5BUOA

A receptor molecule
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
185
structure length
185
Chain Sequence
ENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title NULL
rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 85
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5buoA00
3NYLA 3PMRA 5BUOA 3UMHA 3QMKA 1TKNA 3K66A 3K6BA 3Q7GA 4RDAA 3NYJA 3UMIA 4RD9A 3Q7LA 4YN0B 3UMKA
chains in the Genus database with same CATH superfamily
4U5BE 1G4US 1D1CA 2XLDA 1W2WA 4IWBA 5FZTA 3TJ5A 3FOPA 2J9BA 1ZHZA 3K6BA 2G62A 3OWTA 4JTCB 1E83A 1HMDA 1L3PA 2IXMA 2WVOA 4XPXA 3SXMA 1WOLA 3SXYA 1MMNA 3JYHA 3V7OA 4XWJA 2OJED 3N0TA 3QW0A 2KYHA 1LI7A 1BDJB 1GM5A 2HS5A 4MS2A 1M56C 5K0IA 5L3VA 1C17M 2D4UA 3KL4A 1HY5A 4PJNA 3S27A 5JP7A 3R7CA 2L6GA 3U3FA 2X51A 2AWCA 3EPVA 1N1CA 4MVZA 1WASA 3B71A 2UUIA 1H9TA 3W2WA 4EKWA 1HE9A 4C7OB 4JVSA 2YVKA 1D0XA 4YN0B 5E3CA 3AG3C 2Q3TA 2XLMA 4G78A 3EZIA 4OINF 2HMZA 4O79A 3A9CA 1FTSA 1MMGA 2P7VA 3F46A 4MVSA 3ZC4A 4BJ6C 1FR0A 5B1BC 1TWHA 3C62A 3MBGA 4EWCA 4HE8D 2WB7A 1OCCC 3I4UA 4LDQA 5T3WA 2XRHA 3T4RA 4M63A 3SXZA 2M64A 2OJQA 4Q7CA 3M4CA 4W8KA 3WAQA 2DGJA 3POVA 4O6NA 2BC5A 2H7BA 1G4WR 3R2PA 1EA8A 2Y3GA 3RYLA 4CS9C 1EI7A 4U5EE 4BJTA 3GODA 3IQCA 2V3CC 4OIQF 3L34A 4E0HA 2EIMC 1ORYA 2VCCA 4OIOF 4QI2A 1D1BA 2CGEA 2GWWA 2XSEA 4MTFA 3RKOF 3TULA 5COMA 2EIJC 2EIKC 3QTHA 1U89A 2O9XA 2R02A 5GPGB 3RQEA 2J9WA 3T9OA 5JUAA 1VLSA 2ZPAA 3C7JA 1RKEB 2A0BA 3LLIA 2J0WA 5F5HA 2ZD9A 4J32B 3X2QC 2MWQA 4DBRA 3HNJA 1Z63A 3LS1A 3ZQYA 5KYUB 3UGPA 5L3QA 1ZW2A 1K04A 1WATA 3NYLA 4RBNA 2J46A 4O6YA 1B68A 3DAFA 3VRCA 4EUKB 1TKNA 2OOCA 5A69A 1T9KA 1F1MA 3UNGC 2JPUA 5BQGA 2KGOA 2VCAA 4K0DA 3U9JA 1WN0A 1TFOB 5FCLA 4N4WA 3RH3A 3G4ZA 3FDQA 4CS8C 4CSAC 3ABLC 4YWQA 3UR3C 3G50A 2I8BA 4A2NB 2Q4FA 4P9FA 5L0IA 1FFHA 1SZIA 2YL0A 1TWCA 3H2VA 2J9UA 2XLWA 1M57C 3CEXA 3LEVA 2NUTA 4D4XA 5BQIA 3DJUB 3O10A 1ZHTA 2ETSA 3K1IA 2WZLA 3HNKA 3AG4C 1FFTC 1TQGA 2HJ3A 4NQFA 2YRFA 4XLNF 1BZ4A 2PX0A 3BEHA 3H2UA 1YVIA 4DRHB 4IAQA 3N2ZB 1RJ9B 5L0JA 2LD6A 4B6IA 1S05A 4PK4A 3RQGA 3PHF2 3KPHA 2IXNA 4PJJA 2R7RA 3RF3A 4BJ5A 1BR4A 4FESA 2IXOA 1BR1A 1Q0FA 2ZXPA 3QVZA 1I4YA 1T5OA 3LJBA 5AGFA 4YT2A 1LM3B 2IYLD 3HNIA 2HSBA 3DMDA 3H65A 1EKYA 2Y3BA 1IZMA 1OCZC 3GANA 1LKXA 2PNOA 4PJMA 4JRZA 5DQTA 2IBFA 4ER9A 1H7IA 1DOWA 4CIPA 1A41A 4IRUA 2EPLX 1E85A 1I5NA 4KC9A 1ZYRF 2KJGA 3ASNC 3C8GD 1O87A 3C8GB 3EG9B 4JEBA 5L0DA 2VH3A 1YYJA 4F4BA 1LS1A 4IARA 2VB6A 4LLCA 1GGQA 2A0UA 2ZXWC 4I44A 1A7DA 3DD7A 3IQ5A 4R32A 3SEOA 4DOZA 5BUOA 4DXWA 4GQHA 1A7EA 2H7OA 2W45A 4XQ1A 4W8PA 5KYXA 1YA7O 4AK9A 4O6MA 4CBEA 3GORA 3US6A 4BEJA 3K66A 4MVQA 4EBJA 2NUPB 4YT8A 3L1MA 3ASOC 3LAYA 1WTYA 4AE4A 4BPMA 3TK0A 1SR2A 2LCHA 4EBBA 3S0XA 4MNDA 5JRAA 3O39A 1ORJA 1VOMA 3EGXB 3WG7C 3GEHA 4CDYA 2R9RB 2L6HA 1J8YF 2V26A 3GEIA 5JVEA 4JW1A 4KNVA 3VF0A 1HMOA 4E7SA 1WGWA 3NDBB 1DOVA 1LI5A 2CNWA 3MYFA 4ULWA 3AG1C 2XLEA 1LE4A 4PR9A 3L8JA 4D4NA 4YL3A 3L8IA 2G3VA 4IGGA 1TFKB 2KW3C 1ZU5A 3NMIA 1G8XA 3RW0A 3WHNA 3SNHA 1A0BA 2QTVA 3UMIA 2Y39A 3FHDA 1OW7A 1OQCA 3RVZA 4C3EA 4YT4A 2C04A 2WZGA 2Y3HA 3M79A 3U0CA 1IW7F 3DKAA 4GEHA 2M4EA 1Z23A 2A68F 4KNWA 4I1OB 2FFHA 2OQMA 2EILC 2DB4A 4P6IC 4WGZA 3GM2A 4MW3A 5D91A 1K05A 5DQZA 4Q5SF 3B29A 3ZIBA 2Z15A 2IOQA 3K33A 3AGTA 3W2VA 2XS8A 5KYYB 5JS5A 2R25A 2XXAB 5DS5A 3HJCA 3GM1A 2HUJA 4MTOA 2NG1A 4J7YA 1RCPA 3KYJA 2YLDA 1YJGA 2Q9BA 2QE9A 1YDIA 2J7PA 3PMRA 1PD1A 3QZCA 4JEAA 4ULVA 3KYIA 4RD9A 3ZTZA 1V74B 1Z6AA 3ATPA 3EGDB 4FAPB 4K1OA 2GAQA 2XL4A 5DS6A 2Q9AA 4BJ1A 1UG7A 1NZEA 4U5CE 1OCOC 3OA1A 1FMWA 4I3MA 2Q7RA 1KNYA 1LPEA 4MVOA 2XLHA 2XM0A 2L7AA 4DJ9A 3EHMA 4NY3A 5L0CA 3EH1A 2XS1A 2OCCC 2LFDA 1MMDA 1TR2A 4MVMA 3ZTMA 5L0FA 2XL8A 3E70C 1SMYF 2DI3A 2Y69C 2ASRA 3S84A 1JAFA 2OEVA 3W4YA 3NRHA 4EIYA 1H9GA 2BL2A 2F22A 4Q4ZF 1M2VA 2L9JA 1M2OA 1XWJA 4JIOA 4XTKA 3K1IC 2KSFA 1Q0GA 2QLAA 4J7TA 3JSZA 3GEEA 3LESA 4QI0A 1K40A 2HSQA 4NTAA 1HE1A 3ZG1A 4LDRA 2FGYA 3DAGA 1MMAA 4OIPF 4G7OF 2L81A 1ORSC 3S28A 1ZHYA 3NKDA 3QVYA 4YJWA 5L0HA 4YK5A 2R7SA 3FAPB 4CDVA 2R05A 3LNRA 5A6BA 1Q0DA 1NU9C 3RVYA 1LIHA 2QUPA 2VC9A 2WVNA 4I1MA 3SZRA 4CS9A 4JCHA 1OR3A 4PJLA 4CIHA 1NSGB 3JTLO 1NFNA 1Z7Qc 3S29A 3I5PA 1L7CA 4MVUA 3S90A 2H8AA 3S9OA 1VMAA 2XLOA 4ONSA 2CW0F 1CGNA 3VAYA 1LE2A 1PCXA 3QW1A 1OCRC 1O3UA 2AWYA 2B0HA 1YYXA 1T01A 3RQFA 5DS4A 3AQBA 5T3TA 3X1OA 3ECSA 4N06A 5AC4A 1MNDA 1FMVA 3JYYA 1Z3IX 2KC3A 3M1CB 3W8HA 5KYWA 4U5DE 2HZ8A 1BBHA 3JRTA 3DJNB 2J9VA 3EZHA 2A69F 5E2QA 1ZU4A 1QLEC 3FAJA 3LEOA 1QVXA 3QMKA 3ZDLA 4AL0A 2YL7A 3EJNA 3HLZA 4A4AA 4CS8A 3TD7A 1SF8A 2YL3A 3C63A 2ZXOA 2HMQA 4E0IA 5KYNA 3KKBA 4DVZA 4WGYA 4H54A 2J0XA 3RIPA 5B1AC 3UGOA 2YEVA 4FX5A 2NUTB 5E33A 3U2MA 1AUEA 1V55C 5B3IA 3FMSA 3MLGA 5EK0A 4Z9IA 4CJGA 2WVQA 3O55A 4CX9A 1FAPB 2QNLA 1UFBA 2GFHA 3JSEO 4P9TA 4YT5A 4C3BA 3HNLA 1J8MF 1QKRA 3K1HA 2YZSA 4MQ9F 2R7UA 3ZVRA 2X0CA 1C02A 1JR8A 1YAUO 5L0GA 1E86A 3NYJA 5HSWA 4ZLCA 4NC3A 4MTGA 2WZFA 1M6TA 1OW8A 4YL0A 1S7ZA 1O5HA 4G7ZF 2A1DD 4DVYP 2RD9A 2Q00A 3TOLA 5D92A 4CDAA 1VK5A 2XL6A 4XEKA 2Q9CA 2VCBA 3NMKA 4BG0A 3K7DA 3VYWA 2R7XA 4CJOA 1D0ZA 2P0NA 3FVYA 1C03A 1GS9A 1QZXA 2GA0A 3SXKA 2R7OA 3EFOB 5CIVA 4UDVA 2HJMA 4C7OA 2PX3A 2LQGA 4E7ZA 3C8ZA 3DZAA 1ZHXA 3AGUA 3TJ6A 2ICWG 4EBKA 2VASA 1Y6DA 2YKZA 3M15A 3UMHA 1CGME 2Y3DA 4JZAA 5F5FA 3N24A 1VB5A 1PD0A 2LSEA 3VM6A 4OIRF 2DYRC 2WL8A 1NLXA 3U2LA 1NBBA 2P1AA 4LACB 4E18A 2LP4A 3EGDA 3C18A 2J45A 3CZ6A 5BQHA 2R7VA 1JMWA 4PACA 2NSFA 1TWGA 4JE9A 5KYXB 3U3BA 3B0UX 2J8WA 3T6GB 2PFDA 5DLJA 1Y4CA 2LIGA 3JRMO 2B0JA 3DI5A 4AE4B 2EPNA 2FAPB 2LK4A 1NG1A 1MNEA 4O7GA 2D5RB 1GQAA 1RKEA 2HFIA 1QQ3A 2W4BA 2E87A 4QDLA 4XPYA 3FXHA 3V5XA 4BEMJ 2MHRA 5A6AA 4IAOA 4MVRA 2IM8A 2EPKX 3GWNA 1OXKA 1Z5ZA 2C03A 4KBLA 2KQ9A 4H4KC 2KNHA 5KYUA 4N6HA 1YZAA 1AVOB 1ZHWA 2CNWD 3NMJA 4LERA 5A6KA 1RKCA 4HFFB 4LLEA 2HV7A 3U5SA 3E9VA 3G4XA 1G5ZA 2RSEB 1A7VA 2HKVA 5COGA 3IEEA 4DBQA 4JC7A 3Q6MA 3NKEA 1HW1A 3U9MA 4JJFA 2HV6A 3ZWIA 5B3SC 4JTDB 4U9DA 3V5YA 5COFA 5JT4A 2AP3A 3WODF 1FNTc 4JKVA 2YWAA 1YARO 2GDCA 1EQ1A 5AC5A 2JX0A 1H6GA 1LS4A 5TJ5E 1OKKA 3M4BA 2NPUA 2W9YA 4NTFA 5DVWA 4KI2A 4GYTA 3U8VA 1YLMA 2W4MA 3MX3A 4U5HA 4J30B 2YLIA 2XLVA 1T6IA 3IPMO 1ST6A 2EPOA 4XEVA 3SP1A 4ANJA 2AU5A 2MYSA 4U5FE 1XZPA 5CI8A 1RJ9A 2UUHA 1PV3A 1T6UA 2R03A 4JTAB 5HV9A 2P61A 3UMKA 2I15A 4K7BA 4DRIB 1LVKA 3A11A 2TMVP 3IHUA 1CPQA 4BJ6A 3TQOA 1D1AA 2DYSC 3CAXA 2J7PD 3GWLA 4BJ5C 3KMIA 5JSLA 2YQYA 4FWVA 4PFPA 2AVKA 3ZSUA 4U9EA 3EH2A 2IXPA 1OW6A 2QY9A 3EHNA 2BE5F 3NG1A 1CPRA 3HTKC 2R7TA 4ZLDA 4XEFA 2PP4A 5A6JA 2A6EF 4Z9JA 4CS7A 3O6XA 2CDQA 1Q0MA 2ZXRA 5F28E 1I4ZA 3LNMB 4WABA 1NFOA 4E17A 3T6JA 2JD3A 2CYDA 1JPJA 3C8GA 3EG9A 1V4AA 3AQCA 3ITFA 3NYMA 1CGOA 4NTBA 4YL1A 3PDMP 1RMVA 3DWWA 4HFKB 2R7QA 3DE8A 1T6QA 2NSGA 3BRJA 1JOGA 4NCQA 3RFYA 5EHHA 1M2VB 2P6VA 1OKKD 4DRJB 4L6RA 2KK1A 4AL1A 3IQ6A 2OU6A 1VYKA 1TWAA 3AJMA 1R4TA 2L6FA 3DM9B 2PF4E 3L0IA 3FOOA 3PCVA 2NUPA 1HW2A 4OD5A 3Q6NA 2OG2A 5T1DB 2YL1A 2G3KA 3AOUA 3TOMA 1E2XA 4CSAA 3EGXA 4G0HA 4JCZA 1YA9A 5JLIA 4RDAA 1RXQA 3U8PA 4N6CA 4EHPA 3SYNA 1ZW3A 4AX2A 3B9QA 1OXBA 2LFFA 3LS0A 3HKKA 1NU7D 3JZ0A 5A6BD 1XZQA 2EINC 3JCUQ 1OR2A 1YZCA 3Q7GA 4G7HF 3IQTA 3CSKA 3Q7LA 3EFOA 1V54C 4HEAJ 1U0BB 3LUTB 1JPNA 4XPWA 1MQVA 5E3AA 1VYIA 4JJGA 1VLTA 3V5ZA 1JRAA 3ZQVA 1AEPA 2H7VC 3J06A 3AG2C 3MFNA 1KTMA 4LDKA 3W8IA 3I5QA 1R5ID 1WWPA 1KU2A 3T6BA 2XM4A 2OKUA 1APCA 4PFOA 2YHSA 5EGYA 1Q0KA 3CQZA 3LLKA 4X0RA 1BR2A 4IJJA 4OD4A 2A6HF 1ZZPA 5KYYA 4U5GA 2OEXA 5KYWB 2XXAA 1ZVZA 1QPUA 4Z9HA 4C3DA 2CCYA 1E84A 2EPMX 1SYQA 3DE9A 4JURI 5CI9A 3DM5A 3OEOA 4IB4A 2PBEA 3ABMC 2R7WA 1U6HA 1D0YA 256BA 3EQLF 3KH2A 1QSPA 4WJ0A 5IY5C 3ABKC 3MYIA 4MW8A 3DXJF 3B0PA 2YLGA 3F47A 1VTMP 3B0VC 4XLPF 3GM3A 3JT1A
chains in the Genus database with same CATH topology
4U5BE 1D1CA 4IWBA 1W2WA 1ZHZA 3K6BA 2G62A 3OWTA 2IXMA 2WVOA 1MMNA 3JYHA 3V7OA 4XWJA 3N0TA 1M56C 5L3VA 3KL4A 4PJNA 3S27A 2X51A 3EPVA 1N1CA 3W2WA 4C7OB 4JVSA 1D0XA 4YN0B 5E3CA 3AG3C 2Q3TA 3EZIA 4OINF 4O79A 1FTSA 1MMGA 2P7VA 3F46A 3ZC4A 4BJ6C 5B1BC 1TWHA 4EWCA 4HE8D 2WB7A 1OCCC 3I4UA 5T3WA 2XRHA 3T4RA 4M63A 4Q7CA 4W8KA 2DGJA 3POVA 4O6NA 2H7BA 3RYLA 4CS9C 2Y3GA 2V3CC 4OIQF 4U5EE 4BJTA 3GODA 3L34A 2EIMC 4OIOF 4QI2A 1D1BA 2CGEA 3RKOF 2XSEA 2EIJC 2EIKC 2O9XA 2J9WA 2ZPAA 3LLIA 2J0WA 5F5HA 4J32B 3X2QC 2MWQA 4DBRA 1Z63A 3LS1A 5KYUB 3UGPA 5L3QA 3NYLA 4RBNA 2J46A 4O6YA 3DAFA 1TKNA 3UNGC 2KGOA 4K0DA 5FCLA 3RH3A 3FDQA 4CS8C 4CSAC 3ABLC 4YWQA 3UR3C 2I8BA 4A2NB 1FFHA 1SZIA 1TWCA 2J9UA 3LEVA 1M57C 2NUTA 3DJUB 1ZHTA 2WZLA 4XLNF 3AG4C 1FFTC 2PX0A 3N2ZB 1RJ9B 4B6IA 4PK4A 3PHF2 2IXNA 4PJJA 2R7RA 4BJ5A 1BR4A 4FESA 2IXOA 1BR1A 2ZXPA 3LJBA 4YT2A 2IYLD 3DMDA 3H65A 2Y3BA 1IZMA 1OCZC 3GANA 1LKXA 5DQTA 4PJMA 4IRUA 4KC9A 1ZYRF 2KJGA 3ASNC 1O87A 3EG9B 2VH3A 4F4BA 1LS1A 2VB6A 4LLCA 2ZXWC 4I44A 3DD7A 3SEOA 4DOZA 5BUOA 2H7OA 2W45A 5KYXA 4AK9A 4O6MA 4CBEA 4BEJA 3K66A 4YT8A 2NUPB 3ASOC 3LAYA 4AE4A 4EBBA 3S0XA 4MNDA 3O39A 1VOMA 3EGXB 3WG7C 2V26A 1J8YF 4JW1A 4KNVA 4E7SA 1WGWA 3NDBB 2CNWA 4ULWA 3AG1C 2G3VA 2KW3C 1ZU5A 1G8XA 3SNHA 2QTVA 3UMIA 2Y39A 3FHDA 4C3EA 4YT4A 2C04A 2WZGA 2Y3HA 1IW7F 4GEHA 2M4EA 1Z23A 2A68F 4KNWA 4I1OB 2FFHA 5DQZA 2EILC 4P6IC 5D91A 4Q5SF 3ZIBA 2Z15A 2IOQA 3K33A 3W2VA 5KYYB 2XXAB 5DS5A 3HJCA 2NG1A 2Q9BA 3PMRA 2J7PA 1PD1A 3QZCA 4RD9A 3EGDB 1Z6AA 2XL4A 5DS6A 2Q9AA 4BJ1A 1NZEA 4U5CE 1OCOC 3OA1A 1FMWA 4I3MA 3EHMA 4NY3A 3EH1A 2OCCC 1TR2A 1MMDA 3E70C 1SMYF 2Y69C 3NRHA 4Q4ZF 1M2VA 2L9JA 1M2OA 4XTKA 3K1IC 3JSZA 4QI0A 3LESA 3ZG1A 2FGYA 3DAGA 1MMAA 4OIPF 4G7OF 2L81A 3S28A 1ZHYA 3NKDA 4YJWA 2R7SA 3LNRA 1NU9C 4I1MA 2WVNA 3SZRA 4CS9A 4JCHA 4PJLA 4CIHA 3S29A 3I5PA 1VMAA 2CW0F 3VAYA 1PCXA 1OCRC 5DS4A 3AQBA 5T3TA 3X1OA 3ECSA 4N06A 1MNDA 1FMVA 1Z3IX 5KYWA 3M1CB 3W8HA 4U5DE 3JRTA 3DJNB 2J9VA 3EZHA 2A69F 5E2QA 1ZU4A 1QLEC 3FAJA 3QMKA 3EJNA 3HLZA 4CS8A 3TD7A 1SF8A 2ZXOA 5KYNA 3KKBA 4DVZA 3UGOA 2J0XA 3RIPA 5B1AC 2YEVA 4FX5A 2NUTB 5E33A 1V55C 3MLGA 2WVQA 4YT5A 2GFHA 4C3BA 3K1HA 1J8MF 2R7UA 2YZSA 4MQ9F 3ZVRA 3NYJA 5HSWA 4ZLCA 4G7ZF 2WZFA 1S7ZA 1O5HA 2A1DD 4DVYP 5D92A 1VK5A 4BG0A 2Q9CA 3K7DA 3VYWA 2R7XA 1D0ZA 3FVYA 1QZXA 2R7OA 3EFOB 4C7OA 2PX3A 4E7ZA 3DZAA 1ZHXA 2VASA 5F5FA 3UMHA 2Y3DA 4JZAA 3N24A 1PD0A 2LSEA 4OIRF 2DYRC 2WL8A 4LACB 3EGDA 2J45A 3CZ6A 2R7VA 1TWGA 5KYXB 3B0UX 2PFDA 5DLJA 2B0JA 4AE4B 1NG1A 1MNEA 4O7GA 2D5RB 2W4BA 2E87A 4QDLA 4IAOA 2C03A 1Z5ZA 4KBLA 2KQ9A 4H4KC 2KNHA 5KYUA 2CNWD 1ZHWA 4LERA 4HFFB 4LLEA 2HV7A 3E9VA 3IEEA 4DBQA 3Q6MA 3NKEA 4JJFA 2HV6A 5B3SC 3WODF 1OKKA 2W9YA 5DVWA 4KI2A 4GYTA 2W4MA 3MX3A 4U5HA 4J30B 3SP1A 1ST6A 4ANJA 4U5FE 2MYSA 5CI8A 1RJ9A 3UMKA 4K7BA 1LVKA 4BJ6A 1D1AA 2DYSC 2J7PD 4BJ5C 3KMIA 4FWVA 4PFPA 3ZSUA 3EH2A 2IXPA 2QY9A 3EHNA 2BE5F 3NG1A 3HTKC 2R7TA 4ZLDA 2PP4A 2A6EF 4CS7A 3O6XA 2CDQA 2ZXRA 3T6JA 2JD3A 3ITFA 1JPJA 3EG9A 3AQCA 3NYMA 4HFKB 2R7QA 3RFYA 5EHHA 1M2VB 2P6VA 1OKKD 1TWAA 1VYKA 3L0IA 3DM9B 2PF4E 2NUPA 4OD5A 3Q6NA 2OG2A 5T1DB 2G3KA 4CSAA 3EGXA 4G0HA 4RDAA 3SYNA 4AX2A 3B9QA 3LS0A 1NU7D 4G7HF 2EINC 3JCUQ 3Q7GA 3CSKA 3Q7LA 3EFOA 1V54C 4HEAJ 1JPNA 5E3AA 1VYIA 4JJGA 2H7VC 3AG2C 3W8IA 3I5QA 1KU2A 3T6BA 4PFOA 2YHSA 5EGYA 3CQZA 3LLKA 4X0RA 1BR2A 4IJJA 4OD4A 2A6HF 5KYYA 4U5GA 2XXAA 5KYWB 4C3DA 4JURI 5CI9A 3DM5A 3OEOA 3ABMC 2R7WA 3KH2A 1D0YA 3EQLF 4WJ0A 5IY5C 3ABKC 3DXJF 3B0PA 3F47A 3B0VC 4XLPF 3JT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYL A;  3PMR A;  5BUO A;  3UMH A;  3QMK A;  1TKN A;  3K66 A;  3K6B A;  3Q7G A;  4RDA A;  3NYJ A;  3UMI A;  4RD9 A;  3Q7L A;  4YN0 B;  3UMK A; 
#chains in the Genus database with same CATH topology
 4U5B E;  1G4U S;  1D1C A;  2XLD A;  1W2W A;  4IWB A;  5FZT A;  3TJ5 A;  3FOP A;  2J9B A;  1ZHZ A;  3K6B A;  2G62 A;  3OWT A;  4JTC B;  1E83 A;  1HMD A;  1L3P A;  2IXM A;  2WVO A;  4XPX A;  3SXM A;  1WOL A;  3SXY A;  1MMN A;  3JYH A;  3V7O A;  4XWJ A;  2OJE D;  3N0T A;  3QW0 A;  2KYH A;  1LI7 A;  1BDJ B;  1GM5 A;  2HS5 A;  4MS2 A;  1M56 C;  5K0I A;  5L3V A;  1C17 M;  2D4U A;  3KL4 A;  1HY5 A;  4PJN A;  3S27 A;  5JP7 A;  3R7C A;  2L6G A;  3U3F A;  2X51 A;  2AWC A;  3EPV A;  1N1C A;  4MVZ A;  1WAS A;  3B71 A;  2UUI A;  1H9T A;  3W2W A;  4EKW A;  1HE9 A;  4C7O B;  4JVS A;  2YVK A;  1D0X A;  4YN0 B;  5E3C A;  3AG3 C;  2Q3T A;  2XLM A;  4G78 A;  3EZI A;  4OIN F;  2HMZ A;  4O79 A;  3A9C A;  1FTS A;  1MMG A;  2P7V A;  3F46 A;  4MVS A;  3ZC4 A;  4BJ6 C;  1FR0 A;  5B1B C;  1TWH A;  3C62 A;  3MBG A;  4EWC A;  4HE8 D;  2WB7 A;  1OCC C;  3I4U A;  4LDQ A;  5T3W A;  2XRH A;  3T4R A;  4M63 A;  3SXZ A;  2M64 A;  2OJQ A;  4Q7C A;  3M4C A;  4W8K A;  3WAQ A;  2DGJ A;  3POV A;  4O6N A;  2BC5 A;  2H7B A;  1G4W R;  3R2P A;  1EA8 A;  2Y3G A;  3RYL A;  4CS9 C;  1EI7 A;  4U5E E;  4BJT A;  3GOD A;  3IQC A;  2V3C C;  4OIQ F;  3L34 A;  4E0H A;  2EIM C;  1ORY A;  2VCC A;  4OIO F;  4QI2 A;  1D1B A;  2CGE A;  2GWW A;  2XSE A;  4MTF A;  3RKO F;  3TUL A;  5COM A;  2EIJ C;  2EIK C;  3QTH A;  1U89 A;  2O9X A;  2R02 A;  5GPG B;  3RQE A;  2J9W A;  3T9O A;  5JUA A;  1VLS A;  2ZPA A;  3C7J A;  1RKE B;  2A0B A;  3LLI A;  2J0W A;  5F5H A;  2ZD9 A;  4J32 B;  3X2Q C;  2MWQ A;  4DBR A;  3HNJ A;  1Z63 A;  3LS1 A;  3ZQY A;  5KYU B;  3UGP A;  5L3Q A;  1ZW2 A;  1K04 A;  1WAT A;  3NYL A;  4RBN A;  2J46 A;  4O6Y A;  1B68 A;  3DAF A;  3VRC A;  4EUK B;  1TKN A;  2OOC A;  5A69 A;  1T9K A;  1F1M A;  3UNG C;  2JPU A;  5BQG A;  2KGO A;  2VCA A;  4K0D A;  3U9J A;  1WN0 A;  1TFO B;  5FCL A;  4N4W A;  3RH3 A;  3G4Z A;  3FDQ A;  4CS8 C;  4CSA C;  3ABL C;  4YWQ A;  3UR3 C;  3G50 A;  2I8B A;  4A2N B;  2Q4F A;  4P9F A;  5L0I A;  1FFH A;  1SZI A;  2YL0 A;  1TWC A;  3H2V A;  2J9U A;  2XLW A;  1M57 C;  3CEX A;  3LEV A;  2NUT A;  4D4X A;  5BQI A;  3DJU B;  3O10 A;  1ZHT A;  2ETS A;  3K1I A;  2WZL A;  3HNK A;  3AG4 C;  1FFT C;  1TQG A;  2HJ3 A;  4NQF A;  2YRF A;  4XLN F;  1BZ4 A;  2PX0 A;  3BEH A;  3H2U A;  1YVI A;  4DRH B;  4IAQ A;  3N2Z B;  1RJ9 B;  5L0J A;  2LD6 A;  4B6I A;  1S05 A;  4PK4 A;  3RQG A;  3PHF 2;  3KPH A;  2IXN A;  4PJJ A;  2R7R A;  3RF3 A;  4BJ5 A;  1BR4 A;  4FES A;  2IXO A;  1BR1 A;  1Q0F A;  2ZXP A;  3QVZ A;  1I4Y A;  1T5O A;  3LJB A;  5AGF A;  4YT2 A;  1LM3 B;  2IYL D;  3HNI A;  2HSB A;  3DMD A;  3H65 A;  1EKY A;  2Y3B A;  1IZM A;  1OCZ C;  3GAN A;  1LKX A;  2PNO A;  4PJM A;  4JRZ A;  5DQT A;  2IBF A;  4ER9 A;  1H7I A;  1DOW A;  4CIP A;  1A41 A;  4IRU A;  2EPL X;  1E85 A;  1I5N A;  4KC9 A;  1ZYR F;  2KJG A;  3ASN C;  3C8G D;  1O87 A;  3C8G B;  3EG9 B;  4JEB A;  5L0D A;  2VH3 A;  1YYJ A;  4F4B A;  1LS1 A;  4IAR A;  2VB6 A;  4LLC A;  1GGQ A;  2A0U A;  2ZXW C;  4I44 A;  1A7D A;  3DD7 A;  3IQ5 A;  4R32 A;  3SEO A;  4DOZ A;  5BUO A;  4DXW A;  4GQH A;  1A7E A;  2H7O A;  2W45 A;  4XQ1 A;  4W8P A;  5KYX A;  1YA7 O;  4AK9 A;  4O6M A;  4CBE A;  3GOR A;  3US6 A;  4BEJ A;  3K66 A;  4MVQ A;  4EBJ A;  2NUP B;  4YT8 A;  3L1M A;  3ASO C;  3LAY A;  1WTY A;  4AE4 A;  4BPM A;  3TK0 A;  1SR2 A;  2LCH A;  4EBB A;  3S0X A;  4MND A;  5JRA A;  3O39 A;  1ORJ A;  1VOM A;  3EGX B;  3WG7 C;  3GEH A;  4CDY A;  2R9R B;  2L6H A;  1J8Y F;  2V26 A;  3GEI A;  5JVE A;  4JW1 A;  4KNV A;  3VF0 A;  1HMO A;  4E7S A;  1WGW A;  3NDB B;  1DOV A;  1LI5 A;  2CNW A;  3MYF A;  4ULW A;  3AG1 C;  2XLE A;  1LE4 A;  4PR9 A;  3L8J A;  4D4N A;  4YL3 A;  3L8I A;  2G3V A;  4IGG A;  1TFK B;  2KW3 C;  1ZU5 A;  3NMI A;  1G8X A;  3RW0 A;  3WHN A;  3SNH A;  1A0B A;  2QTV A;  3UMI A;  2Y39 A;  3FHD A;  1OW7 A;  1OQC A;  3RVZ A;  4C3E A;  4YT4 A;  2C04 A;  2WZG A;  2Y3H A;  3M79 A;  3U0C A;  1IW7 F;  3DKA A;  4GEH A;  2M4E A;  1Z23 A;  2A68 F;  4KNW A;  4I1O B;  2FFH A;  2OQM A;  2EIL C;  2DB4 A;  4P6I C;  4WGZ A;  3GM2 A;  4MW3 A;  5D91 A;  1K05 A;  5DQZ A;  4Q5S F;  3B29 A;  3ZIB A;  2Z15 A;  2IOQ A;  3K33 A;  3AGT A;  3W2V A;  2XS8 A;  5KYY B;  5JS5 A;  2R25 A;  2XXA B;  5DS5 A;  3HJC A;  3GM1 A;  2HUJ A;  4MTO A;  2NG1 A;  4J7Y A;  1RCP A;  3KYJ A;  2YLD A;  1YJG A;  2Q9B A;  2QE9 A;  1YDI A;  2J7P A;  3PMR A;  1PD1 A;  3QZC A;  4JEA A;  4ULV A;  3KYI A;  4RD9 A;  3ZTZ A;  1V74 B;  1Z6A A;  3ATP A;  3EGD B;  4FAP B;  4K1O A;  2GAQ A;  2XL4 A;  5DS6 A;  2Q9A A;  4BJ1 A;  1UG7 A;  1NZE A;  4U5C E;  1OCO C;  3OA1 A;  1FMW A;  4I3M A;  2Q7R A;  1KNY A;  1LPE A;  4MVO A;  2XLH A;  2XM0 A;  2L7A A;  4DJ9 A;  3EHM A;  4NY3 A;  5L0C A;  3EH1 A;  2XS1 A;  2OCC C;  2LFD A;  1MMD A;  1TR2 A;  4MVM A;  3ZTM A;  5L0F A;  2XL8 A;  3E70 C;  1SMY F;  2DI3 A;  2Y69 C;  2ASR A;  3S84 A;  1JAF A;  2OEV A;  3W4Y A;  3NRH A;  4EIY A;  1H9G A;  2BL2 A;  2F22 A;  4Q4Z F;  1M2V A;  2L9J A;  1M2O A;  1XWJ A;  4JIO A;  4XTK A;  3K1I C;  2KSF A;  1Q0G A;  2QLA A;  4J7T A;  3JSZ A;  3GEE A;  3LES A;  4QI0 A;  1K40 A;  2HSQ A;  4NTA A;  1HE1 A;  3ZG1 A;  4LDR A;  2FGY A;  3DAG A;  1MMA A;  4OIP F;  4G7O F;  2L81 A;  1ORS C;  3S28 A;  1ZHY A;  3NKD A;  3QVY A;  4YJW A;  5L0H A;  4YK5 A;  2R7S A;  3FAP B;  4CDV A;  2R05 A;  3LNR A;  5A6B A;  1Q0D A;  1NU9 C;  3RVY A;  1LIH A;  2QUP A;  2VC9 A;  2WVN A;  4I1M A;  3SZR A;  4CS9 A;  4JCH A;  1OR3 A;  4PJL A;  4CIH A;  1NSG B;  3JTL O;  1NFN A;  1Z7Q c;  3S29 A;  3I5P A;  1L7C A;  4MVU A;  3S90 A;  2H8A A;  3S9O A;  1VMA A;  2XLO A;  4ONS A;  2CW0 F;  1CGN A;  3VAY A;  1LE2 A;  1PCX A;  3QW1 A;  1OCR C;  1O3U A;  2AWY A;  2B0H A;  1YYX A;  1T01 A;  3RQF A;  5DS4 A;  3AQB A;  5T3T A;  3X1O A;  3ECS A;  4N06 A;  5AC4 A;  1MND A;  1FMV A;  3JYY A;  1Z3I X;  2KC3 A;  3M1C B;  3W8H A;  5KYW A;  4U5D E;  2HZ8 A;  1BBH A;  3JRT A;  3DJN B;  2J9V A;  3EZH A;  2A69 F;  5E2Q A;  1ZU4 A;  1QLE C;  3FAJ A;  3LEO A;  1QVX A;  3QMK A;  3ZDL A;  4AL0 A;  2YL7 A;  3EJN A;  3HLZ A;  4A4A A;  4CS8 A;  3TD7 A;  1SF8 A;  2YL3 A;  3C63 A;  2ZXO A;  2HMQ A;  4E0I A;  5KYN A;  3KKB A;  4DVZ A;  4WGY A;  4H54 A;  2J0X A;  3RIP A;  5B1A C;  3UGO A;  2YEV A;  4FX5 A;  2NUT B;  5E33 A;  3U2M A;  1AUE A;  1V55 C;  5B3I A;  3FMS A;  3MLG A;  5EK0 A;  4Z9I A;  4CJG A;  2WVQ A;  3O55 A;  4CX9 A;  1FAP B;  2QNL A;  1UFB A;  2GFH A;  3JSE O;  4P9T A;  4YT5 A;  4C3B A;  3HNL A;  1J8M F;  1QKR A;  3K1H A;  2YZS A;  4MQ9 F;  2R7U A;  3ZVR A;  2X0C A;  1C02 A;  1JR8 A;  1YAU O;  5L0G A;  1E86 A;  3NYJ A;  5HSW A;  4ZLC A;  4NC3 A;  4MTG A;  2WZF A;  1M6T A;  1OW8 A;  4YL0 A;  1S7Z A;  1O5H A;  4G7Z F;  2A1D D;  4DVY P;  2RD9 A;  2Q00 A;  3TOL A;  5D92 A;  4CDA A;  1VK5 A;  2XL6 A;  4XEK A;  2Q9C A;  2VCB A;  3NMK A;  4BG0 A;  3K7D A;  3VYW A;  2R7X A;  4CJO A;  1D0Z A;  2P0N A;  3FVY A;  1C03 A;  1GS9 A;  1QZX A;  2GA0 A;  3SXK A;  2R7O A;  3EFO B;  5CIV A;  4UDV A;  2HJM A;  4C7O A;  2PX3 A;  2LQG A;  4E7Z A;  3C8Z A;  3DZA A;  1ZHX A;  3AGU A;  3TJ6 A;  2ICW G;  4EBK A;  2VAS A;  1Y6D A;  2YKZ A;  3M15 A;  3UMH A;  1CGM E;  2Y3D A;  4JZA A;  5F5F A;  3N24 A;  1VB5 A;  1PD0 A;  2LSE A;  3VM6 A;  4OIR F;  2DYR C;  2WL8 A;  1NLX A;  3U2L A;  1NBB A;  2P1A A;  4LAC B;  4E18 A;  2LP4 A;  3EGD A;  3C18 A;  2J45 A;  3CZ6 A;  5BQH A;  2R7V A;  1JMW A;  4PAC A;  2NSF A;  1TWG A;  4JE9 A;  5KYX B;  3U3B A;  3B0U X;  2J8W A;  3T6G B;  2PFD A;  5DLJ A;  1Y4C A;  2LIG A;  3JRM O;  2B0J A;  3DI5 A;  4AE4 B;  2EPN A;  2FAP B;  2LK4 A;  1NG1 A;  1MNE A;  4O7G A;  2D5R B;  1GQA A;  1RKE A;  2HFI A;  1QQ3 A;  2W4B A;  2E87 A;  4QDL A;  4XPY A;  3FXH A;  3V5X A;  4BEM J;  2MHR A;  5A6A A;  4IAO A;  4MVR A;  2IM8 A;  2EPK X;  3GWN A;  1OXK A;  1Z5Z A;  2C03 A;  4KBL A;  2KQ9 A;  4H4K C;  2KNH A;  5KYU A;  4N6H A;  1YZA A;  1AVO B;  1ZHW A;  2CNW D;  3NMJ A;  4LER A;  5A6K A;  1RKC A;  4HFF B;  4LLE A;  2HV7 A;  3U5S A;  3E9V A;  3G4X A;  1G5Z A;  2RSE B;  1A7V A;  2HKV A;  5COG A;  3IEE A;  4DBQ A;  4JC7 A;  3Q6M A;  3NKE A;  1HW1 A;  3U9M A;  4JJF A;  2HV6 A;  3ZWI A;  5B3S C;  4JTD B;  4U9D A;  3V5Y A;  5COF A;  5JT4 A;  2AP3 A;  3WOD F;  1FNT c;  4JKV A;  2YWA A;  1YAR O;  2GDC A;  1EQ1 A;  5AC5 A;  2JX0 A;  1H6G A;  1LS4 A;  5TJ5 E;  1OKK A;  3M4B A;  2NPU A;  2W9Y A;  4NTF A;  5DVW A;  4KI2 A;  4GYT A;  3U8V A;  1YLM A;  2W4M A;  3MX3 A;  4U5H A;  4J30 B;  2YLI A;  2XLV A;  1T6I A;  3IPM O;  1ST6 A;  2EPO A;  4XEV A;  3SP1 A;  4ANJ A;  2AU5 A;  2MYS A;  4U5F E;  1XZP A;  5CI8 A;  1RJ9 A;  2UUH A;  1PV3 A;  1T6U A;  2R03 A;  4JTA B;  5HV9 A;  2P61 A;  3UMK A;  2I15 A;  4K7B A;  4DRI B;  1LVK A;  3A11 A;  2TMV P;  3IHU A;  1CPQ A;  4BJ6 A;  3TQO A;  1D1A A;  2DYS C;  3CAX A;  2J7P D;  3GWL A;  4BJ5 C;  3KMI A;  5JSL A;  2YQY A;  4FWV A;  4PFP A;  2AVK A;  3ZSU A;  4U9E A;  3EH2 A;  2IXP A;  1OW6 A;  2QY9 A;  3EHN A;  2BE5 F;  3NG1 A;  1CPR A;  3HTK C;  2R7T A;  4ZLD A;  4XEF A;  2PP4 A;  5A6J A;  2A6E F;  4Z9J A;  4CS7 A;  3O6X A;  2CDQ A;  1Q0M A;  2ZXR A;  5F28 E;  1I4Z A;  3LNM B;  4WAB A;  1NFO A;  4E17 A;  3T6J A;  2JD3 A;  2CYD A;  1JPJ A;  3C8G A;  3EG9 A;  1V4A A;  3AQC A;  3ITF A;  3NYM A;  1CGO A;  4NTB A;  4YL1 A;  3PDM P;  1RMV A;  3DWW A;  4HFK B;  2R7Q A;  3DE8 A;  1T6Q A;  2NSG A;  3BRJ A;  1JOG A;  4NCQ A;  3RFY A;  5EHH A;  1M2V B;  2P6V A;  1OKK D;  4DRJ B;  4L6R A;  2KK1 A;  4AL1 A;  3IQ6 A;  2OU6 A;  1VYK A;  1TWA A;  3AJM A;  1R4T A;  2L6F A;  3DM9 B;  2PF4 E;  3L0I A;  3FOO A;  3PCV A;  2NUP A;  1HW2 A;  4OD5 A;  3Q6N A;  2OG2 A;  5T1D B;  2YL1 A;  2G3K A;  3AOU A;  3TOM A;  1E2X A;  4CSA A;  3EGX A;  4G0H A;  4JCZ A;  1YA9 A;  5JLI A;  4RDA A;  1RXQ A;  3U8P A;  4N6C A;  4EHP A;  3SYN A;  1ZW3 A;  4AX2 A;  3B9Q A;  1OXB A;  2LFF A;  3LS0 A;  3HKK A;  1NU7 D;  3JZ0 A;  5A6B D;  1XZQ A;  2EIN C;  3JCU Q;  1OR2 A;  1YZC A;  3Q7G A;  4G7H F;  3IQT A;  3CSK A;  3Q7L A;  3EFO A;  1V54 C;  4HEA J;  1U0B B;  3LUT B;  1JPN A;  4XPW A;  1MQV A;  5E3A A;  1VYI A;  4JJG A;  1VLT A;  3V5Z A;  1JRA A;  3ZQV A;  1AEP A;  2H7V C;  3J06 A;  3AG2 C;  3MFN A;  1KTM A;  4LDK A;  3W8I A;  3I5Q A;  1R5I D;  1WWP A;  1KU2 A;  3T6B A;  2XM4 A;  2OKU A;  1APC A;  4PFO A;  2YHS A;  5EGY A;  1Q0K A;  3CQZ A;  3LLK A;  4X0R A;  1BR2 A;  4IJJ A;  4OD4 A;  2A6H F;  1ZZP A;  5KYY A;  4U5G A;  2OEX A;  5KYW B;  2XXA A;  1ZVZ A;  1QPU A;  4Z9H A;  4C3D A;  2CCY A;  1E84 A;  2EPM X;  1SYQ A;  3DE9 A;  4JUR I;  5CI9 A;  3DM5 A;  3OEO A;  4IB4 A;  2PBE A;  3ABM C;  2R7W A;  1U6H A;  1D0Y A;  256B A;  3EQL F;  3KH2 A;  1QSP A;  4WJ0 A;  5IY5 C;  3ABK C;  3MYI A;  4MW8 A;  3DXJ F;  3B0P A;  2YLG A;  3F47 A;  1VTM P;  3B0V C;  4XLP F;  3GM3 A;  3JT1 A; 
#chains in the Genus database with same CATH homology
 4U5B E;  1D1C A;  4IWB A;  1W2W A;  1ZHZ A;  3K6B A;  2G62 A;  3OWT A;  2IXM A;  2WVO A;  1MMN A;  3JYH A;  3V7O A;  4XWJ A;  3N0T A;  1M56 C;  5L3V A;  3KL4 A;  4PJN A;  3S27 A;  2X51 A;  3EPV A;  1N1C A;  3W2W A;  4C7O B;  4JVS A;  1D0X A;  4YN0 B;  5E3C A;  3AG3 C;  2Q3T A;  3EZI A;  4OIN F;  4O79 A;  1FTS A;  1MMG A;  2P7V A;  3F46 A;  3ZC4 A;  4BJ6 C;  5B1B C;  1TWH A;  4EWC A;  4HE8 D;  2WB7 A;  1OCC C;  3I4U A;  5T3W A;  2XRH A;  3T4R A;  4M63 A;  4Q7C A;  4W8K A;  2DGJ A;  3POV A;  4O6N A;  2H7B A;  3RYL A;  4CS9 C;  2Y3G A;  2V3C C;  4OIQ F;  4U5E E;  4BJT A;  3GOD A;  3L34 A;  2EIM C;  4OIO F;  4QI2 A;  1D1B A;  2CGE A;  3RKO F;  2XSE A;  2EIJ C;  2EIK C;  2O9X A;  2J9W A;  2ZPA A;  3LLI A;  2J0W A;  5F5H A;  4J32 B;  3X2Q C;  2MWQ A;  4DBR A;  1Z63 A;  3LS1 A;  5KYU B;  3UGP A;  5L3Q A;  3NYL A;  4RBN A;  2J46 A;  4O6Y A;  3DAF A;  1TKN A;  3UNG C;  2KGO A;  4K0D A;  5FCL A;  3RH3 A;  3FDQ A;  4CS8 C;  4CSA C;  3ABL C;  4YWQ A;  3UR3 C;  2I8B A;  4A2N B;  1FFH A;  1SZI A;  1TWC A;  2J9U A;  3LEV A;  1M57 C;  2NUT A;  3DJU B;  1ZHT A;  2WZL A;  4XLN F;  3AG4 C;  1FFT C;  2PX0 A;  3N2Z B;  1RJ9 B;  4B6I A;  4PK4 A;  3PHF 2;  2IXN A;  4PJJ A;  2R7R A;  4BJ5 A;  1BR4 A;  4FES A;  2IXO A;  1BR1 A;  2ZXP A;  3LJB A;  4YT2 A;  2IYL D;  3DMD A;  3H65 A;  2Y3B A;  1IZM A;  1OCZ C;  3GAN A;  1LKX A;  5DQT A;  4PJM A;  4IRU A;  4KC9 A;  1ZYR F;  2KJG A;  3ASN C;  1O87 A;  3EG9 B;  2VH3 A;  4F4B A;  1LS1 A;  2VB6 A;  4LLC A;  2ZXW C;  4I44 A;  3DD7 A;  3SEO A;  4DOZ A;  5BUO A;  2H7O A;  2W45 A;  5KYX A;  4AK9 A;  4O6M A;  4CBE A;  4BEJ A;  3K66 A;  4YT8 A;  2NUP B;  3ASO C;  3LAY A;  4AE4 A;  4EBB A;  3S0X A;  4MND A;  3O39 A;  1VOM A;  3EGX B;  3WG7 C;  2V26 A;  1J8Y F;  4JW1 A;  4KNV A;  4E7S A;  1WGW A;  3NDB B;  2CNW A;  4ULW A;  3AG1 C;  2G3V A;  2KW3 C;  1ZU5 A;  1G8X A;  3SNH A;  2QTV A;  3UMI A;  2Y39 A;  3FHD A;  4C3E A;  4YT4 A;  2C04 A;  2WZG A;  2Y3H A;  1IW7 F;  4GEH A;  2M4E A;  1Z23 A;  2A68 F;  4KNW A;  4I1O B;  2FFH A;  5DQZ A;  2EIL C;  4P6I C;  5D91 A;  4Q5S F;  3ZIB A;  2Z15 A;  2IOQ A;  3K33 A;  3W2V A;  5KYY B;  2XXA B;  5DS5 A;  3HJC A;  2NG1 A;  2Q9B A;  3PMR A;  2J7P A;  1PD1 A;  3QZC A;  4RD9 A;  3EGD B;  1Z6A A;  2XL4 A;  5DS6 A;  2Q9A A;  4BJ1 A;  1NZE A;  4U5C E;  1OCO C;  3OA1 A;  1FMW A;  4I3M A;  3EHM A;  4NY3 A;  3EH1 A;  2OCC C;  1TR2 A;  1MMD A;  3E70 C;  1SMY F;  2Y69 C;  3NRH A;  4Q4Z F;  1M2V A;  2L9J A;  1M2O A;  4XTK A;  3K1I C;  3JSZ A;  4QI0 A;  3LES A;  3ZG1 A;  2FGY A;  3DAG A;  1MMA A;  4OIP F;  4G7O F;  2L81 A;  3S28 A;  1ZHY A;  3NKD A;  4YJW A;  2R7S A;  3LNR A;  1NU9 C;  4I1M A;  2WVN A;  3SZR A;  4CS9 A;  4JCH A;  4PJL A;  4CIH A;  3S29 A;  3I5P A;  1VMA A;  2CW0 F;  3VAY A;  1PCX A;  1OCR C;  5DS4 A;  3AQB A;  5T3T A;  3X1O A;  3ECS A;  4N06 A;  1MND A;  1FMV A;  1Z3I X;  5KYW A;  3M1C B;  3W8H A;  4U5D E;  3JRT A;  3DJN B;  2J9V A;  3EZH A;  2A69 F;  5E2Q A;  1ZU4 A;  1QLE C;  3FAJ A;  3QMK A;  3EJN A;  3HLZ A;  4CS8 A;  3TD7 A;  1SF8 A;  2ZXO A;  5KYN A;  3KKB A;  4DVZ A;  3UGO A;  2J0X A;  3RIP A;  5B1A C;  2YEV A;  4FX5 A;  2NUT B;  5E33 A;  1V55 C;  3MLG A;  2WVQ A;  4YT5 A;  2GFH A;  4C3B A;  3K1H A;  1J8M F;  2R7U A;  2YZS A;  4MQ9 F;  3ZVR A;  3NYJ A;  5HSW A;  4ZLC A;  4G7Z F;  2WZF A;  1S7Z A;  1O5H A;  2A1D D;  4DVY P;  5D92 A;  1VK5 A;  4BG0 A;  2Q9C A;  3K7D A;  3VYW A;  2R7X A;  1D0Z A;  3FVY A;  1QZX A;  2R7O A;  3EFO B;  4C7O A;  2PX3 A;  4E7Z A;  3DZA A;  1ZHX A;  2VAS A;  5F5F A;  3UMH A;  2Y3D A;  4JZA A;  3N24 A;  1PD0 A;  2LSE A;  4OIR F;  2DYR C;  2WL8 A;  4LAC B;  3EGD A;  2J45 A;  3CZ6 A;  2R7V A;  1TWG A;  5KYX B;  3B0U X;  2PFD A;  5DLJ A;  2B0J A;  4AE4 B;  1NG1 A;  1MNE A;  4O7G A;  2D5R B;  2W4B A;  2E87 A;  4QDL A;  4IAO A;  2C03 A;  1Z5Z A;  4KBL A;  2KQ9 A;  4H4K C;  2KNH A;  5KYU A;  2CNW D;  1ZHW A;  4LER A;  4HFF B;  4LLE A;  2HV7 A;  3E9V A;  3IEE A;  4DBQ A;  3Q6M A;  3NKE A;  4JJF A;  2HV6 A;  5B3S C;  3WOD F;  1OKK A;  2W9Y A;  5DVW A;  4KI2 A;  4GYT A;  2W4M A;  3MX3 A;  4U5H A;  4J30 B;  3SP1 A;  1ST6 A;  4ANJ A;  4U5F E;  2MYS A;  5CI8 A;  1RJ9 A;  3UMK A;  4K7B A;  1LVK A;  4BJ6 A;  1D1A A;  2DYS C;  2J7P D;  4BJ5 C;  3KMI A;  4FWV A;  4PFP A;  3ZSU A;  3EH2 A;  2IXP A;  2QY9 A;  3EHN A;  2BE5 F;  3NG1 A;  3HTK C;  2R7T A;  4ZLD A;  2PP4 A;  2A6E F;  4CS7 A;  3O6X A;  2CDQ A;  2ZXR A;  3T6J A;  2JD3 A;  3ITF A;  1JPJ A;  3EG9 A;  3AQC A;  3NYM A;  4HFK B;  2R7Q A;  3RFY A;  5EHH A;  1M2V B;  2P6V A;  1OKK D;  1TWA A;  1VYK A;  3L0I A;  3DM9 B;  2PF4 E;  2NUP A;  4OD5 A;  3Q6N A;  2OG2 A;  5T1D B;  2G3K A;  4CSA A;  3EGX A;  4G0H A;  4RDA A;  3SYN A;  4AX2 A;  3B9Q A;  3LS0 A;  1NU7 D;  4G7H F;  2EIN C;  3JCU Q;  3Q7G A;  3CSK A;  3Q7L A;  3EFO A;  1V54 C;  4HEA J;  1JPN A;  5E3A A;  1VYI A;  4JJG A;  2H7V C;  3AG2 C;  3W8I A;  3I5Q A;  1KU2 A;  3T6B A;  4PFO A;  2YHS A;  5EGY A;  3CQZ A;  3LLK A;  4X0R A;  1BR2 A;  4IJJ A;  4OD4 A;  2A6H F;  5KYY A;  4U5G A;  2XXA A;  5KYW B;  4C3D A;  4JUR I;  5CI9 A;  3DM5 A;  3OEO A;  3ABM C;  2R7W A;  3KH2 A;  1D0Y A;  3EQL F;  4WJ0 A;  5IY5 C;  3ABK C;  3DXJ F;  3B0P A;  3F47 A;  3B0V C;  4XLP F;  3JT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...