2YL1A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16a variant at 1.03 a resolution - restraint refinement
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 54
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl1A00
5B3IA 5JSLA 1YYJA 1GQAA 1BBHA 3ZTZA 1CPQA 3L1MA 2QLAA 3NMIA 3IQ6A 4WGZA 3QVYA 2CCYA 3C63A 2YL7A 2XLWA 3ZQVA 4NC3A 5JT4A 2XL8A 4U9EA 4EIYA 3QW1A 2YLIA 1S05A 3FOPA 1YYXA 4CDYA 4CJGA 4D4NA 1E86A 3HNJA 4CDAA 1YZAA 2XLDA 5AGFA 4U9DA 3NMKA 5JRAA 1NBBA 3VRCA 2XLEA 1CPRA 1QPUA 4JEAA 1EKYA 1M6TA 1E85A 2XLVA 2YL0A 3QVZA 1RCPA 2XL6A 2YLDA 4JKVA 2XM0A 3C62A 3QW0A 5JUAA 4CJOA 3DE8A 1QQ3A 4WGYA 5JP7A 3ZWIA 4ULVA 1A7VA 1E84A 3U8PA 2YL3A 2BC5A 3M4CA 1LM3B 3HNLA 4JE9A 3M79A 3TOMA 3TOLA 4CX9A 3IQ5A 4IB4A 3HNKA 4CIPA 4ER9A 1CGOA 4IAQA 1APCA 2YLGA 3HNIA 4IARA 4CDVA 3M4BA 4JEBA 2YKZA 1E83A 1JAFA 5JLIA 1CGNA 1MQVA 1YZCA 4D4XA 2J8WA 2YL1A 4N6HA 2XLMA 5JS5A 2J9BA 2XM4A 3M15A 3DE9A 4L6RA 2XLHA 256BA 5JVEA 3FOOA 2XLOA 3NMJA 3ZTMA 3ZQYA 4N4WA
chains in the Genus database with same CATH superfamily
3KPHA 5KYYB 1VMAA 5B3IA 2E87A 4AL1A 5DQTA 5GPGB 1BBHA 2Q00A 5KYUA 2G3KA 4JTCB 3ZTZA 2LK4A 3TJ6A 1QVXA 3NMIA 2X0CA 1L7CA 4KC9A 4P6IC 1YA7O 2WZGA 3V5YA 3C63A 3JRTA 2ZXOA 4ONSA 3SXYA 4JURI 4C7OA 3RW0A 2HS5A 1QSPA 2RSEB 3MYIA 3ZQVA 4NC3A 3LEVA 3T6JA 5F5HA 4MW8A 3EQLF 4N06A 2YLIA 1V74B 1OW6A 2MYSA 4KNVA 4A2NB 4YL3A 2R7WA 4CSAA 4DRJB 1OW8A 1GS9A 2H7BA 2AP3A 4Z9HA 1T01A 1E86A 3HNJA 1G4WR 4EBJA 2W9YA 2Q9AA 3VRCA 4K1OA 3WG7C 3FDQA 4C3BA 1NZEA 4X0RA 1M56C 4JEAA 3RIPA 3RVZA 1JR8A 2EPNA 2OG2A 2OEVA 3ASOC 4NY3A 1RCPA 2ASRA 2UUHA 2L9JA 5DQZA 1FNTc 4PJNA 3TJ5A 1A0BA 4UDVA 3S28A 4Z9JA 4BG0A 4PR9A 1TKNA 3C62A 3H2UA 2M4EA 5B1BC 4CJOA 2J46A 5EHHA 4XPXA 3UMKA 1MNDA 2F22A 3K7DA 4PJLA 1RJ9A 1QLEC 5A6JA 4GYTA 1D0YA 1U89A 2ZXRA 4JJFA 4E0HA 5K0IA 3ZWIA 3NKDA 5T3TA 3U5SA 2YQYA 4U5DE 3LJBA 4J7TA 1JPNA 2J7PA 4MVRA 4CS8A 3V7OA 3ZVRA 2Y3DA 1BDJB 2GWWA 2CYDA 4QI2A 5A6KA 4M63A 2IBFA 3PHF2 1LM3B 1QZXA 2QUPA 4YT2A 3JYYA 2NSGA 2P6VA 1LI5A 1V4AA 3AG4C 3KMIA 4CBEA 3FHDA 2LQGA 1OR3A 3TOLA 3X2QC 1TWHA 2WVNA 5L0DA 4EUKB 4XQ1A 3UGPA 3IQ5A 2AVKA 3MLGA 5T1DB 4OIRF 2VCBA 1UFBA 2W4BA 1CGOA 1D0XA 3DM9B 3U3BA 2L6HA 4XWJA 2AWYA 4IRUA 3K33A 4EHPA 4CS9A 3HNIA 1T5OA 3GM1A 4LDRA 1LVKA 2CW0F 2HKVA 3B71A 3EGXB 4FWVA 4U5FE 4JEBA 3T4RA 1NU7D 2IM8A 3C8GD 1JAFA 2R03A 4C3DA 1ZHWA 2DB4A 1TWAA 2HUJA 2EIMC 2KW3C 1EQ1A 4D4XA 1BR1A 2YL1A 5L0IA 1NFNA 2XLMA 1VK5A 3WHNA 3AG1C 4A4AA 5L0JA 4PJJA 5A6AA 3HJCA 3EHNA 4U5HA 4LACB 3JT1A 1VYIA 3M15A 2HSBA 2DI3A 2JD3A 3S84A 1PD0A 3G4XA 2XLHA 3X1OA 4FESA 1MMGA 3HKKA 3EFOB 1I4YA 3DKAA 2GAQA 1R5ID 3FOOA 3ZTMA 2IXOA 4E7SA 5AC5A 1FMVA 3TD7A 4XLNF 2W45A 4XEFA 3B0VC 2NSFA 2J7PD 4BJ6A 3MBGA 3GEEA 5JSLA 3RQEA 3Q6MA 2HMZA 5DLJA 4BJ5C 2XS1A 2LFFA 2KK1A 4DBQA 3C8GB 2UUIA 1EI7A 1N1CA 2I8BA 1G4US 3IQ6A 1C03A 1OQCA 4WGZA 4K7BA 2OKUA 2H8AA 2AWCA 3O10A 5CI8A 2YL7A 1O3UA 3KKBA 5A6BD 1MNEA 3N0TA 3WAQA 4XPYA 2DYSC 3ZIBA 2CGEA 2A69F 2VCAA 1H6GA 2PP4A 4U9EA 3QW1A 4EKWA 4EIYA 1T6QA 3FOPA 4XLPF 4GEHA 5KYXA 2L6FA 1FFTC 2OU6A 1ZZPA 5COFA 4J32B 1WN0A 2IOQA 1YZAA 2XLDA 2HMQA 5L3QA 3SXZA 3EGDB 4BPMA 3NMKA 4JTDB 3RYLA 5JRAA 2J9WA 1ZYRF 3EG9A 2XLEA 3T9OA 1CPRA 1S7ZA 2CNWD 3AGTA 2KC3A 2XLVA 2A6EF 2O9XA 1TQGA 3AGUA 4N6CA 3HTKC 2R7VA 2Q9CA 2XM0A 3LESA 3K1IA 3RF3A 5L0FA 2A1DD 4J30B 4U5GA 2Y3BA 3W2WA 1OCRC 2LD6A 4E18A 3EZIA 2G62A 5A69A 4LDQA 2YZSA 1V55C 2V26A 2J9VA 2NPUA 2OQMA 4PFPA 4I1OB 5JP7A 1U0BB 3PCVA 2L7AA 4I1MA 4O6MA 1KU2A 4RD9A 1Z3IX 5L0GA 2FAPB 3U3FA 1JRAA 3SP1A 5L0HA 4DJ9A 5KYNA 4LLCA 1B68A 2BC5A 1D1BA 3ABLC 4MVUA 3RH3A 4CIHA 2NUTA 1ZHYA 4E7ZA 3KYIA 4FX5A 1LKXA 4G78A 1M57C 1YAUO 4MTGA 2H7VC 4H54A 3SYNA 3KL4A 1MMDA 4MVOA 1LE4A 1L3PA 2GFHA 3TOMA 4ANJA 2FFHA 5DS4A 1WWPA 2ZPAA 2Q7RA 5A6BA 3CZ6A 1OCOC 1MMNA 2G3VA 2R7QA 3AG3C 4RBNA 4HEAJ 4O7GA 3VM6A 4CX9A 1RMVA 4KI2A 4F4BA 2HJ3A 2HV7A 4HFFB 3S90A 1I4ZA 2IXNA 3FVYA 5B1AC 1SF8A 3SXMA 4Q4ZF 1LE2A 1APCA 1WGWA 2KGOA 4G0HA 4BEJA 4CSAC 2D5RB 2J0WA 4Q7CA 5KYWB 3TULA 4NCQA 4CDVA 1F1MA 1RKEB 1NSGB 3U9MA 3ZG1A 2XRHA 1RJ9B 1E83A 2Y39A 1LPEA 1CGNA 1MQVA 1FMWA 1LI7A 1ZW2A 3F47A 3NKEA 4JCZA 1G8XA 5DVWA 1RKCA 2B0JA 2YRFA 1M2VB 3O39A 5AC4A 3J06A 4QDLA 4N6HA 3AQBA 2EPOA 3DMDA 3EJNA 3OEOA 4YT5A 1C02A 2B0HA 2LFDA 3FXHA 4NTFA 3NDBB 2WZFA 3WODF 1AVOB 3U0CA 4OIOF 5E3AA 1O87A 2J9UA 3IQTA 3LLKA 2LIGA 3O6XA 1LS1A 1Q0FA 4W8KA 3NG1A 3RQGA 4YT8A 2HJMA 3SNHA 2EPKX 3Q7LA 3VYWA 5BUOA 1ZU4A 2EINC 3JYHA 1VYKA 3BEHA 256BA 4AX2A 5IY5C 5KYYA 2IYLD 1H9GA 2NUPB 2DYRC 1WASA 3DZAA 1YA9A 5KYUB 3MYFA 3ZQYA 1ZW3A 2QY9A 3CQZA 3B0UX 3S9OA 1YJGA 4DXWA 1O5HA 3IEEA 3UMIA 5HSWA 2A68F 1YYJA 2HFIA 1T6UA 2IXMA 1GQAA 3SEOA 4QI0A 4C7OB 2AU5A 2Q9BA 1CPQA 2R7XA 4E0IA 2GDCA 2XXAA 3CAXA 2R7UA 1OXBA 3N24A 3QVYA 2CCYA 2ZD9A 2PNOA 3NRHA 4CS7A 1ORYA 1U6HA 1LS4A 3FAJA 5COMA 1HE9A 3K66A 2W4MA 4DBRA 5JT4A 2HZ8A 4JRZA 1T6IA 4IGGA 1KTMA 3JSZA 1S05A 1K04A 2CNWA 3AQCA 4JVSA 3UR3C 3GEIA 3MFNA 3NYLA 5DS6A 4RDAA 4XEKA 5BQIA 3ABKC 4YN0B 3UMHA 4D4NA 2Q3TA 1G5ZA 1HE1A 3KH2A 2WL8A 3I5PA 4HFKB 2D4UA 2FGYA 1NBBA 2P1AA 3LLIA 3OWTA 4NTBA 3T6BA 1D0ZA 1QPUA 1OW7A 1TR2A 5L0CA 3G50A 2PBEA 5HV9A 4AE4A 2YL0A 4O6NA 1E85A 4DVYP 1EKYA 2ICWG 5TJ5E 3AG2C 2OJED 4XEVA 2IXPA 3DD7A 4PACA 1LIHA 4U5CE 1HMDA 1JOGA 2OOCA 3U2MA 3S27A 1HW2A 2MHRA 3A11A 1IW7F 3C8GA 1Z23A 1RXQA 1VOMA 3V5XA 5JUAA 4XTKA 1M2OA 3E70C 1HY5A 3QZCA 2OJQA 3RVYA 4WGYA 4C3EA 1HW1A 2NG1A 3NYJA 3ABMC 1QKRA 1D1AA 2X51A 3Q6NA 4CS9C 3W8HA 1YVIA 1KNYA 1ORJA 1XWJA 4JTAB 1A7DA 1WTYA 4K0DA 4LLEA 1W2WA 3H2VA 3S29A 3U8PA 1PD1A 5FCLA 4PFOA 1Z63A 1ORSC 4FAPB 2M64A 1ZVZA 4U5EE 4BJ5A 3L34A 5BQHA 1J8YF 1SMYF 1OKKA 3O55A 3M79A 4JE9A 2ZXWC 3I4UA 1PV3A 1H9TA 3RFYA 4MW3A 2P7VA 3PDMP 1Y6DA 2XL4A 4PK4A 1OR2A 1TWCA 2VC9A 5D91A 2XSEA 5DS5A 3EZHA 3POVA 2OCCC 2Z15A 3C7JA 4IB4A 3HNKA 3LAYA 4O6YA 2ETSA 4ULWA 2VASA 3UNGC 1Q0KA 3SZRA 4G7ZF 3DJUB 3EHMA 4OD5A 5EGYA 2CDQA 3U9JA 2HV6A 3L8JA 2R25A 2EPLX 2VB6A 2XS8A 2A0BA 2ZXPA 1VB5A 3C18A 3I5QA 4J7YA 1EA8A 3EH1A 2V3CC 4CS8C 2WVOA 2Q4FA 2YVKA 2YEVA 2WZLA 3JTLO 4NQFA 4U5BE 4Z9IA 3E9VA 1ZU5A 3EGXA 2J45A 1JPJA 3CSKA 1YLMA 3EPVA 3GM2A 3MX3A 4H4KC 4I3MA 1ZHZA 2DGJA 3IPMO 3T6GB 5JS5A 3PMRA 1VTMP 1JMWA 1SR2A 4E17A 2J9BA 2XM4A 1NLXA 3VF0A 2EIJC 1AEPA 3GANA 5EK0A 4EWCA 4YJWA 2R7OA 3DE9A 3HLZA 4L6RA 4BJ6C 1A41A 2H7OA 3B29A 4MNDA 5E33A 1TFKB 3DWWA 2MWQA 4YT4A 4JC7A 3L8IA 2QTVA 4KBLA 3DJNB 2PF4E 5JVEA 2XLOA 1Q0DA 4JJGA 4I44A 2WVQA 3ZDLA 3CEXA 3EFOA 4MVMA 2EPMX 3R2PA 3DM5A 1YARO 4HE8D 3GM3A 1HMOA 3OA1A 2Y3HA 2KYHA 3L1MA 1RKEA 1WATA 5COGA 2QLAA 1OKKD 1OXKA 5T3WA 1C17M 2C04A 1YDIA 2VH3A 3ASNC 4YL1A 5L3VA 3IQCA 4OIQF 4O79A 1OCZC 1TWGA 2XLWA 3JRMO 5E3CA 3ATPA 3GORA 3QMKA 1ZHTA 1FTSA 1BR4A 4BJ1A 4OIPF 2XL8A 4MS2A 4W8PA 3V5ZA 1XZQA 3A9CA 3K6BA 3EGDA 3H65A 3ZSUA 1K05A 3AOUA 1XZPA 2PFDA 3EG9B 1YYXA 1K40A 2Y69C 4CDYA 3IHUA 4CJGA 1NG1A 1GM5A 2PX0A 4CDAA 4P9FA 2KSFA 5AGFA 3K1IC 4MTOA 3U2LA 3U8VA 3W2VA 4U9DA 1PCXA 1UG7A 2R02A 5KYXB 4WJ0A 4ZLCA 2R9RB 1M6TA 3UGOA 3QVZA 2R05A 3G4ZA 3L0IA 4IWBA 2L6GA 3US6A 4ZLDA 2XL6A 1SZIA 3LNRA 2YLDA 4JKVA 4MTFA 3RQFA 1R4TA 3TQOA 4MVZA 4MQ9F 3DAFA 3C8ZA 4MVSA 3QW0A 2JX0A 3SXKA 5F5FA 2KJGA 3KYJA 1ZHXA 3DE8A 1NFOA 1QQ3A 1FR0A 5CI9A 2HSQA 2LP4A 4ULVA 3W4YA 2QNLA 1A7VA 4JZAA 5B3SC 1IZMA 3RKOF 4G7HF 1CGME 2P0NA 2TMVP 2BE5F 2GA0A 1E84A 3DI5A 2YL3A 4JW1A 3NYMA 3Q7GA 1WOLA 4G7OF 4Q5SF 3M4CA 4DRHB 1J8MF 2A0UA 3HNLA 3FMSA 2KNHA 2PX3A 1ST6A 4EBKA 3JCUQ 1Q0MA 2QE9A 3LEOA 4JIOA 5BQGA 1E2XA 2BL2A 1Y4CA 3LS0A 2LSEA 2R7TA 2NUTB 4P9TA 3GEHA 3LUTB 4WABA 4OINF 2WB7A 4AK9A 4R32A 1D1CA 2YHSA 4YL0A 1BR2A 4AE4B 4AL0A 5D92A 4KNWA 5KYWA 1AUEA 3S0XA 1TFOB 2R7RA 4CIPA 4ER9A 3QTHA 3ZC4A 4IAQA 4BJTA 2I15A 1BZ4A 2YLGA 3F46A 3GWNA 4OD4A 4DVZA 3M1CB 4JCHA 1VLSA 4IARA 1SYQA 3M4BA 1GGQA 1H7IA 1Q0GA 1Z6AA 1A7EA 4B6IA 1Z5ZA 2YKZA 2C03A 5JLIA 4YK5A 4IAOA 2J0XA 1Z7Qc 1YZCA 2VCCA 3DXJF 2A6HF 4EBBA 1FFHA 3EH2A 2J8WA 3VAYA 1OCCC 2OEXA 2JPUA 2YWAA 4XPWA 5FZTA 2Y3GA 4LDKA 1FAPB 3JSEO 3LNMB 4NTAA 5CIVA 4GQHA 2EILC 1M2VA 3N2ZB 3R7CA 2R7SA 2L81A 1V54C 4PJMA 3W8IA 2NUPA 2RD9A 4YWQA 1DOWA 3GODA 3AJMA 4DOZA 1I5NA 3GWLA 2EIKC 3B9QA 3DAGA 4IJJA 3B0PA 2LCHA 3LS1A 3K1HA 1MMAA 3FAPB 3NMJA 4LERA 3TK0A 3BRJA 1VLTA 4MVQA 4DRIB 5F28E 1DOVA 2KQ9A 5E2QA 4BEMJ 3JZ0A 2XXAB 4N4WA 1T9KA 3ECSA 3ITFA 1NU9C 2P61A
chains in the Genus database with same CATH topology
5B3IA 5JSLA 1YYJA 1GQAA 1BBHA 3ZTZA 1CPQA 3L1MA 2QLAA 3NMIA 3IQ6A 4WGZA 3QVYA 2CCYA 3C63A 2YL7A 2XLWA 3ZQVA 4NC3A 5JT4A 2XL8A 4U9EA 4EIYA 3QW1A 2YLIA 1S05A 3FOPA 1YYXA 4CDYA 4CJGA 4D4NA 1E86A 3HNJA 4CDAA 1YZAA 2XLDA 5AGFA 4U9DA 3NMKA 5JRAA 1NBBA 3VRCA 2XLEA 1CPRA 1QPUA 4JEAA 1EKYA 1M6TA 1E85A 2XLVA 2YL0A 3QVZA 1RCPA 2XL6A 2YLDA 4JKVA 2XM0A 3C62A 3QW0A 5JUAA 4CJOA 3DE8A 1QQ3A 4WGYA 5JP7A 3ZWIA 4ULVA 1A7VA 1E84A 3U8PA 2YL3A 2BC5A 3M4CA 1LM3B 3HNLA 4JE9A 3M79A 3TOMA 3TOLA 4CX9A 3IQ5A 4IB4A 3HNKA 4CIPA 4ER9A 1CGOA 4IAQA 1APCA 2YLGA 3HNIA 4IARA 4CDVA 3M4BA 4JEBA 2YKZA 1E83A 1JAFA 5JLIA 1CGNA 1MQVA 1YZCA 4D4XA 2J8WA 2YL1A 4N6HA 2XLMA 5JS5A 2J9BA 2XM4A 3M15A 3DE9A 4L6RA 2XLHA 256BA 5JVEA 3FOOA 2XLOA 3NMJA 3ZTMA 3ZQYA 4N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  5JSL A;  1YYJ A;  1GQA A;  1BBH A;  3ZTZ A;  1CPQ A;  3L1M A;  2QLA A;  3NMI A;  3IQ6 A;  4WGZ A;  3QVY A;  2CCY A;  3C63 A;  2YL7 A;  2XLW A;  3ZQV A;  4NC3 A;  5JT4 A;  2XL8 A;  4U9E A;  4EIY A;  3QW1 A;  2YLI A;  1S05 A;  3FOP A;  1YYX A;  4CDY A;  4CJG A;  4D4N A;  1E86 A;  3HNJ A;  4CDA A;  1YZA A;  2XLD A;  5AGF A;  4U9D A;  3NMK A;  5JRA A;  1NBB A;  3VRC A;  2XLE A;  1CPR A;  1QPU A;  4JEA A;  1EKY A;  1M6T A;  1E85 A;  2XLV A;  2YL0 A;  3QVZ A;  1RCP A;  2XL6 A;  2YLD A;  4JKV A;  2XM0 A;  3C62 A;  3QW0 A;  5JUA A;  4CJO A;  3DE8 A;  1QQ3 A;  4WGY A;  5JP7 A;  3ZWI A;  4ULV A;  1A7V A;  1E84 A;  3U8P A;  2YL3 A;  2BC5 A;  3M4C A;  1LM3 B;  3HNL A;  4JE9 A;  3M79 A;  3TOM A;  3TOL A;  4CX9 A;  3IQ5 A;  4IB4 A;  3HNK A;  4CIP A;  4ER9 A;  1CGO A;  4IAQ A;  1APC A;  2YLG A;  3HNI A;  4IAR A;  4CDV A;  3M4B A;  4JEB A;  2YKZ A;  1E83 A;  1JAF A;  5JLI A;  1CGN A;  1MQV A;  1YZC A;  4D4X A;  2J8W A;  2YL1 A;  4N6H A;  2XLM A;  5JS5 A;  2J9B A;  2XM4 A;  3M15 A;  3DE9 A;  4L6R A;  2XLH A;  256B A;  5JVE A;  3FOO A;  2XLO A;  3NMJ A;  3ZTM A;  3ZQY A;  4N4W A; 
#chains in the Genus database with same CATH topology
 3KPH A;  5KYY B;  1VMA A;  5B3I A;  2E87 A;  4AL1 A;  5DQT A;  5GPG B;  1BBH A;  2Q00 A;  5KYU A;  2G3K A;  4JTC B;  3ZTZ A;  2LK4 A;  3TJ6 A;  1QVX A;  3NMI A;  2X0C A;  1L7C A;  4KC9 A;  4P6I C;  1YA7 O;  2WZG A;  3V5Y A;  3C63 A;  3JRT A;  2ZXO A;  4ONS A;  3SXY A;  4JUR I;  4C7O A;  3RW0 A;  2HS5 A;  1QSP A;  2RSE B;  3MYI A;  3ZQV A;  4NC3 A;  3LEV A;  3T6J A;  5F5H A;  4MW8 A;  3EQL F;  4N06 A;  2YLI A;  1V74 B;  1OW6 A;  2MYS A;  4KNV A;  4A2N B;  4YL3 A;  2R7W A;  4CSA A;  4DRJ B;  1OW8 A;  1GS9 A;  2H7B A;  2AP3 A;  4Z9H A;  1T01 A;  1E86 A;  3HNJ A;  1G4W R;  4EBJ A;  2W9Y A;  2Q9A A;  3VRC A;  4K1O A;  3WG7 C;  3FDQ A;  4C3B A;  1NZE A;  4X0R A;  1M56 C;  4JEA A;  3RIP A;  3RVZ A;  1JR8 A;  2EPN A;  2OG2 A;  2OEV A;  3ASO C;  4NY3 A;  1RCP A;  2ASR A;  2UUH A;  2L9J A;  5DQZ A;  1FNT c;  4PJN A;  3TJ5 A;  1A0B A;  4UDV A;  3S28 A;  4Z9J A;  4BG0 A;  4PR9 A;  1TKN A;  3C62 A;  3H2U A;  2M4E A;  5B1B C;  4CJO A;  2J46 A;  5EHH A;  4XPX A;  3UMK A;  1MND A;  2F22 A;  3K7D A;  4PJL A;  1RJ9 A;  1QLE C;  5A6J A;  4GYT A;  1D0Y A;  1U89 A;  2ZXR A;  4JJF A;  4E0H A;  5K0I A;  3ZWI A;  3NKD A;  5T3T A;  3U5S A;  2YQY A;  4U5D E;  3LJB A;  4J7T A;  1JPN A;  2J7P A;  4MVR A;  4CS8 A;  3V7O A;  3ZVR A;  2Y3D A;  1BDJ B;  2GWW A;  2CYD A;  4QI2 A;  5A6K A;  4M63 A;  2IBF A;  3PHF 2;  1LM3 B;  1QZX A;  2QUP A;  4YT2 A;  3JYY A;  2NSG A;  2P6V A;  1LI5 A;  1V4A A;  3AG4 C;  3KMI A;  4CBE A;  3FHD A;  2LQG A;  1OR3 A;  3TOL A;  3X2Q C;  1TWH A;  2WVN A;  5L0D A;  4EUK B;  4XQ1 A;  3UGP A;  3IQ5 A;  2AVK A;  3MLG A;  5T1D B;  4OIR F;  2VCB A;  1UFB A;  2W4B A;  1CGO A;  1D0X A;  3DM9 B;  3U3B A;  2L6H A;  4XWJ A;  2AWY A;  4IRU A;  3K33 A;  4EHP A;  4CS9 A;  3HNI A;  1T5O A;  3GM1 A;  4LDR A;  1LVK A;  2CW0 F;  2HKV A;  3B71 A;  3EGX B;  4FWV A;  4U5F E;  4JEB A;  3T4R A;  1NU7 D;  2IM8 A;  3C8G D;  1JAF A;  2R03 A;  4C3D A;  1ZHW A;  2DB4 A;  1TWA A;  2HUJ A;  2EIM C;  2KW3 C;  1EQ1 A;  4D4X A;  1BR1 A;  2YL1 A;  5L0I A;  1NFN A;  2XLM A;  1VK5 A;  3WHN A;  3AG1 C;  4A4A A;  5L0J A;  4PJJ A;  5A6A A;  3HJC A;  3EHN A;  4U5H A;  4LAC B;  3JT1 A;  1VYI A;  3M15 A;  2HSB A;  2DI3 A;  2JD3 A;  3S84 A;  1PD0 A;  3G4X A;  2XLH A;  3X1O A;  4FES A;  1MMG A;  3HKK A;  3EFO B;  1I4Y A;  3DKA A;  2GAQ A;  1R5I D;  3FOO A;  3ZTM A;  2IXO A;  4E7S A;  5AC5 A;  1FMV A;  3TD7 A;  4XLN F;  2W45 A;  4XEF A;  3B0V C;  2NSF A;  2J7P D;  4BJ6 A;  3MBG A;  3GEE A;  5JSL A;  3RQE A;  3Q6M A;  2HMZ A;  5DLJ A;  4BJ5 C;  2XS1 A;  2LFF A;  2KK1 A;  4DBQ A;  3C8G B;  2UUI A;  1EI7 A;  1N1C A;  2I8B A;  1G4U S;  3IQ6 A;  1C03 A;  1OQC A;  4WGZ A;  4K7B A;  2OKU A;  2H8A A;  2AWC A;  3O10 A;  5CI8 A;  2YL7 A;  1O3U A;  3KKB A;  5A6B D;  1MNE A;  3N0T A;  3WAQ A;  4XPY A;  2DYS C;  3ZIB A;  2CGE A;  2A69 F;  2VCA A;  1H6G A;  2PP4 A;  4U9E A;  3QW1 A;  4EKW A;  4EIY A;  1T6Q A;  3FOP A;  4XLP F;  4GEH A;  5KYX A;  2L6F A;  1FFT C;  2OU6 A;  1ZZP A;  5COF A;  4J32 B;  1WN0 A;  2IOQ A;  1YZA A;  2XLD A;  2HMQ A;  5L3Q A;  3SXZ A;  3EGD B;  4BPM A;  3NMK A;  4JTD B;  3RYL A;  5JRA A;  2J9W A;  1ZYR F;  3EG9 A;  2XLE A;  3T9O A;  1CPR A;  1S7Z A;  2CNW D;  3AGT A;  2KC3 A;  2XLV A;  2A6E F;  2O9X A;  1TQG A;  3AGU A;  4N6C A;  3HTK C;  2R7V A;  2Q9C A;  2XM0 A;  3LES A;  3K1I A;  3RF3 A;  5L0F A;  2A1D D;  4J30 B;  4U5G A;  2Y3B A;  3W2W A;  1OCR C;  2LD6 A;  4E18 A;  3EZI A;  2G62 A;  5A69 A;  4LDQ A;  2YZS A;  1V55 C;  2V26 A;  2J9V A;  2NPU A;  2OQM A;  4PFP A;  4I1O B;  5JP7 A;  1U0B B;  3PCV A;  2L7A A;  4I1M A;  4O6M A;  1KU2 A;  4RD9 A;  1Z3I X;  5L0G A;  2FAP B;  3U3F A;  1JRA A;  3SP1 A;  5L0H A;  4DJ9 A;  5KYN A;  4LLC A;  1B68 A;  2BC5 A;  1D1B A;  3ABL C;  4MVU A;  3RH3 A;  4CIH A;  2NUT A;  1ZHY A;  4E7Z A;  3KYI A;  4FX5 A;  1LKX A;  4G78 A;  1M57 C;  1YAU O;  4MTG A;  2H7V C;  4H54 A;  3SYN A;  3KL4 A;  1MMD A;  4MVO A;  1LE4 A;  1L3P A;  2GFH A;  3TOM A;  4ANJ A;  2FFH A;  5DS4 A;  1WWP A;  2ZPA A;  2Q7R A;  5A6B A;  3CZ6 A;  1OCO C;  1MMN A;  2G3V A;  2R7Q A;  3AG3 C;  4RBN A;  4HEA J;  4O7G A;  3VM6 A;  4CX9 A;  1RMV A;  4KI2 A;  4F4B A;  2HJ3 A;  2HV7 A;  4HFF B;  3S90 A;  1I4Z A;  2IXN A;  3FVY A;  5B1A C;  1SF8 A;  3SXM A;  4Q4Z F;  1LE2 A;  1APC A;  1WGW A;  2KGO A;  4G0H A;  4BEJ A;  4CSA C;  2D5R B;  2J0W A;  4Q7C A;  5KYW B;  3TUL A;  4NCQ A;  4CDV A;  1F1M A;  1RKE B;  1NSG B;  3U9M A;  3ZG1 A;  2XRH A;  1RJ9 B;  1E83 A;  2Y39 A;  1LPE A;  1CGN A;  1MQV A;  1FMW A;  1LI7 A;  1ZW2 A;  3F47 A;  3NKE A;  4JCZ A;  1G8X A;  5DVW A;  1RKC A;  2B0J A;  2YRF A;  1M2V B;  3O39 A;  5AC4 A;  3J06 A;  4QDL A;  4N6H A;  3AQB A;  2EPO A;  3DMD A;  3EJN A;  3OEO A;  4YT5 A;  1C02 A;  2B0H A;  2LFD A;  3FXH A;  4NTF A;  3NDB B;  2WZF A;  3WOD F;  1AVO B;  3U0C A;  4OIO F;  5E3A A;  1O87 A;  2J9U A;  3IQT A;  3LLK A;  2LIG A;  3O6X A;  1LS1 A;  1Q0F A;  4W8K A;  3NG1 A;  3RQG A;  4YT8 A;  2HJM A;  3SNH A;  2EPK X;  3Q7L A;  3VYW A;  5BUO A;  1ZU4 A;  2EIN C;  3JYH A;  1VYK A;  3BEH A;  256B A;  4AX2 A;  5IY5 C;  5KYY A;  2IYL D;  1H9G A;  2NUP B;  2DYR C;  1WAS A;  3DZA A;  1YA9 A;  5KYU B;  3MYF A;  3ZQY A;  1ZW3 A;  2QY9 A;  3CQZ A;  3B0U X;  3S9O A;  1YJG A;  4DXW A;  1O5H A;  3IEE A;  3UMI A;  5HSW A;  2A68 F;  1YYJ A;  2HFI A;  1T6U A;  2IXM A;  1GQA A;  3SEO A;  4QI0 A;  4C7O B;  2AU5 A;  2Q9B A;  1CPQ A;  2R7X A;  4E0I A;  2GDC A;  2XXA A;  3CAX A;  2R7U A;  1OXB A;  3N24 A;  3QVY A;  2CCY A;  2ZD9 A;  2PNO A;  3NRH A;  4CS7 A;  1ORY A;  1U6H A;  1LS4 A;  3FAJ A;  5COM A;  1HE9 A;  3K66 A;  2W4M A;  4DBR A;  5JT4 A;  2HZ8 A;  4JRZ A;  1T6I A;  4IGG A;  1KTM A;  3JSZ A;  1S05 A;  1K04 A;  2CNW A;  3AQC A;  4JVS A;  3UR3 C;  3GEI A;  3MFN A;  3NYL A;  5DS6 A;  4RDA A;  4XEK A;  5BQI A;  3ABK C;  4YN0 B;  3UMH A;  4D4N A;  2Q3T A;  1G5Z A;  1HE1 A;  3KH2 A;  2WL8 A;  3I5P A;  4HFK B;  2D4U A;  2FGY A;  1NBB A;  2P1A A;  3LLI A;  3OWT A;  4NTB A;  3T6B A;  1D0Z A;  1QPU A;  1OW7 A;  1TR2 A;  5L0C A;  3G50 A;  2PBE A;  5HV9 A;  4AE4 A;  2YL0 A;  4O6N A;  1E85 A;  4DVY P;  1EKY A;  2ICW G;  5TJ5 E;  3AG2 C;  2OJE D;  4XEV A;  2IXP A;  3DD7 A;  4PAC A;  1LIH A;  4U5C E;  1HMD A;  1JOG A;  2OOC A;  3U2M A;  3S27 A;  1HW2 A;  2MHR A;  3A11 A;  1IW7 F;  3C8G A;  1Z23 A;  1RXQ A;  1VOM A;  3V5X A;  5JUA A;  4XTK A;  1M2O A;  3E70 C;  1HY5 A;  3QZC A;  2OJQ A;  3RVY A;  4WGY A;  4C3E A;  1HW1 A;  2NG1 A;  3NYJ A;  3ABM C;  1QKR A;  1D1A A;  2X51 A;  3Q6N A;  4CS9 C;  3W8H A;  1YVI A;  1KNY A;  1ORJ A;  1XWJ A;  4JTA B;  1A7D A;  1WTY A;  4K0D A;  4LLE A;  1W2W A;  3H2V A;  3S29 A;  3U8P A;  1PD1 A;  5FCL A;  4PFO A;  1Z63 A;  1ORS C;  4FAP B;  2M64 A;  1ZVZ A;  4U5E E;  4BJ5 A;  3L34 A;  5BQH A;  1J8Y F;  1SMY F;  1OKK A;  3O55 A;  3M79 A;  4JE9 A;  2ZXW C;  3I4U A;  1PV3 A;  1H9T A;  3RFY A;  4MW3 A;  2P7V A;  3PDM P;  1Y6D A;  2XL4 A;  4PK4 A;  1OR2 A;  1TWC A;  2VC9 A;  5D91 A;  2XSE A;  5DS5 A;  3EZH A;  3POV A;  2OCC C;  2Z15 A;  3C7J A;  4IB4 A;  3HNK A;  3LAY A;  4O6Y A;  2ETS A;  4ULW A;  2VAS A;  3UNG C;  1Q0K A;  3SZR A;  4G7Z F;  3DJU B;  3EHM A;  4OD5 A;  5EGY A;  2CDQ A;  3U9J A;  2HV6 A;  3L8J A;  2R25 A;  2EPL X;  2VB6 A;  2XS8 A;  2A0B A;  2ZXP A;  1VB5 A;  3C18 A;  3I5Q A;  4J7Y A;  1EA8 A;  3EH1 A;  2V3C C;  4CS8 C;  2WVO A;  2Q4F A;  2YVK A;  2YEV A;  2WZL A;  3JTL O;  4NQF A;  4U5B E;  4Z9I A;  3E9V A;  1ZU5 A;  3EGX A;  2J45 A;  1JPJ A;  3CSK A;  1YLM A;  3EPV A;  3GM2 A;  3MX3 A;  4H4K C;  4I3M A;  1ZHZ A;  2DGJ A;  3IPM O;  3T6G B;  5JS5 A;  3PMR A;  1VTM P;  1JMW A;  1SR2 A;  4E17 A;  2J9B A;  2XM4 A;  1NLX A;  3VF0 A;  2EIJ C;  1AEP A;  3GAN A;  5EK0 A;  4EWC A;  4YJW A;  2R7O A;  3DE9 A;  3HLZ A;  4L6R A;  4BJ6 C;  1A41 A;  2H7O A;  3B29 A;  4MND A;  5E33 A;  1TFK B;  3DWW A;  2MWQ A;  4YT4 A;  4JC7 A;  3L8I A;  2QTV A;  4KBL A;  3DJN B;  2PF4 E;  5JVE A;  2XLO A;  1Q0D A;  4JJG A;  4I44 A;  2WVQ A;  3ZDL A;  3CEX A;  3EFO A;  4MVM A;  2EPM X;  3R2P A;  3DM5 A;  1YAR O;  4HE8 D;  3GM3 A;  1HMO A;  3OA1 A;  2Y3H A;  2KYH A;  3L1M A;  1RKE A;  1WAT A;  5COG A;  2QLA A;  1OKK D;  1OXK A;  5T3W A;  1C17 M;  2C04 A;  1YDI A;  2VH3 A;  3ASN C;  4YL1 A;  5L3V A;  3IQC A;  4OIQ F;  4O79 A;  1OCZ C;  1TWG A;  2XLW A;  3JRM O;  5E3C A;  3ATP A;  3GOR A;  3QMK A;  1ZHT A;  1FTS A;  1BR4 A;  4BJ1 A;  4OIP F;  2XL8 A;  4MS2 A;  4W8P A;  3V5Z A;  1XZQ A;  3A9C A;  3K6B A;  3EGD A;  3H65 A;  3ZSU A;  1K05 A;  3AOU A;  1XZP A;  2PFD A;  3EG9 B;  1YYX A;  1K40 A;  2Y69 C;  4CDY A;  3IHU A;  4CJG A;  1NG1 A;  1GM5 A;  2PX0 A;  4CDA A;  4P9F A;  2KSF A;  5AGF A;  3K1I C;  4MTO A;  3U2L A;  3U8V A;  3W2V A;  4U9D A;  1PCX A;  1UG7 A;  2R02 A;  5KYX B;  4WJ0 A;  4ZLC A;  2R9R B;  1M6T A;  3UGO A;  3QVZ A;  2R05 A;  3G4Z A;  3L0I A;  4IWB A;  2L6G A;  3US6 A;  4ZLD A;  2XL6 A;  1SZI A;  3LNR A;  2YLD A;  4JKV A;  4MTF A;  3RQF A;  1R4T A;  3TQO A;  4MVZ A;  4MQ9 F;  3DAF A;  3C8Z A;  4MVS A;  3QW0 A;  2JX0 A;  3SXK A;  5F5F A;  2KJG A;  3KYJ A;  1ZHX A;  3DE8 A;  1NFO A;  1QQ3 A;  1FR0 A;  5CI9 A;  2HSQ A;  2LP4 A;  4ULV A;  3W4Y A;  2QNL A;  1A7V A;  4JZA A;  5B3S C;  1IZM A;  3RKO F;  4G7H F;  1CGM E;  2P0N A;  2TMV P;  2BE5 F;  2GA0 A;  1E84 A;  3DI5 A;  2YL3 A;  4JW1 A;  3NYM A;  3Q7G A;  1WOL A;  4G7O F;  4Q5S F;  3M4C A;  4DRH B;  1J8M F;  2A0U A;  3HNL A;  3FMS A;  2KNH A;  2PX3 A;  1ST6 A;  4EBK A;  3JCU Q;  1Q0M A;  2QE9 A;  3LEO A;  4JIO A;  5BQG A;  1E2X A;  2BL2 A;  1Y4C A;  3LS0 A;  2LSE A;  2R7T A;  2NUT B;  4P9T A;  3GEH A;  3LUT B;  4WAB A;  4OIN F;  2WB7 A;  4AK9 A;  4R32 A;  1D1C A;  2YHS A;  4YL0 A;  1BR2 A;  4AE4 B;  4AL0 A;  5D92 A;  4KNW A;  5KYW A;  1AUE A;  3S0X A;  1TFO B;  2R7R A;  4CIP A;  4ER9 A;  3QTH A;  3ZC4 A;  4IAQ A;  4BJT A;  2I15 A;  1BZ4 A;  2YLG A;  3F46 A;  3GWN A;  4OD4 A;  4DVZ A;  3M1C B;  4JCH A;  1VLS A;  4IAR A;  1SYQ A;  3M4B A;  1GGQ A;  1H7I A;  1Q0G A;  1Z6A A;  1A7E A;  4B6I A;  1Z5Z A;  2YKZ A;  2C03 A;  5JLI A;  4YK5 A;  4IAO A;  2J0X A;  1Z7Q c;  1YZC A;  2VCC A;  3DXJ F;  2A6H F;  4EBB A;  1FFH A;  3EH2 A;  2J8W A;  3VAY A;  1OCC C;  2OEX A;  2JPU A;  2YWA A;  4XPW A;  5FZT A;  2Y3G A;  4LDK A;  1FAP B;  3JSE O;  3LNM B;  4NTA A;  5CIV A;  4GQH A;  2EIL C;  1M2V A;  3N2Z B;  3R7C A;  2R7S A;  2L81 A;  1V54 C;  4PJM A;  3W8I A;  2NUP A;  2RD9 A;  4YWQ A;  1DOW A;  3GOD A;  3AJM A;  4DOZ A;  1I5N A;  3GWL A;  2EIK C;  3B9Q A;  3DAG A;  4IJJ A;  3B0P A;  2LCH A;  3LS1 A;  3K1H A;  1MMA A;  3FAP B;  3NMJ A;  4LER A;  3TK0 A;  3BRJ A;  1VLT A;  4MVQ A;  4DRI B;  5F28 E;  1DOV A;  2KQ9 A;  5E2Q A;  4BEM J;  3JZ0 A;  2XXA B;  4N4W A;  1T9K A;  3ECS A;  3ITF A;  1NU9 C;  2P61 A; 
#chains in the Genus database with same CATH homology
 5B3I A;  5JSL A;  1YYJ A;  1GQA A;  1BBH A;  3ZTZ A;  1CPQ A;  3L1M A;  2QLA A;  3NMI A;  3IQ6 A;  4WGZ A;  3QVY A;  2CCY A;  3C63 A;  2YL7 A;  2XLW A;  3ZQV A;  4NC3 A;  5JT4 A;  2XL8 A;  4U9E A;  4EIY A;  3QW1 A;  2YLI A;  1S05 A;  3FOP A;  1YYX A;  4CDY A;  4CJG A;  4D4N A;  1E86 A;  3HNJ A;  4CDA A;  1YZA A;  2XLD A;  5AGF A;  4U9D A;  3NMK A;  5JRA A;  1NBB A;  3VRC A;  2XLE A;  1CPR A;  1QPU A;  4JEA A;  1EKY A;  1M6T A;  1E85 A;  2XLV A;  2YL0 A;  3QVZ A;  1RCP A;  2XL6 A;  2YLD A;  4JKV A;  2XM0 A;  3C62 A;  3QW0 A;  5JUA A;  4CJO A;  3DE8 A;  1QQ3 A;  4WGY A;  5JP7 A;  3ZWI A;  4ULV A;  1A7V A;  1E84 A;  3U8P A;  2YL3 A;  2BC5 A;  3M4C A;  1LM3 B;  3HNL A;  4JE9 A;  3M79 A;  3TOM A;  3TOL A;  4CX9 A;  3IQ5 A;  4IB4 A;  3HNK A;  4CIP A;  4ER9 A;  1CGO A;  4IAQ A;  1APC A;  2YLG A;  3HNI A;  4IAR A;  4CDV A;  3M4B A;  4JEB A;  2YKZ A;  1E83 A;  1JAF A;  5JLI A;  1CGN A;  1MQV A;  1YZC A;  4D4X A;  2J8W A;  2YL1 A;  4N6H A;  2XLM A;  5JS5 A;  2J9B A;  2XM4 A;  3M15 A;  3DE9 A;  4L6R A;  2XLH A;  256B A;  5JVE A;  3FOO A;  2XLO A;  3NMJ A;  3ZTM A;  3ZQY A;  4N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...