2YL1A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16a variant at 1.03 a resolution - restraint refinement
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 54
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl1A00
4WGYA 2YLDA 5JS5A 1A7VA 3ZTZA 1M6TA 5JT4A 1E83A 3DE9A 2YL3A 2XLWA 3TOMA 1QQ3A 1S05A 1E84A 2J9BA 3ZTMA 4CX9A 3NMIA 1EKYA 3TOLA 3IQ6A 1YYXA 4D4NA 1E86A 5JSLA 1YZAA 3HNKA 3U8PA 4IB4A 4D4XA 2XLEA 3C62A 3IQ5A 1JAFA 3M4CA 3HNLA 4CDAA 3M79A 2YL0A 4JEAA 2XLMA 1CPRA 4NC3A 1CPQA 3VRCA 3ZQYA 4CIPA 2YL7A 4EIYA 2CCYA 2QLAA 1LM3B 1NBBA 3QVZA 4JKVA 4ULVA 1BBHA 4WGZA 5B3IA 5JUAA 2BC5A 2YLGA 4U9EA 3HNIA 4IAQA 3M4BA 3M15A 1QPUA 2XL6A 1CGNA 256BA 3QW1A 5JVEA 2YKZA 3ZWIA 5JLIA 4JEBA 2XLOA 2J8WA 3QW0A 2XM0A 5JP7A 4IARA 3C63A 1E85A 4N4WA 3FOPA 4JE9A 1CGOA 2XL8A 1YZCA 2XM4A 3DE8A 3FOOA 5JRAA 2YL1A 4N6HA 3L1MA 1MQVA 4CDVA 3NMKA 4L6RA 2YLIA 4CJGA 4CJOA 2XLVA 3QVYA 3NMJA 1APCA 2XLDA 4CDYA 4U9DA 1RCPA 3HNJA 1GQAA 5AGFA 3ZQVA 1YYJA 4ER9A 2XLHA
chains in the Genus database with same CATH superfamily
5L0JA 4EBBA 4DRJB 2W4BA 4DBRA 2P0NA 4YL1A 5L0DA 1M6TA 2XS1A 2XS8A 2Q00A 1VTMP 1MMNA 2G3KA 3BRJA 3T6GB 3LLKA 1T9KA 2A6EF 1SZIA 1E83A 4OIQF 4N06A 2E87A 1BR2A 3F47A 1T6UA 2R7WA 1ZVZA 3FHDA 1QQ3A 1S05A 1T01A 3FDQA 3RYLA 2HV6A 4JZAA 2PFDA 3Q7GA 1T6QA 1F1MA 1WATA 4U5FE 1FMWA 3V7OA 3Q6MA 3JRTA 3O6XA 3N2ZB 1JPJA 3C18A 4FWVA 4OIRF 4BJ6A 4Q4ZF 1OXBA 3O39A 5JSLA 1VB5A 2PF4E 1SMYF 1W2WA 5L0IA 1LE4A 2XLEA 3S9OA 1XZPA 1ZW3A 3EFOA 3IQ5A 5B1AC 3DD7A 1QKRA 4H4KC 4CDAA 1Q0KA 4JRZA 4YJWA 4LLCA 2HS5A 3FVYA 2KQ9A 4YN0B 4Q7CA 2OQMA 3OWTA 1A0BA 2XLMA 2OU6A 1CPQA 2ZPAA 3CEXA 2P61A 3TULA 3IEEA 4NTAA 4BG0A 1NFNA 2PP4A 1VMAA 2IM8A 1OW6A 3TK0A 1JMWA 3VRCA 3L34A 3UMKA 3FXHA 1T6IA 2R7QA 2NG1A 1UFBA 4CIPA 4XLNF 1MMDA 2Y39A 4YL0A 1TWHA 1D1AA 3L8JA 2X0CA 3X2QC 4LLEA 4EIYA 2QLAA 4JVSA 4FX5A 1YDIA 3UR3C 4JJFA 2ZXWC 3GWLA 2XXAA 3S29A 1NLXA 2A69F 3AQCA 5JUAA 2G62A 4MTFA 2G3VA 2M64A 3NG1A 1Q0DA 1TFKB 3EZIA 3HNIA 4U9EA 5E2QA 1A7EA 4U5BE 1OW7A 2LIGA 4MVRA 3M15A 4MVSA 1QPUA 2L7AA 3SZRA 1L7CA 2XL6A 2VB6A 1TFOB 2MYSA 4G78A 4JW1A 3RW0A 1OQCA 2CYDA 1CGNA 2LK4A 2L81A 1FFHA 2MWQA 5K0IA 1NZEA 4O79A 2XRHA 5L3VA 3ZWIA 5JLIA 4ULWA 2MHRA 3Q6NA 2IBFA 2NSFA 2XLOA 3QW0A 3V5XA 3GM2A 1PCXA 3AQBA 3K33A 1MNDA 3C8GD 3KPHA 4CS8C 1M2OA 1SF8A 2QUPA 3M1CB 2HMQA 1ZHWA 3DJNB 3LAYA 4E0IA 3S84A 4JE9A 3WHNA 2R7RA 4XPWA 1LPEA 1MMGA 3NYMA 4MVUA 2Y3HA 4N6CA 4W8KA 1B68A 2H7OA 1YZCA 3KH2A 3DI5A 3MBGA 3DE8A 2R7TA 3SP1A 1HW1A 2HJMA 3UGPA 3NKDA 4YT4A 3RKOF 2P7VA 3B0UX 1V74B 3CAXA 3K7DA 5GPGB 3JRMO 2XXAB 2D4UA 4XWJA 1Q0FA 4BEMJ 4CJOA 1GM5A 5CIVA 1K05A 3MFNA 4ANJA 3R2PA 3K6BA 4PR9A 4DVZA 1APCA 1HMDA 1LI5A 3TJ6A 3F46A 3C8GA 3GEIA 2EPLX 1D1CA 2LSEA 1GQAA 2Q9CA 1D1BA 2ZXRA 3HNJA 3I4UA 3IPMO 4U5GA 5A6AA 2A0UA 2EILC 3B0VC 1EQ1A 4RD9A 4MVZA 4BPMA 2R9RB 1TWAA 1YARO 5E3AA 4WGYA 2YLDA 1PD1A 4Z9HA 5JS5A 2J0WA 3B0PA 3SNHA 3KYIA 2R7UA 2WZFA 5KYNA 2YZSA 1PV3A 1Q0MA 1TQGA 4QI0A 1NSGB 5F5FA 5CI9A 2R03A 3EGDA 3U2MA 2OKUA 1Z6AA 3QMKA 1LIHA 4HE8D 2J9BA 1H7IA 4CX9A 1AEPA 2QTVA 5T1DB 2HSBA 1EKYA 1ZHTA 2AVKA 3G4XA 4RBNA 5T3WA 1VYKA 1YYXA 3JT1A 3K1IC 4Z9IA 5COFA 2WZLA 2NUTA 2I8BA 1VLTA 2JX0A 2J0XA 1RJ9B 3X1OA 4XQ1A 3LEOA 3HNKA 2Y3DA 1ZHYA 2QY9A 4MQ9F 1OR3A 3U8PA 4A4AA 3AGUA 2Q9AA 3G50A 3C62A 3GANA 3U9JA 5IY5C 4PJMA 2YRFA 1ZYRF 4MS2A 2ZXPA 2R05A 3GEEA 4I3MA 3DM9B 3HNLA 4J7YA 1GS9A 1Y4CA 1FAPB 1G5ZA 2F22A 2GA0A 1TWGA 2H8AA 1I4YA 4MTGA 4O7GA 4O6MA 3WAQA 3WODF 3C8GB 3E70C 4NC3A 5E33A 4OIOF 2B0HA 1L3PA 5DS4A 1OR2A 1ORSC 4KNVA 1M2VA 2A1DD 1YA7O 1G4US 2OJED 4C3BA 3RQFA 2L6HA 4PJNA 3G4ZA 4O6NA 3HKKA 3GORA 3ECSA 2LCHA 4F4BA 4YK5A 4XTKA 1ZZPA 2WB7A 3I5QA 2FGYA 3H2VA 1LM3B 2AU5A 3EGDB 2BL2A 4CSAA 3V5ZA 4EBJA 3ASOC 3PMRA 1AVOB 2BE5F 2EIKC 2EPOA 2HV7A 2Y3GA 3H65A 2J9WA 3AJMA 2VC9A 4C7OA 2NUTB 3C8ZA 4LACB 5L3QA 4EBKA 5DS6A 3AGTA 2WVOA 4U5DE 2QNLA 1EI7A 1RKCA 4OD4A 5DQZA 2H7BA 1VOMA 5KYXA 4IJJA 1OCRC 256BA 4JTAB 1D0YA 1Y6DA 4U5HA 1IZMA 5DVWA 4KBLA 3RVZA 2V26A 4XEKA 3DXJF 3SYNA 2J8WA 2ASRA 3RQGA 5JP7A 3GODA 2Q4FA 1PD0A 3BEHA 3HJCA 1M2VB 2ZXOA 3C63A 1E85A 3N24A 2VCCA 1A41A 2IXNA 4MTOA 2VCBA 2XL8A 2C03A 1VYIA 2XM4A 3JZ0A 2HUJA 4X0RA 4YT5A 4A2NB 1R5ID 3KL4A 4O6YA 3HTKC 3LESA 3QTHA 3E9VA 4JJGA 2IYLD 1CGME 4CDVA 3AG2C 3KMIA 1OCCC 3UMHA 3LNMB 4CBEA 3SXMA 3RQEA 3FMSA 1DOVA 4RDAA 3U8VA 4J32B 4KC9A 1LE2A 1FMVA 4WABA 4DJ9A 4C7OB 3R7CA 5BUOA 2HFIA 2DGJA 2XLDA 4FESA 4CDYA 4U9DA 1BR1A 1QSPA 1WWPA 1H9TA 1O5HA 5KYXB 3N0TA 2KW3C 3UGOA 1XZQA 1H9GA 3A11A 3TJ5A 3ITFA 3O10A 1O3UA 5D92A 2A0BA 4UDVA 1ST6A 2EIJC 3Q7LA 3EG9B 1M56C 4EWCA 2LFDA 1Z63A 2RD9A 4IAOA 1A7VA 2FFHA 4P6IC 4XEFA 4MW3A 4B6IA 5T3TA 3DE9A 1LKXA 4BJ1A 2XLWA 2PBEA 2IXMA 1RJ9A 2KNHA 4XPYA 4XLPF 2X51A 4JTDB 4AE4A 3ZTMA 4IGGA 5B3SC 1WTYA 2P6VA 5FCLA 1HMOA 3TOLA 1J8YF 3AOUA 4AL1A 4D4NA 1HE9A 2J7PD 4DXWA 5CI8A 1FR0A 1K40A 1IW7F 1NG1A 2CDQA 2YWAA 4YT8A 3L8IA 4PFPA 4LDRA 4WJ0A 2UUHA 3FAPB 5TJ5E 3I5PA 2DYSC 2XL4A 1JAFA 3M4CA 1VK5A 3EPVA 4FAPB 4IWBA 3M79A 3A9CA 4OINF 2Q7RA 1CPRA 4DRHB 3LUTB 1H6GA 3RF3A 3NYLA 4J7TA 3AG4C 5AC4A 3U9MA 5KYWA 3EGXA 1K04A 4DVYP 1JPNA 2LP4A 2NPUA 4OD5A 2AWCA 2YHSA 3ZQYA 1HY5A 2OJQA 3RVYA 1U0BB 2VCAA 3S28A 2EIMC 1RXQA 2YL7A 3KYJA 5FZTA 3SXYA 3T4RA 2JD3A 3JCUQ 4CIHA 4EHPA 2YVKA 5A6JA 1KTMA 3S0XA 2PX3A 2J7PA 4IRUA 1WOLA 4CS8A 1NBBA 2OOCA 3EQLF 3LEVA 3UMIA 3DJUB 4JKVA 4MVQA 4ULVA 4AE4B 1G8XA 1QVXA 2OG2A 2WL8A 3IHUA 4E0HA 1Q0GA 1XWJA 2QE9A 2BC5A 1RMVA 2GAQA 1ORYA 1UG7A 4IAQA 3PCVA 2XSEA 1ZU4A 3IQTA 1WASA 2NSGA 1SR2A 5COMA 4G7HF 1BDJB 2NUPA 5COGA 1ZU5A 2J9VA 2R02A 3LLIA 1Z23A 4LDKA 3SEOA 3B29A 2O9XA 4W8PA 4I1MA 4JCHA 4JC7A 3MX3A 2WZGA 3TQOA 2YKZA 1DOWA 1OCOC 4P9TA 1YAUO 4JEBA 3VYWA 4U5EE 3ZIBA 3EHMA 2XM0A 2P1AA 3K66A 3JSEO 2Y3BA 3KKBA 5KYWB 5E3CA 3EGXB 3T6JA 3JTLO 4N4WA 3U5SA 3IQCA 2YQYA 4AK9A 2IOQA 3NRHA 3ZC4A 1FFTC 1QZXA 1V54C 2EPKX 2R25A 4C3EA 4EKWA 2R7OA 1HE1A 1U6HA 4N6HA 4K0DA 4DRIB 5BQHA 5JRAA 1O87A 2IXOA 1V4AA 3NKEA 3GWNA 1ORJA 4H54A 3NMKA 4U5CE 3RFYA 1R4TA 4PACA 1D0XA 1WN0A 4L6RA 5DQTA 3ASNC 1WGWA 2YLIA 4HFFB 3ABKC 1I5NA 2XLVA 3AG1C 3DAGA 5EK0A 4LERA 3QVYA 1OCZC 1J8MF 3NMJA 4YL3A 3W8IA 5L0FA 2A68F 2LQGA 5L0GA 3DMDA 3EG9A 1C02A 1M57C 4E7SA 2AWYA 1RCPA 5F28E 2NUPB 3K1IA 3K1HA 1AUEA 2A6HF 3NDBB 2Q9BA 4GEHA 3ZQVA 1YYJA 5A6BD 5BQIA 2V3CC 4G7ZF 2ETSA 2H7VC 1MQVA 2XLHA 3MYIA 1BZ4A 2YEVA 4I44A 4NQFA 3LNRA 4PFOA 5D91A 1YA9A 2B0JA 3ATPA 3ZTZA 1Z7Qc 2R7XA 2Q3TA 4BJTA 3EZHA 1LI7A 2EINC 3TD7A 5JT4A 1T5OA 4MW8A 3UNGC 3FAJA 2YL3A 3TOMA 4R32A 2KJGA 2CNWD 2TMVP 4ZLCA 1V55C 4G7OF 1D0ZA 1YLMA 3CQZA 3U2LA 1OKKD 3LS1A 5EHHA 3NMIA 2Y69C 2OEVA 3MYFA 3S90A 4E7ZA 1JRAA 2W4MA 1E2XA 2KGOA 4NY3A 4OIPF 3EH2A 4LDQA 3OA1A 4XPXA 3IQ6A 4JIOA 5DLJA 2AP3A 4J30B 1YJGA 1ZHXA 1ZW2A 1VLSA 3EH1A 3W2WA 3W8HA 1E86A 2J45A 4K7BA 3SXZA 4AX2A 1YZAA 3VAYA 4BJ5C 4IB4A 4HFKB 3U3BA 1RKEA 2ICWG 3GM3A 5AC5A 5A6BA 1FTSA 3POVA 1G4WR 2L6GA 5EGYA 3DKAA 1OW8A 1LVKA 3HLZA 4E18A 1C17M 5L0HA 5DS5A 4YWQA 3ABMC 2YL0A 2C04A 4JEAA 3WG7C 2DYRC 3DWWA 3O55A 2VH3A 2FAPB 3EFOB 2D5RB 4ZLDA 1Z3IX 4QI2A 4GYTA 4CS9C 2CNWA 2KSFA 2VASA 3U3FA 1OKKA 5F5HA 4YT2A 2HMZA 2DB4A 3B9QA 1LS1A 2HJ3A 4Z9JA 1MMAA 3PHF2 2CCYA 1MNEA 4PJLA 2LFFA 2EPMX 3L0IA 2KYHA 4JURI 3OEOA 1JOGA 1KU2A 1OXKA 2J9UA 2WVQA 3QVZA 1NFOA 3EHNA 4NTBA 3RH3A 1S7ZA 1LS4A 2KK1A 5KYYA 1BBHA 4QDLA 4WGZA 5KYUA 5A6KA 5B3IA 3VF0A 2W45A 2GDCA 2YLGA 3AG3C 3JYHA 4JCZA 3V5YA 3DAFA 4CS7A 3MLGA 1NU7D 2KC3A 3EJNA 3NYJA 4M63A 2OCCC 2OEXA 1NU9C 3JSZA 2CW0F 3M4BA 3S27A 2L9JA 2J46A 1EA8A 3US6A 2UUIA 3B71A 1HW2A 3ZG1A 1RKEB 2EPNA 2HKVA 3W4YA 3J06A 1KNYA 2ZD9A 4P9FA 1YVIA 4NCQA 4PK4A 1C03A 3QW1A 5JVEA 2R7VA 3VM6A 2W9YA 4HEAJ 3ZDLA 2R7SA 1GGQA 2CGEA 4ONSA 3W2VA 1U89A 1SYQA 4BJ6C 1E84A 3PDMP 1BR4A 2HSQA 4CSAC 4NTFA 4DBQA 3RIPA 4AL0A 4IARA 1Z5ZA 3SXKA 4BJ5A 2PX0A 3FOPA 4JTCB 4MNDA 2DI3A 3ZSUA 5HV9A 5HSWA 2L6FA 1CGOA 4MVOA 2M4EA 4G0HA 3ZVRA 4GQHA 1N1CA 4I1OB 3FOOA 2YL1A 3GM1A 2GWWA 2I15A 3LJBA 3QZCA 3JYYA 3L1MA 3LS0A 1QLEC 4E17A 3CSKA 4Q5SF 3DM5A 2Z15A 4MVMA 3GEHA 3ABLC 4CJGA 1TWCA 5KYYB 5KYUB 1ZHZA 4K1OA 4D4XA 4DOZA 1TR2A 2GFHA 4XEVA 4C3DA 4CS9A 3U0CA 4KI2A 3H2UA 2HZ8A 1JR8A 1TKNA 2JPUA 5A69A 1I4ZA 3T6BA 4PJJA 5B1BC 5L0CA 4KNWA 2RSEB 3T9OA 2IXPA 1A7DA 4EUKB 1FNTc 5AGFA 2PNOA 3DZAA 2LD6A 5BQGA 2WVNA 4BEJA 3CZ6A 3C7JA 4ER9A
chains in the Genus database with same CATH topology
4WGYA 2YLDA 5JS5A 1A7VA 3ZTZA 1M6TA 5JT4A 1E83A 3DE9A 2YL3A 2XLWA 3TOMA 1QQ3A 1S05A 1E84A 2J9BA 3ZTMA 4CX9A 3NMIA 1EKYA 3TOLA 3IQ6A 1YYXA 4D4NA 1E86A 5JSLA 1YZAA 3HNKA 3U8PA 4IB4A 4D4XA 2XLEA 3C62A 3IQ5A 1JAFA 3M4CA 3HNLA 4CDAA 3M79A 2YL0A 4JEAA 2XLMA 1CPRA 4NC3A 1CPQA 3VRCA 3ZQYA 4CIPA 2YL7A 4EIYA 2CCYA 2QLAA 1LM3B 1NBBA 3QVZA 4JKVA 4ULVA 1BBHA 4WGZA 5B3IA 5JUAA 2BC5A 2YLGA 4U9EA 3HNIA 4IAQA 3M4BA 3M15A 1QPUA 2XL6A 1CGNA 256BA 3QW1A 5JVEA 2YKZA 3ZWIA 5JLIA 4JEBA 2XLOA 2J8WA 3QW0A 2XM0A 5JP7A 4IARA 3C63A 1E85A 4N4WA 3FOPA 4JE9A 1CGOA 2XL8A 1YZCA 2XM4A 3DE8A 3FOOA 5JRAA 2YL1A 4N6HA 3L1MA 1MQVA 4CDVA 3NMKA 4L6RA 2YLIA 4CJGA 4CJOA 2XLVA 3QVYA 3NMJA 1APCA 2XLDA 4CDYA 4U9DA 1RCPA 3HNJA 1GQAA 5AGFA 3ZQVA 1YYJA 4ER9A 2XLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  2YLD A;  5JS5 A;  1A7V A;  3ZTZ A;  1M6T A;  5JT4 A;  1E83 A;  3DE9 A;  2YL3 A;  2XLW A;  3TOM A;  1QQ3 A;  1S05 A;  1E84 A;  2J9B A;  3ZTM A;  4CX9 A;  3NMI A;  1EKY A;  3TOL A;  3IQ6 A;  1YYX A;  4D4N A;  1E86 A;  5JSL A;  1YZA A;  3HNK A;  3U8P A;  4IB4 A;  4D4X A;  2XLE A;  3C62 A;  3IQ5 A;  1JAF A;  3M4C A;  3HNL A;  4CDA A;  3M79 A;  2YL0 A;  4JEA A;  2XLM A;  1CPR A;  4NC3 A;  1CPQ A;  3VRC A;  3ZQY A;  4CIP A;  2YL7 A;  4EIY A;  2CCY A;  2QLA A;  1LM3 B;  1NBB A;  3QVZ A;  4JKV A;  4ULV A;  1BBH A;  4WGZ A;  5B3I A;  5JUA A;  2BC5 A;  2YLG A;  4U9E A;  3HNI A;  4IAQ A;  3M4B A;  3M15 A;  1QPU A;  2XL6 A;  1CGN A;  256B A;  3QW1 A;  5JVE A;  2YKZ A;  3ZWI A;  5JLI A;  4JEB A;  2XLO A;  2J8W A;  3QW0 A;  2XM0 A;  5JP7 A;  4IAR A;  3C63 A;  1E85 A;  4N4W A;  3FOP A;  4JE9 A;  1CGO A;  2XL8 A;  1YZC A;  2XM4 A;  3DE8 A;  3FOO A;  5JRA A;  2YL1 A;  4N6H A;  3L1M A;  1MQV A;  4CDV A;  3NMK A;  4L6R A;  2YLI A;  4CJG A;  4CJO A;  2XLV A;  3QVY A;  3NMJ A;  1APC A;  2XLD A;  4CDY A;  4U9D A;  1RCP A;  3HNJ A;  1GQA A;  5AGF A;  3ZQV A;  1YYJ A;  4ER9 A;  2XLH A; 
#chains in the Genus database with same CATH topology
 5L0J A;  4EBB A;  4DRJ B;  2W4B A;  4DBR A;  2P0N A;  4YL1 A;  5L0D A;  1M6T A;  2XS1 A;  2XS8 A;  2Q00 A;  1VTM P;  1MMN A;  2G3K A;  3BRJ A;  3T6G B;  3LLK A;  1T9K A;  2A6E F;  1SZI A;  1E83 A;  4OIQ F;  4N06 A;  2E87 A;  1BR2 A;  3F47 A;  1T6U A;  2R7W A;  1ZVZ A;  3FHD A;  1QQ3 A;  1S05 A;  1T01 A;  3FDQ A;  3RYL A;  2HV6 A;  4JZA A;  2PFD A;  3Q7G A;  1T6Q A;  1F1M A;  1WAT A;  4U5F E;  1FMW A;  3V7O A;  3Q6M A;  3JRT A;  3O6X A;  3N2Z B;  1JPJ A;  3C18 A;  4FWV A;  4OIR F;  4BJ6 A;  4Q4Z F;  1OXB A;  3O39 A;  5JSL A;  1VB5 A;  2PF4 E;  1SMY F;  1W2W A;  5L0I A;  1LE4 A;  2XLE A;  3S9O A;  1XZP A;  1ZW3 A;  3EFO A;  3IQ5 A;  5B1A C;  3DD7 A;  1QKR A;  4H4K C;  4CDA A;  1Q0K A;  4JRZ A;  4YJW A;  4LLC A;  2HS5 A;  3FVY A;  2KQ9 A;  4YN0 B;  4Q7C A;  2OQM A;  3OWT A;  1A0B A;  2XLM A;  2OU6 A;  1CPQ A;  2ZPA A;  3CEX A;  2P61 A;  3TUL A;  3IEE A;  4NTA A;  4BG0 A;  1NFN A;  2PP4 A;  1VMA A;  2IM8 A;  1OW6 A;  3TK0 A;  1JMW A;  3VRC A;  3L34 A;  3UMK A;  3FXH A;  1T6I A;  2R7Q A;  2NG1 A;  1UFB A;  4CIP A;  4XLN F;  1MMD A;  2Y39 A;  4YL0 A;  1TWH A;  1D1A A;  3L8J A;  2X0C A;  3X2Q C;  4LLE A;  4EIY A;  2QLA A;  4JVS A;  4FX5 A;  1YDI A;  3UR3 C;  4JJF A;  2ZXW C;  3GWL A;  2XXA A;  3S29 A;  1NLX A;  2A69 F;  3AQC A;  5JUA A;  2G62 A;  4MTF A;  2G3V A;  2M64 A;  3NG1 A;  1Q0D A;  1TFK B;  3EZI A;  3HNI A;  4U9E A;  5E2Q A;  1A7E A;  4U5B E;  1OW7 A;  2LIG A;  4MVR A;  3M15 A;  4MVS A;  1QPU A;  2L7A A;  3SZR A;  1L7C A;  2XL6 A;  2VB6 A;  1TFO B;  2MYS A;  4G78 A;  4JW1 A;  3RW0 A;  1OQC A;  2CYD A;  1CGN A;  2LK4 A;  2L81 A;  1FFH A;  2MWQ A;  5K0I A;  1NZE A;  4O79 A;  2XRH A;  5L3V A;  3ZWI A;  5JLI A;  4ULW A;  2MHR A;  3Q6N A;  2IBF A;  2NSF A;  2XLO A;  3QW0 A;  3V5X A;  3GM2 A;  1PCX A;  3AQB A;  3K33 A;  1MND A;  3C8G D;  3KPH A;  4CS8 C;  1M2O A;  1SF8 A;  2QUP A;  3M1C B;  2HMQ A;  1ZHW A;  3DJN B;  3LAY A;  4E0I A;  3S84 A;  4JE9 A;  3WHN A;  2R7R A;  4XPW A;  1LPE A;  1MMG A;  3NYM A;  4MVU A;  2Y3H A;  4N6C A;  4W8K A;  1B68 A;  2H7O A;  1YZC A;  3KH2 A;  3DI5 A;  3MBG A;  3DE8 A;  2R7T A;  3SP1 A;  1HW1 A;  2HJM A;  3UGP A;  3NKD A;  4YT4 A;  3RKO F;  2P7V A;  3B0U X;  1V74 B;  3CAX A;  3K7D A;  5GPG B;  3JRM O;  2XXA B;  2D4U A;  4XWJ A;  1Q0F A;  4BEM J;  4CJO A;  1GM5 A;  5CIV A;  1K05 A;  3MFN A;  4ANJ A;  3R2P A;  3K6B A;  4PR9 A;  4DVZ A;  1APC A;  1HMD A;  1LI5 A;  3TJ6 A;  3F46 A;  3C8G A;  3GEI A;  2EPL X;  1D1C A;  2LSE A;  1GQA A;  2Q9C A;  1D1B A;  2ZXR A;  3HNJ A;  3I4U A;  3IPM O;  4U5G A;  5A6A A;  2A0U A;  2EIL C;  3B0V C;  1EQ1 A;  4RD9 A;  4MVZ A;  4BPM A;  2R9R B;  1TWA A;  1YAR O;  5E3A A;  4WGY A;  2YLD A;  1PD1 A;  4Z9H A;  5JS5 A;  2J0W A;  3B0P A;  3SNH A;  3KYI A;  2R7U A;  2WZF A;  5KYN A;  2YZS A;  1PV3 A;  1Q0M A;  1TQG A;  4QI0 A;  1NSG B;  5F5F A;  5CI9 A;  2R03 A;  3EGD A;  3U2M A;  2OKU A;  1Z6A A;  3QMK A;  1LIH A;  4HE8 D;  2J9B A;  1H7I A;  4CX9 A;  1AEP A;  2QTV A;  5T1D B;  2HSB A;  1EKY A;  1ZHT A;  2AVK A;  3G4X A;  4RBN A;  5T3W A;  1VYK A;  1YYX A;  3JT1 A;  3K1I C;  4Z9I A;  5COF A;  2WZL A;  2NUT A;  2I8B A;  1VLT A;  2JX0 A;  2J0X A;  1RJ9 B;  3X1O A;  4XQ1 A;  3LEO A;  3HNK A;  2Y3D A;  1ZHY A;  2QY9 A;  4MQ9 F;  1OR3 A;  3U8P A;  4A4A A;  3AGU A;  2Q9A A;  3G50 A;  3C62 A;  3GAN A;  3U9J A;  5IY5 C;  4PJM A;  2YRF A;  1ZYR F;  4MS2 A;  2ZXP A;  2R05 A;  3GEE A;  4I3M A;  3DM9 B;  3HNL A;  4J7Y A;  1GS9 A;  1Y4C A;  1FAP B;  1G5Z A;  2F22 A;  2GA0 A;  1TWG A;  2H8A A;  1I4Y A;  4MTG A;  4O7G A;  4O6M A;  3WAQ A;  3WOD F;  3C8G B;  3E70 C;  4NC3 A;  5E33 A;  4OIO F;  2B0H A;  1L3P A;  5DS4 A;  1OR2 A;  1ORS C;  4KNV A;  1M2V A;  2A1D D;  1YA7 O;  1G4U S;  2OJE D;  4C3B A;  3RQF A;  2L6H A;  4PJN A;  3G4Z A;  4O6N A;  3HKK A;  3GOR A;  3ECS A;  2LCH A;  4F4B A;  4YK5 A;  4XTK A;  1ZZP A;  2WB7 A;  3I5Q A;  2FGY A;  3H2V A;  1LM3 B;  2AU5 A;  3EGD B;  2BL2 A;  4CSA A;  3V5Z A;  4EBJ A;  3ASO C;  3PMR A;  1AVO B;  2BE5 F;  2EIK C;  2EPO A;  2HV7 A;  2Y3G A;  3H65 A;  2J9W A;  3AJM A;  2VC9 A;  4C7O A;  2NUT B;  3C8Z A;  4LAC B;  5L3Q A;  4EBK A;  5DS6 A;  3AGT A;  2WVO A;  4U5D E;  2QNL A;  1EI7 A;  1RKC A;  4OD4 A;  5DQZ A;  2H7B A;  1VOM A;  5KYX A;  4IJJ A;  1OCR C;  256B A;  4JTA B;  1D0Y A;  1Y6D A;  4U5H A;  1IZM A;  5DVW A;  4KBL A;  3RVZ A;  2V26 A;  4XEK A;  3DXJ F;  3SYN A;  2J8W A;  2ASR A;  3RQG A;  5JP7 A;  3GOD A;  2Q4F A;  1PD0 A;  3BEH A;  3HJC A;  1M2V B;  2ZXO A;  3C63 A;  1E85 A;  3N24 A;  2VCC A;  1A41 A;  2IXN A;  4MTO A;  2VCB A;  2XL8 A;  2C03 A;  1VYI A;  2XM4 A;  3JZ0 A;  2HUJ A;  4X0R A;  4YT5 A;  4A2N B;  1R5I D;  3KL4 A;  4O6Y A;  3HTK C;  3LES A;  3QTH A;  3E9V A;  4JJG A;  2IYL D;  1CGM E;  4CDV A;  3AG2 C;  3KMI A;  1OCC C;  3UMH A;  3LNM B;  4CBE A;  3SXM A;  3RQE A;  3FMS A;  1DOV A;  4RDA A;  3U8V A;  4J32 B;  4KC9 A;  1LE2 A;  1FMV A;  4WAB A;  4DJ9 A;  4C7O B;  3R7C A;  5BUO A;  2HFI A;  2DGJ A;  2XLD A;  4FES A;  4CDY A;  4U9D A;  1BR1 A;  1QSP A;  1WWP A;  1H9T A;  1O5H A;  5KYX B;  3N0T A;  2KW3 C;  3UGO A;  1XZQ A;  1H9G A;  3A11 A;  3TJ5 A;  3ITF A;  3O10 A;  1O3U A;  5D92 A;  2A0B A;  4UDV A;  1ST6 A;  2EIJ C;  3Q7L A;  3EG9 B;  1M56 C;  4EWC A;  2LFD A;  1Z63 A;  2RD9 A;  4IAO A;  1A7V A;  2FFH A;  4P6I C;  4XEF A;  4MW3 A;  4B6I A;  5T3T A;  3DE9 A;  1LKX A;  4BJ1 A;  2XLW A;  2PBE A;  2IXM A;  1RJ9 A;  2KNH A;  4XPY A;  4XLP F;  2X51 A;  4JTD B;  4AE4 A;  3ZTM A;  4IGG A;  5B3S C;  1WTY A;  2P6V A;  5FCL A;  1HMO A;  3TOL A;  1J8Y F;  3AOU A;  4AL1 A;  4D4N A;  1HE9 A;  2J7P D;  4DXW A;  5CI8 A;  1FR0 A;  1K40 A;  1IW7 F;  1NG1 A;  2CDQ A;  2YWA A;  4YT8 A;  3L8I A;  4PFP A;  4LDR A;  4WJ0 A;  2UUH A;  3FAP B;  5TJ5 E;  3I5P A;  2DYS C;  2XL4 A;  1JAF A;  3M4C A;  1VK5 A;  3EPV A;  4FAP B;  4IWB A;  3M79 A;  3A9C A;  4OIN F;  2Q7R A;  1CPR A;  4DRH B;  3LUT B;  1H6G A;  3RF3 A;  3NYL A;  4J7T A;  3AG4 C;  5AC4 A;  3U9M A;  5KYW A;  3EGX A;  1K04 A;  4DVY P;  1JPN A;  2LP4 A;  2NPU A;  4OD5 A;  2AWC A;  2YHS A;  3ZQY A;  1HY5 A;  2OJQ A;  3RVY A;  1U0B B;  2VCA A;  3S28 A;  2EIM C;  1RXQ A;  2YL7 A;  3KYJ A;  5FZT A;  3SXY A;  3T4R A;  2JD3 A;  3JCU Q;  4CIH A;  4EHP A;  2YVK A;  5A6J A;  1KTM A;  3S0X A;  2PX3 A;  2J7P A;  4IRU A;  1WOL A;  4CS8 A;  1NBB A;  2OOC A;  3EQL F;  3LEV A;  3UMI A;  3DJU B;  4JKV A;  4MVQ A;  4ULV A;  4AE4 B;  1G8X A;  1QVX A;  2OG2 A;  2WL8 A;  3IHU A;  4E0H A;  1Q0G A;  1XWJ A;  2QE9 A;  2BC5 A;  1RMV A;  2GAQ A;  1ORY A;  1UG7 A;  4IAQ A;  3PCV A;  2XSE A;  1ZU4 A;  3IQT A;  1WAS A;  2NSG A;  1SR2 A;  5COM A;  4G7H F;  1BDJ B;  2NUP A;  5COG A;  1ZU5 A;  2J9V A;  2R02 A;  3LLI A;  1Z23 A;  4LDK A;  3SEO A;  3B29 A;  2O9X A;  4W8P A;  4I1M A;  4JCH A;  4JC7 A;  3MX3 A;  2WZG A;  3TQO A;  2YKZ A;  1DOW A;  1OCO C;  4P9T A;  1YAU O;  4JEB A;  3VYW A;  4U5E E;  3ZIB A;  3EHM A;  2XM0 A;  2P1A A;  3K66 A;  3JSE O;  2Y3B A;  3KKB A;  5KYW B;  5E3C A;  3EGX B;  3T6J A;  3JTL O;  4N4W A;  3U5S A;  3IQC A;  2YQY A;  4AK9 A;  2IOQ A;  3NRH A;  3ZC4 A;  1FFT C;  1QZX A;  1V54 C;  2EPK X;  2R25 A;  4C3E A;  4EKW A;  2R7O A;  1HE1 A;  1U6H A;  4N6H A;  4K0D A;  4DRI B;  5BQH A;  5JRA A;  1O87 A;  2IXO A;  1V4A A;  3NKE A;  3GWN A;  1ORJ A;  4H54 A;  3NMK A;  4U5C E;  3RFY A;  1R4T A;  4PAC A;  1D0X A;  1WN0 A;  4L6R A;  5DQT A;  3ASN C;  1WGW A;  2YLI A;  4HFF B;  3ABK C;  1I5N A;  2XLV A;  3AG1 C;  3DAG A;  5EK0 A;  4LER A;  3QVY A;  1OCZ C;  1J8M F;  3NMJ A;  4YL3 A;  3W8I A;  5L0F A;  2A68 F;  2LQG A;  5L0G A;  3DMD A;  3EG9 A;  1C02 A;  1M57 C;  4E7S A;  2AWY A;  1RCP A;  5F28 E;  2NUP B;  3K1I A;  3K1H A;  1AUE A;  2A6H F;  3NDB B;  2Q9B A;  4GEH A;  3ZQV A;  1YYJ A;  5A6B D;  5BQI A;  2V3C C;  4G7Z F;  2ETS A;  2H7V C;  1MQV A;  2XLH A;  3MYI A;  1BZ4 A;  2YEV A;  4I44 A;  4NQF A;  3LNR A;  4PFO A;  5D91 A;  1YA9 A;  2B0J A;  3ATP A;  3ZTZ A;  1Z7Q c;  2R7X A;  2Q3T A;  4BJT A;  3EZH A;  1LI7 A;  2EIN C;  3TD7 A;  5JT4 A;  1T5O A;  4MW8 A;  3UNG C;  3FAJ A;  2YL3 A;  3TOM A;  4R32 A;  2KJG A;  2CNW D;  2TMV P;  4ZLC A;  1V55 C;  4G7O F;  1D0Z A;  1YLM A;  3CQZ A;  3U2L A;  1OKK D;  3LS1 A;  5EHH A;  3NMI A;  2Y69 C;  2OEV A;  3MYF A;  3S90 A;  4E7Z A;  1JRA A;  2W4M A;  1E2X A;  2KGO A;  4NY3 A;  4OIP F;  3EH2 A;  4LDQ A;  3OA1 A;  4XPX A;  3IQ6 A;  4JIO A;  5DLJ A;  2AP3 A;  4J30 B;  1YJG A;  1ZHX A;  1ZW2 A;  1VLS A;  3EH1 A;  3W2W A;  3W8H A;  1E86 A;  2J45 A;  4K7B A;  3SXZ A;  4AX2 A;  1YZA A;  3VAY A;  4BJ5 C;  4IB4 A;  4HFK B;  3U3B A;  1RKE A;  2ICW G;  3GM3 A;  5AC5 A;  5A6B A;  1FTS A;  3POV A;  1G4W R;  2L6G A;  5EGY A;  3DKA A;  1OW8 A;  1LVK A;  3HLZ A;  4E18 A;  1C17 M;  5L0H A;  5DS5 A;  4YWQ A;  3ABM C;  2YL0 A;  2C04 A;  4JEA A;  3WG7 C;  2DYR C;  3DWW A;  3O55 A;  2VH3 A;  2FAP B;  3EFO B;  2D5R B;  4ZLD A;  1Z3I X;  4QI2 A;  4GYT A;  4CS9 C;  2CNW A;  2KSF A;  2VAS A;  3U3F A;  1OKK A;  5F5H A;  4YT2 A;  2HMZ A;  2DB4 A;  3B9Q A;  1LS1 A;  2HJ3 A;  4Z9J A;  1MMA A;  3PHF 2;  2CCY A;  1MNE A;  4PJL A;  2LFF A;  2EPM X;  3L0I A;  2KYH A;  4JUR I;  3OEO A;  1JOG A;  1KU2 A;  1OXK A;  2J9U A;  2WVQ A;  3QVZ A;  1NFO A;  3EHN A;  4NTB A;  3RH3 A;  1S7Z A;  1LS4 A;  2KK1 A;  5KYY A;  1BBH A;  4QDL A;  4WGZ A;  5KYU A;  5A6K A;  5B3I A;  3VF0 A;  2W45 A;  2GDC A;  2YLG A;  3AG3 C;  3JYH A;  4JCZ A;  3V5Y A;  3DAF A;  4CS7 A;  3MLG A;  1NU7 D;  2KC3 A;  3EJN A;  3NYJ A;  4M63 A;  2OCC C;  2OEX A;  1NU9 C;  3JSZ A;  2CW0 F;  3M4B A;  3S27 A;  2L9J A;  2J46 A;  1EA8 A;  3US6 A;  2UUI A;  3B71 A;  1HW2 A;  3ZG1 A;  1RKE B;  2EPN A;  2HKV A;  3W4Y A;  3J06 A;  1KNY A;  2ZD9 A;  4P9F A;  1YVI A;  4NCQ A;  4PK4 A;  1C03 A;  3QW1 A;  5JVE A;  2R7V A;  3VM6 A;  2W9Y A;  4HEA J;  3ZDL A;  2R7S A;  1GGQ A;  2CGE A;  4ONS A;  3W2V A;  1U89 A;  1SYQ A;  4BJ6 C;  1E84 A;  3PDM P;  1BR4 A;  2HSQ A;  4CSA C;  4NTF A;  4DBQ A;  3RIP A;  4AL0 A;  4IAR A;  1Z5Z A;  3SXK A;  4BJ5 A;  2PX0 A;  3FOP A;  4JTC B;  4MND A;  2DI3 A;  3ZSU A;  5HV9 A;  5HSW A;  2L6F A;  1CGO A;  4MVO A;  2M4E A;  4G0H A;  3ZVR A;  4GQH A;  1N1C A;  4I1O B;  3FOO A;  2YL1 A;  3GM1 A;  2GWW A;  2I15 A;  3LJB A;  3QZC A;  3JYY A;  3L1M A;  3LS0 A;  1QLE C;  4E17 A;  3CSK A;  4Q5S F;  3DM5 A;  2Z15 A;  4MVM A;  3GEH A;  3ABL C;  4CJG A;  1TWC A;  5KYY B;  5KYU B;  1ZHZ A;  4K1O A;  4D4X A;  4DOZ A;  1TR2 A;  2GFH A;  4XEV A;  4C3D A;  4CS9 A;  3U0C A;  4KI2 A;  3H2U A;  2HZ8 A;  1JR8 A;  1TKN A;  2JPU A;  5A69 A;  1I4Z A;  3T6B A;  4PJJ A;  5B1B C;  5L0C A;  4KNW A;  2RSE B;  3T9O A;  2IXP A;  1A7D A;  4EUK B;  1FNT c;  5AGF A;  2PNO A;  3DZA A;  2LD6 A;  5BQG A;  2WVN A;  4BEJ A;  3CZ6 A;  3C7J A;  4ER9 A; 
#chains in the Genus database with same CATH homology
 4WGY A;  2YLD A;  5JS5 A;  1A7V A;  3ZTZ A;  1M6T A;  5JT4 A;  1E83 A;  3DE9 A;  2YL3 A;  2XLW A;  3TOM A;  1QQ3 A;  1S05 A;  1E84 A;  2J9B A;  3ZTM A;  4CX9 A;  3NMI A;  1EKY A;  3TOL A;  3IQ6 A;  1YYX A;  4D4N A;  1E86 A;  5JSL A;  1YZA A;  3HNK A;  3U8P A;  4IB4 A;  4D4X A;  2XLE A;  3C62 A;  3IQ5 A;  1JAF A;  3M4C A;  3HNL A;  4CDA A;  3M79 A;  2YL0 A;  4JEA A;  2XLM A;  1CPR A;  4NC3 A;  1CPQ A;  3VRC A;  3ZQY A;  4CIP A;  2YL7 A;  4EIY A;  2CCY A;  2QLA A;  1LM3 B;  1NBB A;  3QVZ A;  4JKV A;  4ULV A;  1BBH A;  4WGZ A;  5B3I A;  5JUA A;  2BC5 A;  2YLG A;  4U9E A;  3HNI A;  4IAQ A;  3M4B A;  3M15 A;  1QPU A;  2XL6 A;  1CGN A;  256B A;  3QW1 A;  5JVE A;  2YKZ A;  3ZWI A;  5JLI A;  4JEB A;  2XLO A;  2J8W A;  3QW0 A;  2XM0 A;  5JP7 A;  4IAR A;  3C63 A;  1E85 A;  4N4W A;  3FOP A;  4JE9 A;  1CGO A;  2XL8 A;  1YZC A;  2XM4 A;  3DE8 A;  3FOO A;  5JRA A;  2YL1 A;  4N6H A;  3L1M A;  1MQV A;  4CDV A;  3NMK A;  4L6R A;  2YLI A;  4CJG A;  4CJO A;  2XLV A;  3QVY A;  3NMJ A;  1APC A;  2XLD A;  4CDY A;  4U9D A;  1RCP A;  3HNJ A;  1GQA A;  5AGF A;  3ZQV A;  1YYJ A;  4ER9 A;  2XLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...