5BUOA

A receptor molecule
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
185
structure length
185
Chain Sequence
b'ENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title NULL
rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 85
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5buoA00
3NYJA 3UMIA 3K66A 3QMKA 3UMHA 3Q7LA 4RD9A 4YN0B 3NYLA 3UMKA 3PMRA 3K6BA 4RDAA 3Q7GA 1TKNA 5BUOA
chains in the Genus database with same CATH superfamily
1LVKA 3ABKC 1VK5A 1Z6AA 4JJFA 4JURI 4U9DA 2XL8A 5L0HA 1ZZPA 4LLEA 2R02A 1CGME 5DVWA 4AL1A 2WVQA 4JTDB 3MLGA 3SP1A 3UGOA 2W45A 2A0BA 2H7VC 3C63A 2NUPB 4MTFA 3WAQA 4CSAA 2KSFA 1VTMP 2G3VA 2W9YA 1OKKD 4KNVA 4PFPA 4BJ6A 3K1IA 4BPMA 4BEMJ 2XXAA 4XTKA 1QPUA 3EHNA 1ORYA 3I4UA 1OW6A 2YVKA 3G50A 1SMYF 3CQZA 5DS5A 2YZSA 3ZTZA 2XLEA 1V54C 5KYNA 4JEBA 2XM4A 2JPUA 4NTAA 5EHHA 4GEHA 3MFNA 2PFDA 1WWPA 2XM0A 1FFTC 4Q5SF 3F46A 3JYYA 4DJ9A 1ZW2A 1HW2A 1C02A 1LI5A 3VRCA 1HMOA 3ZWIA 4Z9IA 4Z9JA 2P0NA 3A9CA 1ZYRF 4PR9A 2J0WA 2J9VA 3VM6A 4B6IA 5L0JA 1JAFA 1AUEA 3EFOA 3R7CA 1T6UA 4J7TA 4MVZA 4DVZA 5A6JA 1FR0A 3EZHA 2EINC 2GFHA 4JIOA 4G0HA 1MNEA 2YLDA 2R7TA 4U5GA 3FHDA 1ZU4A 1A0BA 1G5ZA 4U5EE 3B9QA 4DRJB 4JRZA 4CS9A 2QLAA 3GANA 4DRIB 5A6BD 1LE4A 3DXJF 3GEIA 1FFHA 2WB7A 2D5RB 2ZPAA 3LEOA 3QVZA 3DJNB 1NU7D 1CGNA 3TQOA 3AG4C 2OEVA 4NCQA 1RKCA 3NRHA 3JRTA 3RYLA 5KYWB 2ZXPA 1FTSA 4QI0A 5A69A 4YL1A 4XEFA 3ZQYA 4CBEA 4IGGA 1MQVA 2AWYA 2Y39A 1IW7F 2VCCA 2IXOA 2M64A 4C3DA 3GWNA 4P6IC 3J06A 1CPQA 3CSKA 3M79A 3DAFA 2PNOA 1O5HA 3I5QA 4IAQA 5F5FA 1ORJA 2X0CA 2OG2A 2ZXWC 1HMDA 3EG9A 3NKEA 2ZXRA 1HE1A 2KYHA 3U8PA 1Q0GA 2EPKX 2FGYA 1OCZC 3C8GA 1YZCA 4LLCA 1D0YA 1Q0KA 2RSEB 3EFOB 1RCPA 1LKXA 3E9VA 4W8PA 1QSPA 1FMVA 4YT5A 3H2UA 1KU2A 1HE9A 2QE9A 3DE8A 5E3AA 4E7ZA 3EZIA 4PJJA 3M15A 3QW1A 5T3TA 5A6KA 4DBRA 1YA9A 4N6CA 1K40A 2A68F 1YDIA 3OEOA 2EPLX 4LERA 4NTBA 2IXPA 4GQHA 1UG7A 1M56C 3SNHA 3EPVA 4OD5A 2HV6A 3K6BA 4OIPF 4RDAA 2LP4A 1WASA 4O6YA 1ZHWA 2XL6A 3LLIA 1HY5A 2R25A 2VC9A 3BEHA 4G7HF 5L0CA 3WODF 2R7WA 3HNIA 3V5XA 5T1DB 2H8AA 5FZTA 1ZW3A 2W4BA 2R7QA 2Y3DA 3DZAA 2HSQA 3TK0A 3HNKA 5DQZA 5AC5A 4CS8A 1G8XA 1RMVA 1GM5A 5L0GA 3B0PA 3T4RA 4ULWA 4K7BA 5BUOA 1NFNA 3UMIA 1JOGA 5JRAA 2I15A 3LAYA 4PACA 4EBKA 3PDMP 1ZU5A 4MVUA 4EIYA 2E87A 3UGPA 2XLHA 2G62A 3NDBB 3L8IA 2ASRA 3KL4A 4CDYA 4BG0A 4BJ5A 1TWGA 1OW7A 1YA7O 5JLIA 2IXNA 1NBBA 4MTGA 1VYIA 4WGZA 4D4XA 4JTCB 5HV9A 1NG1A 4KC9A 4R32A 3VYWA 1YYXA 3DAGA 3L1MA 3AG1C 4O6MA 4KBLA 2L9JA 3ZVRA 4ULVA 5A6BA 3JYHA 4IRUA 2CNWA 4QDLA 4QI2A 2YEVA 5TJ5E 3S28A 2VH3A 4U5HA 2YL3A 3QTHA 1QZXA 3U3FA 5DLJA 2WVOA 2XLOA 4H4KC 5BQIA 2J45A 3ZDLA 2KC3A 1YZAA 2WZGA 3EGXA 1G4WR 5T3WA 3W2VA 4BEJA 1TFKB 5F28E 3ZQVA 5KYXB 1T6IA 4ONSA 2YQYA 1NZEA 4UDVA 4N6HA 2CW0F 5COFA 4CJOA 1VYKA 3RVZA 4E7SA 1Z7Qc 4X0RA 3SYNA 3T6GB 2EPMX 3JRMO 4MVMA 4OD4A 4EWCA 1E86A 1J8YF 2BE5F 3HLZA 3AGUA 3DKAA 1LIHA 4YK5A 1WOLA 3L8JA 1R5ID 2WL8A 1AVOB 1VLSA 3Q7LA 2NG1A 2Y3GA 2YWAA 3M1CB 4XEVA 3TOMA 3TULA 4MVRA 3AJMA 4KI2A 3C62A 3WG7C 3DM5A 2HMZA 3DWWA 1YAUO 3GEHA 3IEEA 3C8ZA 2O9XA 3GEEA 3EGDA 3RQEA 3U0CA 1MMGA 2CYDA 2IXMA 5CI8A 1T9KA 4D4NA 2HZ8A 3U2LA 1OCOC 1LS1A 3UMHA 1BR1A 4MVQA 1Z63A 1OXKA 2OOCA 2VCAA 3IQ5A 2L6FA 4YT2A 1LI7A 2NSFA 1NSGB 5F5HA 2R7RA 2G3KA 1E85A 3B29A 2J9BA 3FXHA 2P61A 4RD9A 2PX0A 4A2NB 4JJGA 2OKUA 3EGXB 1OCCC 1Z5ZA 4M63A 3RQFA 5KYYA 5A6AA 1JPNA 5KYUA 2KNHA 4JC7A 2L81A 1VMAA 1RKEA 2P7VA 4MW3A 2YLGA 4PJLA 1D0ZA 4MS2A 4N4WA 3UMKA 3VAYA 4Q4ZF 4OIOF 2HFIA 1KNYA 3DMDA 2Q9CA 2RD9A 5L3VA 4CSAC 1QQ3A 4EBBA 1YJGA 3TD7A 2HMQA 1Q0MA 1QKRA 3K1IC 4BJ6C 1JR8A 3ZSUA 2XXAB 5BQHA 4JKVA 3G4XA 1EI7A 2VB6A 4Q7CA 5COMA 1E83A 3TJ6A 1E84A 3K66A 3SXZA 1A7DA 4AK9A 1MMNA 1T6QA 1LPEA 5E33A 3LJBA 5EK0A 2QUPA 1GGQA 3MX3A 3GM2A 3EGDB 1YVIA 4ANJA 4I1MA 2Q00A 1M57C 2EIJC 3I5PA 4LDKA 4AX2A 1KTMA 3U3BA 4RBNA 1U6HA 2H7BA 4PJMA 2R7UA 2HUJA 1V74B 2M4EA 1JPJA 3KKBA 3Q6NA 3QW0A 3X1OA 2EPOA 2J9WA 4AE4A 4I44A 3K33A 1Q0DA 1RJ9A 4FESA 5L3QA 5CIVA 2KGOA 1BR2A 5IY5C 4CS9C 2P6VA 4W8KA 3ATPA 3W2WA 5KYUB 1TWHA 4YJWA 1RKEB 1SR2A 1D1BA 4PJNA 3SXKA 1I4YA 2OJQA 3W8IA 4HEAJ 3W8HA 2Y69C 3FOPA 5E3CA 3RFYA 3V5ZA 1TKNA 1I5NA 1B68A 2NSGA 3RKOF 1Z23A 3LLKA 2YKZA 3GM3A 2WZLA 2ZXOA 4YL3A 1XWJA 4XLNF 1R4TA 3AG2C 2XLMA 2DGJA 3HNLA 2A1DD 1MMAA 1FMWA 4L6RA 5D91A 1V4AA 3LUTB 3DM9B 4O6NA 1APCA 1Y4CA 2XLDA 1TFOB 3RIPA 1OKKA 1VOMA 3A11A 4EKWA 4U5CE 4JCZA 1ORSC 2NPUA 2C03A 3EG9B 3N2ZB 3VF0A 3E70C 2R9RB 3NMKA 3TJ5A 4YT8A 4XLPF 3FMSA 2Q9AA 3DE9A 3C8GB 1QLEC 1DOVA 1S05A 2KK1A 3AGTA 4WJ0A 4AE4B 1WGWA 1WATA 3SXMA 3B0VC 3RF3A 1RJ9B 2J7PD 1ZHXA 3ZC4A 4IARA 4J7YA 4YL0A 2AU5A 4U5BE 3DI5A 1YYJA 3W4YA 3SEOA 5JVEA 3PHF2 1SZIA 2XLVA 1HW1A 1VLTA 3ITFA 2BC5A 3ZTMA 2DYSC 3FVYA 3NYMA 2LQGA 2Y3BA 1T5OA 4NTFA 1OCRC 4CX9A 3O10A 1WTYA 4DBQA 3N0TA 2KQ9A 1ZHYA 2ETSA 5K0IA 1ZHZA 2GDCA 3G4ZA 1SYQA 5L0FA 1GS9A 1RXQA 3R2PA 3IQTA 3NYJA 1LM3B 2LIGA 3EH1A 2R7VA 2OEXA 5DS4A 3RH3A 2PP4A 2FAPB 3IHUA 3IQ6A 1H9TA 2HV7A 1XZQA 4E18A 3S90A 4NY3A 2R05A 3JT1A 4JZAA 4PFOA 4BJ1A 4CS8C 1MMDA 3S84A 5JT4A 2VASA 1M6TA 2R7OA 3U5SA 3MYFA 3PCVA 2I8BA 3Q7GA 4MVOA 2MHRA 1N1CA 2HJ3A 3LEVA 1EQ1A 4FAPB 4JVSA 2A6HF 2A6EF 5DS6A 1S7ZA 3ASOC 3UR3C 2W4MA 1W2WA 4FWVA 2WZFA 2YL7A 3T9OA 1CGOA 2IOQA 3O39A 3SXYA 3ABLC 4BJ5C 4WGYA 1K04A 4E0IA 1O3UA 4P9TA 3K1HA 2JX0A 1E2XA 1K05A 3U2MA 4EHPA 2LFDA 3AQCA 3QZCA 3US6A 1T01A 3LS1A 4U5DE 1H6GA 2CGEA 5JP7A 2D4UA 4ZLDA 2NUTA 4NC3A 2LK4A 3NMJA 1I4ZA 4K0DA 2ZD9A 3KPHA 3NG1A 3HTKC 4E0HA 5BQGA 4XPYA 3OWTA 3L34A 1A7VA 5B1AC 2R7SA 4HFFB 2HJMA 2Y3HA 4MQ9F 3ZIBA 1QVXA 2Q4FA 3O6XA 4LDQA 1JRAA 4JW1A 4MNDA 2YL1A 4Z9HA 3ZG1A 4J32B 3V5YA 3POVA 1YLMA 2B0HA 4MVSA 5KYWA 1D0XA 1U0BB 1V55C 3JZ0A 4DXWA 2EPNA 4C7OA 2LFFA 2AWCA 2HKVA 2EIMC 3FAPB 2DYRC 2YL0A 1CPRA 1TWAA 1DOWA 1PD0A 4C3BA 1FNTc 2Z15A 5AGFA 3BRJA 1A7EA 1BZ4A 2R03A 2XL4A 5CI9A 4CDAA 1ZVZA 2HS5A 5E2QA 4A4AA 3S0XA 3FAJA 1WN0A 2A0UA 4CDVA 3CEXA 1J8MF 4ER9A 3EHMA 3EQLF 4MW8A 2NUTB 3T6JA 1IZMA 4YN0B 3N24A 2DB4A 2XS8A 3OA1A 2J7PA 4JCHA 1H9GA 4XEKA 2R7XA 3TOLA 1TQGA 2CNWD 2J0XA 4U9EA 1Z3IX 3EJNA 4NQFA 1M2VA 2EILC 4C3EA 1OR3A 1NFOA 4CIPA 256BA 2UUIA 2MWQA 3JCUQ 3KYIA 1BR4A 2PBEA 2QNLA 2XSEA 1NU9C 2IM8A 3S29A 1D1AA 2XS1A 2OJED 2QTVA 3C7JA 3NMIA 4HE8D 2OU6A 1H7IA 5D92A 5FCLA 5JUAA 3LS0A 4XWJA 1LS4A 3IQCA 4I3MA 2YLIA 5KYYB 2B0JA 5B3SC 3ABMC 4C7OB 4G7OF 1F1MA 1GQAA 1TWCA 2Q3TA 1O87A 2UUHA 3QMKA 4JTAB 5JSLA 3CZ6A 2IYLD 2LSEA 1XZPA 2QY9A 3O55A 1UFBA 1PV3A 5COGA 1BDJB 2CDQA 3KYJA 3V7OA 2EIKC 1FAPB 5GPGB 1OXBA 2PX3A 2VCBA 4AL0A 3IPMO 2XLWA 4WABA 4XQ1A 3S27A 3PMRA 2J8WA 1ST6A 4XPXA 2Q7RA 5HSWA 3K7DA 4HFKB 3RVYA 2BL2A 2CCYA 3AQBA 3KMIA 3AOUA 2A69F 1EKYA 5DQTA 4KNWA 5L0IA 3U9JA 4G78A 1C17M 1OQCA 2LD6A 4OIRF 4F4BA 2C04A 2YRFA 3Q6MA 1M2VB 1SF8A 1PCXA 1Q0FA 1YARO 1G4US 2IBFA 3F47A 3H2VA 4E17A 4JEAA 4CIHA 2V26A 3X2QC 1C03A 4CS7A 2J46A 2XRHA 3CAXA 4G7ZF 3L0IA 3JTLO 5B3IA 1U89A 2L7AA 4MTOA 3LNMB 2L6GA 3GWLA 4XPWA 3WHNA 1A41A 3B71A 4O79A 3U8VA 1PD1A 3KH2A 4I1OB 4IWBA 4DRHB 3H65A 3GM1A 2HSBA 1OR2A 4N06A 2GA0A 4EUKB 2FFHA 4JE9A 3NKDA 3MYIA 1Y6DA 2X51A 3HJCA 2L6HA 3ASNC 4ZLCA 1L3PA 5KYXA 1NLXA 3DD7A 2PF4E 3AG3C 3ECSA 1JMWA 2KJGA 2Q9BA 4K1OA 4P9FA 3RQGA 5EGYA 4H54A 3SZRA 4PK4A 1TR2A 2OCCC 4U5FE 3M4CA 2NUPA 4IJJA 5JS5A 3HNJA 1LE2A 2AP3A 3LESA 3QVYA 4DOZA 3T6BA 1M2OA 2J9UA 3GODA 3JSEO 4OIQF 1BBHA 2DI3A 4LACB 3U9MA 2V3CC 4GYTA 4YT4A 1VB5A 3EH2A 1ZHTA 2P1AA 4J30B 4DVYP 2JD3A 3C8GD 3HKKA 4YWQA 3DJUB 5AC4A 3B0UX 2TMVP 1OW8A 1AEPA 2H7OA 2YHSA 4BJTA 3JSZA 2KW3C 2ICWG 3UNGC 3FDQA 2MYSA 3RW0A 3S9OA 1D1CA 3MBGA 3NYLA 2AVKA 4IB4A 1L7CA 4CJGA 4EBJA 4LDRA 2LCHA 2GAQA 3GORA 1EA8A 2F22A 2GWWA 1MNDA 2OQMA 2WVNA 4FX5A 4IAOA 5B1BC 5L0DA 3FOOA 3C18A 4OINF 3LNRA 3M4BA 4O7GA
chains in the Genus database with same CATH topology
1LVKA 3ABKC 1VK5A 1Z6AA 4JJFA 4JURI 4LLEA 5DVWA 2WVQA 3MLGA 3SP1A 3UGOA 2W45A 2H7VC 2NUPB 4CSAA 2G3VA 2W9YA 1OKKD 4KNVA 4PFPA 4BJ6A 2XXAA 4XTKA 3EHNA 3I4UA 1SMYF 3CQZA 5DS5A 2YZSA 1V54C 5KYNA 5EHHA 4GEHA 4Q5SF 2PFDA 1FFTC 3F46A 1ZYRF 2J0WA 2J9VA 4B6IA 3EFOA 4DVZA 3EZHA 2EINC 2GFHA 2R7TA 4G0HA 1MNEA 4U5GA 3FHDA 1ZU4A 4U5EE 3B9QA 4CS9A 3GANA 3DXJF 1FFHA 2WB7A 2D5RB 2ZPAA 3DJNB 1NU7D 3AG4C 3NRHA 3JRTA 3RYLA 5KYWB 2ZXPA 1FTSA 4QI0A 4CBEA 2Y39A 1IW7F 4C3DA 2IXOA 4P6IC 3CSKA 3DAFA 1O5HA 3I5QA 5F5FA 2OG2A 2ZXWC 3EG9A 3NKEA 2ZXRA 2FGYA 1OCZC 4LLCA 1D0YA 3EFOB 1LKXA 3E9VA 1FMVA 4YT5A 1KU2A 5E3AA 4E7ZA 3EZIA 4PJJA 5T3TA 4DBRA 2A68F 3OEOA 4LERA 2IXPA 3SNHA 1M56C 3EPVA 4OD5A 2HV6A 3K6BA 4OIPF 4RDAA 4O6YA 1ZHWA 3LLIA 4G7HF 3WODF 2R7WA 5T1DB 2Y3DA 2W4BA 2R7QA 3DZAA 4XLPF 5DQZA 4CS8A 1G8XA 3B0PA 3T4RA 4ULWA 4K7BA 5BUOA 3UMIA 3LAYA 1ZU5A 2E87A 3UGPA 2G62A 3NDBB 3KL4A 4BG0A 4BJ5A 1TWGA 2IXNA 1VYIA 1NG1A 3VYWA 3DAGA 3AG1C 4O6MA 4KBLA 2L9JA 3ZVRA 3JYHA 4IRUA 2CNWA 4QDLA 4QI2A 2YEVA 3S28A 2VH3A 4U5HA 5DLJA 1QZXA 2WVOA 4H4KC 2J45A 2WZGA 3EGXA 5T3WA 3W2VA 4BEJA 5KYXB 1NZEA 2CW0F 1VYKA 4E7SA 3SYNA 4X0RA 4OD4A 4EWCA 1J8YF 2BE5F 3HLZA 4KC9A 3Q7LA 2WL8A 2NG1A 2Y3GA 3M1CB 4KI2A 3WG7C 3DM5A 3IEEA 2O9XA 3EGDA 1MMGA 2IXMA 5CI8A 1OCOC 1LS1A 3UMHA 1BR1A 1Z63A 4YT2A 5F5HA 2R7RA 2G3KA 4RD9A 2PX0A 4A2NB 4JJGA 3EGXB 1OCCC 1Z5ZA 4M63A 5KYYA 1JPNA 5KYUA 2KNHA 2L81A 1VMAA 4PJLA 2P7VA 4RBNA 3UMKA 1D0ZA 4OIOF 3VAYA 4Q4ZF 3DMDA 2Q9CA 5L3VA 4CSAC 4EBBA 3TD7A 4BJ6C 3K1IC 3ZSUA 2XXAB 4Q7CA 2VB6A 3K66A 4AK9A 1MMNA 5E33A 3LJBA 3MX3A 3EGDB 4ANJA 4I1MA 1M57C 2EIJC 3I5PA 4AX2A 2H7BA 4PJMA 2R7UA 2M4EA 1JPJA 3KKBA 3Q6NA 3X1OA 2J9WA 4AE4A 4I44A 3K33A 4FESA 1RJ9A 5L3QA 2KGOA 1BR2A 5IY5C 4CS9C 2P6VA 4W8KA 3W2WA 5KYUB 1TWHA 4YJWA 1D1BA 4PJNA 3W8IA 4HEAJ 3W8HA 2Y69C 5E3CA 3RFYA 1TKNA 3RKOF 1Z23A 3LLKA 2WZLA 2ZXOA 4XLNF 3AG2C 2DGJA 2A1DD 1MMAA 1FMWA 5D91A 3DM9B 4O6NA 3RIPA 1OKKA 1VOMA 4U5CE 2C03A 3EG9B 3N2ZB 3E70C 4YT8A 2Q9AA 1QLEC 4WJ0A 4AE4B 3B0VC 1WGWA 1RJ9B 2J7PD 1ZHXA 3ZC4A 4U5BE 3SEOA 3PHF2 1SZIA 3ITFA 2DYSC 3FVYA 3NYMA 2Y3BA 1OCRC 4DBQA 3N0TA 2KQ9A 1ZHYA 1ZHZA 3NYJA 3EH1A 2R7VA 5DS4A 3RH3A 2PP4A 2HV7A 4NY3A 3JT1A 4JZAA 4PFOA 4BJ1A 4CS8C 1MMDA 2VASA 2R7OA 2I8BA 3Q7GA 1N1CA 3LEVA 4JVSA 2A6HF 2A6EF 5DS6A 1S7ZA 3ASOC 3UR3C 2W4MA 1W2WA 4FWVA 2WZFA 2IOQA 3O39A 3ABLC 4BJ5C 3K1HA 3AQCA 3QZCA 3LS1A 4U5DE 2CGEA 4ZLDA 2NUTA 4K0DA 3NG1A 3HTKC 3OWTA 3L34A 5B1AC 2R7SA 4HFFB 2Y3HA 4MQ9F 3ZIBA 4MNDA 3O6XA 4JW1A 3ZG1A 4J32B 3POVA 5KYWA 1D0XA 1V55C 4C7OA 2EIMC 2DYRC 1TWAA 1PD0A 4C3BA 2Z15A 2XL4A 5CI9A 5E2QA 3S0XA 3FAJA 1J8MF 3EHMA 3EQLF 3T6JA 2NUTB 1IZMA 4YN0B 3N24A 3OA1A 2J7PA 4JCHA 2R7XA 2CNWD 2J0XA 1Z3IX 3EJNA 4C3EA 1M2VA 2EILC 3JCUQ 2MWQA 1BR4A 2XSEA 1NU9C 3S29A 1D1AA 2QTVA 4HE8D 5D92A 5FCLA 3LS0A 4XWJA 4I3MA 5KYYB 2B0JA 5B3SC 3ABMC 4C7OB 4G7OF 2Q3TA 1TWCA 1O87A 3QMKA 3CZ6A 2IYLD 2LSEA 2QY9A 2CDQA 3V7OA 2EIKC 2PX3A 3S27A 3PMRA 1ST6A 5HSWA 3K7DA 4HFKB 3AQBA 3KMIA 2A69F 5DQTA 4KNWA 4OIRF 4F4BA 2C04A 3Q6MA 1M2VB 1SF8A 1PCXA 3F47A 4CIHA 2V26A 3X2QC 4CS7A 2J46A 2XRHA 4G7ZF 3L0IA 4O79A 1PD1A 3KH2A 4I1OB 4IWBA 3H65A 4N06A 2FFHA 3NKDA 2X51A 3HJCA 3ASNC 4ZLCA 5KYXA 3DD7A 2PF4E 3AG3C 3ECSA 2Q9BA 2KJGA 5EGYA 3SZRA 4PK4A 1TR2A 2OCCC 4U5FE 4IJJA 2NUPA 3LESA 4DOZA 3T6BA 1M2OA 2J9UA 3GODA 4OIQF 4LACB 2V3CC 4GYTA 4YT4A 3EH2A 1ZHTA 4J30B 4DVYP 2JD3A 4YWQA 3DJUB 3B0UX 2H7OA 2YHSA 4BJTA 3JSZA 2KW3C 3UNGC 3FDQA 2MYSA 1D1CA 3NYLA 2WVNA 1MNDA 4FX5A 5B1BC 4IAOA 4OINF 3LNRA 4O7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYJ A;  3UMI A;  3K66 A;  3QMK A;  3UMH A;  3Q7L A;  4RD9 A;  4YN0 B;  3NYL A;  3UMK A;  3PMR A;  3K6B A;  4RDA A;  3Q7G A;  1TKN A;  5BUO A; 
#chains in the Genus database with same CATH topology
 1LVK A;  3ABK C;  1VK5 A;  1Z6A A;  4JJF A;  4JUR I;  4U9D A;  2XL8 A;  5L0H A;  1ZZP A;  4LLE A;  2R02 A;  1CGM E;  5DVW A;  4AL1 A;  2WVQ A;  4JTD B;  3MLG A;  3SP1 A;  3UGO A;  2W45 A;  2A0B A;  2H7V C;  3C63 A;  2NUP B;  4MTF A;  3WAQ A;  4CSA A;  2KSF A;  1VTM P;  2G3V A;  2W9Y A;  1OKK D;  4KNV A;  4PFP A;  4BJ6 A;  3K1I A;  4BPM A;  4BEM J;  2XXA A;  4XTK A;  1QPU A;  3EHN A;  1ORY A;  3I4U A;  1OW6 A;  2YVK A;  3G50 A;  1SMY F;  3CQZ A;  5DS5 A;  2YZS A;  3ZTZ A;  2XLE A;  1V54 C;  5KYN A;  4JEB A;  2XM4 A;  2JPU A;  4NTA A;  5EHH A;  4GEH A;  3MFN A;  2PFD A;  1WWP A;  2XM0 A;  1FFT C;  4Q5S F;  3F46 A;  3JYY A;  4DJ9 A;  1ZW2 A;  1HW2 A;  1C02 A;  1LI5 A;  3VRC A;  1HMO A;  3ZWI A;  4Z9I A;  4Z9J A;  2P0N A;  3A9C A;  1ZYR F;  4PR9 A;  2J0W A;  2J9V A;  3VM6 A;  4B6I A;  5L0J A;  1JAF A;  1AUE A;  3EFO A;  3R7C A;  1T6U A;  4J7T A;  4MVZ A;  4DVZ A;  5A6J A;  1FR0 A;  3EZH A;  2EIN C;  2GFH A;  4JIO A;  4G0H A;  1MNE A;  2YLD A;  2R7T A;  4U5G A;  3FHD A;  1ZU4 A;  1A0B A;  1G5Z A;  4U5E E;  3B9Q A;  4DRJ B;  4JRZ A;  4CS9 A;  2QLA A;  3GAN A;  4DRI B;  5A6B D;  1LE4 A;  3DXJ F;  3GEI A;  1FFH A;  2WB7 A;  2D5R B;  2ZPA A;  3LEO A;  3QVZ A;  3DJN B;  1NU7 D;  1CGN A;  3TQO A;  3AG4 C;  2OEV A;  4NCQ A;  1RKC A;  3NRH A;  3JRT A;  3RYL A;  5KYW B;  2ZXP A;  1FTS A;  4QI0 A;  5A69 A;  4YL1 A;  4XEF A;  3ZQY A;  4CBE A;  4IGG A;  1MQV A;  2AWY A;  2Y39 A;  1IW7 F;  2VCC A;  2IXO A;  2M64 A;  4C3D A;  3GWN A;  4P6I C;  3J06 A;  1CPQ A;  3CSK A;  3M79 A;  3DAF A;  2PNO A;  1O5H A;  3I5Q A;  4IAQ A;  5F5F A;  1ORJ A;  2X0C A;  2OG2 A;  2ZXW C;  1HMD A;  3EG9 A;  3NKE A;  2ZXR A;  1HE1 A;  2KYH A;  3U8P A;  1Q0G A;  2EPK X;  2FGY A;  1OCZ C;  3C8G A;  1YZC A;  4LLC A;  1D0Y A;  1Q0K A;  2RSE B;  3EFO B;  1RCP A;  1LKX A;  3E9V A;  4W8P A;  1QSP A;  1FMV A;  4YT5 A;  3H2U A;  1KU2 A;  1HE9 A;  2QE9 A;  3DE8 A;  5E3A A;  4E7Z A;  3EZI A;  4PJJ A;  3M15 A;  3QW1 A;  5T3T A;  5A6K A;  4DBR A;  1YA9 A;  4N6C A;  1K40 A;  2A68 F;  1YDI A;  3OEO A;  2EPL X;  4LER A;  4NTB A;  2IXP A;  4GQH A;  1UG7 A;  1M56 C;  3SNH A;  3EPV A;  4OD5 A;  2HV6 A;  3K6B A;  4OIP F;  4RDA A;  2LP4 A;  1WAS A;  4O6Y A;  1ZHW A;  2XL6 A;  3LLI A;  1HY5 A;  2R25 A;  2VC9 A;  3BEH A;  4G7H F;  5L0C A;  3WOD F;  2R7W A;  3HNI A;  3V5X A;  5T1D B;  2H8A A;  5FZT A;  1ZW3 A;  2W4B A;  2R7Q A;  2Y3D A;  3DZA A;  2HSQ A;  3TK0 A;  3HNK A;  5DQZ A;  5AC5 A;  4CS8 A;  1G8X A;  1RMV A;  1GM5 A;  5L0G A;  3B0P A;  3T4R A;  4ULW A;  4K7B A;  5BUO A;  1NFN A;  3UMI A;  1JOG A;  5JRA A;  2I15 A;  3LAY A;  4PAC A;  4EBK A;  3PDM P;  1ZU5 A;  4MVU A;  4EIY A;  2E87 A;  3UGP A;  2XLH A;  2G62 A;  3NDB B;  3L8I A;  2ASR A;  3KL4 A;  4CDY A;  4BG0 A;  4BJ5 A;  1TWG A;  1OW7 A;  1YA7 O;  5JLI A;  2IXN A;  1NBB A;  4MTG A;  1VYI A;  4WGZ A;  4D4X A;  4JTC B;  5HV9 A;  1NG1 A;  4KC9 A;  4R32 A;  3VYW A;  1YYX A;  3DAG A;  3L1M A;  3AG1 C;  4O6M A;  4KBL A;  2L9J A;  3ZVR A;  4ULV A;  5A6B A;  3JYH A;  4IRU A;  2CNW A;  4QDL A;  4QI2 A;  2YEV A;  5TJ5 E;  3S28 A;  2VH3 A;  4U5H A;  2YL3 A;  3QTH A;  1QZX A;  3U3F A;  5DLJ A;  2WVO A;  2XLO A;  4H4K C;  5BQI A;  2J45 A;  3ZDL A;  2KC3 A;  1YZA A;  2WZG A;  3EGX A;  1G4W R;  5T3W A;  3W2V A;  4BEJ A;  1TFK B;  5F28 E;  3ZQV A;  5KYX B;  1T6I A;  4ONS A;  2YQY A;  1NZE A;  4UDV A;  4N6H A;  2CW0 F;  5COF A;  4CJO A;  1VYK A;  3RVZ A;  4E7S A;  1Z7Q c;  4X0R A;  3SYN A;  3T6G B;  2EPM X;  3JRM O;  4MVM A;  4OD4 A;  4EWC A;  1E86 A;  1J8Y F;  2BE5 F;  3HLZ A;  3AGU A;  3DKA A;  1LIH A;  4YK5 A;  1WOL A;  3L8J A;  1R5I D;  2WL8 A;  1AVO B;  1VLS A;  3Q7L A;  2NG1 A;  2Y3G A;  2YWA A;  3M1C B;  4XEV A;  3TOM A;  3TUL A;  4MVR A;  3AJM A;  4KI2 A;  3C62 A;  3WG7 C;  3DM5 A;  2HMZ A;  3DWW A;  1YAU O;  3GEH A;  3IEE A;  3C8Z A;  2O9X A;  3GEE A;  3EGD A;  3RQE A;  3U0C A;  1MMG A;  2CYD A;  2IXM A;  5CI8 A;  1T9K A;  4D4N A;  2HZ8 A;  3U2L A;  1OCO C;  1LS1 A;  3UMH A;  1BR1 A;  4MVQ A;  1Z63 A;  1OXK A;  2OOC A;  2VCA A;  3IQ5 A;  2L6F A;  4YT2 A;  1LI7 A;  2NSF A;  1NSG B;  5F5H A;  2R7R A;  2G3K A;  1E85 A;  3B29 A;  2J9B A;  3FXH A;  2P61 A;  4RD9 A;  2PX0 A;  4A2N B;  4JJG A;  2OKU A;  3EGX B;  1OCC C;  1Z5Z A;  4M63 A;  3RQF A;  5KYY A;  5A6A A;  1JPN A;  5KYU A;  2KNH A;  4JC7 A;  2L81 A;  1VMA A;  1RKE A;  2P7V A;  4MW3 A;  2YLG A;  4PJL A;  1D0Z A;  4MS2 A;  4N4W A;  3UMK A;  3VAY A;  4Q4Z F;  4OIO F;  2HFI A;  1KNY A;  3DMD A;  2Q9C A;  2RD9 A;  5L3V A;  4CSA C;  1QQ3 A;  4EBB A;  1YJG A;  3TD7 A;  2HMQ A;  1Q0M A;  1QKR A;  3K1I C;  4BJ6 C;  1JR8 A;  3ZSU A;  2XXA B;  5BQH A;  4JKV A;  3G4X A;  1EI7 A;  2VB6 A;  4Q7C A;  5COM A;  1E83 A;  3TJ6 A;  1E84 A;  3K66 A;  3SXZ A;  1A7D A;  4AK9 A;  1MMN A;  1T6Q A;  1LPE A;  5E33 A;  3LJB A;  5EK0 A;  2QUP A;  1GGQ A;  3MX3 A;  3GM2 A;  3EGD B;  1YVI A;  4ANJ A;  4I1M A;  2Q00 A;  1M57 C;  2EIJ C;  3I5P A;  4LDK A;  4AX2 A;  1KTM A;  3U3B A;  4RBN A;  1U6H A;  2H7B A;  4PJM A;  2R7U A;  2HUJ A;  1V74 B;  2M4E A;  1JPJ A;  3KKB A;  3Q6N A;  3QW0 A;  3X1O A;  2EPO A;  2J9W A;  4AE4 A;  4I44 A;  3K33 A;  1Q0D A;  1RJ9 A;  4FES A;  5L3Q A;  5CIV A;  2KGO A;  1BR2 A;  5IY5 C;  4CS9 C;  2P6V A;  4W8K A;  3ATP A;  3W2W A;  5KYU B;  1TWH A;  4YJW A;  1RKE B;  1SR2 A;  1D1B A;  4PJN A;  3SXK A;  1I4Y A;  2OJQ A;  3W8I A;  4HEA J;  3W8H A;  2Y69 C;  3FOP A;  5E3C A;  3RFY A;  3V5Z A;  1TKN A;  1I5N A;  1B68 A;  2NSG A;  3RKO F;  1Z23 A;  3LLK A;  2YKZ A;  3GM3 A;  2WZL A;  2ZXO A;  4YL3 A;  1XWJ A;  4XLN F;  1R4T A;  3AG2 C;  2XLM A;  2DGJ A;  3HNL A;  2A1D D;  1MMA A;  1FMW A;  4L6R A;  5D91 A;  1V4A A;  3LUT B;  3DM9 B;  4O6N A;  1APC A;  1Y4C A;  2XLD A;  1TFO B;  3RIP A;  1OKK A;  1VOM A;  3A11 A;  4EKW A;  4U5C E;  4JCZ A;  1ORS C;  2NPU A;  2C03 A;  3EG9 B;  3N2Z B;  3VF0 A;  3E70 C;  2R9R B;  3NMK A;  3TJ5 A;  4YT8 A;  4XLP F;  3FMS A;  2Q9A A;  3DE9 A;  3C8G B;  1QLE C;  1DOV A;  1S05 A;  2KK1 A;  3AGT A;  4WJ0 A;  4AE4 B;  1WGW A;  1WAT A;  3SXM A;  3B0V C;  3RF3 A;  1RJ9 B;  2J7P D;  1ZHX A;  3ZC4 A;  4IAR A;  4J7Y A;  4YL0 A;  2AU5 A;  4U5B E;  3DI5 A;  1YYJ A;  3W4Y A;  3SEO A;  5JVE A;  3PHF 2;  1SZI A;  2XLV A;  1HW1 A;  1VLT A;  3ITF A;  2BC5 A;  3ZTM A;  2DYS C;  3FVY A;  3NYM A;  2LQG A;  2Y3B A;  1T5O A;  4NTF A;  1OCR C;  4CX9 A;  3O10 A;  1WTY A;  4DBQ A;  3N0T A;  2KQ9 A;  1ZHY A;  2ETS A;  5K0I A;  1ZHZ A;  2GDC A;  3G4Z A;  1SYQ A;  5L0F A;  1GS9 A;  1RXQ A;  3R2P A;  3IQT A;  3NYJ A;  1LM3 B;  2LIG A;  3EH1 A;  2R7V A;  2OEX A;  5DS4 A;  3RH3 A;  2PP4 A;  2FAP B;  3IHU A;  3IQ6 A;  1H9T A;  2HV7 A;  1XZQ A;  4E18 A;  3S90 A;  4NY3 A;  2R05 A;  3JT1 A;  4JZA A;  4PFO A;  4BJ1 A;  4CS8 C;  1MMD A;  3S84 A;  5JT4 A;  2VAS A;  1M6T A;  2R7O A;  3U5S A;  3MYF A;  3PCV A;  2I8B A;  3Q7G A;  4MVO A;  2MHR A;  1N1C A;  2HJ3 A;  3LEV A;  1EQ1 A;  4FAP B;  4JVS A;  2A6H F;  2A6E F;  5DS6 A;  1S7Z A;  3ASO C;  3UR3 C;  2W4M A;  1W2W A;  4FWV A;  2WZF A;  2YL7 A;  3T9O A;  1CGO A;  2IOQ A;  3O39 A;  3SXY A;  3ABL C;  4BJ5 C;  4WGY A;  1K04 A;  4E0I A;  1O3U A;  4P9T A;  3K1H A;  2JX0 A;  1E2X A;  1K05 A;  3U2M A;  4EHP A;  2LFD A;  3AQC A;  3QZC A;  3US6 A;  1T01 A;  3LS1 A;  4U5D E;  1H6G A;  2CGE A;  5JP7 A;  2D4U A;  4ZLD A;  2NUT A;  4NC3 A;  2LK4 A;  3NMJ A;  1I4Z A;  4K0D A;  2ZD9 A;  3KPH A;  3NG1 A;  3HTK C;  4E0H A;  5BQG A;  4XPY A;  3OWT A;  3L34 A;  1A7V A;  5B1A C;  2R7S A;  4HFF B;  2HJM A;  2Y3H A;  4MQ9 F;  3ZIB A;  1QVX A;  2Q4F A;  3O6X A;  4LDQ A;  1JRA A;  4JW1 A;  4MND A;  2YL1 A;  4Z9H A;  3ZG1 A;  4J32 B;  3V5Y A;  3POV A;  1YLM A;  2B0H A;  4MVS A;  5KYW A;  1D0X A;  1U0B B;  1V55 C;  3JZ0 A;  4DXW A;  2EPN A;  4C7O A;  2LFF A;  2AWC A;  2HKV A;  2EIM C;  3FAP B;  2DYR C;  2YL0 A;  1CPR A;  1TWA A;  1DOW A;  1PD0 A;  4C3B A;  1FNT c;  2Z15 A;  5AGF A;  3BRJ A;  1A7E A;  1BZ4 A;  2R03 A;  2XL4 A;  5CI9 A;  4CDA A;  1ZVZ A;  2HS5 A;  5E2Q A;  4A4A A;  3S0X A;  3FAJ A;  1WN0 A;  2A0U A;  4CDV A;  3CEX A;  1J8M F;  4ER9 A;  3EHM A;  3EQL F;  4MW8 A;  2NUT B;  3T6J A;  1IZM A;  4YN0 B;  3N24 A;  2DB4 A;  2XS8 A;  3OA1 A;  2J7P A;  4JCH A;  1H9G A;  4XEK A;  2R7X A;  3TOL A;  1TQG A;  2CNW D;  2J0X A;  4U9E A;  1Z3I X;  3EJN A;  4NQF A;  1M2V A;  2EIL C;  4C3E A;  1OR3 A;  1NFO A;  4CIP A;  256B A;  2UUI A;  2MWQ A;  3JCU Q;  3KYI A;  1BR4 A;  2PBE A;  2QNL A;  2XSE A;  1NU9 C;  2IM8 A;  3S29 A;  1D1A A;  2XS1 A;  2OJE D;  2QTV A;  3C7J A;  3NMI A;  4HE8 D;  2OU6 A;  1H7I A;  5D92 A;  5FCL A;  5JUA A;  3LS0 A;  4XWJ A;  1LS4 A;  3IQC A;  4I3M A;  2YLI A;  5KYY B;  2B0J A;  5B3S C;  3ABM C;  4C7O B;  4G7O F;  1F1M A;  1GQA A;  1TWC A;  2Q3T A;  1O87 A;  2UUH A;  3QMK A;  4JTA B;  5JSL A;  3CZ6 A;  2IYL D;  2LSE A;  1XZP A;  2QY9 A;  3O55 A;  1UFB A;  1PV3 A;  5COG A;  1BDJ B;  2CDQ A;  3KYJ A;  3V7O A;  2EIK C;  1FAP B;  5GPG B;  1OXB A;  2PX3 A;  2VCB A;  4AL0 A;  3IPM O;  2XLW A;  4WAB A;  4XQ1 A;  3S27 A;  3PMR A;  2J8W A;  1ST6 A;  4XPX A;  2Q7R A;  5HSW A;  3K7D A;  4HFK B;  3RVY A;  2BL2 A;  2CCY A;  3AQB A;  3KMI A;  3AOU A;  2A69 F;  1EKY A;  5DQT A;  4KNW A;  5L0I A;  3U9J A;  4G78 A;  1C17 M;  1OQC A;  2LD6 A;  4OIR F;  4F4B A;  2C04 A;  2YRF A;  3Q6M A;  1M2V B;  1SF8 A;  1PCX A;  1Q0F A;  1YAR O;  1G4U S;  2IBF A;  3F47 A;  3H2V A;  4E17 A;  4JEA A;  4CIH A;  2V26 A;  3X2Q C;  1C03 A;  4CS7 A;  2J46 A;  2XRH A;  3CAX A;  4G7Z F;  3L0I A;  3JTL O;  5B3I A;  1U89 A;  2L7A A;  4MTO A;  3LNM B;  2L6G A;  3GWL A;  4XPW A;  3WHN A;  1A41 A;  3B71 A;  4O79 A;  3U8V A;  1PD1 A;  3KH2 A;  4I1O B;  4IWB A;  4DRH B;  3H65 A;  3GM1 A;  2HSB A;  1OR2 A;  4N06 A;  2GA0 A;  4EUK B;  2FFH A;  4JE9 A;  3NKD A;  3MYI A;  1Y6D A;  2X51 A;  3HJC A;  2L6H A;  3ASN C;  4ZLC A;  1L3P A;  5KYX A;  1NLX A;  3DD7 A;  2PF4 E;  3AG3 C;  3ECS A;  1JMW A;  2KJG A;  2Q9B A;  4K1O A;  4P9F A;  3RQG A;  5EGY A;  4H54 A;  3SZR A;  4PK4 A;  1TR2 A;  2OCC C;  4U5F E;  3M4C A;  2NUP A;  4IJJ A;  5JS5 A;  3HNJ A;  1LE2 A;  2AP3 A;  3LES A;  3QVY A;  4DOZ A;  3T6B A;  1M2O A;  2J9U A;  3GOD A;  3JSE O;  4OIQ F;  1BBH A;  2DI3 A;  4LAC B;  3U9M A;  2V3C C;  4GYT A;  4YT4 A;  1VB5 A;  3EH2 A;  1ZHT A;  2P1A A;  4J30 B;  4DVY P;  2JD3 A;  3C8G D;  3HKK A;  4YWQ A;  3DJU B;  5AC4 A;  3B0U X;  2TMV P;  1OW8 A;  1AEP A;  2H7O A;  2YHS A;  4BJT A;  3JSZ A;  2KW3 C;  2ICW G;  3UNG C;  3FDQ A;  2MYS A;  3RW0 A;  3S9O A;  1D1C A;  3MBG A;  3NYL A;  2AVK A;  4IB4 A;  1L7C A;  4CJG A;  4EBJ A;  4LDR A;  2LCH A;  2GAQ A;  3GOR A;  1EA8 A;  2F22 A;  2GWW A;  1MND A;  2OQM A;  2WVN A;  4FX5 A;  4IAO A;  5B1B C;  5L0D A;  3FOO A;  3C18 A;  4OIN F;  3LNR A;  3M4B A;  4O7G A; 
#chains in the Genus database with same CATH homology
 1LVK A;  3ABK C;  1VK5 A;  1Z6A A;  4JJF A;  4JUR I;  4LLE A;  5DVW A;  2WVQ A;  3MLG A;  3SP1 A;  3UGO A;  2W45 A;  2H7V C;  2NUP B;  4CSA A;  2G3V A;  2W9Y A;  1OKK D;  4KNV A;  4PFP A;  4BJ6 A;  2XXA A;  4XTK A;  3EHN A;  3I4U A;  1SMY F;  3CQZ A;  5DS5 A;  2YZS A;  1V54 C;  5KYN A;  5EHH A;  4GEH A;  4Q5S F;  2PFD A;  1FFT C;  3F46 A;  1ZYR F;  2J0W A;  2J9V A;  4B6I A;  3EFO A;  4DVZ A;  3EZH A;  2EIN C;  2GFH A;  2R7T A;  4G0H A;  1MNE A;  4U5G A;  3FHD A;  1ZU4 A;  4U5E E;  3B9Q A;  4CS9 A;  3GAN A;  3DXJ F;  1FFH A;  2WB7 A;  2D5R B;  2ZPA A;  3DJN B;  1NU7 D;  3AG4 C;  3NRH A;  3JRT A;  3RYL A;  5KYW B;  2ZXP A;  1FTS A;  4QI0 A;  4CBE A;  2Y39 A;  1IW7 F;  4C3D A;  2IXO A;  4P6I C;  3CSK A;  3DAF A;  1O5H A;  3I5Q A;  5F5F A;  2OG2 A;  2ZXW C;  3EG9 A;  3NKE A;  2ZXR A;  2FGY A;  1OCZ C;  4LLC A;  1D0Y A;  3EFO B;  1LKX A;  3E9V A;  1FMV A;  4YT5 A;  1KU2 A;  5E3A A;  4E7Z A;  3EZI A;  4PJJ A;  5T3T A;  4DBR A;  2A68 F;  3OEO A;  4LER A;  2IXP A;  3SNH A;  1M56 C;  3EPV A;  4OD5 A;  2HV6 A;  3K6B A;  4OIP F;  4RDA A;  4O6Y A;  1ZHW A;  3LLI A;  4G7H F;  3WOD F;  2R7W A;  5T1D B;  2Y3D A;  2W4B A;  2R7Q A;  3DZA A;  4XLP F;  5DQZ A;  4CS8 A;  1G8X A;  3B0P A;  3T4R A;  4ULW A;  4K7B A;  5BUO A;  3UMI A;  3LAY A;  1ZU5 A;  2E87 A;  3UGP A;  2G62 A;  3NDB B;  3KL4 A;  4BG0 A;  4BJ5 A;  1TWG A;  2IXN A;  1VYI A;  1NG1 A;  3VYW A;  3DAG A;  3AG1 C;  4O6M A;  4KBL A;  2L9J A;  3ZVR A;  3JYH A;  4IRU A;  2CNW A;  4QDL A;  4QI2 A;  2YEV A;  3S28 A;  2VH3 A;  4U5H A;  5DLJ A;  1QZX A;  2WVO A;  4H4K C;  2J45 A;  2WZG A;  3EGX A;  5T3W A;  3W2V A;  4BEJ A;  5KYX B;  1NZE A;  2CW0 F;  1VYK A;  4E7S A;  3SYN A;  4X0R A;  4OD4 A;  4EWC A;  1J8Y F;  2BE5 F;  3HLZ A;  4KC9 A;  3Q7L A;  2WL8 A;  2NG1 A;  2Y3G A;  3M1C B;  4KI2 A;  3WG7 C;  3DM5 A;  3IEE A;  2O9X A;  3EGD A;  1MMG A;  2IXM A;  5CI8 A;  1OCO C;  1LS1 A;  3UMH A;  1BR1 A;  1Z63 A;  4YT2 A;  5F5H A;  2R7R A;  2G3K A;  4RD9 A;  2PX0 A;  4A2N B;  4JJG A;  3EGX B;  1OCC C;  1Z5Z A;  4M63 A;  5KYY A;  1JPN A;  5KYU A;  2KNH A;  2L81 A;  1VMA A;  4PJL A;  2P7V A;  4RBN A;  3UMK A;  1D0Z A;  4OIO F;  3VAY A;  4Q4Z F;  3DMD A;  2Q9C A;  5L3V A;  4CSA C;  4EBB A;  3TD7 A;  4BJ6 C;  3K1I C;  3ZSU A;  2XXA B;  4Q7C A;  2VB6 A;  3K66 A;  4AK9 A;  1MMN A;  5E33 A;  3LJB A;  3MX3 A;  3EGD B;  4ANJ A;  4I1M A;  1M57 C;  2EIJ C;  3I5P A;  4AX2 A;  2H7B A;  4PJM A;  2R7U A;  2M4E A;  1JPJ A;  3KKB A;  3Q6N A;  3X1O A;  2J9W A;  4AE4 A;  4I44 A;  3K33 A;  4FES A;  1RJ9 A;  5L3Q A;  2KGO A;  1BR2 A;  5IY5 C;  4CS9 C;  2P6V A;  4W8K A;  3W2W A;  5KYU B;  1TWH A;  4YJW A;  1D1B A;  4PJN A;  3W8I A;  4HEA J;  3W8H A;  2Y69 C;  5E3C A;  3RFY A;  1TKN A;  3RKO F;  1Z23 A;  3LLK A;  2WZL A;  2ZXO A;  4XLN F;  3AG2 C;  2DGJ A;  2A1D D;  1MMA A;  1FMW A;  5D91 A;  3DM9 B;  4O6N A;  3RIP A;  1OKK A;  1VOM A;  4U5C E;  2C03 A;  3EG9 B;  3N2Z B;  3E70 C;  4YT8 A;  2Q9A A;  1QLE C;  4WJ0 A;  4AE4 B;  3B0V C;  1WGW A;  1RJ9 B;  2J7P D;  1ZHX A;  3ZC4 A;  4U5B E;  3SEO A;  3PHF 2;  1SZI A;  3ITF A;  2DYS C;  3FVY A;  3NYM A;  2Y3B A;  1OCR C;  4DBQ A;  3N0T A;  2KQ9 A;  1ZHY A;  1ZHZ A;  3NYJ A;  3EH1 A;  2R7V A;  5DS4 A;  3RH3 A;  2PP4 A;  2HV7 A;  4NY3 A;  3JT1 A;  4JZA A;  4PFO A;  4BJ1 A;  4CS8 C;  1MMD A;  2VAS A;  2R7O A;  2I8B A;  3Q7G A;  1N1C A;  3LEV A;  4JVS A;  2A6H F;  2A6E F;  5DS6 A;  1S7Z A;  3ASO C;  3UR3 C;  2W4M A;  1W2W A;  4FWV A;  2WZF A;  2IOQ A;  3O39 A;  3ABL C;  4BJ5 C;  3K1H A;  3AQC A;  3QZC A;  3LS1 A;  4U5D E;  2CGE A;  4ZLD A;  2NUT A;  4K0D A;  3NG1 A;  3HTK C;  3OWT A;  3L34 A;  5B1A C;  2R7S A;  4HFF B;  2Y3H A;  4MQ9 F;  3ZIB A;  4MND A;  3O6X A;  4JW1 A;  3ZG1 A;  4J32 B;  3POV A;  5KYW A;  1D0X A;  1V55 C;  4C7O A;  2EIM C;  2DYR C;  1TWA A;  1PD0 A;  4C3B A;  2Z15 A;  2XL4 A;  5CI9 A;  5E2Q A;  3S0X A;  3FAJ A;  1J8M F;  3EHM A;  3EQL F;  3T6J A;  2NUT B;  1IZM A;  4YN0 B;  3N24 A;  3OA1 A;  2J7P A;  4JCH A;  2R7X A;  2CNW D;  2J0X A;  1Z3I X;  3EJN A;  4C3E A;  1M2V A;  2EIL C;  3JCU Q;  2MWQ A;  1BR4 A;  2XSE A;  1NU9 C;  3S29 A;  1D1A A;  2QTV A;  4HE8 D;  5D92 A;  5FCL A;  3LS0 A;  4XWJ A;  4I3M A;  5KYY B;  2B0J A;  5B3S C;  3ABM C;  4C7O B;  4G7O F;  2Q3T A;  1TWC A;  1O87 A;  3QMK A;  3CZ6 A;  2IYL D;  2LSE A;  2QY9 A;  2CDQ A;  3V7O A;  2EIK C;  2PX3 A;  3S27 A;  3PMR A;  1ST6 A;  5HSW A;  3K7D A;  4HFK B;  3AQB A;  3KMI A;  2A69 F;  5DQT A;  4KNW A;  4OIR F;  4F4B A;  2C04 A;  3Q6M A;  1M2V B;  1SF8 A;  1PCX A;  3F47 A;  4CIH A;  2V26 A;  3X2Q C;  4CS7 A;  2J46 A;  2XRH A;  4G7Z F;  3L0I A;  4O79 A;  1PD1 A;  3KH2 A;  4I1O B;  4IWB A;  3H65 A;  4N06 A;  2FFH A;  3NKD A;  2X51 A;  3HJC A;  3ASN C;  4ZLC A;  5KYX A;  3DD7 A;  2PF4 E;  3AG3 C;  3ECS A;  2Q9B A;  2KJG A;  5EGY A;  3SZR A;  4PK4 A;  1TR2 A;  2OCC C;  4U5F E;  4IJJ A;  2NUP A;  3LES A;  4DOZ A;  3T6B A;  1M2O A;  2J9U A;  3GOD A;  4OIQ F;  4LAC B;  2V3C C;  4GYT A;  4YT4 A;  3EH2 A;  1ZHT A;  4J30 B;  4DVY P;  2JD3 A;  4YWQ A;  3DJU B;  3B0U X;  2H7O A;  2YHS A;  4BJT A;  3JSZ A;  2KW3 C;  3UNG C;  3FDQ A;  2MYS A;  1D1C A;  3NYL A;  2WVN A;  1MND A;  4FX5 A;  5B1B C;  4IAO A;  4OIN F;  3LNR A;  4O7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...