOA 5L0FA 2X51A 1Q0MA 3JSEO 4BJ5C 3DJNB 3AQCA 4DXWA 3DM9B 2HJ3A 3RYLA 1WWPA 3ZWIA 3IHUA 2W9YA 1TQGA 3T6JA 2J0WA 2AWCA 4XLNF 2PBEA 1RKCA 4O6NA 3DXJF 1KU2A 3U2LA 2D5RB 3ABMC 4AL0A 1FFHA 5DS6A 2CCYA 2Y39A 1Q0GA 1FNTc 2J9BA 2A69F 2IXOA 3DI5A 1H6GA 4YL3A 1RKEA 2WL8A 2D4UA 2B0HA 1OR3A 3VM6A 1ZHZA 4BJ6C 4ANJA 3FAPB 4E0HA 1M2OA 2M4EA 2XL6A 2J9VA 3L8IA 3SXMA 4BJ5A 5IY5C 1ORYA 3AG3C 4U5DE 3RKOF 2YQYA 1VMAA 1L7CA 4I3MA 3HNKA 3TOLA 3LAYA 2ZXPA 4PFPA 4XWJA 1G4US 3V7OA 3ZTMA 2P7VA 1RJ9A 2NSGA 3LEOA 3CEXA 2GWWA 1UG7A 4M63A 1JOGA 3NRHA 4YN0B 1D1CA 3RVZA 3GODA 3DE8A 3H65A 1TR2A 5JLIA 1EKYA 3C8GD 4BJ6A 5JVEA 5L0IA 1AUEA 1MMDA 1BZ4A 1RKEB 2BC5A 3CSKA 3KKBA 3M15A 3O55A 1SF8A 1T6IA 2R7VA 3FDQA 4ER9A 1S7ZA 4JJFA 3T9OA 4OIPF 1OXKA 2HFIA 1RJ9B 3B0VC 1GS9A 1FMWA 4P6IC 5DVWA 3IQCA 5CIVA 1A0BA 1PD0A 2DYSC 2P0NA 2Y3BA 2L81A 3ATPA 4LDKA 2Q3TA 4MVUA 3NDBB 3EGXA 4MS2A 1BBHA 3SXYA 4Q4ZF 1C17M 5L0HA 2XS8A 2W45A 3AQBA 2VB6A 3U2MA 2XLOA 1Z6AA 3MYFA 1E2XA 3JTLO 4E18A 3JSZA 5D92A 4K1OA 4H54A 2IBFA 4U5FE 4CDVA 1NU7D 2I8BA 2YZSA 2VCCA 4CS7A 2R7SA 2YLGA 3I4UA 3B71A 2CYDA 2L7AA 3RF3A 4LACB 2R9RB 4G0HA 4YL1A 3S27A 3OEOA 1HE1A 1OXBA 3LLIA 2YLIA 3TQOA 1TFOB 4EBBA 3QVYA 2Y69C 3QZCA 4JE9A 1HE9A 1OKKA 3MFNA 4K7BA 4XPYA 3UNGC 4DBRA 3EGXB 4MW8A 2GA0A 3DM5A 2J45A 1NZEA 2YLDA 3KL4A 4G7HF 5F5FA 1Z63A 3I5PA 2QNLA 3IPMO 2W4BA 3LJBA 5K0IA 4EWCA 1MMAA 2AP3A 2A6EF 3GM1A 4P9TA 3U9JA 2L6FA 3HNLA 1E84A 2CW0F 1ZHWA 2H7BA 2ZXOA 2Q00A 1CPRA 4JIOA 4HEAJ 5AC4A 1H7IA 1WASA 3EG9A 5EGYA 5L0JA 3ECSA 1PCXA 1HW2A 2ZXWC 4PJMA 3AGUA 4WGYA 3WODF 2HZ8A 1LI7A 3GEEA 3U9MA 3PDMP 3TULA 2XSEA 5L0CA 2NPUA 1D0XA 3SXZA 5L0GA 3S90A 4BG0A 2LIGA 4ULWA 3T4RA 3J06A 3LS0A 3HJCA 2IXMA 2MWQA 1MNEA 2J7PD 2PX3A 2VASA 3FAJA 3MBGA 1Z23A 1NBBA 2PP4A 4MW3A 1V74B 4JVSA 1W2WA 3UGPA 4U5GA 1LKXA 2PNOA 4DRJB 2R7TA 3DD7A 3ZIBA 5BQHA 2QE9A 2G3VA 1N1CA 3KYIA 4BJ1A 1ZYRF 3V5YA 5BQGA 1DOVA 3C63A 3EG9B 4A2NB 5B3IA 4Q5SF 3IQ6A 3LNMB 1K40A 4Z9JA 1B68A 3ASNC 1OCZC 3RIPA 4YJWA 2PFDA 2R05A 3IEEA 5A6BD 1F1MA 5E3AA 4GEHA 3RQEA 3S29A 5L0DA 4ZLCA 2A1DD 4KI2A 3ASOC 4XPXA 2C04A 2EPKX 3K1HA 2R25A 3W4YA 1G4WR 3DAFA 1EI7A 5F28E 1CGME 3KMIA 2EILC 3EQLF 2VCAA 4FX5A 4IB4A 4NQFA 1MMGA 1ZW3A 4JW1A 4U5BE 3ZQYA 1J8YF 3GM3A 1ZHTA 4G7OF 1JAFA 3SXKA 5JS5A 4LERA 4X0RA 1HMDA 2ASRA 2HMZA 1U6HA 2KGOA 4KNVA 2NSFA 3RQFA 5KYXA 1PD1A 5EHHA 5COFA 1FFTC 4QI2A 1MNDA 1XWJA 1T6UA 3E9VA 4Q7CA 3HNJA 3ZVRA 3AG2C 3LEVA 4Z9IA 3C7JA 2HKVA 2I15A 4NC3A 2GAQA 3ABKC 4YL0A 3RW0A 3DKAA 3F47A 4D4NA 2ZXRA 1Y4CA 3ITFA 3NMJA 3A11A 2XLMA 3TJ6A 4GQHA 2JD3A 3GORA 1VLTA 4I44A 1JPNA 4JRZA 3N0TA 2E87A 5TJ5E 4MVSA 2KW3C 2MYSA 2V26A 3EH2A 2CNWA 5AGFA 1D0YA 2YRFA 1YLMA 5B1AC 5D91A 1M6TA 2CNWD 4MVZA 2XLVA 3SYNA 4AX2A 5KYXB 4CJOA 1OW6A 4MTFA 4LDQA 4NTBA 3NMKA 3U3BA 2IYLD 1MMNA 2HMQA 1SMYF 3K1IC 4FAPB 3C18A 2A0BA 4O6MA 1TWCA 3DWWA 1O87A 1DOWA 2LCHA 2OKUA 2L6GA 3C8ZA 4EBJA 5L3VA 5DS5A 2XLHA 3B0UX 4NY3A 3B9QA 3FMSA 5T3WA 4XEKA 2X0CA 1R5ID 4CDAA 3FHDA 3HTKC 4IRUA 5KYWA 4PJLA 1K04A 1SR2A 1A7VA 2DI3A 1S05A 1LM3B 5FZTA 1BDJB 4CIPA 5JP7A 2ZPAA 3JT1A 2Q9AA 1VYIA 3K1IA 4G7ZF 1MQVA 2GFHA 2LSEA 4C7OB 3CQZA 3AJMA 2J9WA 4NCQA 5DQZA 3G4ZA 4ONSA 1QSPA 1C03A 2LD6A 2PF4E 3WHNA 1NU9C 1D0ZA 5DS4A 5A6JA 3QW0A 3Q7GA 5L3QA 3X1OA 2AVKA 3HNIA 3JCUQ 4KC9A 2H8AA 3EGDA 1H9TA 3M1CB 3GWNA 2DB4A 3EHMA 5KYWB 4XLPF 4N6CA 2XL4A 4LLEA 2Q9BA 3NYMA 4MNDA 5AC5A 3VAYA 4N6HA 5COGA 2XLDA 3UR3C 3DE9A 2HV6A 3V5XA 3QVZA 3BEHA 4WJ0A 2YL1A 3QW1A 3JYHA 2LQGA 1QVXA 3SNHA 3U0CA 4QI0A 2IXPA 4JTCB 4QDLA 3ZC4A 3LESA 3NMIA 5CI9A 5DLJA 4D4XA 5JRAA 2UUIA 1YZAA 1AVOB 1OKKD 4W8PA 2WVQA 2AU5A 3EGDB 2XLEA 1IW7F 1D1BA 1I5NA 1YARO 4O7GA 2BE5F 4YK5A 2KQ9A 4CS8C 2R7XA 2FAPB 1BR1A 4K0DA 1WTYA 4J32B 4PACA 1OW8A 1RXQA 2JX0A 3S0XA 4OIRF 1YVIA 1OQCA 3H2UA 4PFOA 4C7OA 4JTDB 4OINF 1CGOA 1JPJA 3MX3A 3QMKA 1NFOA 4JEBA 3W2VA 2OJED 4U5HA 3WG7C 5DQTA 3LUTB 3EZHA 2Q7RA 1T6QA 2EINC 4CS8A 1A7EA 3L8JA 1Q0FA 1LE2A 5BQIA 1OW7A 5HSWA 2HSQA 2OEXA 2AWYA 2YKZA 2J46A 3TJ5A 4C3BA 3EHNA 3K6BA 5EK0A 1HY5A 1E85A 2KC3A 2R7QA 3DAGA 2A0UA 1APCA 2CGEA 2XRHA 5F5HA 4AL1A 1QQ3A 2P1AA 2YL0A 1GGQA 1YJGA 2WVNA 3Q6NA 1LS1A 1OCOC 1NLXA 3LNRA 4U9EA 4EBKA 4YT4A 1VTMP 2R7UA 5T1DB 1FAPB 2QLAA 3EZIA 2WB7A 4BEJA 3JRTA 4U5CE 4AK9A 1ST6A 4JCHA 4BJTA 1BR2A 3EFOA 1ZZPA 1I4YA 5A69A 4IAQA 1Y6DA 2KNHA 3JYYA 2YWAA 1ZU5A 2ICWG 1FTSA 3AG4C 3IQTA 4P9FA 4RDAA 4DOZA 4UDVA 3NKDA 3WAQA 4YT8A 3F46A 4BPMA 2WVOA 2FGYA 3HLZA 2XM4A 1H9GA 3IQ5A 1OR2A 3U8VA 2HSBA 2HS5A 4CDYA 5CI8A 4CIHA 1E86A 1QPUA 1U0BB 1I4ZA 1Z7Qc 1G8XA 2B0JA 3DMDA 3EPVA 256BA 3NYLA 3AG1C 3SP1A 3KYJA 2CDQA 1WGWA 3ZSUA 1LVKA 1YYXA 1ORSC 3NG1A 3B0PA 4CX9A 2V3CC 3EFOB 4RD9A 4OIOF 1YA9A 4W8KA 5B1BC 3TOMA 3S28A 4JZAA 5HV9A 1LE4A 1GM5A 2NUTA 1M2VA 2LFFA 1LI5A 3UGOA 4KBLA 2Q9CA 1V4AA 1WOLA 1TWHA
chains in the Genus database with same CATH topology
2OG2A 3NKEA 4IAOA 1ZU4A 3X2QC 4RBNA 4E7SA 4HFKB 3VYWA 1V54C 4FESA 2HV7A 3SEOA 4OD4A 2EIMC 4OIQF 3Q6MA 1FMVA 4HFFB 2KJGA 3RH3A 2XXAA 3SZRA 3L0IA 4DVZA 1J8MF 4U5EE 1M57C 3PHF2 2NUTB 1M2VB 3O6XA 4YT2A 4C3EA 2FFHA 3PMRA 2IXNA 2G62A 3ABLC 5KYYA 1VYKA 3W2WA 2OCCC 3RFYA 1O5HA 4LLCA 2Y3HA 3MLGA 4I1OB 4KNWA 4YWQA 2R7WA 4O6YA 2IOQA 4AE4A 2XXAB 1VK5A 3GANA 5KYNA 3N2ZB 3OWTA 1Z5ZA 3UMHA 4IWBA 3UMIA 4E7ZA 2H7OA 1VOMA 1NG1A 5KYUA 5KYYB 2WZFA 2A6HF 4CS9C 1BR4A 5FCLA 2J0XA 4C3DA 1SZIA 4PJJA 2R7OA 4AE4B 3LS1A 2QTVA 1QLEC 1ZHXA 4PJNA 2NUPA 4J30B 4FWVA 5KYUB 3KH2A 4GYTA 3TD7A 3K7DA 4CS9A 1QZXA 1M56C 3UMKA 2Y3GA 2WZLA 2Z15A 2EIKC 4DVYP 3W8IA 2R7RA 1ZHYA 5BUOA 1D1AA 2L9JA 4F4BA 4CBEA 3ZG1A 2NUPB 2WZGA 4XTKA 2DYRC 1TWGA 3FVYA 2C03A 4JURI 3K66A 4IJJA 4HE8D 2YHSA 1OCRC 5E3CA 3NYJA 2YEVA 4B6IA 1OCCC 2QY9A 4CSAC 4PK4A 3E70C 1Z3IX 3K33A 3LLKA 3DZAA 3Q7LA 4DOZA 4YT5A 4OD5A 2J7PA 2J9UA 1TKNA 5B3SC 2O9XA 1V55C 2P6VA 3DJUB 2VH3A 2NG1A 3EJNA 4CSAA 3CZ6A 2G3KA 4I1MA 3I5QA 2A68F 3N24A 2W4MA 5T3TA 3EH1A 4O79A 5E33A 3OA1A 3L34A 2Y3DA 3POVA 5E2QA 1IZMA 2DGJA 2PX0A 2H7VC 4JJGA 1TWAA 4MQ9F 4ZLDA 4H4KC 3W8HA 4N06A 3O39A 2EIJC 2X51A 4BJ5C 3DJNB 3AQCA 3DM9B 3RYLA 2W9YA 3T6JA 2J0WA 4XLNF 4O6NA 3DXJF 1KU2A 2D5RB 3ABMC 1FFHA 5DS6A 2Y39A 2A69F 2IXOA 2WL8A 4BJ6C 1ZHZA 4ANJA 1M2OA 2M4EA 2J9VA 4BJ5A 5IY5C 3AG3C 4U5DE 3RKOF 1VMAA 4I3MA 3LAYA 2ZXPA 4PFPA 4XWJA 3V7OA 2P7VA 1RJ9A 4M63A 3NRHA 4YN0B 1D1CA 3GODA 3H65A 1TR2A 4BJ6A 1MMDA 3CSKA 3KKBA 1SF8A 2R7VA 3FDQA 1S7ZA 4JJFA 4OIPF 1RJ9B 3B0VC 1FMWA 4P6IC 5DVWA 4Q5SF 1PD0A 2Y3BA 2DYSC 3NDBB 2L81A 2Q3TA 3EGXA 2W45A 3AQBA 2VB6A 1Z6AA 3JSZA 5D92A 4U5FE 4CS7A 1NU7D 2I8BA 2YZSA 2R7SA 3I4UA 4LACB 4G0HA 3S27A 3OEOA 3LLIA 4EBBA 2Y69C 3QZCA 1OKKA 4K7BA 3UNGC 4DBRA 3EGXB 3DM5A 2J45A 1NZEA 3KL4A 4G7HF 5F5FA 1Z63A 3I5PA 3LJBA 2W4BA 4EWCA 1MMAA 2A6EF 2CW0F 1ZHWA 2H7BA 2ZXOA 4HEAJ 5EGYA 3EG9A 3ECSA 1PCXA 2ZXWC 4PJMA 3WODF 2XSEA 1D0XA 4BG0A 4ULWA 3T4RA 3LS0A 3HJCA 2IXMA 2MWQA 1MNEA 2J7PD 2PX3A 2VASA 3FAJA 1Z23A 2PP4A 4JVSA 1W2WA 3UGPA 4U5GA 1LKXA 2R7TA 3DD7A 3ZIBA 2G3VA 1N1CA 4BJ1A 1ZYRF 3EG9B 4A2NB 3RIPA 3ASNC 1OCZC 4YJWA 2PFDA 3IEEA 5E3AA 4GEHA 3S29A 4ZLCA 2A1DD 4KI2A 3ASOC 2C04A 3K1HA 3DAFA 3KMIA 2EILC 3EQLF 4U5BE 4FX5A 1MMGA 4JW1A 1J8YF 1ZHTA 4G7OF 4LERA 4X0RA 2KGOA 4KNVA 5KYXA 1PD1A 5EHHA 1FFTC 4QI2A 1MNDA 4Q7CA 3E9VA 3ZVRA 3AG2C 3LEVA 3ABKC 3F47A 2ZXRA 3ITFA 2JD3A 4I44A 1JPNA 4DBQA 3N0TA 2E87A 2KW3C 2MYSA 2V26A 3EH2A 2CNWA 3T6BA 1D0YA 4AX2A 5B1AC 3SYNA 5D91A 2CNWD 4BEJA 4C7OA 5KYXB 2IYLD 1MMNA 3K1IC 1SMYF 4O6MA 1TWCA 1O87A 5L3VA 3B0UX 4NY3A 3B9QA 5T3WA 3FHDA 3HTKC 4IRUA 5KYWA 4PJLA 2ZPAA 3JT1A 2Q9AA 1VYIA 4G7ZF 2GFHA 4C7OB 2LSEA 3CQZA 2J9WA 5DQZA 2PF4E 1NU9C 1D0ZA 5DS4A 3Q7GA 5L3QA 3X1OA 3JCUQ 4KC9A 3EGDA 3M1CB 5KYWB 3EHMA 4XLPF 2XL4A 4LLEA 2Q9BA 3NYMA 4MNDA 3VAYA 3UR3C 2HV6A 4WJ0A 3JYHA 3SNHA 4QI0A 2IXPA 4QDLA 3ZC4A 3LESA 5CI9A 5DLJA 1OKKD 2WVQA 3EGDB 1IW7F 1D1BA 4O7GA 2BE5F 2KQ9A 4CS8C 2R7XA 1BR1A 4K0DA 4J32B 3S0XA 4OIRF 4PFOA 4OINF 3MX3A 1JPJA 3QMKA 3W2VA 4U5HA 3WG7C 5DQTA 3EZHA 2EINC 4CS8A 4Q4ZF 5DS5A 5HSWA 4C3BA 2J46A 3EHNA 3K6BA 2R7QA 3DAGA 2XRHA 2CGEA 5F5HA 3Q6NA 2WVNA 1LS1A 1OCOC 3LNRA 4YT4A 2R7UA 5T1DB 3EZIA 2WB7A 3JRTA 4U5CE 4AK9A 1ST6A 4JCHA 4BJTA 1BR2A 3EFOA 2KNHA 1ZU5A 1FTSA 3AG4C 4RDAA 3NKDA 4YT8A 3F46A 2WVOA 2FGYA 3HLZA 4CIHA 5CI8A 1G8XA 2B0JA 3DMDA 3EPVA 3NYLA 3AG1C 3SP1A 2CDQA 1WGWA 3ZSUA 1LVKA 3NG1A 3B0PA 2V3CC 4OIOF 3EFOB 4RD9A 4W8KA 5B1BC 3S28A 4JZAA 2NUTA 1M2VA 3UGOA 4KBLA 2Q9CA 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI8 A;  3DJN B;  2D5R B;  3DJU B;  5CI9 A;  2Z15 A;  3E9V A; 
#chains in the Genus database with same CATH topology
 4EIY A;  4J7Y A;  2OG2 A;  3NKE A;  4IAO A;  1ZU4 A;  4DJ9 A;  4U9D A;  4G78 A;  4E17 A;  4LDR A;  3AGT A;  4RBN A;  3X2Q C;  4E7S A;  4HFK B;  3VYW A;  1V54 C;  4FES A;  2HV7 A;  3PCV A;  3HKK A;  3SEO A;  3V5Z A;  4OD4 A;  2EIM C;  2OU6 A;  1WN0 A;  4OIQ F;  3Q6M A;  3U3F A;  1FMV A;  4HFF B;  2KJG A;  2XL8 A;  3JRM O;  3RH3 A;  2XXA A;  3SZR A;  3L0I A;  4DVZ A;  1J8M F;  4U5E E;  1M57 C;  3PHF 2;  2NUT B;  1M2V B;  2LK4 A;  3O6X A;  4YT2 A;  4CJG A;  4JTA B;  3T6G B;  4C3E A;  2FFH A;  2OEV A;  3T6B A;  1QKR A;  2ETS A;  3PMR A;  4MTG A;  1FR0 A;  4IAR A;  2IXN A;  2G62 A;  3ABL C;  5KYY A;  1LPE A;  4MVO A;  4BEM J;  1VYK A;  3W2W A;  4E7Z A;  5JUA A;  2OCC C;  3RFY A;  5GPG B;  1O5H A;  1WAT A;  3ZQV A;  1T5O A;  1YDI A;  2VCB A;  2Y3H A;  4LLC A;  3M4C A;  3MLG A;  2M64 A;  3B29 A;  4I1O B;  4KNW A;  4O6Y A;  2IOQ A;  1O3U A;  4AE4 A;  4YWQ A;  2R7W A;  2XXA B;  2XS1 A;  1VK5 A;  4DBQ A;  5A6B A;  3GAN A;  4A4A A;  5KYN A;  1VLS A;  3N2Z B;  3OWT A;  2RSE B;  4JEA A;  1Z5Z A;  1XZP A;  4IWB A;  3UMH A;  3UMI A;  2BL2 A;  1AEP A;  2H7O A;  1VOM A;  3C8G A;  1JMW A;  1NG1 A;  5COM A;  4ULV A;  5KYU A;  1T9K A;  2MHR A;  1UFB A;  5KYY B;  5A6A A;  1LS4 A;  2JPU A;  1JRA A;  2A6H F;  2WZF A;  4E0I A;  4DRI B;  4R32 A;  2EPL X;  2L6H A;  4JCZ A;  2P61 A;  3G50 A;  4CS9 C;  1BR4 A;  1XZQ A;  4Z9H A;  2J0X A;  5FCL A;  4C3D A;  1KTM A;  1PV3 A;  1SZI A;  4PJJ A;  2F22 A;  4XQ1 A;  2R7O A;  4WAB A;  4AE4 B;  1ZVZ A;  2RD9 A;  1YYJ A;  3LS1 A;  3RQG A;  4NTA A;  1R4T A;  1E83 A;  2QTV A;  1QLE C;  1K05 A;  1U89 A;  3L1M A;  2HJM A;  1ZHX A;  3GEI A;  4PJN A;  2NUP A;  4J30 B;  4FWV A;  3ZTZ A;  2UUH A;  3C8G B;  5JT4 A;  5A6K A;  5KYU B;  3JZ0 A;  3KH2 A;  1GQA A;  4EHP A;  4GYT A;  3TD7 A;  3K7D A;  4CS9 A;  1QZX A;  1A41 A;  1CGN A;  4J7T A;  2QUP A;  1M56 C;  2OQM A;  1C02 A;  2LFD A;  4MVR A;  3UMK A;  3TK0 A;  2Y3G A;  3R2P A;  2TMV P;  1KNY A;  2KSF A;  3RVY A;  4JC7 A;  1G5Z A;  2WZL A;  2Z15 A;  4MVM A;  2EIK C;  4DVY P;  3W8I A;  2LP4 A;  2R7R A;  1ZHY A;  5BUO A;  2VC9 A;  1D1A A;  2L9J A;  4F4B A;  4CBE A;  3ZG1 A;  1T01 A;  2NUP B;  2WZG A;  1JR8 A;  2DYR C;  2Q4F A;  3GWL A;  4XTK A;  3VRC A;  2EPN A;  1RMV A;  1TWG A;  4WGZ A;  1YZC A;  3H2V A;  3FVY A;  2C03 A;  4JUR I;  3GEH A;  3K66 A;  2J8W A;  5JSL A;  4IJJ A;  4HE8 D;  2YHS A;  3QTH A;  2XLW A;  1TFK B;  1ORJ A;  1OCR C;  2YL7 A;  3NYJ A;  5E3C A;  1LIH A;  2YEV A;  4B6I A;  3FOO A;  1OCC C;  1RCP A;  4MTO A;  1A7D A;  4N4W A;  2QY9 A;  4CSA C;  3AOU A;  1EQ1 A;  4PK4 A;  3ZDL A;  3A9C A;  3E70 C;  3VF0 A;  1Z3I X;  3K33 A;  3GM2 A;  4IGG A;  4JKV A;  3LLK A;  3DZA A;  3Q7L A;  1SYQ A;  3G4X A;  3C62 A;  4YT5 A;  3FXH A;  3KPH A;  2J7P A;  3O10 A;  2KYH A;  2R03 A;  4OD5 A;  1Q0D A;  1HW1 A;  2J9U A;  4XPW A;  2R02 A;  1TKN A;  3M4B A;  3U8P A;  2O9X A;  3U5S A;  5B3S C;  1V55 C;  2P6V A;  1NFN A;  3DJU B;  2VH3 A;  2NG1 A;  2YVK A;  2EPM X;  3EJN A;  3R7C A;  4CSA A;  3CZ6 A;  2G3K A;  1YA7 O;  4XEV A;  3S84 A;  4I1M A;  3I5Q A;  2A68 F;  2YL3 A;  2IM8 A;  3N24 A;  2W4M A;  3CAX A;  5T3T A;  1L3P A;  3EH1 A;  4O79 A;  1NSG B;  5E33 A;  3M79 A;  1Q0K A;  4L6R A;  2GDC A;  4PR9 A;  3S9O A;  3FOP A;  3OA1 A;  2HUJ A;  2XM0 A;  3L34 A;  1EA8 A;  4MVQ A;  4DRH B;  4EKW A;  2ZD9 A;  3US6 A;  4NTF A;  2Y3D A;  3POV A;  5E2Q A;  2OJQ A;  1IZM A;  2DGJ A;  2PX0 A;  1YAU O;  4XEF A;  1HMO A;  2H7V C;  4JJG A;  1TWA A;  4MQ9 F;  4ZLD A;  1ZW2 A;  3BRJ A;  4EUK B;  3MYI A;  4H4K C;  2KK1 A;  1CPQ A;  3W8H A;  2OOC A;  4N06 A;  3O39 A;  2EIJ C;  1VB5 A;  2EPO A;  5L0F A;  2X51 A;  1Q0M A;  3JSE O;  4BJ5 C;  3DJN B;  3AQC A;  4DXW A;  3DM9 B;  2HJ3 A;  3RYL A;  1WWP A;  3ZWI A;  3IHU A;  2W9Y A;  1TQG A;  3T6J A;  2J0W A;  2AWC A;  4XLN F;  2PBE A;  1RKC A;  4O6N A;  3DXJ F;  1KU2 A;  3U2L A;  2D5R B;  3ABM C;  4AL0 A;  1FFH A;  5DS6 A;  2CCY A;  2Y39 A;  1Q0G A;  1FNT c;  2J9B A;  2A69 F;  2IXO A;  3DI5 A;  1H6G A;  4YL3 A;  1RKE A;  2WL8 A;  2D4U A;  2B0H A;  1OR3 A;  3VM6 A;  1ZHZ A;  4BJ6 C;  4ANJ A;  3FAP B;  4E0H A;  1M2O A;  2M4E A;  2XL6 A;  2J9V A;  3L8I A;  3SXM A;  4BJ5 A;  5IY5 C;  1ORY A;  3AG3 C;  4U5D E;  3RKO F;  2YQY A;  1VMA A;  1L7C A;  4I3M A;  3HNK A;  3TOL A;  3LAY A;  2ZXP A;  4PFP A;  4XWJ A;  1G4U S;  3V7O A;  3ZTM A;  2P7V A;  1RJ9 A;  2NSG A;  3LEO A;  3CEX A;  2GWW A;  1UG7 A;  4M63 A;  1JOG A;  3NRH A;  4YN0 B;  1D1C A;  3RVZ A;  3GOD A;  3DE8 A;  3H65 A;  1TR2 A;  5JLI A;  1EKY A;  3C8G D;  4BJ6 A;  5JVE A;  5L0I A;  1AUE A;  1MMD A;  1BZ4 A;  1RKE B;  2BC5 A;  3CSK A;  3KKB A;  3M15 A;  3O55 A;  1SF8 A;  1T6I A;  2R7V A;  3FDQ A;  4ER9 A;  1S7Z A;  4JJF A;  3T9O A;  4OIP F;  1OXK A;  2HFI A;  1RJ9 B;  3B0V C;  1GS9 A;  1FMW A;  4P6I C;  5DVW A;  3IQC A;  5CIV A;  1A0B A;  1PD0 A;  2DYS C;  2P0N A;  2Y3B A;  2L81 A;  3ATP A;  4LDK A;  2Q3T A;  4MVU A;  3NDB B;  3EGX A;  4MS2 A;  1BBH A;  3SXY A;  4Q4Z F;  1C17 M;  5L0H A;  2XS8 A;  2W45 A;  3AQB A;  2VB6 A;  3U2M A;  2XLO A;  1Z6A A;  3MYF A;  1E2X A;  3JTL O;  4E18 A;  3JSZ A;  5D92 A;  4K1O A;  4H54 A;  2IBF A;  4U5F E;  4CDV A;  1NU7 D;  2I8B A;  2YZS A;  2VCC A;  4CS7 A;  2R7S A;  2YLG A;  3I4U A;  3B71 A;  2CYD A;  2L7A A;  3RF3 A;  4LAC B;  2R9R B;  4G0H A;  4YL1 A;  3S27 A;  3OEO A;  1HE1 A;  1OXB A;  3LLI A;  2YLI A;  3TQO A;  1TFO B;  4EBB A;  3QVY A;  2Y69 C;  3QZC A;  4JE9 A;  1HE9 A;  1OKK A;  3MFN A;  4K7B A;  4XPY A;  3UNG C;  4DBR A;  3EGX B;  4MW8 A;  2GA0 A;  3DM5 A;  2J45 A;  1NZE A;  2YLD A;  3KL4 A;  4G7H F;  5F5F A;  1Z63 A;  3I5P A;  2QNL A;  3IPM O;  2W4B A;  3LJB A;  5K0I A;  4EWC A;  1MMA A;  2AP3 A;  2A6E F;  3GM1 A;  4P9T A;  3U9J A;  2L6F A;  3HNL A;  1E84 A;  2CW0 F;  1ZHW A;  2H7B A;  2ZXO A;  2Q00 A;  1CPR A;  4JIO A;  4HEA J;  5AC4 A;  1H7I A;  1WAS A;  3EG9 A;  5EGY A;  5L0J A;  3ECS A;  1PCX A;  1HW2 A;  2ZXW C;  4PJM A;  3AGU A;  4WGY A;  3WOD F;  2HZ8 A;  1LI7 A;  3GEE A;  3U9M A;  3PDM P;  3TUL A;  2XSE A;  5L0C A;  2NPU A;  1D0X A;  3SXZ A;  5L0G A;  3S90 A;  4BG0 A;  2LIG A;  4ULW A;  3T4R A;  3J06 A;  3LS0 A;  3HJC A;  2IXM A;  2MWQ A;  1MNE A;  2J7P D;  2PX3 A;  2VAS A;  3FAJ A;  3MBG A;  1Z23 A;  1NBB A;  2PP4 A;  4MW3 A;  1V74 B;  4JVS A;  1W2W A;  3UGP A;  4U5G A;  1LKX A;  2PNO A;  4DRJ B;  2R7T A;  3DD7 A;  3ZIB A;  5BQH A;  2QE9 A;  2G3V A;  1N1C A;  3KYI A;  4BJ1 A;  1ZYR F;  3V5Y A;  5BQG A;  1DOV A;  3C63 A;  3EG9 B;  4A2N B;  5B3I A;  4Q5S F;  3IQ6 A;  3LNM B;  1K40 A;  4Z9J A;  1B68 A;  3ASN C;  1OCZ C;  3RIP A;  4YJW A;  2PFD A;  2R05 A;  3IEE A;  5A6B D;  1F1M A;  5E3A A;  4GEH A;  3RQE A;  3S29 A;  5L0D A;  4ZLC A;  2A1D D;  4KI2 A;  3ASO C;  4XPX A;  2C04 A;  2EPK X;  3K1H A;  2R25 A;  3W4Y A;  1G4W R;  3DAF A;  1EI7 A;  5F28 E;  1CGM E;  3KMI A;  2EIL C;  3EQL F;  2VCA A;  4FX5 A;  4IB4 A;  4NQF A;  1MMG A;  1ZW3 A;  4JW1 A;  4U5B E;  3ZQY A;  1J8Y F;  3GM3 A;  1ZHT A;  4G7O F;  1JAF A;  3SXK A;  5JS5 A;  4LER A;  4X0R A;  1HMD A;  2ASR A;  2HMZ A;  1U6H A;  2KGO A;  4KNV A;  2NSF A;  3RQF A;  5KYX A;  1PD1 A;  5EHH A;  5COF A;  1FFT C;  4QI2 A;  1MND A;  1XWJ A;  1T6U A;  3E9V A;  4Q7C A;  3HNJ A;  3ZVR A;  3AG2 C;  3LEV A;  4Z9I A;  3C7J A;  2HKV A;  2I15 A;  4NC3 A;  2GAQ A;  3ABK C;  4YL0 A;  3RW0 A;  3DKA A;  3F47 A;  4D4N A;  2ZXR A;  1Y4C A;  3ITF A;  3NMJ A;  3A11 A;  2XLM A;  3TJ6 A;  4GQH A;  2JD3 A;  3GOR A;  1VLT A;  4I44 A;  1JPN A;  4JRZ A;  3N0T A;  2E87 A;  5TJ5 E;  4MVS A;  2KW3 C;  2MYS A;  2V26 A;  3EH2 A;  2CNW A;  5AGF A;  1D0Y A;  2YRF A;  1YLM A;  5B1A C;  5D91 A;  1M6T A;  2CNW D;  4MVZ A;  2XLV A;  3SYN A;  4AX2 A;  5KYX B;  4CJO A;  1OW6 A;  4MTF A;  4LDQ A;  4NTB A;  3NMK A;  3U3B A;  2IYL D;  1MMN A;  2HMQ A;  1SMY F;  3K1I C;  4FAP B;  3C18 A;  2A0B A;  4O6M A;  1TWC A;  3DWW A;  1O87 A;  1DOW A;  2LCH A;  2OKU A;  2L6G A;  3C8Z A;  4EBJ A;  5L3V A;  5DS5 A;  2XLH A;  3B0U X;  4NY3 A;  3B9Q A;  3FMS A;  5T3W A;  4XEK A;  2X0C A;  1R5I D;  4CDA A;  3FHD A;  3HTK C;  4IRU A;  5KYW A;  4PJL A;  1K04 A;  1SR2 A;  1A7V A;  2DI3 A;  1S05 A;  1LM3 B;  5FZT A;  1BDJ B;  4CIP A;  5JP7 A;  2ZPA A;  3JT1 A;  2Q9A A;  1VYI A;  3K1I A;  4G7Z F;  1MQV A;  2GFH A;  2LSE A;  4C7O B;  3CQZ A;  3AJM A;  2J9W A;  4NCQ A;  5DQZ A;  3G4Z A;  4ONS A;  1QSP A;  1C03 A;  2LD6 A;  2PF4 E;  3WHN A;  1NU9 C;  1D0Z A;  5DS4 A;  5A6J A;  3QW0 A;  3Q7G A;  5L3Q A;  3X1O A;  2AVK A;  3HNI A;  3JCU Q;  4KC9 A;  2H8A A;  3EGD A;  1H9T A;  3M1C B;  3GWN A;  2DB4 A;  3EHM A;  5KYW B;  4XLP F;  4N6C A;  2XL4 A;  4LLE A;  2Q9B A;  3NYM A;  4MND A;  5AC5 A;  3VAY A;  4N6H A;  5COG A;  2XLD A;  3UR3 C;  3DE9 A;  2HV6 A;  3V5X A;  3QVZ A;  3BEH A;  4WJ0 A;  2YL1 A;  3QW1 A;  3JYH A;  2LQG A;  1QVX A;  3SNH A;  3U0C A;  4QI0 A;  2IXP A;  4JTC B;  4QDL A;  3ZC4 A;  3LES A;  3NMI A;  5CI9 A;  5DLJ A;  4D4X A;  5JRA A;  2UUI A;  1YZA A;  1AVO B;  1OKK D;  4W8P A;  2WVQ A;  2AU5 A;  3EGD B;  2XLE A;  1IW7 F;  1D1B A;  1I5N A;  1YAR O;  4O7G A;  2BE5 F;  4YK5 A;  2KQ9 A;  4CS8 C;  2R7X A;  2FAP B;  1BR1 A;  4K0D A;  1WTY A;  4J32 B;  4PAC A;  1OW8 A;  1RXQ A;  2JX0 A;  3S0X A;  4OIR F;  1YVI A;  1OQC A;  3H2U A;  4PFO A;  4C7O A;  4JTD B;  4OIN F;  1CGO A;  1JPJ A;  3MX3 A;  3QMK A;  1NFO A;  4JEB A;  3W2V A;  2OJE D;  4U5H A;  3WG7 C;  5DQT A;  3LUT B;  3EZH A;  2Q7R A;  1T6Q A;  2EIN C;  4CS8 A;  1A7E A;  3L8J A;  1Q0F A;  1LE2 A;  5BQI A;  1OW7 A;  5HSW A;  2HSQ A;  2OEX A;  2AWY A;  2YKZ A;  2J46 A;  3TJ5 A;  4C3B A;  3EHN A;  3K6B A;  5EK0 A;  1HY5 A;  1E85 A;  2KC3 A;  2R7Q A;  3DAG A;  2A0U A;  1APC A;  2CGE A;  2XRH A;  5F5H A;  4AL1 A;  1QQ3 A;  2P1A A;  2YL0 A;  1GGQ A;  1YJG A;  2WVN A;  3Q6N A;  1LS1 A;  1OCO C;  1NLX A;  3LNR A;  4U9E A;  4EBK A;  4YT4 A;  1VTM P;  2R7U A;  5T1D B;  1FAP B;  2QLA A;  3EZI A;  2WB7 A;  4BEJ A;  3JRT A;  4U5C E;  4AK9 A;  1ST6 A;  4JCH A;  4BJT A;  1BR2 A;  3EFO A;  1ZZP A;  1I4Y A;  5A69 A;  4IAQ A;  1Y6D A;  2KNH A;  3JYY A;  2YWA A;  1ZU5 A;  2ICW G;  1FTS A;  3AG4 C;  3IQT A;  4P9F A;  4RDA A;  4DOZ A;  4UDV A;  3NKD A;  3WAQ A;  4YT8 A;  3F46 A;  4BPM A;  2WVO A;  2FGY A;  3HLZ A;  2XM4 A;  1H9G A;  3IQ5 A;  1OR2 A;  3U8V A;  2HSB A;  2HS5 A;  4CDY A;  5CI8 A;  4CIH A;  1E86 A;  1QPU A;  1U0B B;  1I4Z A;  1Z7Q c;  1G8X A;  2B0J A;  3DMD A;  3EPV A;  256B A;  3NYL A;  3AG1 C;  3SP1 A;  3KYJ A;  2CDQ A;  1WGW A;  3ZSU A;  1LVK A;  1YYX A;  1ORS C;  3NG1 A;  3B0P A;  4CX9 A;  2V3C C;  3EFO B;  4RD9 A;  4OIO F;  1YA9 A;  4W8K A;  5B1B C;  3TOM A;  3S28 A;  4JZA A;  5HV9 A;  1LE4 A;  1GM5 A;  2NUT A;  1M2V A;  2LFF A;  1LI5 A;  3UGO A;  4KBL A;  2Q9C A;  1V4A A;  1WOL A;  1TWH A; 
#chains in the Genus database with same CATH homology
 2OG2 A;  3NKE A;  4IAO A;  1ZU4 A;  3X2Q C;  4RBN A;  4E7S A;  4HFK B;  3VYW A;  1V54 C;  4FES A;  2HV7 A;  3SEO A;  4OD4 A;  2EIM C;  4OIQ F;  3Q6M A;  1FMV A;  4HFF B;  2KJG A;  3RH3 A;  2XXA A;  3SZR A;  3L0I A;  4DVZ A;  1J8M F;  4U5E E;  1M57 C;  3PHF 2;  2NUT B;  1M2V B;  3O6X A;  4YT2 A;  4C3E A;  2FFH A;  3PMR A;  2IXN A;  2G62 A;  3ABL C;  5KYY A;  1VYK A;  3W2W A;  2OCC C;  3RFY A;  1O5H A;  4LLC A;  2Y3H A;  3MLG A;  4I1O B;  4KNW A;  4YWQ A;  2R7W A;  4O6Y A;  2IOQ A;  4AE4 A;  2XXA B;  1VK5 A;  3GAN A;  5KYN A;  3N2Z B;  3OWT A;  1Z5Z A;  3UMH A;  4IWB A;  3UMI A;  4E7Z A;  2H7O A;  1VOM A;  1NG1 A;  5KYU A;  5KYY B;  2WZF A;  2A6H F;  4CS9 C;  1BR4 A;  5FCL A;  2J0X A;  4C3D A;  1SZI A;  4PJJ A;  2R7O A;  4AE4 B;  3LS1 A;  2QTV A;  1QLE C;  1ZHX A;  4PJN A;  2NUP A;  4J30 B;  4FWV A;  5KYU B;  3KH2 A;  4GYT A;  3TD7 A;  3K7D A;  4CS9 A;  1QZX A;  1M56 C;  3UMK A;  2Y3G A;  2WZL A;  2Z15 A;  2EIK C;  4DVY P;  3W8I A;  2R7R A;  1ZHY A;  5BUO A;  1D1A A;  2L9J A;  4F4B A;  4CBE A;  3ZG1 A;  2NUP B;  2WZG A;  4XTK A;  2DYR C;  1TWG A;  3FVY A;  2C03 A;  4JUR I;  3K66 A;  4IJJ A;  4HE8 D;  2YHS A;  1OCR C;  5E3C A;  3NYJ A;  2YEV A;  4B6I A;  1OCC C;  2QY9 A;  4CSA C;  4PK4 A;  3E70 C;  1Z3I X;  3K33 A;  3LLK A;  3DZA A;  3Q7L A;  4DOZ A;  4YT5 A;  4OD5 A;  2J7P A;  2J9U A;  1TKN A;  5B3S C;  2O9X A;  1V55 C;  2P6V A;  3DJU B;  2VH3 A;  2NG1 A;  3EJN A;  4CSA A;  3CZ6 A;  2G3K A;  4I1M A;  3I5Q A;  2A68 F;  3N24 A;  2W4M A;  5T3T A;  3EH1 A;  4O79 A;  5E33 A;  3OA1 A;  3L34 A;  2Y3D A;  3POV A;  5E2Q A;  1IZM A;  2DGJ A;  2PX0 A;  2H7V C;  4JJG A;  1TWA A;  4MQ9 F;  4ZLD A;  4H4K C;  3W8H A;  4N06 A;  3O39 A;  2EIJ C;  2X51 A;  4BJ5 C;  3DJN B;  3AQC A;  3DM9 B;  3RYL A;  2W9Y A;  3T6J A;  2J0W A;  4XLN F;  4O6N A;  3DXJ F;  1KU2 A;  2D5R B;  3ABM C;  1FFH A;  5DS6 A;  2Y39 A;  2A69 F;  2IXO A;  2WL8 A;  4BJ6 C;  1ZHZ A;  4ANJ A;  1M2O A;  2M4E A;  2J9V A;  4BJ5 A;  5IY5 C;  3AG3 C;  4U5D E;  3RKO F;  1VMA A;  4I3M A;  3LAY A;  2ZXP A;  4PFP A;  4XWJ A;  3V7O A;  2P7V A;  1RJ9 A;  4M63 A;  3NRH A;  4YN0 B;  1D1C A;  3GOD A;  3H65 A;  1TR2 A;  4BJ6 A;  1MMD A;  3CSK A;  3KKB A;  1SF8 A;  2R7V A;  3FDQ A;  1S7Z A;  4JJF A;  4OIP F;  1RJ9 B;  3B0V C;  1FMW A;  4P6I C;  5DVW A;  4Q5S F;  1PD0 A;  2Y3B A;  2DYS C;  3NDB B;  2L81 A;  2Q3T A;  3EGX A;  2W45 A;  3AQB A;  2VB6 A;  1Z6A A;  3JSZ A;  5D92 A;  4U5F E;  4CS7 A;  1NU7 D;  2I8B A;  2YZS A;  2R7S A;  3I4U A;  4LAC B;  4G0H A;  3S27 A;  3OEO A;  3LLI A;  4EBB A;  2Y69 C;  3QZC A;  1OKK A;  4K7B A;  3UNG C;  4DBR A;  3EGX B;  3DM5 A;  2J45 A;  1NZE A;  3KL4 A;  4G7H F;  5F5F A;  1Z63 A;  3I5P A;  3LJB A;  2W4B A;  4EWC A;  1MMA A;  2A6E F;  2CW0 F;  1ZHW A;  2H7B A;  2ZXO A;  4HEA J;  5EGY A;  3EG9 A;  3ECS A;  1PCX A;  2ZXW C;  4PJM A;  3WOD F;  2XSE A;  1D0X A;  4BG0 A;  4ULW A;  3T4R A;  3LS0 A;  3HJC A;  2IXM A;  2MWQ A;  1MNE A;  2J7P D;  2PX3 A;  2VAS A;  3FAJ A;  1Z23 A;  2PP4 A;  4JVS A;  1W2W A;  3UGP A;  4U5G A;  1LKX A;  2R7T A;  3DD7 A;  3ZIB A;  2G3V A;  1N1C A;  4BJ1 A;  1ZYR F;  3EG9 B;  4A2N B;  3RIP A;  3ASN C;  1OCZ C;  4YJW A;  2PFD A;  3IEE A;  5E3A A;  4GEH A;  3S29 A;  4ZLC A;  2A1D D;  4KI2 A;  3ASO C;  2C04 A;  3K1H A;  3DAF A;  3KMI A;  2EIL C;  3EQL F;  4U5B E;  4FX5 A;  1MMG A;  4JW1 A;  1J8Y F;  1ZHT A;  4G7O F;  4LER A;  4X0R A;  2KGO A;  4KNV A;  5KYX A;  1PD1 A;  5EHH A;  1FFT C;  4QI2 A;  1MND A;  4Q7C A;  3E9V A;  3ZVR A;  3AG2 C;  3LEV A;  3ABK C;  3F47 A;  2ZXR A;  3ITF A;  2JD3 A;  4I44 A;  1JPN A;  4DBQ A;  3N0T A;  2E87 A;  2KW3 C;  2MYS A;  2V26 A;  3EH2 A;  2CNW A;  3T6B A;  1D0Y A;  4AX2 A;  5B1A C;  3SYN A;  5D91 A;  2CNW D;  4BEJ A;  4C7O A;  5KYX B;  2IYL D;  1MMN A;  3K1I C;  1SMY F;  4O6M A;  1TWC A;  1O87 A;  5L3V A;  3B0U X;  4NY3 A;  3B9Q A;  5T3W A;  3FHD A;  3HTK C;  4IRU A;  5KYW A;  4PJL A;  2ZPA A;  3JT1 A;  2Q9A A;  1VYI A;  4G7Z F;  2GFH A;  4C7O B;  2LSE A;  3CQZ A;  2J9W A;  5DQZ A;  2PF4 E;  1NU9 C;  1D0Z A;  5DS4 A;  3Q7G A;  5L3Q A;  3X1O A;  3JCU Q;  4KC9 A;  3EGD A;  3M1C B;  5KYW B;  3EHM A;  4XLP F;  2XL4 A;  4LLE A;  2Q9B A;  3NYM A;  4MND A;  3VAY A;  3UR3 C;  2HV6 A;  4WJ0 A;  3JYH A;  3SNH A;  4QI0 A;  2IXP A;  4QDL A;  3ZC4 A;  3LES A;  5CI9 A;  5DLJ A;  1OKK D;  2WVQ A;  3EGD B;  1IW7 F;  1D1B A;  4O7G A;  2BE5 F;  2KQ9 A;  4CS8 C;  2R7X A;  1BR1 A;  4K0D A;  4J32 B;  3S0X A;  4OIR F;  4PFO A;  4OIN F;  3MX3 A;  1JPJ A;  3QMK A;  3W2V A;  4U5H A;  3WG7 C;  5DQT A;  3EZH A;  2EIN C;  4CS8 A;  4Q4Z F;  5DS5 A;  5HSW A;  4C3B A;  2J46 A;  3EHN A;  3K6B A;  2R7Q A;  3DAG A;  2XRH A;  2CGE A;  5F5H A;  3Q6N A;  2WVN A;  1LS1 A;  1OCO C;  3LNR A;  4YT4 A;  2R7U A;  5T1D B;  3EZI A;  2WB7 A;  3JRT A;  4U5C E;  4AK9 A;  1ST6 A;  4JCH A;  4BJT A;  1BR2 A;  3EFO A;  2KNH A;  1ZU5 A;  1FTS A;  3AG4 C;  4RDA A;  3NKD A;  4YT8 A;  3F46 A;  2WVO A;  2FGY A;  3HLZ A;  4CIH A;  5CI8 A;  1G8X A;  2B0J A;  3DMD A;  3EPV A;  3NYL A;  3AG1 C;  3SP1 A;  2CDQ A;  1WGW A;  3ZSU A;  1LVK A;  3NG1 A;  3B0P A;  2V3C C;  4OIO F;  3EFO B;  4RD9 A;  4W8K A;  5B1B C;  3S28 A;  4JZA A;  2NUT A;  1M2V A;  3UGO A;  4KBL A;  2Q9C A;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...