2YL1A

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16a variant at 1.03 a resolution - restraint refinement
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 54
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl1A00
1RCPA 1YZAA 4CX9A 4CJOA 2YLGA 1E83A 1A7VA 1YYJA 2XLWA 3IQ6A 1CGOA 3HNKA 2CCYA 3U8PA 1NBBA 3ZWIA 4U9EA 4JEAA 1CGNA 2J8WA 1QQ3A 3QW1A 5JLIA 3HNLA 4U9DA 1M6TA 3M4BA 5JS5A 3HNIA 1CPRA 2XL6A 1APCA 1E85A 1LM3B 1S05A 2XLHA 3IQ5A 3ZQYA 3M79A 3TOMA 5JRAA 2YL1A 1YZCA 4WGYA 2BC5A 3DE9A 4L6RA 3FOPA 4ULVA 4JE9A 5JVEA 1MQVA 3TOLA 1EKYA 2XLMA 4IAQA 5JUAA 3VRCA 3C62A 5AGFA 3M4CA 256BA 4N6HA 3M15A 4CDVA 5JT4A 1YYXA 4JKVA 1E86A 2XLVA 4CJGA 1BBHA 2XLDA 2XL8A 2XM4A 3ZTMA 2YLDA 1JAFA 3DE8A 4D4XA 4EIYA 2YKZA 1QPUA 2YL0A 2XLEA 4D4NA 3ZTZA 5B3IA 3C63A 4IARA 2YL7A 3NMIA 3HNJA 3NMJA 3ZQVA 3QW0A 2XLOA 4CDYA 4IB4A 2QLAA 3QVYA 3NMKA 2XM0A 3FOOA 1CPQA 2YL3A 5JP7A 1GQAA 3QVZA 2YLIA 1E84A 3L1MA 4CIPA 4NC3A 4CDAA 4ER9A 4JEBA 4WGZA 5JSLA 2J9BA 4N4WA
chains in the Genus database with same CATH superfamily
4EUKB 1RCPA 1YZAA 3VAYA 1LPEA 3Q6NA 3CSKA 3JCUQ 4MVMA 4P9FA 2NUTA 3EH2A 3SXKA 1A7VA 2KC3A 1K40A 2PNOA 1YYJA 3U3FA 4CS7A 3BEHA 1ZU4A 2QE9A 2KSFA 2XL4A 3M1CB 1BDJB 2J9UA 3KYJA 3AG2C 1YARO 1FR0A 4MVZA 4F4BA 1DOVA 4LACB 4BG0A 2LD6A 5T3TA 4IJJA 3W8IA 4JCHA 4U5EE 3V5ZA 3B0VC 4MTOA 2XS8A 4FESA 4MW3A 3SNHA 1WASA 4AL0A 1I5NA 4IGGA 3LEOA 3W4YA 4OIOF 1VYIA 1L7CA 2KW3C 2OQMA 3AJMA 1OR2A 2OEVA 1TFOB 2J8WA 2OEXA 3S9OA 4KBLA 5COMA 4ZLDA 1KTMA 1F1MA 5HV9A 3VYWA 3F46A 4E0HA 4R32A 3HNLA 2AWCA 1ZYRF 3T6JA 2HZ8A 1A41A 4GYTA 5JS5A 4C7OA 1ZVZA 1OW7A 3K1IC 2HV6A 1YA7O 2OKUA 2XL6A 3UGPA 1ZHZA 3IEEA 3TJ6A 4XEKA 1WWPA 3B29A 3GEIA 3L8IA 1MMGA 3V7OA 3M79A 3ZQYA 1MNDA 2VCBA 3T4RA 2BC5A 4JJFA 3DE9A 3SEOA 2Y3DA 3MYFA 3CZ6A 1C03A 4ULVA 3GM3A 5COGA 3LLIA 1A0BA 2IXNA 1EKYA 4IAQA 5JUAA 3VRCA 3FXHA 1H9GA 2NSFA 1KU2A 5KYUB 2R7SA 1O87A 256BA 2A0UA 3LAYA 4DBQA 4YT2A 5JT4A 3ZG1A 3K66A 4XTKA 3ASNC 3G4XA 3CEXA 1OCZC 2LK4A 2JPUA 2LFDA 3A9CA 1IZMA 4P9TA 2XLVA 3EGDA 1BBHA 4YT8A 4PR9A 4E7SA 1R5ID 3JYHA 1ST6A 2HKVA 3SXZA 2CYDA 4D4XA 1HW2A 4O79A 4I1OB 1RMVA 3KPHA 1OCOC 3S0XA 5L0CA 5B3IA 4DRIB 3EHNA 3HNJA 1KNYA 2Q9CA 3B0PA 3AG3C 4IRUA 1FMVA 3LESA 1T6IA 4JURI 3RQEA 1NFNA 1UG7A 5B3SC 5DLJA 3QVYA 1V74B 5CI9A 3X2QC 3LEVA 4Q5SF 3S28A 2XM0A 1O3UA 1TR2A 2KNHA 4JJGA 4O6NA 2LFFA 4MQ9F 3OWTA 3NKDA 3KYIA 2KQ9A 3RW0A 5L0DA 2DYRC 3LS1A 1ZW3A 3Q7LA 3UMIA 3TD7A 1O5HA 1YAUO 2VH3A 2Y3HA 3DWWA 1ORSC 2D5RB 3OA1A 4Q7CA 5D92A 2H7OA 2HV7A 4K1OA 3ZVRA 4BPMA 2EIKC 4NC3A 4CDAA 5KYWB 2ZXOA 2O9XA 2XS1A 3S27A 3DKAA 4JEBA 1ORYA 1D0ZA 2OCCC 5JSLA 5KYYA 3EQLF 2GDCA 4N4WA 3MBGA 4FAPB 4CSAC 4E18A 1N1CA 2NG1A 2PP4A 2VC9A 2Y3BA 3DJNB 1MMNA 1HE1A 2I8BA 4CX9A 4IAOA 3C7JA 4MVSA 2YLGA 2AU5A 4BJ5A 1LS1A 2G3KA 2IXPA 2WB7A 4QDLA 3I4UA 2X51A 4C3DA 2XLWA 4U5HA 2UUHA 2OJED 2MHRA 1Q0KA 4G78A 4MVRA 3HNKA 1BR2A 2B0HA 4JCZA 2EPNA 3SYNA 3DXJF 2CCYA 1PCXA 4AX2A 4MNDA 1NBBA 2CW0F 3PHF2 2DB4A 3NKEA 2KJGA 2MYSA 3DAGA 4JEAA 3O6XA 2B0JA 1OW8A 1T6UA 3E70C 2PX0A 2WZGA 2H7BA 1QQ3A 3HTKC 3NYLA 5DS6A 3ABMC 4HFKB 3GM2A 3US6A 1NLXA 4NTAA 4W8KA 3WG7C 4ANJA 4XPXA 3U9MA 4BEMJ 2L9JA 3U8VA 2WVOA 3I5PA 5JLIA 2FAPB 1H9TA 1BR1A 1M6TA 1SMYF 2H7VC 2PX3A 1NU7D 1VLSA 1GGQA 2P1AA 3HNIA 3Q7GA 2X0CA 3RQGA 2Y3GA 5F5HA 3SP1A 4AL1A 2L81A 2W9YA 1E85A 2EILC 3QMKA 1S05A 3RQFA 3H2VA 1RKEB 4YWQA 2J9WA 2OG2A 4LDKA 2HSQA 4OIRF 3TK0A 3VF0A 1AUEA 3EGXA 4ONSA 1JPNA 1M2VB 3B9QA 1M2OA 2C04A 2YL1A 3T6BA 1YZCA 1SF8A 2A69F 3H65A 3CAXA 4L6RA 5F28E 2V3CC 2NUTB 3DI5A 4MW8A 4DRHB 1Z6AA 4U5BE 1FAPB 2AWYA 4ULWA 4DXWA 1L3PA 2I15A 3GEHA 4NTBA 1JR8A 2ZXWC 1GS9A 5BQHA 3C8ZA 5DS5A 1C17M 5AGFA 1YVIA 4JVSA 1JRAA 4XEVA 2R7UA 1W2WA 4BEJA 2A1DD 3EH1A 4HE8D 1OKKA 2DI3A 1Z5ZA 3UNGC 2IOQA 4CS9C 3N24A 1Z3IX 4A2NB 2PFDA 5KYXA 2NUPB 3KL4A 2H8AA 1HMDA 2YHSA 1OR3A 3DD7A 3F47A 4CJGA 5CIVA 1U0BB 4BJ6C 2L6GA 2HFIA 3V5YA 3PDMP 4EBKA 4Z9JA 3DE8A 1PD1A 1T01A 3FAJA 3JRTA 1Q0GA 4MVQA 1NFOA 3U9JA 1YJGA 2Q00A 3RH3A 2R7RA 2TMVP 1ORJA 2YL0A 4PACA 3EPVA 2VCAA 2W4MA 4J7YA 3IHUA 3WHNA 3RIPA 4AE4B 2A6EF 2BL2A 3NMIA 2RD9A 3EFOB 3NMJA 5COFA 5E2QA 3TJ5A 3ABKC 2E87A 4FX5A 3ZQVA 4JTCB 4U5DE 3RVZA 1UFBA 3AQBA 3ATPA 1TWHA 2KGOA 2KYHA 3DM5A 3RYLA 1VB5A 1LIHA 4IB4A 1SR2A 1NZEA 2R7OA 1Y6DA 2OU6A 3AOUA 3RFYA 5L0IA 3ECSA 2EPLX 3SXYA 1OQCA 2HMZA 3AQCA 3O55A 3W8HA 5A6JA 1RJ9A 2YL3A 5D91A 5L3VA 2EPKX 2LSEA 2W45A 1TQGA 2FGYA 4JIOA 4XEFA 2P7VA 4I1MA 3U5SA 3UMHA 5BUOA 3JTLO 2FFHA 3WODF 4YJWA 1G4WR 3L1MA 1XWJA 5A6AA 1JPJA 2WVNA 4XPYA 2LCHA 1V55C 4JRZA 1QZXA 2R03A 4CSAA 4P6IC 3DZAA 2AP3A 2J9BA 2GAQA 3PCVA 4DVZA 5A6KA 2Y39A 2XRHA 1I4ZA 3NG1A 4KC9A 2WVQA 1LKXA 5B1AC 3LJBA 4NTFA 5L0JA 3GWNA 4U5CE 4W8PA 1I4YA 1Q0MA 3W2VA 2YQYA 2J46A 2R02A 3FMSA 3KMIA 4LDRA 4MS2A 4WJ0A 4BJ5C 1D0YA 2YVKA 3U3BA 1JMWA 1NSGB 1HE9A 4Q4ZF 3C8GA 1A7DA 4ZLCA 4C7OB 2EIMC 4QI0A 3ZWIA 3OEOA 1CGME 1OXKA 1LI7A 1V54C 2YWAA 3GORA 2W4BA 4MVOA 3HLZA 5AC5A 3U0CA 3EJNA 5L3QA 4FWVA 4LERA 1RKCA 3GODA 4G7ZF 1LI5A 1ZHYA 3EG9A 4HFFB 5KYNA 1TFKB 2Z15A 2ASRA 4JZAA 3W2WA 1OCRC 2EPMX 1G5ZA 1H7IA 1FFHA 3QW1A 2ZXPA 1M2VA 4U5FE 3LNMB 4YN0B 3HKKA 4U9DA 2A6HF 3M4BA 4J32B 1Q0DA 5T1DB 2M4EA 4M63A 4CS8C 4DVYP 4DBRA 3L34A 4O6YA 3UR3C 1LM3B 2C03A 2WL8A 4RDAA 2R9RB 1DOWA 1MMAA 2XLHA 1LE4A 1WTYA 1XZQA 2Q3TA 2ZPAA 3TOMA 2CNWA 4Z9IA 3KH2A 5JRAA 4RBNA 1NU9C 4J7TA 5GPGB 3RKOF 1VK5A 2ICWG 3T6GB 2R7WA 3DMDA 4JE9A 2GA0A 1QSPA 5DQTA 1SZIA 3TOLA 2HJ3A 1NG1A 3TQOA 5FCLA 1LE2A 3V5XA 4E7ZA 2RSEB 1HY5A 3RF3A 3GANA 1AVOB 3M4CA 4G0HA 4N6HA 3M15A 2P6VA 1EI7A 3EGXB 4CDVA 3NDBB 3N0TA 2VCCA 4LLEA 1FMWA 3FAPB 3K1HA 2BE5F 4I44A 4JKVA 5E3AA 2IBFA 3AG4C 1U6HA 3O10A 1SYQA 5L0FA 2J45A 3ABLC 3I5QA 2XLDA 3MX3A 4MTGA 2GWWA 3ZTMA 2DYSC 2YLDA 1XZPA 4EHPA 5A69A 3S90A 5BQIA 4QI2A 4PFOA 2F22A 4YT5A 2IXMA 3POVA 1QPUA 2CDQA 3FVYA 4OINF 4C3EA 1RKEA 2V26A 5E33A 2XSEA 3EGDB 4D4NA 2EINC 3C63A 4NCQA 5KYXB 4YT4A 2IM8A 2YL7A 4IARA 2NSGA 4H4KC 1QLEC 5DVWA 5T3WA 4UDVA 2NPUA 4OIQF 3JZ0A 1FTSA 3QW0A 3UMKA 2PBEA 1ZHXA 3EHMA 1T6QA 3H2UA 1R4TA 3DM9B 2QLAA 2JD3A 2PF4E 3NMKA 5DQZA 2L6HA 2DGJA 1WN0A 3A11A 1BR4A 4H54A 3FOOA 2M64A 3SXMA 1T5OA 1TKNA 3K1IA 2Q7RA 2ZD9A 2YRFA 4XLNF 4KI2A 1HMOA 3ZSUA 1GQAA 4YL1A 2YLIA 2CGEA 5L0GA 2LP4A 3AGUA 4JW1A 1FFTC 1K05A 1E84A 3JSZA 2EPOA 4JC7A 1VLTA 3K7DA 4JTAB 1WGWA 3CQZA 3QTHA 4PJMA 4KNVA 2P61A 4RD9A 4ER9A 3C8GB 2J0WA 1V4AA 4PFPA 2OJQA 3EZHA 4BJTA 3ITFA 3KKBA 4NY3A 4AE4A 1VOMA 3U2MA 4K7BA 3C18A 3FHDA 4CJOA 3BRJA 1D1CA 4IWBA 4OD4A 4DOZA 5EGYA 1E83A 1D1AA 3LS0A 5F5FA 1B68A 1EQ1A 1M57C 3ZDLA 3B71A 1J8YF 1QKRA 1G8XA 3DAFA 3G50A 1PD0A 3IQ6A 3MLGA 3ZIBA 3PMRA 1CGOA 3LLKA 4N06A 3S29A 1VTMP 3HJCA 4LDQA 3U8PA 3LUTB 2J9VA 3IQTA 5TJ5E 2R7XA 2R05A 3IQCA 4U9EA 3R2PA 2YEVA 1M56C 3NYMA 2UUIA 1TWCA 1AEPA 4K0DA 1MNEA 3G4ZA 3RVYA 1CGNA 1K04A 1Q0FA 2MWQA 4XQ1A 2R7TA 1YDIA 2QUPA 5IY5C 2HUJA 4PJJA 3C8GD 2QY9A 4KNWA 2D4UA 4I3MA 4YK5A 1J8MF 1MMDA 3JYYA 4O6MA 1VMAA 4DJ9A 3NYJA 4G7HF 2IXOA 4G7OF 1CPRA 3EZIA 3R7CA 3VM6A 3K33A 4YL0A 4GQHA 4XWJA 1APCA 4BJ1A 2ETSA 3JT1A 3WAQA 2XXAB 1YLMA 1H6GA 1WOLA 3EFOA 3IQ5A 2R7QA 3U2LA 1PV3A 2CNWD 2GFHA 5KYUA 1VYKA 4HEAJ 4WGYA 3JSEO 4MTFA 2QTVA 4MVUA 4EKWA 1HW1A 3FOPA 4XPWA 2WZFA 5EHHA 2KK1A 5JVEA 1MQVA 1G4US 4E17A 4EBBA 4N6CA 2XLMA 2L6FA 2OOCA 2G62A 2G3VA 1OKKD 5L0HA 3C62A 1BZ4A 1E2XA 2P0NA 2YZSA 4GEHA 4WABA 5CI8A 5A6BD 5K0IA 3J06A 1ZHWA 1WATA 2J7PA 1U89A 1S7ZA 1A7EA 2J0XA 1YYXA 4BJ6A 4YL3A 2HSBA 2QNLA 3GWLA 3MFNA 4PJLA 4CBEA 2VB6A 3IPMO 1TWAA 3NRHA 1IW7F 4JTDB 1Z23A 4CS9A 1E86A 1ZU5A 2XL8A 4AK9A 3GM1A 4LLCA 2XM4A 3Q6MA 3GEEA 3EG9B 4A4AA 1JAFA 4EWCA 5HSWA 2IYLD 1C02A 1Z63A 2R7VA 4NQFA 2AVKA 1T9KA 1D0XA 3AG1C 1OXBA 1TWGA 2YKZA 4EIYA 2HJMA 4X0RA 5B1BC 5KYYB 2XXAA 3AGTA 3DJUB 2XLEA 4O7GA 5E3CA 3ZTZA 2LQGA 1D1BA 4CIHA 5BQGA 1YA9A 1OCCC 5A6BA 1RXQA 2Q9BA 3N2ZB 3ASOC 3QZCA 1Y4CA 3T9OA 2VASA 3LNRA 1Z7Qc 3X1OA 3ZC4A 3JRMO 3S84A 4OIPF 4PJNA 3B0UX 2R25A 2XLOA 1OW6A 1ZW2A 3E9VA 4U5GA 4CDYA 3FDQA 1ZZPA 4DRJB 3TULA 5AC4A 5KYWA 4XLPF 3MYIA 4PK4A 4Z9HA 4E0IA 3SZRA 3K6BA 2Q4FA 5DS4A 1CPQA 1JOGA 1LS4A 1QVXA 2ZXRA 5FZTA 5EK0A 3O39A 5JP7A 4C3BA 2J7PD 2Q9AA 2NUPA 3QVZA 4OD5A 2LIGA 4CS8A 2A0BA 4J30B 4CIPA 1LVKA 1EA8A 4EBJA 2L7AA 1GM5A 2JX0A 2HS5A 2HMQA 2A68F 2Y69C 4WGZA 4B6IA 1ZHTA 3L8JA 3UGOA 2EIJC 1FNTc 1RJ9B 2WZLA 3L0IA
chains in the Genus database with same CATH topology
1RCPA 1YZAA 4CX9A 4CJOA 2YLGA 1E83A 1A7VA 1YYJA 2XLWA 3IQ6A 1CGOA 3HNKA 2CCYA 3U8PA 1NBBA 3ZWIA 4U9EA 4JEAA 1CGNA 2J8WA 1QQ3A 3QW1A 5JLIA 3HNLA 4U9DA 1M6TA 3M4BA 5JS5A 3HNIA 1CPRA 2XL6A 1APCA 1E85A 1LM3B 1S05A 2XLHA 3IQ5A 3ZQYA 3M79A 3TOMA 5JRAA 2YL1A 1YZCA 4WGYA 2BC5A 3DE9A 4L6RA 3FOPA 4ULVA 4JE9A 5JVEA 1MQVA 3TOLA 1EKYA 2XLMA 4IAQA 5JUAA 3VRCA 3C62A 5AGFA 3M4CA 256BA 4N6HA 3M15A 4CDVA 5JT4A 1YYXA 4JKVA 1E86A 2XLVA 4CJGA 1BBHA 2XLDA 2XL8A 2XM4A 3ZTMA 2YLDA 1JAFA 3DE8A 4D4XA 4EIYA 2YKZA 1QPUA 2YL0A 2XLEA 4D4NA 3ZTZA 5B3IA 3C63A 4IARA 2YL7A 3NMIA 3HNJA 3NMJA 3ZQVA 3QW0A 2XLOA 4CDYA 4IB4A 2QLAA 3QVYA 3NMKA 2XM0A 3FOOA 1CPQA 2YL3A 5JP7A 1GQAA 3QVZA 2YLIA 1E84A 3L1MA 4CIPA 4NC3A 4CDAA 4ER9A 4JEBA 4WGZA 5JSLA 2J9BA 4N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCP A;  1YZA A;  4CX9 A;  4CJO A;  2YLG A;  1E83 A;  1A7V A;  1YYJ A;  2XLW A;  3IQ6 A;  1CGO A;  3HNK A;  2CCY A;  3U8P A;  1NBB A;  3ZWI A;  4U9E A;  4JEA A;  1CGN A;  2J8W A;  1QQ3 A;  3QW1 A;  5JLI A;  3HNL A;  4U9D A;  1M6T A;  3M4B A;  5JS5 A;  3HNI A;  1CPR A;  2XL6 A;  1APC A;  1E85 A;  1LM3 B;  1S05 A;  2XLH A;  3IQ5 A;  3ZQY A;  3M79 A;  3TOM A;  5JRA A;  2YL1 A;  1YZC A;  4WGY A;  2BC5 A;  3DE9 A;  4L6R A;  3FOP A;  4ULV A;  4JE9 A;  5JVE A;  1MQV A;  3TOL A;  1EKY A;  2XLM A;  4IAQ A;  5JUA A;  3VRC A;  3C62 A;  5AGF A;  3M4C A;  256B A;  4N6H A;  3M15 A;  4CDV A;  5JT4 A;  1YYX A;  4JKV A;  1E86 A;  2XLV A;  4CJG A;  1BBH A;  2XLD A;  2XL8 A;  2XM4 A;  3ZTM A;  2YLD A;  1JAF A;  3DE8 A;  4D4X A;  4EIY A;  2YKZ A;  1QPU A;  2YL0 A;  2XLE A;  4D4N A;  3ZTZ A;  5B3I A;  3C63 A;  4IAR A;  2YL7 A;  3NMI A;  3HNJ A;  3NMJ A;  3ZQV A;  3QW0 A;  2XLO A;  4CDY A;  4IB4 A;  2QLA A;  3QVY A;  3NMK A;  2XM0 A;  3FOO A;  1CPQ A;  2YL3 A;  5JP7 A;  1GQA A;  3QVZ A;  2YLI A;  1E84 A;  3L1M A;  4CIP A;  4NC3 A;  4CDA A;  4ER9 A;  4JEB A;  4WGZ A;  5JSL A;  2J9B A;  4N4W A; 
#chains in the Genus database with same CATH topology
 4EUK B;  1RCP A;  1YZA A;  3VAY A;  1LPE A;  3Q6N A;  3CSK A;  3JCU Q;  4MVM A;  4P9F A;  2NUT A;  3EH2 A;  3SXK A;  1A7V A;  2KC3 A;  1K40 A;  2PNO A;  1YYJ A;  3U3F A;  4CS7 A;  3BEH A;  1ZU4 A;  2QE9 A;  2KSF A;  2XL4 A;  3M1C B;  1BDJ B;  2J9U A;  3KYJ A;  3AG2 C;  1YAR O;  1FR0 A;  4MVZ A;  4F4B A;  1DOV A;  4LAC B;  4BG0 A;  2LD6 A;  5T3T A;  4IJJ A;  3W8I A;  4JCH A;  4U5E E;  3V5Z A;  3B0V C;  4MTO A;  2XS8 A;  4FES A;  4MW3 A;  3SNH A;  1WAS A;  4AL0 A;  1I5N A;  4IGG A;  3LEO A;  3W4Y A;  4OIO F;  1VYI A;  1L7C A;  2KW3 C;  2OQM A;  3AJM A;  1OR2 A;  2OEV A;  1TFO B;  2J8W A;  2OEX A;  3S9O A;  4KBL A;  5COM A;  4ZLD A;  1KTM A;  1F1M A;  5HV9 A;  3VYW A;  3F46 A;  4E0H A;  4R32 A;  3HNL A;  2AWC A;  1ZYR F;  3T6J A;  2HZ8 A;  1A41 A;  4GYT A;  5JS5 A;  4C7O A;  1ZVZ A;  1OW7 A;  3K1I C;  2HV6 A;  1YA7 O;  2OKU A;  2XL6 A;  3UGP A;  1ZHZ A;  3IEE A;  3TJ6 A;  4XEK A;  1WWP A;  3B29 A;  3GEI A;  3L8I A;  1MMG A;  3V7O A;  3M79 A;  3ZQY A;  1MND A;  2VCB A;  3T4R A;  2BC5 A;  4JJF A;  3DE9 A;  3SEO A;  2Y3D A;  3MYF A;  3CZ6 A;  1C03 A;  4ULV A;  3GM3 A;  5COG A;  3LLI A;  1A0B A;  2IXN A;  1EKY A;  4IAQ A;  5JUA A;  3VRC A;  3FXH A;  1H9G A;  2NSF A;  1KU2 A;  5KYU B;  2R7S A;  1O87 A;  256B A;  2A0U A;  3LAY A;  4DBQ A;  4YT2 A;  5JT4 A;  3ZG1 A;  3K66 A;  4XTK A;  3ASN C;  3G4X A;  3CEX A;  1OCZ C;  2LK4 A;  2JPU A;  2LFD A;  3A9C A;  1IZM A;  4P9T A;  2XLV A;  3EGD A;  1BBH A;  4YT8 A;  4PR9 A;  4E7S A;  1R5I D;  3JYH A;  1ST6 A;  2HKV A;  3SXZ A;  2CYD A;  4D4X A;  1HW2 A;  4O79 A;  4I1O B;  1RMV A;  3KPH A;  1OCO C;  3S0X A;  5L0C A;  5B3I A;  4DRI B;  3EHN A;  3HNJ A;  1KNY A;  2Q9C A;  3B0P A;  3AG3 C;  4IRU A;  1FMV A;  3LES A;  1T6I A;  4JUR I;  3RQE A;  1NFN A;  1UG7 A;  5B3S C;  5DLJ A;  3QVY A;  1V74 B;  5CI9 A;  3X2Q C;  3LEV A;  4Q5S F;  3S28 A;  2XM0 A;  1O3U A;  1TR2 A;  2KNH A;  4JJG A;  4O6N A;  2LFF A;  4MQ9 F;  3OWT A;  3NKD A;  3KYI A;  2KQ9 A;  3RW0 A;  5L0D A;  2DYR C;  3LS1 A;  1ZW3 A;  3Q7L A;  3UMI A;  3TD7 A;  1O5H A;  1YAU O;  2VH3 A;  2Y3H A;  3DWW A;  1ORS C;  2D5R B;  3OA1 A;  4Q7C A;  5D92 A;  2H7O A;  2HV7 A;  4K1O A;  3ZVR A;  4BPM A;  2EIK C;  4NC3 A;  4CDA A;  5KYW B;  2ZXO A;  2O9X A;  2XS1 A;  3S27 A;  3DKA A;  4JEB A;  1ORY A;  1D0Z A;  2OCC C;  5JSL A;  5KYY A;  3EQL F;  2GDC A;  4N4W A;  3MBG A;  4FAP B;  4CSA C;  4E18 A;  1N1C A;  2NG1 A;  2PP4 A;  2VC9 A;  2Y3B A;  3DJN B;  1MMN A;  1HE1 A;  2I8B A;  4CX9 A;  4IAO A;  3C7J A;  4MVS A;  2YLG A;  2AU5 A;  4BJ5 A;  1LS1 A;  2G3K A;  2IXP A;  2WB7 A;  4QDL A;  3I4U A;  2X51 A;  4C3D A;  2XLW A;  4U5H A;  2UUH A;  2OJE D;  2MHR A;  1Q0K A;  4G78 A;  4MVR A;  3HNK A;  1BR2 A;  2B0H A;  4JCZ A;  2EPN A;  3SYN A;  3DXJ F;  2CCY A;  1PCX A;  4AX2 A;  4MND A;  1NBB A;  2CW0 F;  3PHF 2;  2DB4 A;  3NKE A;  2KJG A;  2MYS A;  3DAG A;  4JEA A;  3O6X A;  2B0J A;  1OW8 A;  1T6U A;  3E70 C;  2PX0 A;  2WZG A;  2H7B A;  1QQ3 A;  3HTK C;  3NYL A;  5DS6 A;  3ABM C;  4HFK B;  3GM2 A;  3US6 A;  1NLX A;  4NTA A;  4W8K A;  3WG7 C;  4ANJ A;  4XPX A;  3U9M A;  4BEM J;  2L9J A;  3U8V A;  2WVO A;  3I5P A;  5JLI A;  2FAP B;  1H9T A;  1BR1 A;  1M6T A;  1SMY F;  2H7V C;  2PX3 A;  1NU7 D;  1VLS A;  1GGQ A;  2P1A A;  3HNI A;  3Q7G A;  2X0C A;  3RQG A;  2Y3G A;  5F5H A;  3SP1 A;  4AL1 A;  2L81 A;  2W9Y A;  1E85 A;  2EIL C;  3QMK A;  1S05 A;  3RQF A;  3H2V A;  1RKE B;  4YWQ A;  2J9W A;  2OG2 A;  4LDK A;  2HSQ A;  4OIR F;  3TK0 A;  3VF0 A;  1AUE A;  3EGX A;  4ONS A;  1JPN A;  1M2V B;  3B9Q A;  1M2O A;  2C04 A;  2YL1 A;  3T6B A;  1YZC A;  1SF8 A;  2A69 F;  3H65 A;  3CAX A;  4L6R A;  5F28 E;  2V3C C;  2NUT B;  3DI5 A;  4MW8 A;  4DRH B;  1Z6A A;  4U5B E;  1FAP B;  2AWY A;  4ULW A;  4DXW A;  1L3P A;  2I15 A;  3GEH A;  4NTB A;  1JR8 A;  2ZXW C;  1GS9 A;  5BQH A;  3C8Z A;  5DS5 A;  1C17 M;  5AGF A;  1YVI A;  4JVS A;  1JRA A;  4XEV A;  2R7U A;  1W2W A;  4BEJ A;  2A1D D;  3EH1 A;  4HE8 D;  1OKK A;  2DI3 A;  1Z5Z A;  3UNG C;  2IOQ A;  4CS9 C;  3N24 A;  1Z3I X;  4A2N B;  2PFD A;  5KYX A;  2NUP B;  3KL4 A;  2H8A A;  1HMD A;  2YHS A;  1OR3 A;  3DD7 A;  3F47 A;  4CJG A;  5CIV A;  1U0B B;  4BJ6 C;  2L6G A;  2HFI A;  3V5Y A;  3PDM P;  4EBK A;  4Z9J A;  3DE8 A;  1PD1 A;  1T01 A;  3FAJ A;  3JRT A;  1Q0G A;  4MVQ A;  1NFO A;  3U9J A;  1YJG A;  2Q00 A;  3RH3 A;  2R7R A;  2TMV P;  1ORJ A;  2YL0 A;  4PAC A;  3EPV A;  2VCA A;  2W4M A;  4J7Y A;  3IHU A;  3WHN A;  3RIP A;  4AE4 B;  2A6E F;  2BL2 A;  3NMI A;  2RD9 A;  3EFO B;  3NMJ A;  5COF A;  5E2Q A;  3TJ5 A;  3ABK C;  2E87 A;  4FX5 A;  3ZQV A;  4JTC B;  4U5D E;  3RVZ A;  1UFB A;  3AQB A;  3ATP A;  1TWH A;  2KGO A;  2KYH A;  3DM5 A;  3RYL A;  1VB5 A;  1LIH A;  4IB4 A;  1SR2 A;  1NZE A;  2R7O A;  1Y6D A;  2OU6 A;  3AOU A;  3RFY A;  5L0I A;  3ECS A;  2EPL X;  3SXY A;  1OQC A;  2HMZ A;  3AQC A;  3O55 A;  3W8H A;  5A6J A;  1RJ9 A;  2YL3 A;  5D91 A;  5L3V A;  2EPK X;  2LSE A;  2W45 A;  1TQG A;  2FGY A;  4JIO A;  4XEF A;  2P7V A;  4I1M A;  3U5S A;  3UMH A;  5BUO A;  3JTL O;  2FFH A;  3WOD F;  4YJW A;  1G4W R;  3L1M A;  1XWJ A;  5A6A A;  1JPJ A;  2WVN A;  4XPY A;  2LCH A;  1V55 C;  4JRZ A;  1QZX A;  2R03 A;  4CSA A;  4P6I C;  3DZA A;  2AP3 A;  2J9B A;  2GAQ A;  3PCV A;  4DVZ A;  5A6K A;  2Y39 A;  2XRH A;  1I4Z A;  3NG1 A;  4KC9 A;  2WVQ A;  1LKX A;  5B1A C;  3LJB A;  4NTF A;  5L0J A;  3GWN A;  4U5C E;  4W8P A;  1I4Y A;  1Q0M A;  3W2V A;  2YQY A;  2J46 A;  2R02 A;  3FMS A;  3KMI A;  4LDR A;  4MS2 A;  4WJ0 A;  4BJ5 C;  1D0Y A;  2YVK A;  3U3B A;  1JMW A;  1NSG B;  1HE9 A;  4Q4Z F;  3C8G A;  1A7D A;  4ZLC A;  4C7O B;  2EIM C;  4QI0 A;  3ZWI A;  3OEO A;  1CGM E;  1OXK A;  1LI7 A;  1V54 C;  2YWA A;  3GOR A;  2W4B A;  4MVO A;  3HLZ A;  5AC5 A;  3U0C A;  3EJN A;  5L3Q A;  4FWV A;  4LER A;  1RKC A;  3GOD A;  4G7Z F;  1LI5 A;  1ZHY A;  3EG9 A;  4HFF B;  5KYN A;  1TFK B;  2Z15 A;  2ASR A;  4JZA A;  3W2W A;  1OCR C;  2EPM X;  1G5Z A;  1H7I A;  1FFH A;  3QW1 A;  2ZXP A;  1M2V A;  4U5F E;  3LNM B;  4YN0 B;  3HKK A;  4U9D A;  2A6H F;  3M4B A;  4J32 B;  1Q0D A;  5T1D B;  2M4E A;  4M63 A;  4CS8 C;  4DVY P;  4DBR A;  3L34 A;  4O6Y A;  3UR3 C;  1LM3 B;  2C03 A;  2WL8 A;  4RDA A;  2R9R B;  1DOW A;  1MMA A;  2XLH A;  1LE4 A;  1WTY A;  1XZQ A;  2Q3T A;  2ZPA A;  3TOM A;  2CNW A;  4Z9I A;  3KH2 A;  5JRA A;  4RBN A;  1NU9 C;  4J7T A;  5GPG B;  3RKO F;  1VK5 A;  2ICW G;  3T6G B;  2R7W A;  3DMD A;  4JE9 A;  2GA0 A;  1QSP A;  5DQT A;  1SZI A;  3TOL A;  2HJ3 A;  1NG1 A;  3TQO A;  5FCL A;  1LE2 A;  3V5X A;  4E7Z A;  2RSE B;  1HY5 A;  3RF3 A;  3GAN A;  1AVO B;  3M4C A;  4G0H A;  4N6H A;  3M15 A;  2P6V A;  1EI7 A;  3EGX B;  4CDV A;  3NDB B;  3N0T A;  2VCC A;  4LLE A;  1FMW A;  3FAP B;  3K1H A;  2BE5 F;  4I44 A;  4JKV A;  5E3A A;  2IBF A;  3AG4 C;  1U6H A;  3O10 A;  1SYQ A;  5L0F A;  2J45 A;  3ABL C;  3I5Q A;  2XLD A;  3MX3 A;  4MTG A;  2GWW A;  3ZTM A;  2DYS C;  2YLD A;  1XZP A;  4EHP A;  5A69 A;  3S90 A;  5BQI A;  4QI2 A;  4PFO A;  2F22 A;  4YT5 A;  2IXM A;  3POV A;  1QPU A;  2CDQ A;  3FVY A;  4OIN F;  4C3E A;  1RKE A;  2V26 A;  5E33 A;  2XSE A;  3EGD B;  4D4N A;  2EIN C;  3C63 A;  4NCQ A;  5KYX B;  4YT4 A;  2IM8 A;  2YL7 A;  4IAR A;  2NSG A;  4H4K C;  1QLE C;  5DVW A;  5T3W A;  4UDV A;  2NPU A;  4OIQ F;  3JZ0 A;  1FTS A;  3QW0 A;  3UMK A;  2PBE A;  1ZHX A;  3EHM A;  1T6Q A;  3H2U A;  1R4T A;  3DM9 B;  2QLA A;  2JD3 A;  2PF4 E;  3NMK A;  5DQZ A;  2L6H A;  2DGJ A;  1WN0 A;  3A11 A;  1BR4 A;  4H54 A;  3FOO A;  2M64 A;  3SXM A;  1T5O A;  1TKN A;  3K1I A;  2Q7R A;  2ZD9 A;  2YRF A;  4XLN F;  4KI2 A;  1HMO A;  3ZSU A;  1GQA A;  4YL1 A;  2YLI A;  2CGE A;  5L0G A;  2LP4 A;  3AGU A;  4JW1 A;  1FFT C;  1K05 A;  1E84 A;  3JSZ A;  2EPO A;  4JC7 A;  1VLT A;  3K7D A;  4JTA B;  1WGW A;  3CQZ A;  3QTH A;  4PJM A;  4KNV A;  2P61 A;  4RD9 A;  4ER9 A;  3C8G B;  2J0W A;  1V4A A;  4PFP A;  2OJQ A;  3EZH A;  4BJT A;  3ITF A;  3KKB A;  4NY3 A;  4AE4 A;  1VOM A;  3U2M A;  4K7B A;  3C18 A;  3FHD A;  4CJO A;  3BRJ A;  1D1C A;  4IWB A;  4OD4 A;  4DOZ A;  5EGY A;  1E83 A;  1D1A A;  3LS0 A;  5F5F A;  1B68 A;  1EQ1 A;  1M57 C;  3ZDL A;  3B71 A;  1J8Y F;  1QKR A;  1G8X A;  3DAF A;  3G50 A;  1PD0 A;  3IQ6 A;  3MLG A;  3ZIB A;  3PMR A;  1CGO A;  3LLK A;  4N06 A;  3S29 A;  1VTM P;  3HJC A;  4LDQ A;  3U8P A;  3LUT B;  2J9V A;  3IQT A;  5TJ5 E;  2R7X A;  2R05 A;  3IQC A;  4U9E A;  3R2P A;  2YEV A;  1M56 C;  3NYM A;  2UUI A;  1TWC A;  1AEP A;  4K0D A;  1MNE A;  3G4Z A;  3RVY A;  1CGN A;  1K04 A;  1Q0F A;  2MWQ A;  4XQ1 A;  2R7T A;  1YDI A;  2QUP A;  5IY5 C;  2HUJ A;  4PJJ A;  3C8G D;  2QY9 A;  4KNW A;  2D4U A;  4I3M A;  4YK5 A;  1J8M F;  1MMD A;  3JYY A;  4O6M A;  1VMA A;  4DJ9 A;  3NYJ A;  4G7H F;  2IXO A;  4G7O F;  1CPR A;  3EZI A;  3R7C A;  3VM6 A;  3K33 A;  4YL0 A;  4GQH A;  4XWJ A;  1APC A;  4BJ1 A;  2ETS A;  3JT1 A;  3WAQ A;  2XXA B;  1YLM A;  1H6G A;  1WOL A;  3EFO A;  3IQ5 A;  2R7Q A;  3U2L A;  1PV3 A;  2CNW D;  2GFH A;  5KYU A;  1VYK A;  4HEA J;  4WGY A;  3JSE O;  4MTF A;  2QTV A;  4MVU A;  4EKW A;  1HW1 A;  3FOP A;  4XPW A;  2WZF A;  5EHH A;  2KK1 A;  5JVE A;  1MQV A;  1G4U S;  4E17 A;  4EBB A;  4N6C A;  2XLM A;  2L6F A;  2OOC A;  2G62 A;  2G3V A;  1OKK D;  5L0H A;  3C62 A;  1BZ4 A;  1E2X A;  2P0N A;  2YZS A;  4GEH A;  4WAB A;  5CI8 A;  5A6B D;  5K0I A;  3J06 A;  1ZHW A;  1WAT A;  2J7P A;  1U89 A;  1S7Z A;  1A7E A;  2J0X A;  1YYX A;  4BJ6 A;  4YL3 A;  2HSB A;  2QNL A;  3GWL A;  3MFN A;  4PJL A;  4CBE A;  2VB6 A;  3IPM O;  1TWA A;  3NRH A;  1IW7 F;  4JTD B;  1Z23 A;  4CS9 A;  1E86 A;  1ZU5 A;  2XL8 A;  4AK9 A;  3GM1 A;  4LLC A;  2XM4 A;  3Q6M A;  3GEE A;  3EG9 B;  4A4A A;  1JAF A;  4EWC A;  5HSW A;  2IYL D;  1C02 A;  1Z63 A;  2R7V A;  4NQF A;  2AVK A;  1T9K A;  1D0X A;  3AG1 C;  1OXB A;  1TWG A;  2YKZ A;  4EIY A;  2HJM A;  4X0R A;  5B1B C;  5KYY B;  2XXA A;  3AGT A;  3DJU B;  2XLE A;  4O7G A;  5E3C A;  3ZTZ A;  2LQG A;  1D1B A;  4CIH A;  5BQG A;  1YA9 A;  1OCC C;  5A6B A;  1RXQ A;  2Q9B A;  3N2Z B;  3ASO C;  3QZC A;  1Y4C A;  3T9O A;  2VAS A;  3LNR A;  1Z7Q c;  3X1O A;  3ZC4 A;  3JRM O;  3S84 A;  4OIP F;  4PJN A;  3B0U X;  2R25 A;  2XLO A;  1OW6 A;  1ZW2 A;  3E9V A;  4U5G A;  4CDY A;  3FDQ A;  1ZZP A;  4DRJ B;  3TUL A;  5AC4 A;  5KYW A;  4XLP F;  3MYI A;  4PK4 A;  4Z9H A;  4E0I A;  3SZR A;  3K6B A;  2Q4F A;  5DS4 A;  1CPQ A;  1JOG A;  1LS4 A;  1QVX A;  2ZXR A;  5FZT A;  5EK0 A;  3O39 A;  5JP7 A;  4C3B A;  2J7P D;  2Q9A A;  2NUP A;  3QVZ A;  4OD5 A;  2LIG A;  4CS8 A;  2A0B A;  4J30 B;  4CIP A;  1LVK A;  1EA8 A;  4EBJ A;  2L7A A;  1GM5 A;  2JX0 A;  2HS5 A;  2HMQ A;  2A68 F;  2Y69 C;  4WGZ A;  4B6I A;  1ZHT A;  3L8J A;  3UGO A;  2EIJ C;  1FNT c;  1RJ9 B;  2WZL A;  3L0I A; 
#chains in the Genus database with same CATH homology
 1RCP A;  1YZA A;  4CX9 A;  4CJO A;  2YLG A;  1E83 A;  1A7V A;  1YYJ A;  2XLW A;  3IQ6 A;  1CGO A;  3HNK A;  2CCY A;  3U8P A;  1NBB A;  3ZWI A;  4U9E A;  4JEA A;  1CGN A;  2J8W A;  1QQ3 A;  3QW1 A;  5JLI A;  3HNL A;  4U9D A;  1M6T A;  3M4B A;  5JS5 A;  3HNI A;  1CPR A;  2XL6 A;  1APC A;  1E85 A;  1LM3 B;  1S05 A;  2XLH A;  3IQ5 A;  3ZQY A;  3M79 A;  3TOM A;  5JRA A;  2YL1 A;  1YZC A;  4WGY A;  2BC5 A;  3DE9 A;  4L6R A;  3FOP A;  4ULV A;  4JE9 A;  5JVE A;  1MQV A;  3TOL A;  1EKY A;  2XLM A;  4IAQ A;  5JUA A;  3VRC A;  3C62 A;  5AGF A;  3M4C A;  256B A;  4N6H A;  3M15 A;  4CDV A;  5JT4 A;  1YYX A;  4JKV A;  1E86 A;  2XLV A;  4CJG A;  1BBH A;  2XLD A;  2XL8 A;  2XM4 A;  3ZTM A;  2YLD A;  1JAF A;  3DE8 A;  4D4X A;  4EIY A;  2YKZ A;  1QPU A;  2YL0 A;  2XLE A;  4D4N A;  3ZTZ A;  5B3I A;  3C63 A;  4IAR A;  2YL7 A;  3NMI A;  3HNJ A;  3NMJ A;  3ZQV A;  3QW0 A;  2XLO A;  4CDY A;  4IB4 A;  2QLA A;  3QVY A;  3NMK A;  2XM0 A;  3FOO A;  1CPQ A;  2YL3 A;  5JP7 A;  1GQA A;  3QVZ A;  2YLI A;  1E84 A;  3L1M A;  4CIP A;  4NC3 A;  4CDA A;  4ER9 A;  4JEB A;  4WGZ A;  5JSL A;  2J9B A;  4N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...