2YL1A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16a variant at 1.03 a resolution - restraint refinement
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 54
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl1A00
1LM3B 1YZAA 1E86A 1CPRA 2XLMA 3HNLA 4IB4A 3NMKA 1S05A 4ER9A 3HNJA 1QQ3A 5JT4A 3U8PA 3VRCA 2YL7A 3DE8A 1APCA 1CGOA 2XL6A 1CPQA 3IQ6A 3NMJA 1CGNA 5JLIA 4JEBA 3L1MA 3ZWIA 5JRAA 5JS5A 4ULVA 4CJGA 2XL8A 3DE9A 1M6TA 3IQ5A 3QW1A 3NMIA 2YKZA 2J8WA 1MQVA 2YL0A 5B3IA 3C62A 2CCYA 3ZQVA 3FOOA 4JKVA 4JEAA 5JVEA 3M4BA 1EKYA 4CJOA 2QLAA 4CDVA 1E83A 2XLDA 2XM0A 3ZQYA 1JAFA 5AGFA 3FOPA 3QVYA 4WGYA 2YLGA 3QW0A 2XM4A 4L6RA 4U9DA 5JP7A 3ZTMA 3HNKA 4N6HA 1E84A 2XLWA 2XLVA 5JUAA 3ZTZA 1QPUA 1GQAA 3M4CA 1YYXA 2YLDA 2BC5A 4WGZA 3C63A 3TOMA 1A7VA 1E85A 3M79A 4D4NA 1BBHA 2YL1A 4CIPA 3TOLA 1NBBA 256BA 2XLEA 4U9EA 4EIYA 2XLHA 1YZCA 4N4WA 1RCPA 2YL3A 4D4XA 1YYJA 4IARA 4CDAA 2YLIA 4CDYA 2XLOA 4CX9A 3QVZA 4JE9A 3HNIA 2J9BA 5JSLA 4IAQA 3M15A 4NC3A
chains in the Genus database with same CATH superfamily
2HFIA 4YJWA 2LSEA 4DRIB 1E86A 1W2WA 2KSFA 2H7VC 1EQ1A 1ZVZA 4IB4A 1RKEA 2A1DD 3SXYA 3L8IA 2HS5A 3ZSUA 4K1OA 1V54C 3U0CA 1LE2A 1XZPA 2A6HF 3ABLC 4LDRA 3N2ZB 4B6IA 3T6JA 4FAPB 3FDQA 1TKNA 2YL7A 3DE8A 3G4XA 3PMRA 5COMA 3DM9B 3DAGA 2UUIA 3RQGA 3VM6A 1D1CA 4DOZA 4G7ZF 4XPXA 3KKBA 3H2UA 2CW0F 3UNGC 2R7WA 1H9TA 5L0FA 2ZXRA 3AQCA 1RMVA 4ULVA 2J9UA 3EZHA 4JVSA 3JCUQ 3E9VA 2GAQA 1U89A 1M6TA 5BQIA 2D4UA 1U0BB 4YN0B 2DYRC 2YWAA 1BR4A 3Q6NA 3O39A 2VCAA 3NMIA 3K7DA 1LPEA 5F5HA 1SYQA 2EILC 1D1AA 2LFFA 2RD9A 3K1IC 4H54A 4RD9A 1KTMA 2PX3A 5KYNA 2EIMC 4C3EA 3DJUB 3WG7C 5L3VA 3C62A 2P0NA 4MVSA 1Q0GA 1XZQA 4LACB 2P6VA 3LUTB 1NU9C 3EGDB 2O9XA 4CBEA 4Q5SF 2L6HA 3FXHA 4A2NB 5DLJA 4DBQA 3LAYA 4CS9A 1OCRC 5F5FA 1EKYA 4OINF 3LS0A 5A69A 4OIRF 1R4TA 4I1MA 1V55C 4PACA 1N1CA 2XM0A 3B71A 3K1HA 1SMYF 3BEHA 5KYUB 1WN0A 5KYUA 3RKOF 3I5QA 2J7PD 3DAFA 1OCCC 4YT4A 1WTYA 4NTBA 3ASOC 3Q6MA 3ABMC 1VTMP 5A6KA 3KYIA 5T3WA 1JOGA 2DYSC 4O6YA 1ORSC 1T9KA 3H2VA 2Y3BA 3U3BA 4CIHA 5JP7A 2HV6A 2AP3A 5DVWA 2KC3A 2QY9A 3HNKA 4J7YA 4U5BE 3T6GB 5E2QA 3MFNA 2X51A 1E84A 4PR9A 4NCQA 1OKKA 3K33A 3V5XA 5AC4A 2HZ8A 1F1MA 3AGTA 3AJMA 3LJBA 2EPKX 4PJNA 4Z9IA 2YEVA 3IQTA 3EFOB 1YJGA 2YLDA 2OJED 4F4BA 3NYLA 2XS8A 4KC9A 3M79A 3ZIBA 4D4NA 2P61A 5AC5A 1VYKA 3X1OA 3EPVA 3E70C 5DS4A 4N06A 4CIPA 2WB7A 2YRFA 5A6BA 2PNOA 3Q7GA 3TOLA 3GODA 1TWHA 2XLEA 2F22A 3GORA 5E3AA 5EGYA 3NYMA 1M2OA 5BUOA 1HW1A 4EHPA 3UR3C 4WJ0A 2AU5A 2KK1A 3POVA 2CNWD 2JX0A 4EBJA 2XLHA 3U9JA 1O5HA 3JSZA 3K1IA 4N4WA 4E0IA 1OW7A 4P9TA 1Y6DA 3U8VA 2R7UA 1ZZPA 3ZDLA 2C03A 3O10A 1HMOA 4QDLA 3AOUA 2XLOA 3X2QC 3QVZA 4BJ5C 4MTGA 4CDYA 3EGDA 4CX9A 3U3FA 3RQEA 2TMVP 1H9GA 1LI7A 3UMIA 1OCOC 1G4US 1MMAA 3O6XA 1YDIA 1TWGA 2A69F 3M15A 4XLPF 1C17M 4QI2A 1LM3B 1YZAA 4K7BA 2LCHA 2R02A 1HE9A 3UMKA 3SEOA 3DM5A 2XLMA 3DZAA 3NMKA 1S05A 4MVOA 1VB5A 2EINC 3TJ5A 4AK9A 1OW6A 4OD5A 1I4ZA 1ZHXA 1QQ3A 3MLGA 5TJ5E 4MNDA 3U8PA 2HUJA 1A41A 2R9RB 3WHNA 1NFNA 4JJGA 4OIOF 1APCA 3IPMO 2J0XA 3JYHA 2XL6A 4OIPF 2J45A 3L8JA 3NG1A 5T3TA 1CPQA 1DOWA 1LVKA 2NUPB 1CGNA 3IQ6A 3NMJA 3LS1A 4O6MA 4XQ1A 5EHHA 4AL1A 5JLIA 4K0DA 4I3MA 2IXOA 3S84A 3VYWA 1YAUO 4LLEA 3C8GD 3EGXB 2IM8A 2PP4A 5JRAA 2PX0A 3R7CA 5JS5A 3RIPA 3IHUA 4CJGA 2XL8A 1Z6AA 1CGME 5K0IA 1UG7A 3FAJA 2Q4FA 3V7OA 3EFOA 5B1AC 2OKUA 1BR1A 2BL2A 2Z15A 2WZFA 3IQ5A 5A6JA 2VCCA 4CS8C 1V74B 4JW1A 3V5ZA 3HTKC 1LE4A 4Z9JA 2OOCA 3CSKA 3VF0A 3ZG1A 1BDJB 1VLTA 3W4YA 2OEXA 3LLIA 4DJ9A 4BJ6C 4NY3A 2PF4E 5L0CA 3ZQVA 2FGYA 3FOOA 4XEFA 2VB6A 3I4UA 2YQYA 1T6QA 1NFOA 4JEAA 4H4KC 1YLMA 2M64A 4CJOA 4PJJA 4J7TA 2NG1A 2NPUA 4LDKA 4CSAC 1AEPA 2B0JA 5D91A 1UFBA 3U9MA 4BJ5A 2Y3GA 3JZ0A 2R25A 1K05A 1YA7O 1LS1A 3EZIA 3OEOA 3W8HA 4PFOA 3ZC4A 2Y3HA 5AGFA 2G3VA 4G78A 3CQZA 4JTDB 4JTAB 4W8KA 4WGYA 3T6BA 4AX2A 3UGPA 2XM4A 3S90A 4YT2A 4L6RA 3GM3A 3S9OA 3ASNC 4E7SA 4PJMA 4U9DA 4J30B 3W8IA 3T4RA 2R7SA 4HFKB 2AVKA 2Q9AA 1MNDA 1SF8A 2OEVA 3PCVA 2JD3A 1FR0A 2L9JA 1Y4CA 1TWCA 2XLVA 3ZTZA 5JUAA 1GGQA 1QPUA 2AWYA 4AL0A 4BJ1A 2L81A 1NLXA 1RJ9B 4FESA 4E7ZA 5KYYB 1QKRA 3EHMA 1T6UA 1GQAA 2FFHA 2R7TA 3M4CA 3DI5A 4LLCA 1WATA 2ZXOA 2KGOA 4WGZA 4G7HF 2NUPA 3SNHA 1A7VA 1Q0DA 2EPMX 3JYYA 1OXKA 4CS7A 1BBHA 1MMNA 1K40A 1O87A 1M57C 3SP1A 3EGXA 4C7OB 1VLSA 2HSQA 1NBBA 1U6HA 1J8YF 2IXPA 4U9EA 4EIYA 1AUEA 2BE5F 2OU6A 1FTSA 3U5SA 5B3SC 2P7VA 2UUHA 2ICWG 3A9CA 3EG9B 5D92A 4CS8A 2Y39A 2E87A 4NTFA 1ORYA 5COFA 3RYLA 3AGUA 4LDQA 4J32B 4GYTA 2XXAB 2YL3A 3S28A 4Q7CA 3U2MA 1OW8A 5F28E 4JCZA 4IAOA 4JCHA 4BJ6A 5DQTA 1MNEA 1SR2A 4BJTA 3NRHA 4YL0A 1S7ZA 4XEVA 1WASA 3Q7LA 2XRHA 3NDBB 4JE9A 3GM1A 3SXMA 4PK4A 4DRJB 2W4BA 2HKVA 5JSLA 1H7IA 2P1AA 3DJNB 2ETSA 1FFTC 4P9FA 4N6CA 4E18A 4CSAA 3G50A 1CPRA 2EIKC 3LEVA 4MTOA 2Q9BA 2CGEA 2I15A 3TD7A 4DRHB 4ER9A 4BEMJ 5L0IA 2C04A 1G4WR 2B0HA 1YARO 1FAPB 1D1BA 3HNJA 1O3UA 3KL4A 1NSGB 1G5ZA 5CIVA 2YVKA 3FMSA 3FHDA 1FNTc 4JTCB 3PDMP 4MVZA 3WAQA 3US6A 4MVUA 1ZU5A 3UGOA 4C3BA 1T01A 3SYNA 2L7AA 2YHSA 1KNYA 4DVYP 4EUKB 3TQOA 2VC9A 1SZIA 3R2PA 4EBKA 1M56C 3ABKC 3GWNA 1BR2A 3KMIA 2H7OA 5DS6A 5A6AA 2W4MA 4MW3A 1RJ9A 1NG1A 2QTVA 2I8BA 5KYYA 1M2VB 3DE9A 2LD6A 1NU7D 1G8XA 2L6FA 3BRJA 4U5FE 1HMDA 1DOVA 3KYJA 4JIOA 4AE4B 2L6GA 1JPJA 3KPHA 2OQMA 3ECSA 3EJNA 4C7OA 4MTFA 2YKZA 2J8WA 1MQVA 5L3QA 4X0RA 5IY5C 3EG9A 4HFFB 3AG2C 1E2XA 2A68F 2J9VA 3JT1A 1D0YA 4O6NA 1ZW3A 1D0ZA 4JKVA 2X0CA 3M4BA 1L7CA 3ITFA 3AG3C 2A6EF 3JRTA 3O55A 4IWBA 2XXAA 4RBNA 4Z9HA 1PD1A 4R32A 1OXBA 2QLAA 3B0PA 4OD4A 2KW3C 4YWQA 1QVXA 3T9OA 2EPOA 2NUTB 2JPUA 1R5ID 1JAFA 4LERA 4U5DE 5L0JA 4ZLDA 3NKDA 1QSPA 1RXQA 1VK5A 3CEXA 4IGGA 2GA0A 3RF3A 3MX3A 2H8AA 2J46A 3FOPA 3IEEA 3C18A 3QVYA 5COGA 5CI9A 3TK0A 2QUPA 4FWVA 1C03A 2GWWA 4U5GA 4BG0A 2Q3TA 4O7GA 1WWPA 3ZTMA 5E33A 3B29A 4N6HA 3CAXA 2J7PA 1PD0A 1V4AA 2MHRA 2XLWA 3DWWA 4EWCA 4W8PA 4ULWA 2R7XA 2ZPAA 3HKKA 3KH2A 2G3KA 1Z5ZA 4XPWA 4GEHA 2V26A 1HW2A 3S27A 4MQ9F 4I44A 1K04A 2GFHA 2LP4A 2KNHA 3L34A 4XWJA 1EA8A 2Y69C 3C63A 1T6IA 3DKAA 3NKEA 5FCLA 3C7JA 1D0XA 1ZYRF 2RSEB 3LLKA 1A7DA 1PV3A 3C8GB 2Q00A 3K66A 1M2VA 5CI8A 3AQBA 4U5CE 2DB4A 1VOMA 2QNLA 3GWLA 4P6IC 1LI5A 2R03A 2WZLA 1ZHWA 3TJ6A 3VAYA 2R7RA 4RDAA 1EI7A 4AE4A 4JURI 4MW8A 2WVQA 2VH3A 5DS5A 1GS9A 3WODF 2HJMA 1YZCA 2XSEA 5KYWB 1TR2A 4C3DA 4D4XA 4IARA 5KYXB 3W2WA 2VCBA 3QMKA 3OWTA 1MMDA 2FAPB 4I1OB 2EPNA 4NQFA 4UDVA 1Q0MA 2G62A 1TWAA 2DGJA 2VASA 1T5OA 3I5PA 2CDQA 1ZW2A 2CNWA 2J9BA 3GEIA 1HE1A 2Y3DA 1RKCA 4IAQA 3AG1C 2W45A 3JSEO 4XEKA 1LKXA 1ORJA 3SXZA 4EKWA 1Z23A 4U5EE 4YT8A 1HY5A 2IOQA 4YL3A 2R05A 3J06A 3HNLA 2ZD9A 3EQLF 4HE8D 2OCCC 3LESA 3F46A 2NUTA 3W2VA 3SZRA 1MMGA 2EIJC 5BQGA 3B0UX 2A0BA 3MYFA 2ZXWC 1Q0FA 3FAPB 1WGWA 2AWCA 4U5HA 5JT4A 4BPMA 2Q7RA 2R7QA 3DMDA 3G4ZA 3VRCA 3HJCA 2R7OA 1VYIA 1QZXA 1I5NA 3RVZA 3A11A 3MYIA 1CGOA 4E0HA 2LFDA 1IZMA 3V5YA 1L3PA 3IQCA 5B1BC 3AG4C 4YK5A 2YZSA 4JEBA 4Q4ZF 3L1MA 2R7VA 1GM5A 3ZWIA 4JZAA 4WABA 3B0VC 4MS2A 3QTHA 2LK4A 3H65A 2D5RB 2WL8A 3LEOA 1OCZC 2IBFA 5HV9A 4YL1A 3QW1A 2GDCA 1OR3A 4FX5A 1B68A 1VMAA 1IW7F 2LIGA 4YT5A 2NSFA 1OR2A 1FMWA 3C8GA 4MVMA 5EK0A 4DBRA 4XTKA 4BEJA 3NYJA 2YL0A 5B3IA 5E3CA 2CCYA 4O79A 4MVQA 4ANJA 3DXJF 1ZU4A 4JRZA 5DQZA 3L0IA 2IYLD 2KJGA 3LNRA 1JPNA 1Z7Qc 4DVZA 2DI3A 4ONSA 5JVEA 5KYWA 2HMZA 1JRAA 3RVYA 1LS4A 2WVOA 3GM2A 3GANA 2Q9CA 2J9WA 2WZGA 4HEAJ 5KYXA 4CDVA 2IXMA 2XLDA 1E83A 3ATPA 3RQFA 2MWQA 5HSWA 1Z63A 2XS1A 3RFYA 1LIHA 2W9YA 4KBLA 1RKEB 4IRUA 3ZQYA 2H7BA 2PFDA 5FZTA 4A4AA 1TQGA 2CYDA 4DXWA 4QI0A 1J8MF 4KNVA 1OQCA 1H6GA 1YA9A 2YLGA 3QW0A 2KYHA 1WOLA 2M4EA 5GPGB 3S0XA 4KI2A 3K6BA 4GQHA 4XPYA 5L0HA 3PHF2 4G7OF 3RH3A 5L0GA 2PBEA 3TULA 1BZ4A 1PCXA 3EH2A 3OA1A 4MVRA 1KU2A 2A0UA 2XL4A 2HMQA 3S29A 3JRMO 4JJFA 2HV7A 2ZXPA 3QZCA 4OIQF 1YYXA 2NSGA 2BC5A 1Z3IX 3HLZA 5BQHA 1ZHZA 1XWJA 2HSBA 2OJQA 3TOMA 1E85A 4ZLCA 4JC7A 1Q0KA 2KQ9A 2IXNA 2YL1A 3EHNA 1JMWA 1TFOB 1ST6A 3LNMB 4EBBA 2OG2A 2QE9A 4G0HA 256BA 1TFKB 3UMHA 2V3CC 1ZHTA 3EH1A 1OKKD 1QLEC 4KNWA 4IJJA 3U2LA 3B9QA 3CZ6A 3N24A 2HJ3A 2MYSA 1A7EA 1AVOB 2WVNA 1YVIA 1FMVA 1JR8A 3DD7A 3M1CB 3N0TA 2EPLX 1C02A 1NZEA 4CS9C 4E17A 1RCPA 3FVYA 1YYJA 4CDAA 2ASRA 5L0DA 1A0BA 3RW0A 3C8ZA 4PJLA 3MBGA 4NTAA 1I4YA 2YLIA 5A6BD 2LQGA 3F47A 4XLNF 3HNIA 3GEHA 2J0WA 3JTLO 1FFHA 3SXKA 5T1DB 3GEEA 4PFPA 3ZVRA 1ZHYA 4M63A 4NC3A
chains in the Genus database with same CATH topology
1LM3B 1YZAA 1E86A 1CPRA 2XLMA 3HNLA 4IB4A 3NMKA 1S05A 4ER9A 3HNJA 1QQ3A 5JT4A 3U8PA 3VRCA 2YL7A 3DE8A 1APCA 1CGOA 2XL6A 1CPQA 3IQ6A 3NMJA 1CGNA 5JLIA 4JEBA 3L1MA 3ZWIA 5JRAA 5JS5A 4ULVA 4CJGA 2XL8A 3DE9A 1M6TA 3IQ5A 3QW1A 3NMIA 2YKZA 2J8WA 1MQVA 2YL0A 5B3IA 3C62A 2CCYA 3ZQVA 3FOOA 4JKVA 4JEAA 5JVEA 3M4BA 1EKYA 4CJOA 2QLAA 4CDVA 1E83A 2XLDA 2XM0A 3ZQYA 1JAFA 5AGFA 3FOPA 3QVYA 4WGYA 2YLGA 3QW0A 2XM4A 4L6RA 4U9DA 5JP7A 3ZTMA 3HNKA 4N6HA 1E84A 2XLWA 2XLVA 5JUAA 3ZTZA 1QPUA 1GQAA 3M4CA 1YYXA 2YLDA 2BC5A 4WGZA 3C63A 3TOMA 1A7VA 1E85A 3M79A 4D4NA 1BBHA 2YL1A 4CIPA 3TOLA 1NBBA 256BA 2XLEA 4U9EA 4EIYA 2XLHA 1YZCA 4N4WA 1RCPA 2YL3A 4D4XA 1YYJA 4IARA 4CDAA 2YLIA 4CDYA 2XLOA 4CX9A 3QVZA 4JE9A 3HNIA 2J9BA 5JSLA 4IAQA 3M15A 4NC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  1YZA A;  1E86 A;  1CPR A;  2XLM A;  3HNL A;  4IB4 A;  3NMK A;  1S05 A;  4ER9 A;  3HNJ A;  1QQ3 A;  5JT4 A;  3U8P A;  3VRC A;  2YL7 A;  3DE8 A;  1APC A;  1CGO A;  2XL6 A;  1CPQ A;  3IQ6 A;  3NMJ A;  1CGN A;  5JLI A;  4JEB A;  3L1M A;  3ZWI A;  5JRA A;  5JS5 A;  4ULV A;  4CJG A;  2XL8 A;  3DE9 A;  1M6T A;  3IQ5 A;  3QW1 A;  3NMI A;  2YKZ A;  2J8W A;  1MQV A;  2YL0 A;  5B3I A;  3C62 A;  2CCY A;  3ZQV A;  3FOO A;  4JKV A;  4JEA A;  5JVE A;  3M4B A;  1EKY A;  4CJO A;  2QLA A;  4CDV A;  1E83 A;  2XLD A;  2XM0 A;  3ZQY A;  1JAF A;  5AGF A;  3FOP A;  3QVY A;  4WGY A;  2YLG A;  3QW0 A;  2XM4 A;  4L6R A;  4U9D A;  5JP7 A;  3ZTM A;  3HNK A;  4N6H A;  1E84 A;  2XLW A;  2XLV A;  5JUA A;  3ZTZ A;  1QPU A;  1GQA A;  3M4C A;  1YYX A;  2YLD A;  2BC5 A;  4WGZ A;  3C63 A;  3TOM A;  1A7V A;  1E85 A;  3M79 A;  4D4N A;  1BBH A;  2YL1 A;  4CIP A;  3TOL A;  1NBB A;  256B A;  2XLE A;  4U9E A;  4EIY A;  2XLH A;  1YZC A;  4N4W A;  1RCP A;  2YL3 A;  4D4X A;  1YYJ A;  4IAR A;  4CDA A;  2YLI A;  4CDY A;  2XLO A;  4CX9 A;  3QVZ A;  4JE9 A;  3HNI A;  2J9B A;  5JSL A;  4IAQ A;  3M15 A;  4NC3 A; 
#chains in the Genus database with same CATH topology
 2HFI A;  4YJW A;  2LSE A;  4DRI B;  1E86 A;  1W2W A;  2KSF A;  2H7V C;  1EQ1 A;  1ZVZ A;  4IB4 A;  1RKE A;  2A1D D;  3SXY A;  3L8I A;  2HS5 A;  3ZSU A;  4K1O A;  1V54 C;  3U0C A;  1LE2 A;  1XZP A;  2A6H F;  3ABL C;  4LDR A;  3N2Z B;  4B6I A;  3T6J A;  4FAP B;  3FDQ A;  1TKN A;  2YL7 A;  3DE8 A;  3G4X A;  3PMR A;  5COM A;  3DM9 B;  3DAG A;  2UUI A;  3RQG A;  3VM6 A;  1D1C A;  4DOZ A;  4G7Z F;  4XPX A;  3KKB A;  3H2U A;  2CW0 F;  3UNG C;  2R7W A;  1H9T A;  5L0F A;  2ZXR A;  3AQC A;  1RMV A;  4ULV A;  2J9U A;  3EZH A;  4JVS A;  3JCU Q;  3E9V A;  2GAQ A;  1U89 A;  1M6T A;  5BQI A;  2D4U A;  1U0B B;  4YN0 B;  2DYR C;  2YWA A;  1BR4 A;  3Q6N A;  3O39 A;  2VCA A;  3NMI A;  3K7D A;  1LPE A;  5F5H A;  1SYQ A;  2EIL C;  1D1A A;  2LFF A;  2RD9 A;  3K1I C;  4H54 A;  4RD9 A;  1KTM A;  2PX3 A;  5KYN A;  2EIM C;  4C3E A;  3DJU B;  3WG7 C;  5L3V A;  3C62 A;  2P0N A;  4MVS A;  1Q0G A;  1XZQ A;  4LAC B;  2P6V A;  3LUT B;  1NU9 C;  3EGD B;  2O9X A;  4CBE A;  4Q5S F;  2L6H A;  3FXH A;  4A2N B;  5DLJ A;  4DBQ A;  3LAY A;  4CS9 A;  1OCR C;  5F5F A;  1EKY A;  4OIN F;  3LS0 A;  5A69 A;  4OIR F;  1R4T A;  4I1M A;  1V55 C;  4PAC A;  1N1C A;  2XM0 A;  3B71 A;  3K1H A;  1SMY F;  3BEH A;  5KYU B;  1WN0 A;  5KYU A;  3RKO F;  3I5Q A;  2J7P D;  3DAF A;  1OCC C;  4YT4 A;  1WTY A;  4NTB A;  3ASO C;  3Q6M A;  3ABM C;  1VTM P;  5A6K A;  3KYI A;  5T3W A;  1JOG A;  2DYS C;  4O6Y A;  1ORS C;  1T9K A;  3H2V A;  2Y3B A;  3U3B A;  4CIH A;  5JP7 A;  2HV6 A;  2AP3 A;  5DVW A;  2KC3 A;  2QY9 A;  3HNK A;  4J7Y A;  4U5B E;  3T6G B;  5E2Q A;  3MFN A;  2X51 A;  1E84 A;  4PR9 A;  4NCQ A;  1OKK A;  3K33 A;  3V5X A;  5AC4 A;  2HZ8 A;  1F1M A;  3AGT A;  3AJM A;  3LJB A;  2EPK X;  4PJN A;  4Z9I A;  2YEV A;  3IQT A;  3EFO B;  1YJG A;  2YLD A;  2OJE D;  4F4B A;  3NYL A;  2XS8 A;  4KC9 A;  3M79 A;  3ZIB A;  4D4N A;  2P61 A;  5AC5 A;  1VYK A;  3X1O A;  3EPV A;  3E70 C;  5DS4 A;  4N06 A;  4CIP A;  2WB7 A;  2YRF A;  5A6B A;  2PNO A;  3Q7G A;  3TOL A;  3GOD A;  1TWH A;  2XLE A;  2F22 A;  3GOR A;  5E3A A;  5EGY A;  3NYM A;  1M2O A;  5BUO A;  1HW1 A;  4EHP A;  3UR3 C;  4WJ0 A;  2AU5 A;  2KK1 A;  3POV A;  2CNW D;  2JX0 A;  4EBJ A;  2XLH A;  3U9J A;  1O5H A;  3JSZ A;  3K1I A;  4N4W A;  4E0I A;  1OW7 A;  4P9T A;  1Y6D A;  3U8V A;  2R7U A;  1ZZP A;  3ZDL A;  2C03 A;  3O10 A;  1HMO A;  4QDL A;  3AOU A;  2XLO A;  3X2Q C;  3QVZ A;  4BJ5 C;  4MTG A;  4CDY A;  3EGD A;  4CX9 A;  3U3F A;  3RQE A;  2TMV P;  1H9G A;  1LI7 A;  3UMI A;  1OCO C;  1G4U S;  1MMA A;  3O6X A;  1YDI A;  1TWG A;  2A69 F;  3M15 A;  4XLP F;  1C17 M;  4QI2 A;  1LM3 B;  1YZA A;  4K7B A;  2LCH A;  2R02 A;  1HE9 A;  3UMK A;  3SEO A;  3DM5 A;  2XLM A;  3DZA A;  3NMK A;  1S05 A;  4MVO A;  1VB5 A;  2EIN C;  3TJ5 A;  4AK9 A;  1OW6 A;  4OD5 A;  1I4Z A;  1ZHX A;  1QQ3 A;  3MLG A;  5TJ5 E;  4MND A;  3U8P A;  2HUJ A;  1A41 A;  2R9R B;  3WHN A;  1NFN A;  4JJG A;  4OIO F;  1APC A;  3IPM O;  2J0X A;  3JYH A;  2XL6 A;  4OIP F;  2J45 A;  3L8J A;  3NG1 A;  5T3T A;  1CPQ A;  1DOW A;  1LVK A;  2NUP B;  1CGN A;  3IQ6 A;  3NMJ A;  3LS1 A;  4O6M A;  4XQ1 A;  5EHH A;  4AL1 A;  5JLI A;  4K0D A;  4I3M A;  2IXO A;  3S84 A;  3VYW A;  1YAU O;  4LLE A;  3C8G D;  3EGX B;  2IM8 A;  2PP4 A;  5JRA A;  2PX0 A;  3R7C A;  5JS5 A;  3RIP A;  3IHU A;  4CJG A;  2XL8 A;  1Z6A A;  1CGM E;  5K0I A;  1UG7 A;  3FAJ A;  2Q4F A;  3V7O A;  3EFO A;  5B1A C;  2OKU A;  1BR1 A;  2BL2 A;  2Z15 A;  2WZF A;  3IQ5 A;  5A6J A;  2VCC A;  4CS8 C;  1V74 B;  4JW1 A;  3V5Z A;  3HTK C;  1LE4 A;  4Z9J A;  2OOC A;  3CSK A;  3VF0 A;  3ZG1 A;  1BDJ B;  1VLT A;  3W4Y A;  2OEX A;  3LLI A;  4DJ9 A;  4BJ6 C;  4NY3 A;  2PF4 E;  5L0C A;  3ZQV A;  2FGY A;  3FOO A;  4XEF A;  2VB6 A;  3I4U A;  2YQY A;  1T6Q A;  1NFO A;  4JEA A;  4H4K C;  1YLM A;  2M64 A;  4CJO A;  4PJJ A;  4J7T A;  2NG1 A;  2NPU A;  4LDK A;  4CSA C;  1AEP A;  2B0J A;  5D91 A;  1UFB A;  3U9M A;  4BJ5 A;  2Y3G A;  3JZ0 A;  2R25 A;  1K05 A;  1YA7 O;  1LS1 A;  3EZI A;  3OEO A;  3W8H A;  4PFO A;  3ZC4 A;  2Y3H A;  5AGF A;  2G3V A;  4G78 A;  3CQZ A;  4JTD B;  4JTA B;  4W8K A;  4WGY A;  3T6B A;  4AX2 A;  3UGP A;  2XM4 A;  3S90 A;  4YT2 A;  4L6R A;  3GM3 A;  3S9O A;  3ASN C;  4E7S A;  4PJM A;  4U9D A;  4J30 B;  3W8I A;  3T4R A;  2R7S A;  4HFK B;  2AVK A;  2Q9A A;  1MND A;  1SF8 A;  2OEV A;  3PCV A;  2JD3 A;  1FR0 A;  2L9J A;  1Y4C A;  1TWC A;  2XLV A;  3ZTZ A;  5JUA A;  1GGQ A;  1QPU A;  2AWY A;  4AL0 A;  4BJ1 A;  2L81 A;  1NLX A;  1RJ9 B;  4FES A;  4E7Z A;  5KYY B;  1QKR A;  3EHM A;  1T6U A;  1GQA A;  2FFH A;  2R7T A;  3M4C A;  3DI5 A;  4LLC A;  1WAT A;  2ZXO A;  2KGO A;  4WGZ A;  4G7H F;  2NUP A;  3SNH A;  1A7V A;  1Q0D A;  2EPM X;  3JYY A;  1OXK A;  4CS7 A;  1BBH A;  1MMN A;  1K40 A;  1O87 A;  1M57 C;  3SP1 A;  3EGX A;  4C7O B;  1VLS A;  2HSQ A;  1NBB A;  1U6H A;  1J8Y F;  2IXP A;  4U9E A;  4EIY A;  1AUE A;  2BE5 F;  2OU6 A;  1FTS A;  3U5S A;  5B3S C;  2P7V A;  2UUH A;  2ICW G;  3A9C A;  3EG9 B;  5D92 A;  4CS8 A;  2Y39 A;  2E87 A;  4NTF A;  1ORY A;  5COF A;  3RYL A;  3AGU A;  4LDQ A;  4J32 B;  4GYT A;  2XXA B;  2YL3 A;  3S28 A;  4Q7C A;  3U2M A;  1OW8 A;  5F28 E;  4JCZ A;  4IAO A;  4JCH A;  4BJ6 A;  5DQT A;  1MNE A;  1SR2 A;  4BJT A;  3NRH A;  4YL0 A;  1S7Z A;  4XEV A;  1WAS A;  3Q7L A;  2XRH A;  3NDB B;  4JE9 A;  3GM1 A;  3SXM A;  4PK4 A;  4DRJ B;  2W4B A;  2HKV A;  5JSL A;  1H7I A;  2P1A A;  3DJN B;  2ETS A;  1FFT C;  4P9F A;  4N6C A;  4E18 A;  4CSA A;  3G50 A;  1CPR A;  2EIK C;  3LEV A;  4MTO A;  2Q9B A;  2CGE A;  2I15 A;  3TD7 A;  4DRH B;  4ER9 A;  4BEM J;  5L0I A;  2C04 A;  1G4W R;  2B0H A;  1YAR O;  1FAP B;  1D1B A;  3HNJ A;  1O3U A;  3KL4 A;  1NSG B;  1G5Z A;  5CIV A;  2YVK A;  3FMS A;  3FHD A;  1FNT c;  4JTC B;  3PDM P;  4MVZ A;  3WAQ A;  3US6 A;  4MVU A;  1ZU5 A;  3UGO A;  4C3B A;  1T01 A;  3SYN A;  2L7A A;  2YHS A;  1KNY A;  4DVY P;  4EUK B;  3TQO A;  2VC9 A;  1SZI A;  3R2P A;  4EBK A;  1M56 C;  3ABK C;  3GWN A;  1BR2 A;  3KMI A;  2H7O A;  5DS6 A;  5A6A A;  2W4M A;  4MW3 A;  1RJ9 A;  1NG1 A;  2QTV A;  2I8B A;  5KYY A;  1M2V B;  3DE9 A;  2LD6 A;  1NU7 D;  1G8X A;  2L6F A;  3BRJ A;  4U5F E;  1HMD A;  1DOV A;  3KYJ A;  4JIO A;  4AE4 B;  2L6G A;  1JPJ A;  3KPH A;  2OQM A;  3ECS A;  3EJN A;  4C7O A;  4MTF A;  2YKZ A;  2J8W A;  1MQV A;  5L3Q A;  4X0R A;  5IY5 C;  3EG9 A;  4HFF B;  3AG2 C;  1E2X A;  2A68 F;  2J9V A;  3JT1 A;  1D0Y A;  4O6N A;  1ZW3 A;  1D0Z A;  4JKV A;  2X0C A;  3M4B A;  1L7C A;  3ITF A;  3AG3 C;  2A6E F;  3JRT A;  3O55 A;  4IWB A;  2XXA A;  4RBN A;  4Z9H A;  1PD1 A;  4R32 A;  1OXB A;  2QLA A;  3B0P A;  4OD4 A;  2KW3 C;  4YWQ A;  1QVX A;  3T9O A;  2EPO A;  2NUT B;  2JPU A;  1R5I D;  1JAF A;  4LER A;  4U5D E;  5L0J A;  4ZLD A;  3NKD A;  1QSP A;  1RXQ A;  1VK5 A;  3CEX A;  4IGG A;  2GA0 A;  3RF3 A;  3MX3 A;  2H8A A;  2J46 A;  3FOP A;  3IEE A;  3C18 A;  3QVY A;  5COG A;  5CI9 A;  3TK0 A;  2QUP A;  4FWV A;  1C03 A;  2GWW A;  4U5G A;  4BG0 A;  2Q3T A;  4O7G A;  1WWP A;  3ZTM A;  5E33 A;  3B29 A;  4N6H A;  3CAX A;  2J7P A;  1PD0 A;  1V4A A;  2MHR A;  2XLW A;  3DWW A;  4EWC A;  4W8P A;  4ULW A;  2R7X A;  2ZPA A;  3HKK A;  3KH2 A;  2G3K A;  1Z5Z A;  4XPW A;  4GEH A;  2V26 A;  1HW2 A;  3S27 A;  4MQ9 F;  4I44 A;  1K04 A;  2GFH A;  2LP4 A;  2KNH A;  3L34 A;  4XWJ A;  1EA8 A;  2Y69 C;  3C63 A;  1T6I A;  3DKA A;  3NKE A;  5FCL A;  3C7J A;  1D0X A;  1ZYR F;  2RSE B;  3LLK A;  1A7D A;  1PV3 A;  3C8G B;  2Q00 A;  3K66 A;  1M2V A;  5CI8 A;  3AQB A;  4U5C E;  2DB4 A;  1VOM A;  2QNL A;  3GWL A;  4P6I C;  1LI5 A;  2R03 A;  2WZL A;  1ZHW A;  3TJ6 A;  3VAY A;  2R7R A;  4RDA A;  1EI7 A;  4AE4 A;  4JUR I;  4MW8 A;  2WVQ A;  2VH3 A;  5DS5 A;  1GS9 A;  3WOD F;  2HJM A;  1YZC A;  2XSE A;  5KYW B;  1TR2 A;  4C3D A;  4D4X A;  4IAR A;  5KYX B;  3W2W A;  2VCB A;  3QMK A;  3OWT A;  1MMD A;  2FAP B;  4I1O B;  2EPN A;  4NQF A;  4UDV A;  1Q0M A;  2G62 A;  1TWA A;  2DGJ A;  2VAS A;  1T5O A;  3I5P A;  2CDQ A;  1ZW2 A;  2CNW A;  2J9B A;  3GEI A;  1HE1 A;  2Y3D A;  1RKC A;  4IAQ A;  3AG1 C;  2W45 A;  3JSE O;  4XEK A;  1LKX A;  1ORJ A;  3SXZ A;  4EKW A;  1Z23 A;  4U5E E;  4YT8 A;  1HY5 A;  2IOQ A;  4YL3 A;  2R05 A;  3J06 A;  3HNL A;  2ZD9 A;  3EQL F;  4HE8 D;  2OCC C;  3LES A;  3F46 A;  2NUT A;  3W2V A;  3SZR A;  1MMG A;  2EIJ C;  5BQG A;  3B0U X;  2A0B A;  3MYF A;  2ZXW C;  1Q0F A;  3FAP B;  1WGW A;  2AWC A;  4U5H A;  5JT4 A;  4BPM A;  2Q7R A;  2R7Q A;  3DMD A;  3G4Z A;  3VRC A;  3HJC A;  2R7O A;  1VYI A;  1QZX A;  1I5N A;  3RVZ A;  3A11 A;  3MYI A;  1CGO A;  4E0H A;  2LFD A;  1IZM A;  3V5Y A;  1L3P A;  3IQC A;  5B1B C;  3AG4 C;  4YK5 A;  2YZS A;  4JEB A;  4Q4Z F;  3L1M A;  2R7V A;  1GM5 A;  3ZWI A;  4JZA A;  4WAB A;  3B0V C;  4MS2 A;  3QTH A;  2LK4 A;  3H65 A;  2D5R B;  2WL8 A;  3LEO A;  1OCZ C;  2IBF A;  5HV9 A;  4YL1 A;  3QW1 A;  2GDC A;  1OR3 A;  4FX5 A;  1B68 A;  1VMA A;  1IW7 F;  2LIG A;  4YT5 A;  2NSF A;  1OR2 A;  1FMW A;  3C8G A;  4MVM A;  5EK0 A;  4DBR A;  4XTK A;  4BEJ A;  3NYJ A;  2YL0 A;  5B3I A;  5E3C A;  2CCY A;  4O79 A;  4MVQ A;  4ANJ A;  3DXJ F;  1ZU4 A;  4JRZ A;  5DQZ A;  3L0I A;  2IYL D;  2KJG A;  3LNR A;  1JPN A;  1Z7Q c;  4DVZ A;  2DI3 A;  4ONS A;  5JVE A;  5KYW A;  2HMZ A;  1JRA A;  3RVY A;  1LS4 A;  2WVO A;  3GM2 A;  3GAN A;  2Q9C A;  2J9W A;  2WZG A;  4HEA J;  5KYX A;  4CDV A;  2IXM A;  2XLD A;  1E83 A;  3ATP A;  3RQF A;  2MWQ A;  5HSW A;  1Z63 A;  2XS1 A;  3RFY A;  1LIH A;  2W9Y A;  4KBL A;  1RKE B;  4IRU A;  3ZQY A;  2H7B A;  2PFD A;  5FZT A;  4A4A A;  1TQG A;  2CYD A;  4DXW A;  4QI0 A;  1J8M F;  4KNV A;  1OQC A;  1H6G A;  1YA9 A;  2YLG A;  3QW0 A;  2KYH A;  1WOL A;  2M4E A;  5GPG B;  3S0X A;  4KI2 A;  3K6B A;  4GQH A;  4XPY A;  5L0H A;  3PHF 2;  4G7O F;  3RH3 A;  5L0G A;  2PBE A;  3TUL A;  1BZ4 A;  1PCX A;  3EH2 A;  3OA1 A;  4MVR A;  1KU2 A;  2A0U A;  2XL4 A;  2HMQ A;  3S29 A;  3JRM O;  4JJF A;  2HV7 A;  2ZXP A;  3QZC A;  4OIQ F;  1YYX A;  2NSG A;  2BC5 A;  1Z3I X;  3HLZ A;  5BQH A;  1ZHZ A;  1XWJ A;  2HSB A;  2OJQ A;  3TOM A;  1E85 A;  4ZLC A;  4JC7 A;  1Q0K A;  2KQ9 A;  2IXN A;  2YL1 A;  3EHN A;  1JMW A;  1TFO B;  1ST6 A;  3LNM B;  4EBB A;  2OG2 A;  2QE9 A;  4G0H A;  256B A;  1TFK B;  3UMH A;  2V3C C;  1ZHT A;  3EH1 A;  1OKK D;  1QLE C;  4KNW A;  4IJJ A;  3U2L A;  3B9Q A;  3CZ6 A;  3N24 A;  2HJ3 A;  2MYS A;  1A7E A;  1AVO B;  2WVN A;  1YVI A;  1FMV A;  1JR8 A;  3DD7 A;  3M1C B;  3N0T A;  2EPL X;  1C02 A;  1NZE A;  4CS9 C;  4E17 A;  1RCP A;  3FVY A;  1YYJ A;  4CDA A;  2ASR A;  5L0D A;  1A0B A;  3RW0 A;  3C8Z A;  4PJL A;  3MBG A;  4NTA A;  1I4Y A;  2YLI A;  5A6B D;  2LQG A;  3F47 A;  4XLN F;  3HNI A;  3GEH A;  2J0W A;  3JTL O;  1FFH A;  3SXK A;  5T1D B;  3GEE A;  4PFP A;  3ZVR A;  1ZHY A;  4M63 A;  4NC3 A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  1YZA A;  1E86 A;  1CPR A;  2XLM A;  3HNL A;  4IB4 A;  3NMK A;  1S05 A;  4ER9 A;  3HNJ A;  1QQ3 A;  5JT4 A;  3U8P A;  3VRC A;  2YL7 A;  3DE8 A;  1APC A;  1CGO A;  2XL6 A;  1CPQ A;  3IQ6 A;  3NMJ A;  1CGN A;  5JLI A;  4JEB A;  3L1M A;  3ZWI A;  5JRA A;  5JS5 A;  4ULV A;  4CJG A;  2XL8 A;  3DE9 A;  1M6T A;  3IQ5 A;  3QW1 A;  3NMI A;  2YKZ A;  2J8W A;  1MQV A;  2YL0 A;  5B3I A;  3C62 A;  2CCY A;  3ZQV A;  3FOO A;  4JKV A;  4JEA A;  5JVE A;  3M4B A;  1EKY A;  4CJO A;  2QLA A;  4CDV A;  1E83 A;  2XLD A;  2XM0 A;  3ZQY A;  1JAF A;  5AGF A;  3FOP A;  3QVY A;  4WGY A;  2YLG A;  3QW0 A;  2XM4 A;  4L6R A;  4U9D A;  5JP7 A;  3ZTM A;  3HNK A;  4N6H A;  1E84 A;  2XLW A;  2XLV A;  5JUA A;  3ZTZ A;  1QPU A;  1GQA A;  3M4C A;  1YYX A;  2YLD A;  2BC5 A;  4WGZ A;  3C63 A;  3TOM A;  1A7V A;  1E85 A;  3M79 A;  4D4N A;  1BBH A;  2YL1 A;  4CIP A;  3TOL A;  1NBB A;  256B A;  2XLE A;  4U9E A;  4EIY A;  2XLH A;  1YZC A;  4N4W A;  1RCP A;  2YL3 A;  4D4X A;  1YYJ A;  4IAR A;  4CDA A;  2YLI A;  4CDY A;  2XLO A;  4CX9 A;  3QVZ A;  4JE9 A;  3HNI A;  2J9B A;  5JSL A;  4IAQ A;  3M15 A;  4NC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...