3E9VA

Crystal structure of human b-cell translocation gene 2 (btg2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BTG2
publication title Crystal structure of human B-cell Translocation Gene 2 (BTG2)
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3e9vA00
5CI8A 5CI9A 3E9VA 3DJNB 2Z15A 3DJUB 2D5RB
chains in the Genus database with same CATH superfamily
4O6MA 5KYXA 4MVSA 3LS0A 2W4MA 4JIOA 4G7HF 1FMVA 3NMJA 1O87A 3L34A 3PCVA 1Q0MA 1YA7O 3IPMO 5A6JA 1EKYA 1Y4CA 2KYHA 4XEVA 4O6YA 1QKRA 3O55A 3TULA 3QMKA 3U2MA 1FMWA 1TQGA 5CIVA 1ORSC 3N24A 3ZG1A 1M2OA 1NU7D 2QNLA 3T9OA 1WATA 1V74B 3N2ZB 1JRAA 3V5ZA 2VB6A 4OD5A 3IQ5A 4U5GA 4E7ZA 2VCCA 4EBKA 1W2WA 2EPMX 4AK9A 3S0XA 3T6JA 1Q0DA 1GQAA 3GEIA 3TD7A 5JT4A 3MX3A 4U9DA 3QW1A 3RVZA 3S27A 2XLOA 5BUOA 5JS5A 1E85A 5L0CA 4LDKA 4XPXA 2GDCA 2WVOA 3AQBA 3TK0A 4OIPF 3SYNA 1MMDA 2IXOA 4N6CA 3RW0A 1LS1A 1VB5A 1HMDA 2YRFA 1MMAA 4I3MA 1BR1A 3DJNB 4MVQA 5E33A 3EGDA 3AG2C 1U0BB 3PDMP 1NSGB 2VCBA 3DE8A 2NUPB 3EFOB 4PJJA 4BEJA 2Y69C 4L6RA 2QLAA 2W4BA 1H9TA 3L8IA 2YL3A 5A6KA 2P0NA 3ZDLA 3G50A 1TFKB 2ZPAA 3JCUQ 1Z23A 3NYMA 1RCPA 3M15A 5F28E 1QSPA 2XL8A 2NUTA 5DQZA 2NSFA 3L1MA 1G5ZA 2E87A 4ULVA 1Z6AA 3G4XA 4WABA 3SXZA 1CPRA 5L0FA 3AGTA 5F5FA 2QY9A 5AC5A 2L81A 2CYDA 4DBRA 4MNDA 2CDQA 1J8MF 3FMSA 3K7DA 2LFFA 3B71A 4NTBA 4EIYA 1YDIA 3KKBA 1JOGA 4U9EA 4ZLDA 2HUJA 1UG7A 1TWAA 2H7VC 2GWWA 3WODF 5T1DB 2EILC 3EQLF 4JTCB 3GM2A 1WASA 2RSEB 5DS6A 4H4KC 4DVZA 3TJ6A 5AC4A 4LERA 3I4UA 4X0RA 4A4AA 1TR2A 1SYQA 1A7DA 1SMYF 4YWQA 4CSAC 1RKEA 3UMHA 2YL1A 1UFBA 3RYLA 3OWTA 2J9BA 1XZQA 4XWJA 1YVIA 1OR2A 2R9RB 1R5ID 3AJMA 4NTFA 4R32A 1PD1A 4IJJA 3KPHA 1ZHTA 3FHDA 3ZSUA 1FFHA 3DE9A 2A0UA 3I5QA 1GS9A 3C62A 3LS1A 4Q4ZF 2R7SA 4HFKB 1OKKD 2DYRC 4O79A 4YL1A 3TOMA 4PJLA 4J7YA 1LE4A 1ZZPA 1O5HA 1BZ4A 3EZIA 4RD9A 4CJGA 2OCCC 1JMWA 3L0IA 3ECSA 1VTMP 1PV3A 2P1AA 1VLTA 2HKVA 2MHRA 3IQCA 3LLIA 4XPYA 3U8PA 3VAYA 2J9UA 1MQVA 2HSQA 4HE8D 2EPNA 2WB7A 3H65A 1M57C 4JEBA 3GWNA 4PFOA 1OQCA 3JSZA 2Z15A 4DBQA 3FAJA 2J7PD 3EG9B 5L3QA 3LEVA 2A68F 1V54C 1PD0A 4NTAA 4BG0A 3EPVA 3FOPA 4YL3A 2QTVA 4EHPA 4AE4B 2HJMA 3EGXB 3JTLO 4I44A 3V5YA 1JPJA 4JKVA 3LLKA 3O6XA 3NMIA 3OEOA 2GAQA 4JRZA 3NMKA 1ZYRF 3LNMB 1Z7Qc 3RQEA 2A69F 4BJ6A 5A6BA 2XLDA 3VYWA 3LNRA 2KC3A 4OINF 3U8VA 2R03A 1M2VB 2YEVA 2J0WA 3U9JA 1Z63A 4BJ1A 3OA1A 4FX5A 4LLEA 1TWGA 4U5HA 2R7QA 4MTFA 3BRJA 2LIGA 4YJWA 1ZHWA 2A0BA 3GORA 2J9VA 3A11A 1V4AA 4NY3A 1T6QA 3C8GD 4CIPA 3HNIA 2KW3C 1T6IA 4BEMJ 4CS7A 4IAOA 3X2QC 2YQYA 3IQTA 2NG1A 3DKAA 1MNEA 5BQHA 2IOQA 3GODA 1BBHA 3W4YA 4ULWA 4M63A 2A6EF 5E3CA 3U3BA 4YT4A 5KYNA 2XLHA 1A0BA 4JEAA 5L0IA 1MMGA 3CEXA 3S29A 2CNWD 2J0XA 2JPUA 3CZ6A 3HJCA 4J7TA 4PJNA 4W8PA 2J9WA 2PFDA 3NYJA 4C3DA 4XTKA 4CDVA 5F5HA 5EGYA 5A6AA 4UDVA 3ASNC 3CAXA 4ZLCA 2XLVA 3I5PA 5EK0A 3U5SA 4EKWA 1FNTc 4LDQA 1SF8A 3KH2A 3LAYA 3GM3A 4XEKA 3SEOA 2R7RA 1TKNA 3K6BA 3CQZA 3O39A 1OW6A 3JZ0A 4NC3A 2NSGA 4CIHA 1RJ9A 1VMAA 2IYLD 2FAPB 2WZFA 1VOMA 2WL8A 5BQIA 2XXAB 3S28A 4CDYA 2HV7A 1ZU5A 2VASA 3RQGA 1T6UA 2H7OA 3RKOF 5L0GA 4J30B 2EPKX 1SR2A 3C8GB 1LKXA 3T6BA 3ASOC 4DRIB 4KC9A 3BEHA 5E3AA 1RXQA 3ZWIA 2XS1A 4E17A 3JYYA 2L6HA 2FFHA 2OOCA 1BR4A 1N1CA 3Q6MA 3DI5A 1WN0A 3GWLA 1VK5A 2IM8A 3WHNA 1CGME 4DRJB 3N0TA 256BA 4G0HA 4K7BA 4BJ6C 3SNHA 3QVYA 5T3WA 4G78A 3WAQA 4DOZA 4XLPF 1U89A 2W45A 1D1AA 3MBGA 4MVRA 1L3PA 3GANA 1D1BA 5L0JA 1OKKA 2M64A 3HLZA 3DAFA 1IZMA 2JD3A 4KNVA 1T5OA 1OXKA 4Z9HA 3X1OA 5KYYB 4C7OA 1G4WR 2VH3A 2LP4A 5DVWA 2YVKA 5L0HA 2IXNA 3JRMO 3NYLA 3DM9B 1RKCA 2AVKA 2XSEA 1ST6A 3DJUB 1SZIA 1NFNA 2OU6A 2Q00A 1K40A 3RF3A 1QPUA 1XZPA 3DXJF 3ZC4A 1V55C 2UUHA 5DQTA 3ABKC 4N4WA 2MWQA 3HNKA 2H7BA 3W8HA 3O10A 3UGPA 2XRHA 4IWBA 3A9CA 4Z9JA 2I15A 2M4EA 1E2XA 4YT5A 1C17M 4F4BA 3ITFA 5A69A 4HEAJ 2KGOA 2MYSA 3AG1C 2EIKC 4YK5A 2J7PA 4Q7CA 3ZIBA 1YA9A 2IXPA 3DD7A 1YYJA 3LEOA 2XL4A 3K1IC 4LACB 4PK4A 3PHF2 2G62A 2ETSA 3FOOA 3IQ6A 1ZU4A 2WZGA 5B3IA 5CI9A 2ZD9A 5DS4A 2TMVP 2CGEA 4RDAA 3U9MA 2CW0F 2I8BA 2CCYA 3RVYA 1A7VA 2DB4A 2F22A 3EZHA 3F47A 1G8XA 2GA0A 1RMVA 3SZRA 1ZW3A 4CJOA 4CS8A 2HS5A 3ZQYA 2AWCA 2XLMA 3DM5A 5KYUB 1VYKA 1A7EA 4KBLA 3HNJA 3TQOA 2FGYA 2IXMA 4DJ9A 2LSEA 2PX0A 3DAGA 1D0ZA 2HJ3A 4AL0A 1WWPA 1LIHA 4FWVA 1Q0FA 3JYHA 2R7OA 2KSFA 2XM0A 2OG2A 3B9QA 4KI2A 4MTOA 2D5RB 1LVKA 1NU9C 1IW7F 3LUTB 5E2QA 3W8IA 2PBEA 3NRHA 4P6IC 5DLJA 4DXWA 1FTSA 3POVA 1ZHYA 4IB4A 1VLSA 1Y6DA 1QLEC 3VRCA 4HFFB 3ZTMA 1WOLA 1ZW2A 1NLXA 3GM1A 2O9XA 2XL6A 4MVOA 4OIOF 3T4RA 1QVXA 1D1CA 3SXMA 5HV9A 1H6GA 3QW0A 3QVZA 4PACA 2HMZA 3RQFA 4N6HA 3FXHA 2Y3GA 3JT1A 3WG7C 1H9GA 3L8JA 4AL1A 3U2LA 4LDRA 4G7OF 2C03A 4JW1A 4CX9A 2L7AA 3NKDA 4FAPB 4XPWA 2WVNA 3VF0A 2LD6A 4JE9A 3CSKA 4WJ0A 2AP3A 1ORJA 3EFOA 2NUPA 5COMA 3TOLA 2OQMA 4XQ1A 3M4BA 5T3TA 1CPQA 1YARO 2KK1A 1LPEA 4D4XA 3HKKA 1DOWA 4BJTA 2R7UA 1NG1A 2RD9A 5L3VA 2ICWG 2UUIA 2BL2A 2Q9AA 4JJGA 4N06A 2PNOA 5AGFA 1LE2A 1HY5A 2DGJA 3B29A 3K1HA 5KYUA 4GYTA 2Q7RA 3LJBA 3E9VA 3PMRA 2D4UA 3DMDA 4FESA 1FFTC 4KNWA 4DRHB 1LS4A 1NFOA 1KU2A 5L0DA 3RIPA 2YL7A 4QI2A 2X51A 2WZLA 4WGZA 4QDLA 2XLEA 3R7CA 1S05A 3UMIA 3K1IA 4CS8C 4GQHA 1E86A 3EGDB 4MS2A 4EBBA 3EHNA 3AQCA 3Q7GA 3B0UX 3UGOA 1B68A 2EINC 4G7ZF 2J45A 4OIQF 1YZAA 5B1BC 2HV6A 3Q6NA 1CGNA 2NUTB 4PR9A 2OEXA 4E18A 5FZTA 3FVYA 1J8YF 5GPGB 1OCRC 1ORYA 3SXKA 2H8AA 4JJFA 2V3CC 4LLCA 3C8ZA 2B0JA 1OCCC 4CDAA 2Q4FA 4O7GA 3TJ5A 4U5DE 1AVOB 4YL0A 1U6HA 1Z5ZA 2KJGA 1D0YA 1LM3B 3DZAA 4IGGA 3EG9A 4K0DA 2VC9A 1TWCA 2A1DD 3NKEA 4JTDB 1Q0GA 3C7JA 1T9KA 3W2WA 2Y3BA 1L7CA 4MVZA 3S90A 1KTMA 1HE9A 2DYSC 2OKUA 2ZXWC 4AE4A 3LESA 1MMNA 3EGXA 4P9FA 1YZCA 4U5CE 2Y3HA 3V7OA 4GEHA 3ATPA 5A6BD 3AOUA 3S84A 1AEPA 2KQ9A 4JZAA 2R7VA 4IRUA 1NZEA 2OJQA 1H7IA 5DS5A 2LFDA 4EBJA 5IY5C 1EQ1A 2LK4A 4XEFA 2G3VA 4EWCA 1ZHXA 3J06A 1M2VA 3QTHA 1Q0KA 1ZHZA 2EPOA 4I1OB 2ASRA 2BE5F 4E0HA 3AG3C 4D4NA 2R7TA 4JC7A 1HMOA 2YLDA 4JURI 3SXYA 5K0IA 5KYWB 1A41A 1MNDA 5JP7A 3H2UA 4IARA 1E84A 3F46A 1M56C 3MYFA 1JPNA 4U5BE 4B6IA 4BJ5A 2Y3DA 2AU5A 3E70C 1HE1A 2EIMC 4IAQA 1K04A 3C18A 5D91A 3M4CA 1OR3A 4MVUA 3RH3A 3KL4A 2G3KA 1C02A 4JCZA 1QZXA 1BR2A 4U5EE 3G4ZA 1WTYA 3IHUA 2YL0A 3AG4C 5BQGA 1PCXA 4QI0A 4OIRF 4H54A 2L9JA 4U5FE 4ONSA 3K66A 2J8WA 2ZXPA 3FAPB 4RBNA 2ZXOA 3GEEA 2R7WA 4Z9IA 2XXAA 4MVMA 1JAFA 4K1OA 3DWWA 1FR0A 2YHSA 1GGQA 1M6TA 3EH2A 1YLMA 2P7VA 4MW8A 3C8GA 2HMQA 2YWAA 4CS9A 1EA8A 3C63A 1TFOB 1OW8A 1OW7A 2GFHA 5JUAA 2V26A 3ABMC 3VM6A 4JCHA 2C04A 1BDJB 2BC5A 2YKZA 3B0VC 4BPMA 2VCAA 1I4YA 1YAUO 2OJED 2R05A 2NPUA 3M79A 4PFPA 5D92A 3W2VA 4CBEA 1R4TA 2R7XA 3JRTA 3QZCA 2R25A 4E0IA 2B0HA 2CNWA 1AUEA 4W8KA 5B1AC 1WGWA 3MFNA 3MYIA 4C3EA 5JRAA 5KYXB 4A2NB 5TJ5E 5JVEA 3SP1A 2A6HF 2XM4A 2PP4A 3UMKA 3UNGC 5KYYA 1OCZC 2XLWA 2YLGA 3B0PA 1OCOC 3KYJA 4ER9A 3ABLC 4EUKB 2PX3A 4YT2A 1I4ZA 4J32B 1RJ9B 1GM5A 2Y39A 4MW3A 1K05A 2IBFA 2JX0A 1DOVA 3RFYA 1QQ3A 1O3UA 3GEHA 1CGOA 4BJ5C 2XS8A 1FAPB 2Q9BA 2KNHA 1HW1A 3EH1A 1D0XA 1F1MA 3H2VA 3MLGA 5JSLA 4C3BA 2DI3A 2AWYA 1S7ZA 2HSBA 2HFIA 3HNLA 4JTAB 4AX2A 2EIJC 1HW2A 2P61A 4JVSA 3NDBB 4WGYA 3ZTZA 2HZ8A 4NCQA 3NG1A 2Q3TA 1LI7A 1YJGA 2J46A 1KNYA 1Z3IX 3S9OA 3UR3C 1EI7A 4OD4A 5HSWA 1T01A 1TWHA 3T6GB 3US6A 3KMIA 4PJMA 5FCLA 3HTKC 3ZVRA 2P6VA 2L6GA 3ZQVA 4E7SA 2W9YA 1E83A 2R02A 3Q7LA 5JLIA 4C7OB 4MTGA 2QUPA 5COFA 2QE9A 1I5NA 1LI5A 3K33A 5EHHA 3R2PA 4ANJA 4YT8A 2WVQA 3JSEO 1G4US 4P9TA 3AGUA 4Q5SF 1C03A 2PF4E 1NBBA 4CS9C 3V5XA 3IEEA 1XWJA 1VYIA 2L6FA 2OEVA 1JR8A 5CI8A 2LQGA 3EHMA 4I1MA 4O6NA 5COGA 4DVYP 2YLIA 3U3FA 5B3SC 3U0CA 3FDQA 3EJNA 3KYIA 3M1CB 5KYWA 2EPLX 2ZXRA 1OXBA 4CSAA 1YYXA 4YN0B 4NQFA 2X0CA 1ZVZA 2LCHA 1RKEB 4XLNF 1APCA 2YZSA 2Q9CA 4MQ9F
chains in the Genus database with same CATH topology
4O6MA 5KYXA 3LS0A 2W4MA 4G7HF 1FMVA 1O87A 3L34A 4O6YA 3QMKA 1FMWA 3N24A 3ZG1A 1M2OA 1NU7D 3N2ZB 2VB6A 4OD5A 4U5GA 4E7ZA 1W2WA 4AK9A 3S0XA 3T6JA 3TD7A 3MX3A 5BUOA 3S27A 4OIPF 2WVOA 3AQBA 3SYNA 1MMDA 2IXOA 1LS1A 1MMAA 4I3MA 1BR1A 3DJNB 5E33A 3EGDA 3AG2C 3EFOB 2NUPB 4PJJA 4BEJA 2Y69C 2W4BA 3JCUQ 2ZPAA 1Z23A 3NYMA 2NUTA 5DQZA 2E87A 1Z6AA 5F5FA 2QY9A 2L81A 4DBRA 4MNDA 2CDQA 1J8MF 3K7DA 3KKBA 4ZLDA 1TWAA 2H7VC 3WODF 5T1DB 2EILC 3EQLF 5DS6A 4H4KC 4DVZA 4LERA 3I4UA 4X0RA 4YWQA 1TR2A 4CSAC 1SMYF 3UMHA 3RYLA 3OWTA 4XWJA 1PD1A 4IJJA 3ZSUA 1ZHTA 3FHDA 1FFHA 3I5QA 3LS1A 2R7SA 4HFKB 1OKKD 2DYRC 4O79A 4PJLA 1O5HA 3EZIA 4RD9A 2OCCC 3L0IA 3ECSA 3LLIA 3VAYA 2J9UA 4HE8D 2WB7A 3H65A 1M57C 4PFOA 3JSZA 2Z15A 4DBQA 3FAJA 2J7PD 3EG9B 5L3QA 3LEVA 2A68F 1V54C 1PD0A 4BG0A 3EPVA 2QTVA 4AE4B 3EGXB 4I44A 1JPJA 3LLKA 3O6XA 3OEOA 4Q4ZF 1ZYRF 4BJ6A 2A69F 3VYWA 3LNRA 4OINF 1M2VB 2YEVA 2J0WA 1Z63A 4BJ1A 3OA1A 4FX5A 4LLEA 1TWGA 4U5HA 2R7QA 4YJWA 1ZHWA 2J9VA 4NY3A 2KW3C 4CS7A 4IAOA 3X2QC 2NG1A 1MNEA 2IOQA 3GODA 4ULWA 4M63A 2A6EF 5E3CA 4YT4A 5KYNA 1MMGA 3S29A 2CNWD 2J0XA 3CZ6A 3HJCA 4PJNA 4C3DA 2J9WA 2PFDA 3NYJA 4XTKA 5EGYA 5F5HA 3ASNC 4ZLCA 3I5PA 1SF8A 3KH2A 3LAYA 2R7RA 3SEOA 1TKNA 3K6BA 3CQZA 3O39A 4CIHA 1RJ9A 1VMAA 2IYLD 2WZFA 1VOMA 2WL8A 2XXAB 3S28A 2HV7A 1ZU5A 2VASA 2H7OA 3RKOF 4J30B 1LKXA 3T6BA 3ASOC 4KC9A 5E3AA 2FFHA 1BR4A 1N1CA 3Q6MA 1VK5A 3N0TA 4K7BA 4G0HA 4BJ6C 3SNHA 5T3WA 4XLPF 4DOZA 2W45A 1D1AA 3GANA 1D1BA 1OKKA 3HLZA 3DAFA 1IZMA 2JD3A 4KNVA 3X1OA 5KYYB 4C7OA 2VH3A 5DVWA 2IXNA 3NYLA 3DM9B 2XSEA 1ST6A 3DJUB 1SZIA 3ZC4A 3DXJF 5DQTA 1V55C 3ABKC 2MWQA 3UGPA 2H7BA 3W8HA 2XRHA 4IWBA 2M4EA 4YT5A 5KYWB 4F4BA 3ITFA 4HEAJ 2KGOA 2MYSA 3AG1C 2EIKC 2J7PA 4Q7CA 3ZIBA 3DD7A 2IXPA 4LACB 5KYUB 4PK4A 2XL4A 3K1IC 3PHF2 2G62A 1ZU4A 2WZGA 5CI9A 5DS4A 2CGEA 4RDAA 2CW0F 2I8BA 3EZHA 3F47A 1G8XA 3SZRA 4CS8A 3DM5A 1VYKA 4KBLA 2FGYA 2IXMA 2LSEA 2PX0A 3DAGA 1D0ZA 4FWVA 3JYHA 2R7OA 3B9QA 2OG2A 4KI2A 2D5RB 1LVKA 1NU9C 1IW7F 5E2QA 3W8IA 3NRHA 4P6IC 5DLJA 1FTSA 3POVA 1ZHYA 1QLEC 4HFFB 4OIOF 2O9XA 3T4RA 1D1CA 3JT1A 2Y3GA 3WG7C 4G7OF 2C03A 4JW1A 3NKDA 2WVNA 3CSKA 4WJ0A 3EFOA 2NUPA 5T3TA 4BJTA 2R7UA 1NG1A 5L3VA 2Q9AA 4JJGA 4N06A 2DGJA 3K1HA 5KYUA 4GYTA 3LJBA 3E9VA 3PMRA 3DMDA 4FESA 1FFTC 4KNWA 4QI2A 1KU2A 3RIPA 2X51A 2WZLA 4QDLA 3UMIA 4CS8C 3EGDB 4EBBA 3EHNA 3AQCA 3Q7GA 3B0UX 3UGOA 2EINC 4G7ZF 2J45A 4OIQF 5B1BC 2HV6A 3Q6NA 2NUTB 3FVYA 1J8YF 2V3CC 1OCRC 4JJFA 4LLCA 2B0JA 1OCCC 4O7GA 4U5DE 1Z5ZA 2KJGA 1D0YA 3DZAA 3EG9A 4K0DA 1TWCA 2A1DD 3NKEA 3W2WA 2Y3BA 2DYSC 2ZXWC 4AE4A 3LESA 1MMNA 3EGXA 4U5CE 3V7OA 2Y3HA 4GEHA 2R7VA 4JZAA 2KQ9A 4IRUA 1NZEA 5DS5A 5IY5C 2G3VA 4EWCA 1ZHXA 1M2VA 1ZHZA 4I1OB 2BE5F 3AG3C 2R7TA 4JURI 1MNDA 3F46A 1M56C 1JPNA 4U5BE 4B6IA 4BJ5A 2Y3DA 3E70C 2EIMC 5D91A 3RH3A 3KL4A 2G3KA 1QZXA 1BR2A 4U5EE 3AG4C 1PCXA 4QI0A 4OIRF 2L9JA 4U5FE 3K66A 2ZXPA 4RBNA 2ZXOA 2R7WA 2XXAA 2YHSA 3EH2A 2P7VA 4CS9A 2GFHA 2V26A 3ABMC 4JCHA 2C04A 3B0VC 4PFPA 5D92A 3W2VA 2R7XA 4CBEA 3JRTA 3QZCA 4W8KA 2CNWA 5B1AC 1WGWA 4C3EA 5KYXB 4A2NB 3SP1A 2A6HF 2PP4A 3UMKA 3UNGC 5KYYA 1OCZC 3B0PA 1OCOC 3ABLC 2PX3A 4YT2A 4J32B 1RJ9B 2Y39A 3RFYA 4BJ5C 2Q9BA 2KNHA 3EH1A 3MLGA 1D0XA 5KYWA 4C3BA 1S7ZA 4AX2A 2EIJC 4JVSA 3NDBB 3NG1A 2Q3TA 2J46A 1Z3IX 3UR3C 5HSWA 4OD4A 1TWHA 3KMIA 4PJMA 5FCLA 3HTKC 3ZVRA 2P6VA 4E7SA 2W9YA 3Q7LA 4C7OB 5EHHA 3K33A 4ANJA 4YT8A 2WVQA 4Q5SF 2PF4E 4CS9C 3IEEA 5CI8A 1VYIA 3EHMA 4I1MA 4O6NA 4DVYP 3FDQA 5B3SC 3EJNA 3M1CB 2ZXRA 4CSAA 4YN0B 4XLNF 2YZSA 2Q9CA 4MQ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI8 A;  5CI9 A;  3E9V A;  3DJN B;  2Z15 A;  3DJU B;  2D5R B; 
#chains in the Genus database with same CATH topology
 4O6M A;  5KYX A;  4MVS A;  3LS0 A;  2W4M A;  4JIO A;  4G7H F;  1FMV A;  3NMJ A;  1O87 A;  3L34 A;  3PCV A;  1Q0M A;  1YA7 O;  3IPM O;  5A6J A;  1EKY A;  1Y4C A;  2KYH A;  4XEV A;  4O6Y A;  1QKR A;  3O55 A;  3TUL A;  3QMK A;  3U2M A;  1FMW A;  1TQG A;  5CIV A;  1ORS C;  3N24 A;  3ZG1 A;  1M2O A;  1NU7 D;  2QNL A;  3T9O A;  1WAT A;  1V74 B;  3N2Z B;  1JRA A;  3V5Z A;  2VB6 A;  4OD5 A;  3IQ5 A;  4U5G A;  4E7Z A;  2VCC A;  4EBK A;  1W2W A;  2EPM X;  4AK9 A;  3S0X A;  3T6J A;  1Q0D A;  1GQA A;  3GEI A;  3TD7 A;  5JT4 A;  3MX3 A;  4U9D A;  3QW1 A;  3RVZ A;  3S27 A;  2XLO A;  5BUO A;  5JS5 A;  1E85 A;  5L0C A;  4LDK A;  4XPX A;  2GDC A;  2WVO A;  3AQB A;  3TK0 A;  4OIP F;  3SYN A;  1MMD A;  2IXO A;  4N6C A;  3RW0 A;  1LS1 A;  1VB5 A;  1HMD A;  2YRF A;  1MMA A;  4I3M A;  1BR1 A;  3DJN B;  4MVQ A;  5E33 A;  3EGD A;  3AG2 C;  1U0B B;  3PDM P;  1NSG B;  2VCB A;  3DE8 A;  2NUP B;  3EFO B;  4PJJ A;  4BEJ A;  2Y69 C;  4L6R A;  2QLA A;  2W4B A;  1H9T A;  3L8I A;  2YL3 A;  5A6K A;  2P0N A;  3ZDL A;  3G50 A;  1TFK B;  2ZPA A;  3JCU Q;  1Z23 A;  3NYM A;  1RCP A;  3M15 A;  5F28 E;  1QSP A;  2XL8 A;  2NUT A;  5DQZ A;  2NSF A;  3L1M A;  1G5Z A;  2E87 A;  4ULV A;  1Z6A A;  3G4X A;  4WAB A;  3SXZ A;  1CPR A;  5L0F A;  3AGT A;  5F5F A;  2QY9 A;  5AC5 A;  2L81 A;  2CYD A;  4DBR A;  4MND A;  2CDQ A;  1J8M F;  3FMS A;  3K7D A;  2LFF A;  3B71 A;  4NTB A;  4EIY A;  1YDI A;  3KKB A;  1JOG A;  4U9E A;  4ZLD A;  2HUJ A;  1UG7 A;  1TWA A;  2H7V C;  2GWW A;  3WOD F;  5T1D B;  2EIL C;  3EQL F;  4JTC B;  3GM2 A;  1WAS A;  2RSE B;  5DS6 A;  4H4K C;  4DVZ A;  3TJ6 A;  5AC4 A;  4LER A;  3I4U A;  4X0R A;  4A4A A;  1TR2 A;  1SYQ A;  1A7D A;  1SMY F;  4YWQ A;  4CSA C;  1RKE A;  3UMH A;  2YL1 A;  1UFB A;  3RYL A;  3OWT A;  2J9B A;  1XZQ A;  4XWJ A;  1YVI A;  1OR2 A;  2R9R B;  1R5I D;  3AJM A;  4NTF A;  4R32 A;  1PD1 A;  4IJJ A;  3KPH A;  1ZHT A;  3FHD A;  3ZSU A;  1FFH A;  3DE9 A;  2A0U A;  3I5Q A;  1GS9 A;  3C62 A;  3LS1 A;  4Q4Z F;  2R7S A;  4HFK B;  1OKK D;  2DYR C;  4O79 A;  4YL1 A;  3TOM A;  4PJL A;  4J7Y A;  1LE4 A;  1ZZP A;  1O5H A;  1BZ4 A;  3EZI A;  4RD9 A;  4CJG A;  2OCC C;  1JMW A;  3L0I A;  3ECS A;  1VTM P;  1PV3 A;  2P1A A;  1VLT A;  2HKV A;  2MHR A;  3IQC A;  3LLI A;  4XPY A;  3U8P A;  3VAY A;  2J9U A;  1MQV A;  2HSQ A;  4HE8 D;  2EPN A;  2WB7 A;  3H65 A;  1M57 C;  4JEB A;  3GWN A;  4PFO A;  1OQC A;  3JSZ A;  2Z15 A;  4DBQ A;  3FAJ A;  2J7P D;  3EG9 B;  5L3Q A;  3LEV A;  2A68 F;  1V54 C;  1PD0 A;  4NTA A;  4BG0 A;  3EPV A;  3FOP A;  4YL3 A;  2QTV A;  4EHP A;  4AE4 B;  2HJM A;  3EGX B;  3JTL O;  4I44 A;  3V5Y A;  1JPJ A;  4JKV A;  3LLK A;  3O6X A;  3NMI A;  3OEO A;  2GAQ A;  4JRZ A;  3NMK A;  1ZYR F;  3LNM B;  1Z7Q c;  3RQE A;  2A69 F;  4BJ6 A;  5A6B A;  2XLD A;  3VYW A;  3LNR A;  2KC3 A;  4OIN F;  3U8V A;  2R03 A;  1M2V B;  2YEV A;  2J0W A;  3U9J A;  1Z63 A;  4BJ1 A;  3OA1 A;  4FX5 A;  4LLE A;  1TWG A;  4U5H A;  2R7Q A;  4MTF A;  3BRJ A;  2LIG A;  4YJW A;  1ZHW A;  2A0B A;  3GOR A;  2J9V A;  3A11 A;  1V4A A;  4NY3 A;  1T6Q A;  3C8G D;  4CIP A;  3HNI A;  2KW3 C;  1T6I A;  4BEM J;  4CS7 A;  4IAO A;  3X2Q C;  2YQY A;  3IQT A;  2NG1 A;  3DKA A;  1MNE A;  5BQH A;  2IOQ A;  3GOD A;  1BBH A;  3W4Y A;  4ULW A;  4M63 A;  2A6E F;  5E3C A;  3U3B A;  4YT4 A;  5KYN A;  2XLH A;  1A0B A;  4JEA A;  5L0I A;  1MMG A;  3CEX A;  3S29 A;  2CNW D;  2J0X A;  2JPU A;  3CZ6 A;  3HJC A;  4J7T A;  4PJN A;  4W8P A;  2J9W A;  2PFD A;  3NYJ A;  4C3D A;  4XTK A;  4CDV A;  5F5H A;  5EGY A;  5A6A A;  4UDV A;  3ASN C;  3CAX A;  4ZLC A;  2XLV A;  3I5P A;  5EK0 A;  3U5S A;  4EKW A;  1FNT c;  4LDQ A;  1SF8 A;  3KH2 A;  3LAY A;  3GM3 A;  4XEK A;  3SEO A;  2R7R A;  1TKN A;  3K6B A;  3CQZ A;  3O39 A;  1OW6 A;  3JZ0 A;  4NC3 A;  2NSG A;  4CIH A;  1RJ9 A;  1VMA A;  2IYL D;  2FAP B;  2WZF A;  1VOM A;  2WL8 A;  5BQI A;  2XXA B;  3S28 A;  4CDY A;  2HV7 A;  1ZU5 A;  2VAS A;  3RQG A;  1T6U A;  2H7O A;  3RKO F;  5L0G A;  4J30 B;  2EPK X;  1SR2 A;  3C8G B;  1LKX A;  3T6B A;  3ASO C;  4DRI B;  4KC9 A;  3BEH A;  5E3A A;  1RXQ A;  3ZWI A;  2XS1 A;  4E17 A;  3JYY A;  2L6H A;  2FFH A;  2OOC A;  1BR4 A;  1N1C A;  3Q6M A;  3DI5 A;  1WN0 A;  3GWL A;  1VK5 A;  2IM8 A;  3WHN A;  1CGM E;  4DRJ B;  3N0T A;  256B A;  4G0H A;  4K7B A;  4BJ6 C;  3SNH A;  3QVY A;  5T3W A;  4G78 A;  3WAQ A;  4DOZ A;  4XLP F;  1U89 A;  2W45 A;  1D1A A;  3MBG A;  4MVR A;  1L3P A;  3GAN A;  1D1B A;  5L0J A;  1OKK A;  2M64 A;  3HLZ A;  3DAF A;  1IZM A;  2JD3 A;  4KNV A;  1T5O A;  1OXK A;  4Z9H A;  3X1O A;  5KYY B;  4C7O A;  1G4W R;  2VH3 A;  2LP4 A;  5DVW A;  2YVK A;  5L0H A;  2IXN A;  3JRM O;  3NYL A;  3DM9 B;  1RKC A;  2AVK A;  2XSE A;  1ST6 A;  3DJU B;  1SZI A;  1NFN A;  2OU6 A;  2Q00 A;  1K40 A;  3RF3 A;  1QPU A;  1XZP A;  3DXJ F;  3ZC4 A;  1V55 C;  2UUH A;  5DQT A;  3ABK C;  4N4W A;  2MWQ A;  3HNK A;  2H7B A;  3W8H A;  3O10 A;  3UGP A;  2XRH A;  4IWB A;  3A9C A;  4Z9J A;  2I15 A;  2M4E A;  1E2X A;  4YT5 A;  1C17 M;  4F4B A;  3ITF A;  5A69 A;  4HEA J;  2KGO A;  2MYS A;  3AG1 C;  2EIK C;  4YK5 A;  2J7P A;  4Q7C A;  3ZIB A;  1YA9 A;  2IXP A;  3DD7 A;  1YYJ A;  3LEO A;  2XL4 A;  3K1I C;  4LAC B;  4PK4 A;  3PHF 2;  2G62 A;  2ETS A;  3FOO A;  3IQ6 A;  1ZU4 A;  2WZG A;  5B3I A;  5CI9 A;  2ZD9 A;  5DS4 A;  2TMV P;  2CGE A;  4RDA A;  3U9M A;  2CW0 F;  2I8B A;  2CCY A;  3RVY A;  1A7V A;  2DB4 A;  2F22 A;  3EZH A;  3F47 A;  1G8X A;  2GA0 A;  1RMV A;  3SZR A;  1ZW3 A;  4CJO A;  4CS8 A;  2HS5 A;  3ZQY A;  2AWC A;  2XLM A;  3DM5 A;  5KYU B;  1VYK A;  1A7E A;  4KBL A;  3HNJ A;  3TQO A;  2FGY A;  2IXM A;  4DJ9 A;  2LSE A;  2PX0 A;  3DAG A;  1D0Z A;  2HJ3 A;  4AL0 A;  1WWP A;  1LIH A;  4FWV A;  1Q0F A;  3JYH A;  2R7O A;  2KSF A;  2XM0 A;  2OG2 A;  3B9Q A;  4KI2 A;  4MTO A;  2D5R B;  1LVK A;  1NU9 C;  1IW7 F;  3LUT B;  5E2Q A;  3W8I A;  2PBE A;  3NRH A;  4P6I C;  5DLJ A;  4DXW A;  1FTS A;  3POV A;  1ZHY A;  4IB4 A;  1VLS A;  1Y6D A;  1QLE C;  3VRC A;  4HFF B;  3ZTM A;  1WOL A;  1ZW2 A;  1NLX A;  3GM1 A;  2O9X A;  2XL6 A;  4MVO A;  4OIO F;  3T4R A;  1QVX A;  1D1C A;  3SXM A;  5HV9 A;  1H6G A;  3QW0 A;  3QVZ A;  4PAC A;  2HMZ A;  3RQF A;  4N6H A;  3FXH A;  2Y3G A;  3JT1 A;  3WG7 C;  1H9G A;  3L8J A;  4AL1 A;  3U2L A;  4LDR A;  4G7O F;  2C03 A;  4JW1 A;  4CX9 A;  2L7A A;  3NKD A;  4FAP B;  4XPW A;  2WVN A;  3VF0 A;  2LD6 A;  4JE9 A;  3CSK A;  4WJ0 A;  2AP3 A;  1ORJ A;  3EFO A;  2NUP A;  5COM A;  3TOL A;  2OQM A;  4XQ1 A;  3M4B A;  5T3T A;  1CPQ A;  1YAR O;  2KK1 A;  1LPE A;  4D4X A;  3HKK A;  1DOW A;  4BJT A;  2R7U A;  1NG1 A;  2RD9 A;  5L3V A;  2ICW G;  2UUI A;  2BL2 A;  2Q9A A;  4JJG A;  4N06 A;  2PNO A;  5AGF A;  1LE2 A;  1HY5 A;  2DGJ A;  3B29 A;  3K1H A;  5KYU A;  4GYT A;  2Q7R A;  3LJB A;  3E9V A;  3PMR A;  2D4U A;  3DMD A;  4FES A;  1FFT C;  4KNW A;  4DRH B;  1LS4 A;  1NFO A;  1KU2 A;  5L0D A;  3RIP A;  2YL7 A;  4QI2 A;  2X51 A;  2WZL A;  4WGZ A;  4QDL A;  2XLE A;  3R7C A;  1S05 A;  3UMI A;  3K1I A;  4CS8 C;  4GQH A;  1E86 A;  3EGD B;  4MS2 A;  4EBB A;  3EHN A;  3AQC A;  3Q7G A;  3B0U X;  3UGO A;  1B68 A;  2EIN C;  4G7Z F;  2J45 A;  4OIQ F;  1YZA A;  5B1B C;  2HV6 A;  3Q6N A;  1CGN A;  2NUT B;  4PR9 A;  2OEX A;  4E18 A;  5FZT A;  3FVY A;  1J8Y F;  5GPG B;  1OCR C;  1ORY A;  3SXK A;  2H8A A;  4JJF A;  2V3C C;  4LLC A;  3C8Z A;  2B0J A;  1OCC C;  4CDA A;  2Q4F A;  4O7G A;  3TJ5 A;  4U5D E;  1AVO B;  4YL0 A;  1U6H A;  1Z5Z A;  2KJG A;  1D0Y A;  1LM3 B;  3DZA A;  4IGG A;  3EG9 A;  4K0D A;  2VC9 A;  1TWC A;  2A1D D;  3NKE A;  4JTD B;  1Q0G A;  3C7J A;  1T9K A;  3W2W A;  2Y3B A;  1L7C A;  4MVZ A;  3S90 A;  1KTM A;  1HE9 A;  2DYS C;  2OKU A;  2ZXW C;  4AE4 A;  3LES A;  1MMN A;  3EGX A;  4P9F A;  1YZC A;  4U5C E;  2Y3H A;  3V7O A;  4GEH A;  3ATP A;  5A6B D;  3AOU A;  3S84 A;  1AEP A;  2KQ9 A;  4JZA A;  2R7V A;  4IRU A;  1NZE A;  2OJQ A;  1H7I A;  5DS5 A;  2LFD A;  4EBJ A;  5IY5 C;  1EQ1 A;  2LK4 A;  4XEF A;  2G3V A;  4EWC A;  1ZHX A;  3J06 A;  1M2V A;  3QTH A;  1Q0K A;  1ZHZ A;  2EPO A;  4I1O B;  2ASR A;  2BE5 F;  4E0H A;  3AG3 C;  4D4N A;  2R7T A;  4JC7 A;  1HMO A;  2YLD A;  4JUR I;  3SXY A;  5K0I A;  5KYW B;  1A41 A;  1MND A;  5JP7 A;  3H2U A;  4IAR A;  1E84 A;  3F46 A;  1M56 C;  3MYF A;  1JPN A;  4U5B E;  4B6I A;  4BJ5 A;  2Y3D A;  2AU5 A;  3E70 C;  1HE1 A;  2EIM C;  4IAQ A;  1K04 A;  3C18 A;  5D91 A;  3M4C A;  1OR3 A;  4MVU A;  3RH3 A;  3KL4 A;  2G3K A;  1C02 A;  4JCZ A;  1QZX A;  1BR2 A;  4U5E E;  3G4Z A;  1WTY A;  3IHU A;  2YL0 A;  3AG4 C;  5BQG A;  1PCX A;  4QI0 A;  4OIR F;  4H54 A;  2L9J A;  4U5F E;  4ONS A;  3K66 A;  2J8W A;  2ZXP A;  3FAP B;  4RBN A;  2ZXO A;  3GEE A;  2R7W A;  4Z9I A;  2XXA A;  4MVM A;  1JAF A;  4K1O A;  3DWW A;  1FR0 A;  2YHS A;  1GGQ A;  1M6T A;  3EH2 A;  1YLM A;  2P7V A;  4MW8 A;  3C8G A;  2HMQ A;  2YWA A;  4CS9 A;  1EA8 A;  3C63 A;  1TFO B;  1OW8 A;  1OW7 A;  2GFH A;  5JUA A;  2V26 A;  3ABM C;  3VM6 A;  4JCH A;  2C04 A;  1BDJ B;  2BC5 A;  2YKZ A;  3B0V C;  4BPM A;  2VCA A;  1I4Y A;  1YAU O;  2OJE D;  2R05 A;  2NPU A;  3M79 A;  4PFP A;  5D92 A;  3W2V A;  4CBE A;  1R4T A;  2R7X A;  3JRT A;  3QZC A;  2R25 A;  4E0I A;  2B0H A;  2CNW A;  1AUE A;  4W8K A;  5B1A C;  1WGW A;  3MFN A;  3MYI A;  4C3E A;  5JRA A;  5KYX B;  4A2N B;  5TJ5 E;  5JVE A;  3SP1 A;  2A6H F;  2XM4 A;  2PP4 A;  3UMK A;  3UNG C;  5KYY A;  1OCZ C;  2XLW A;  2YLG A;  3B0P A;  1OCO C;  3KYJ A;  4ER9 A;  3ABL C;  4EUK B;  2PX3 A;  4YT2 A;  1I4Z A;  4J32 B;  1RJ9 B;  1GM5 A;  2Y39 A;  4MW3 A;  1K05 A;  2IBF A;  2JX0 A;  1DOV A;  3RFY A;  1QQ3 A;  1O3U A;  3GEH A;  1CGO A;  4BJ5 C;  2XS8 A;  1FAP B;  2Q9B A;  2KNH A;  1HW1 A;  3EH1 A;  1D0X A;  1F1M A;  3H2V A;  3MLG A;  5JSL A;  4C3B A;  2DI3 A;  2AWY A;  1S7Z A;  2HSB A;  2HFI A;  3HNL A;  4JTA B;  4AX2 A;  2EIJ C;  1HW2 A;  2P61 A;  4JVS A;  3NDB B;  4WGY A;  3ZTZ A;  2HZ8 A;  4NCQ A;  3NG1 A;  2Q3T A;  1LI7 A;  1YJG A;  2J46 A;  1KNY A;  1Z3I X;  3S9O A;  3UR3 C;  1EI7 A;  4OD4 A;  5HSW A;  1T01 A;  1TWH A;  3T6G B;  3US6 A;  3KMI A;  4PJM A;  5FCL A;  3HTK C;  3ZVR A;  2P6V A;  2L6G A;  3ZQV A;  4E7S A;  2W9Y A;  1E83 A;  2R02 A;  3Q7L A;  5JLI A;  4C7O B;  4MTG A;  2QUP A;  5COF A;  2QE9 A;  1I5N A;  1LI5 A;  3K33 A;  5EHH A;  3R2P A;  4ANJ A;  4YT8 A;  2WVQ A;  3JSE O;  1G4U S;  4P9T A;  3AGU A;  4Q5S F;  1C03 A;  2PF4 E;  1NBB A;  4CS9 C;  3V5X A;  3IEE A;  1XWJ A;  1VYI A;  2L6F A;  2OEV A;  1JR8 A;  5CI8 A;  2LQG A;  3EHM A;  4I1M A;  4O6N A;  5COG A;  4DVY P;  2YLI A;  3U3F A;  5B3S C;  3U0C A;  3FDQ A;  3EJN A;  3KYI A;  3M1C B;  5KYW A;  2EPL X;  2ZXR A;  1OXB A;  4CSA A;  1YYX A;  4YN0 B;  4NQF A;  2X0C A;  1ZVZ A;  2LCH A;  1RKE B;  4XLN F;  1APC A;  2YZS A;  2Q9C A;  4MQ9 F; 
#chains in the Genus database with same CATH homology
 4O6M A;  5KYX A;  3LS0 A;  2W4M A;  4G7H F;  1FMV A;  1O87 A;  3L34 A;  4O6Y A;  3QMK A;  1FMW A;  3N24 A;  3ZG1 A;  1M2O A;  1NU7 D;  3N2Z B;  2VB6 A;  4OD5 A;  4U5G A;  4E7Z A;  1W2W A;  4AK9 A;  3S0X A;  3T6J A;  3TD7 A;  3MX3 A;  5BUO A;  3S27 A;  4OIP F;  2WVO A;  3AQB A;  3SYN A;  1MMD A;  2IXO A;  1LS1 A;  1MMA A;  4I3M A;  1BR1 A;  3DJN B;  5E33 A;  3EGD A;  3AG2 C;  3EFO B;  2NUP B;  4PJJ A;  4BEJ A;  2Y69 C;  2W4B A;  3JCU Q;  2ZPA A;  1Z23 A;  3NYM A;  2NUT A;  5DQZ A;  2E87 A;  1Z6A A;  5F5F A;  2QY9 A;  2L81 A;  4DBR A;  4MND A;  2CDQ A;  1J8M F;  3K7D A;  3KKB A;  4ZLD A;  1TWA A;  2H7V C;  3WOD F;  5T1D B;  2EIL C;  3EQL F;  5DS6 A;  4H4K C;  4DVZ A;  4LER A;  3I4U A;  4X0R A;  4YWQ A;  1TR2 A;  4CSA C;  1SMY F;  3UMH A;  3RYL A;  3OWT A;  4XWJ A;  1PD1 A;  4IJJ A;  3ZSU A;  1ZHT A;  3FHD A;  1FFH A;  3I5Q A;  3LS1 A;  2R7S A;  4HFK B;  1OKK D;  2DYR C;  4O79 A;  4PJL A;  1O5H A;  3EZI A;  4RD9 A;  2OCC C;  3L0I A;  3ECS A;  3LLI A;  3VAY A;  2J9U A;  4HE8 D;  2WB7 A;  3H65 A;  1M57 C;  4PFO A;  3JSZ A;  2Z15 A;  4DBQ A;  3FAJ A;  2J7P D;  3EG9 B;  5L3Q A;  3LEV A;  2A68 F;  1V54 C;  1PD0 A;  4BG0 A;  3EPV A;  2QTV A;  4AE4 B;  3EGX B;  4I44 A;  1JPJ A;  3LLK A;  3O6X A;  3OEO A;  4Q4Z F;  1ZYR F;  4BJ6 A;  2A69 F;  3VYW A;  3LNR A;  4OIN F;  1M2V B;  2YEV A;  2J0W A;  1Z63 A;  4BJ1 A;  3OA1 A;  4FX5 A;  4LLE A;  1TWG A;  4U5H A;  2R7Q A;  4YJW A;  1ZHW A;  2J9V A;  4NY3 A;  2KW3 C;  4CS7 A;  4IAO A;  3X2Q C;  2NG1 A;  1MNE A;  2IOQ A;  3GOD A;  4ULW A;  4M63 A;  2A6E F;  5E3C A;  4YT4 A;  5KYN A;  1MMG A;  3S29 A;  2CNW D;  2J0X A;  3CZ6 A;  3HJC A;  4PJN A;  4C3D A;  2J9W A;  2PFD A;  3NYJ A;  4XTK A;  5EGY A;  5F5H A;  3ASN C;  4ZLC A;  3I5P A;  1SF8 A;  3KH2 A;  3LAY A;  2R7R A;  3SEO A;  1TKN A;  3K6B A;  3CQZ A;  3O39 A;  4CIH A;  1RJ9 A;  1VMA A;  2IYL D;  2WZF A;  1VOM A;  2WL8 A;  2XXA B;  3S28 A;  2HV7 A;  1ZU5 A;  2VAS A;  2H7O A;  3RKO F;  4J30 B;  1LKX A;  3T6B A;  3ASO C;  4KC9 A;  5E3A A;  2FFH A;  1BR4 A;  1N1C A;  3Q6M A;  1VK5 A;  3N0T A;  4K7B A;  4G0H A;  4BJ6 C;  3SNH A;  5T3W A;  4XLP F;  4DOZ A;  2W45 A;  1D1A A;  3GAN A;  1D1B A;  1OKK A;  3HLZ A;  3DAF A;  1IZM A;  2JD3 A;  4KNV A;  3X1O A;  5KYY B;  4C7O A;  2VH3 A;  5DVW A;  2IXN A;  3NYL A;  3DM9 B;  2XSE A;  1ST6 A;  3DJU B;  1SZI A;  3ZC4 A;  3DXJ F;  5DQT A;  1V55 C;  3ABK C;  2MWQ A;  3UGP A;  2H7B A;  3W8H A;  2XRH A;  4IWB A;  2M4E A;  4YT5 A;  5KYW B;  4F4B A;  3ITF A;  4HEA J;  2KGO A;  2MYS A;  3AG1 C;  2EIK C;  2J7P A;  4Q7C A;  3ZIB A;  3DD7 A;  2IXP A;  4LAC B;  5KYU B;  4PK4 A;  2XL4 A;  3K1I C;  3PHF 2;  2G62 A;  1ZU4 A;  2WZG A;  5CI9 A;  5DS4 A;  2CGE A;  4RDA A;  2CW0 F;  2I8B A;  3EZH A;  3F47 A;  1G8X A;  3SZR A;  4CS8 A;  3DM5 A;  1VYK A;  4KBL A;  2FGY A;  2IXM A;  2LSE A;  2PX0 A;  3DAG A;  1D0Z A;  4FWV A;  3JYH A;  2R7O A;  3B9Q A;  2OG2 A;  4KI2 A;  2D5R B;  1LVK A;  1NU9 C;  1IW7 F;  5E2Q A;  3W8I A;  3NRH A;  4P6I C;  5DLJ A;  1FTS A;  3POV A;  1ZHY A;  1QLE C;  4HFF B;  4OIO F;  2O9X A;  3T4R A;  1D1C A;  3JT1 A;  2Y3G A;  3WG7 C;  4G7O F;  2C03 A;  4JW1 A;  3NKD A;  2WVN A;  3CSK A;  4WJ0 A;  3EFO A;  2NUP A;  5T3T A;  4BJT A;  2R7U A;  1NG1 A;  5L3V A;  2Q9A A;  4JJG A;  4N06 A;  2DGJ A;  3K1H A;  5KYU A;  4GYT A;  3LJB A;  3E9V A;  3PMR A;  3DMD A;  4FES A;  1FFT C;  4KNW A;  4QI2 A;  1KU2 A;  3RIP A;  2X51 A;  2WZL A;  4QDL A;  3UMI A;  4CS8 C;  3EGD B;  4EBB A;  3EHN A;  3AQC A;  3Q7G A;  3B0U X;  3UGO A;  2EIN C;  4G7Z F;  2J45 A;  4OIQ F;  5B1B C;  2HV6 A;  3Q6N A;  2NUT B;  3FVY A;  1J8Y F;  2V3C C;  1OCR C;  4JJF A;  4LLC A;  2B0J A;  1OCC C;  4O7G A;  4U5D E;  1Z5Z A;  2KJG A;  1D0Y A;  3DZA A;  3EG9 A;  4K0D A;  1TWC A;  2A1D D;  3NKE A;  3W2W A;  2Y3B A;  2DYS C;  2ZXW C;  4AE4 A;  3LES A;  1MMN A;  3EGX A;  4U5C E;  3V7O A;  2Y3H A;  4GEH A;  2R7V A;  4JZA A;  2KQ9 A;  4IRU A;  1NZE A;  5DS5 A;  5IY5 C;  2G3V A;  4EWC A;  1ZHX A;  1M2V A;  1ZHZ A;  4I1O B;  2BE5 F;  3AG3 C;  2R7T A;  4JUR I;  1MND A;  3F46 A;  1M56 C;  1JPN A;  4U5B E;  4B6I A;  4BJ5 A;  2Y3D A;  3E70 C;  2EIM C;  5D91 A;  3RH3 A;  3KL4 A;  2G3K A;  1QZX A;  1BR2 A;  4U5E E;  3AG4 C;  1PCX A;  4QI0 A;  4OIR F;  2L9J A;  4U5F E;  3K66 A;  2ZXP A;  4RBN A;  2ZXO A;  2R7W A;  2XXA A;  2YHS A;  3EH2 A;  2P7V A;  4CS9 A;  2GFH A;  2V26 A;  3ABM C;  4JCH A;  2C04 A;  3B0V C;  4PFP A;  5D92 A;  3W2V A;  2R7X A;  4CBE A;  3JRT A;  3QZC A;  4W8K A;  2CNW A;  5B1A C;  1WGW A;  4C3E A;  5KYX B;  4A2N B;  3SP1 A;  2A6H F;  2PP4 A;  3UMK A;  3UNG C;  5KYY A;  1OCZ C;  3B0P A;  1OCO C;  3ABL C;  2PX3 A;  4YT2 A;  4J32 B;  1RJ9 B;  2Y39 A;  3RFY A;  4BJ5 C;  2Q9B A;  2KNH A;  3EH1 A;  3MLG A;  1D0X A;  5KYW A;  4C3B A;  1S7Z A;  4AX2 A;  2EIJ C;  4JVS A;  3NDB B;  3NG1 A;  2Q3T A;  2J46 A;  1Z3I X;  3UR3 C;  5HSW A;  4OD4 A;  1TWH A;  3KMI A;  4PJM A;  5FCL A;  3HTK C;  3ZVR A;  2P6V A;  4E7S A;  2W9Y A;  3Q7L A;  4C7O B;  5EHH A;  3K33 A;  4ANJ A;  4YT8 A;  2WVQ A;  4Q5S F;  2PF4 E;  4CS9 C;  3IEE A;  5CI8 A;  1VYI A;  3EHM A;  4I1M A;  4O6N A;  4DVY P;  3FDQ A;  5B3S C;  3EJN A;  3M1C B;  2ZXR A;  4CSA A;  4YN0 B;  4XLN F;  2YZS A;  2Q9C A;  4MQ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...