5BUOA

A receptor molecule
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
185
structure length
185
Chain Sequence
ENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Amyloid beta A4 protein
publication title NULL
rcsb
source organism Homo sapiens
total genus 85
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5buoA00
3K6BA 3UMKA 4RDAA 3Q7LA 3NYLA 3UMHA 3NYJA 1TKNA 3UMIA 3PMRA 3QMKA 4RD9A 5BUOA 4YN0B 3K66A 3Q7GA
chains in the Genus database with same CATH superfamily
3EFOA 2WVNA 3KMIA 2BC5A 1SMYF 4MTFA 3EGXA 1WTYA 3FAPB 2R7UA 3LS0A 4U5EE 3N2ZB 3T4RA 1A7VA 3MYIA 1TR2A 3DM9B 2GA0A 2P6VA 3NKDA 4BEJA 1XZQA 2B0JA 2YWAA 4U5DE 5BQGA 2CGEA 4MVZA 2IBFA 4JKVA 1V74B 2EPLX 3U2LA 3ZSUA 3AG3C 1U6HA 3HJCA 1YARO 4MW8A 4N6HA 4CIHA 5T1DB 2R7XA 3L8JA 3NYLA 1OCCC 1NG1A 4PK4A 4E18A 2IYLD 3DZAA 1KTMA 1U0BB 2IXMA 3GEEA 4LDQA 2XLOA 4JTCB 4IB4A 2HV6A 4YK5A 1MQVA 4AE4B 4BJTA 4YT4A 2VCBA 3EG9A 3O39A 1QSPA 3FDQA 2XRHA 2XL8A 4A2NB 3HTKC 4D4XA 4JZAA 1F1MA 1KNYA 1SF8A 2ASRA 4LERA 3DMDA 3MX3A 1L3PA 1A7EA 1C17M 5KYNA 4LLCA 4CIPA 2GDCA 2P1AA 5DQZA 2QTVA 2J9BA 4JJGA 2HJMA 2Z15A 3RYLA 2A6EF 2LK4A 2L6FA 4MVMA 3M4BA 3X1OA 5EHHA 1Z23A 1ZYRF 4OIQF 4NTBA 2OKUA 2ZXRA 1GQAA 5JP7A 4CBEA 3WHNA 4ULWA 2J45A 3ABKC 3OA1A 4P9TA 2YL1A 3VRCA 2JD3A 3ZQYA 4XLPF 4QDLA 1VYIA 3FXHA 4C3BA 3RVZA 3SZRA 4DBQA 4J7YA 1FAPB 1E83A 1VTMP 3V5XA 1EKYA 1W2WA 1Q0FA 1VMAA 2CCYA 2BL2A 4M63A 5EK0A 1SR2A 4WABA 1WWPA 4JTDB 3NMIA 3K1HA 5KYXA 2XXAB 3TJ5A 2LFFA 4CJOA 1JPJA 4O6YA 4EKWA 5A69A 1S7ZA 4GEHA 1J8MF 2UUIA 4O7GA 1TWCA 2PF4E 4PR9A 1M6TA 5E3AA 1T6QA 4A4AA 4JW1A 2Y69C 3RKOF 5K0IA 2JX0A 5DQTA 2P7VA 3IEEA 3DKAA 3LEVA 2HUJA 2EPKX 3S28A 5L0CA 1RJ9A 1I4YA 4F4BA 2AWCA 3O6XA 4U5HA 4CX9A 4IWBA 2YKZA 1G5ZA 3EHMA 4JEAA 3TQOA 5JT4A 2XSEA 4OD4A 3H65A 3EGDA 2OG2A 1NBBA 1LPEA 2Y39A 3EH2A 4JE9A 3U8PA 4DJ9A 5DS6A 1LI5A 2XLHA 3AGUA 4NC3A 1H6GA 4ER9A 2R05A 4MVOA 2AWYA 5A6JA 1RXQA 1MMAA 2XLVA 1E2XA 2ZXPA 3M15A 4OIPF 1O3UA 4DXWA 2ETSA 2OCCC 2FGYA 4YWQA 4NY3A 4U5GA 4BJ6A 2YLDA 3H2VA 2NSFA 2VCAA 5DLJA 2HJ3A 1AEPA 4K7BA 3SNHA 1WOLA 2YLIA 3QZCA 3I5PA 3QW0A 4LACB 2HSQA 3W8HA 1V54C 3K66A 1SYQA 2HMQA 4YT5A 3UMHA 2KGOA 3ASOC 4FAPB 2AP3A 1E85A 3B0VC 1JMWA 5AC4A 5L0FA 1ZU5A 5GPGB 4DBRA 2Q3TA 1EQ1A 1HE9A 3QVYA 1ST6A 1G4WR 3V5YA 4CSAA 1O5HA 4J7TA 3SYNA 2WZGA 5KYYA 4PJMA 4Q7CA 4G78A 1K40A 2X51A 2X0CA 3LLKA 4CS8A 2IXOA 1RCPA 4JVSA 4WGZA 1GS9A 1YYXA 2EIKC 1T9KA 4JJFA 2Q9CA 2DI3A 4I44A 3GM3A 3RIPA 3NYJA 1UFBA 2J0WA 3NMKA 5JVEA 1I4ZA 3S9OA 1T6UA 3C8GA 3KH2A 1B68A 1YVIA 1Z3IX 3JSZA 4BJ5A 1XZPA 5T3TA 3DWWA 1CGME 4RDAA 3L0IA 3GM1A 5A6BD 3A9CA 1Q0KA 4MS2A 4OINF 2HMZA 2J0XA 5KYWA 1FNTc 3AOUA 1YZAA 3E70C 2R7SA 5AC5A 3DAFA 3FVYA 3G4XA 4KNWA 4CSAC 4OIOF 1CPRA 2RSEB 3LJBA 4XTKA 1M2OA 1VLSA 1ZZPA 5E33A 1TWAA 3LEOA 2H8AA 3ZVRA 1TFOB 2XM0A 2Y3HA 3HLZA 2A6HF 2J7PD 2R9RB 1N1CA 2XLMA 3MBGA 4GYTA 3TOLA 3X2QC 1D0ZA 3EH1A 3ZIBA 4CS8C 4DRIB 3HNJA 2GAQA 1I5NA 2HFIA 1LE2A 3LS1A 5A6KA 2OEVA 4U9EA 1E84A 3S90A 3IQ5A 3GWLA 4JCZA 4HE8D 2QY9A 4WJ0A 1DOWA 3T6GB 4LDKA 4BJ5C 2A0BA 2Q4FA 3KYIA 3ZWIA 3AGTA 3OWTA 4NQFA 4W8PA 4XQ1A 3AG1C 2J9WA 4IRUA 1PD1A 4O79A 3C8ZA 4C7OB 5BQIA 2OQMA 4WGYA 1M2VA 3VF0A 1AVOB 3JYYA 1A0BA 4ZLDA 3M4CA 1NU7D 3FMSA 2I15A 5L3VA 2ICWG 3SXKA 3TULA 1OR3A 2W45A 1HY5A 2H7VC 4U9DA 3DXJF 4JRZA 4E0IA 1D1BA 3NG1A 4NCQA 2CNWA 5T3WA 2WZLA 3U9JA 4MVRA 2XXAA 2G3KA 2P61A 1HE1A 1TKNA 2OU6A 2Y3GA 4U5BE 3DAGA 3GEIA 4DRHB 3K7DA 1LI7A 2XL4A 2H7BA 4I1OB 4PACA 4U5CE 3SEOA 3ZTZA 2R7QA 3Q7LA 4EUKB 3KL4A 4DOZA 3R7CA 2L7AA 2OJQA 4XEKA 2IXPA 3EFOB 4O6NA 3PCVA 3DD7A 4MVUA 1OW7A 3J06A 1SZIA 3EGXB 3IQCA 4QI2A 3OEOA 2NG1A 2YL0A 3JSEO 3K6BA 3KYJA 4L6RA 4PJLA 3IQTA 4H4KC 4BG0A 3US6A 3LESA 1QQ3A 2G3VA 2ZD9A 5HV9A 1ZHTA 3F47A 3DE8A 1O87A 2KJGA 3E9VA 1ORYA 2R25A 2RD9A 4MVQA 1ZHZA 2J7PA 5JRAA 1LKXA 4MQ9F 2J46A 3EZHA 3LLIA 3RQEA 5L0GA 1C02A 4CS9A 4N4WA 3ITFA 3UMKA 1GGQA 1Q0GA 5JSLA 4IAQA 4JC7A 2R7WA 3LUTB 4ONSA 4J30B 4PFPA 4XPYA 1VYKA 1QZXA 2CW0F 2IM8A 3QTHA 3HKKA 2WL8A 1EA8A 1BBHA 2L6GA 5FCLA 4YT2A 1D1CA 1K04A 2Q9AA 4C3EA 1A41A 3ATPA 3V7OA 3UR3C 2YHSA 2A68F 3EHNA 4G7ZF 1LM3B 1Z5ZA 1MMGA 3AG4C 1LS4A 1KU2A 2YL3A 3M1CB 2J9UA 3W8IA 3ZTMA 1NSGB 3NMJA 4EBKA 3F46A 1QKRA 2XL6A 3S27A 4B6IA 3BRJA 1JRAA 1JOGA 3JZ0A 1Z6AA 3RQFA 3U3BA 4XWJA 1CGNA 3I4UA 5F28E 4NTAA 1V4AA 2FFHA 3W2VA 1NFOA 2Q00A 4CS9C 3V5ZA 2CDQA 3PHF2 1IW7F 5KYXB 5F5FA 1JPNA 2B0HA 4LDRA 4DVYP 1J8YF 1WGWA 2HZ8A 3NRHA 4ULVA 3LNMB 5CI9A 1NFNA 1T5OA 1Y6DA 2WB7A 1FTSA 1RKEA 1D0XA 1ZW3A 3ECSA 2ZPAA 4JTAB 4XPXA 4UDVA 3R2PA 4DVZA 5COGA 3ABMC 5JLIA 1QVXA 1Z7Qc 1VOMA 1RJ9B 2AU5A 2LCHA 4FX5A 4I3MA 1MMDA 4N6CA 1APCA 1YJGA 3Q6NA 4C3DA 4BJ6C 1LIHA 3TJ6A 2PP4A 1BR2A 2J9VA 4CDYA 3EGDB 1LE4A 1R5ID 4KI2A 4K1OA 1Z63A 1PCXA 3TD7A 4RD9A 3N0TA 2EPOA 4AK9A 3L34A 2YEVA 3A11A 3U5SA 1JR8A 2FAPB 3BEHA 1OW6A 3W4YA 1VB5A 2A0UA 5BUOA 1ZVZA 3NKEA 4P9FA 1D0YA 1K05A 1G4US 3EQLF 4HFKB 1G8XA 2NUTB 5TJ5E 2EILC 5DS5A 1GM5A 1AUEA 1T01A 3L1MA 4C7OA 1BR1A 1ZHXA 1NZEA 3K33A 3PMRA 1HW2A 5COMA 4IAOA 5KYUB 5COFA 3ABLC 1JAFA 2EIMC 2M4EA 5L0DA 3B9QA 2OEXA 1H9GA 1QPUA 4OD5A 4DRJB 4CJGA 4AE4A 1TWGA 4H54A 5L0HA 2LSEA 1WASA 2LQGA 4EBJA 5A6AA 2DYSC 3VM6A 4KBLA 1CPQA 3DE9A 4P6IC 3FOOA 2YRFA 5JUAA 1A7DA 3G50A 1M56C 5DVWA 2VCCA 1IZMA 3JRMO 2W4BA 2C03A 4N06A 2LFDA 4MTOA 1OCRC 2JPUA 3FAJA 2ZXOA 1YDIA 1R4TA 2L9JA 3Q6MA 2L6HA 2HV7A 3NYMA 4E17A 4D4NA 5KYYB 3UMIA 3U0CA 2M64A 2R7RA 4MNDA 3QW1A 4IARA 1C03A 1MNDA 3C62A 4G7HF 1YA9A 3O55A 2V26A 1Q0DA 2L81A 2QLAA 2VASA 4FWVA 4YN0B 3MLGA 4EWCA 3MYFA 2DGJA 3C8GB 1HW1A 2XS8A 2VC9A 4XEVA 4ZLCA 2XLWA 5L0IA 1FR0A 4PJJA 3G4ZA 3C63A 3GANA 2EIJC 2YQYA 3N24A 4Z9JA 3O10A 2V3CC 4Q5SF 4K0DA 3ZC4A 4JURI 1FMVA 2G62A 3DM5A 1TWHA 4YL1A 5B3IA 4YL0A 3WODF 5KYWB 2PFDA 3NDBB 1VK5A 4JCHA 5AGFA 4XPWA 3U3FA 2AVKA 2W9YA 4Z9HA 5L0JA 1OKKD 1WN0A 1YA7O 2O9XA 1ZHYA 3W2WA 2VH3A 2YL7A 2NUPB 3ZG1A 1RMVA 2EINC 2EPNA 3CQZA 4GQHA 3UNGC 4QI0A 3PDMP 2Q9BA 1HMDA 2GFHA 3T9OA 2Q7RA 1UG7A 2KSFA 5A6BA 3DI5A 2E87A 3CZ6A 3IQ6A 4BJ1A 1HMOA 2LP4A 3AG2C 1OCOC 3EPVA 2DB4A 2HS5A 2XLDA 5L3QA 3RH3A 1OCZC 3ZDLA 3JT1A 1LVKA 2F22A 2PX0A 2GWWA 3C7JA 3T6JA 5B1BC 3RQGA 2R03A 3B71A 3S84A 3SP1A 2H7OA 3AQCA 4HEAJ 4MVSA 1M2VB 2BE5F 2WVOA 5D91A 3IPMO 2WZFA 1RKCA 3GWNA 4LLEA 4XLNF 3HNKA 2ZXWC 4IJJA 4O6MA 3WAQA 3U8VA 5JS5A 3TOMA 1U89A 5E3CA 4XEFA 3EG9B 4CS7A 3RF3A 5HSWA 2I8BA 3UGOA 1BZ4A 3MFNA 2KNHA 2KK1A 2YVKA 1FFTC 3ZQVA 3B29A 1D1AA 4FESA 3I5QA 4R32A 4PFOA 1V55C 2QNLA 1L7CA 3EZIA 2MYSA 4OIRF 3SXZA 3DJUB 3K1IA 3KKBA 2QE9A 3ASNC 3M79A 2PBEA 2WVQA 2Y3BA 3C8GD 3VAYA 1PD0A 1LS1A 4G0HA 3POVA 3CEXA 1YYJA 1ZW2A 2DYRC 1Y4CA 3QVZA 2D4UA 3GEHA 4IGGA 3RFYA 4Z9IA 1DOVA 5CIVA 4BPMA 2OJED 2PX3A 4JEBA 2KC3A 3AQBA 4EBBA 3RW0A 3LAYA 2TMVP 3RVYA 3JCUQ 4CDVA 4CDAA 1ORSC 2OOCA 4E7ZA 2MWQA 1FFHA 3Q7GA 4KC9A 3TK0A 4EHPA 1WATA 2LIGA 1OKKA 3WG7C 5EGYA 2YZSA 1PV3A 2R7VA 3SXYA 3HNLA 5CI8A 3K1IC 2MHRA 2XLEA 2R02A 4JIOA 2NSGA 3B0PA 3JRTA 4MTGA 2NUTA 1S05A 1YAUO 1Q0MA 1BR4A 3LNRA 3U9MA 4E0HA 1OQCA 2EPMX 1NLXA 2QUPA 4KNVA 2IXNA 5F5HA 3VYWA 5KYUA 1M57C 2PNOA 3EJNA 1ZHWA 3JTLO 4RBNA 2LD6A 3S29A 3CAXA 1YLMA 2HSBA 4YL3A 1NU9C 1OR2A 2Y3DA 3C18A 4E7SA 2XM4A 1TQGA 1EI7A 1MNEA 1ORJA 4MW3A 1H7IA 4U5FE 1T6IA 3T6BA 1TFKB 1OXBA 5E2QA 3SXMA 5BQHA 2P0NA 3DJNB 2C04A 2A69F 2KW3C 2UUHA 1E86A 5D92A 3U2MA 2CNWD 1MMNA 2KQ9A 2XS1A 1OW8A 3GODA 4G7OF 4ANJA 4PJNA 2A1DD 4W8KA 3H2UA 2R7TA 256BA 2YLGA 2D5RB 3S0XA 2VB6A 2R7OA 3FOPA 3QMKA 1XWJA 4X0RA 2HKVA 4AX2A 5IY5C 3AJMA 5DS4A 4HFFB 1H9TA 1FMWA 2IOQA 2W4MA 2J8WA 3L8IA 4J32B 4AL1A 1RKEB 1ZU4A 3JYHA 5B3SC 3B0UX 3GORA 3IHUA 1BDJB 5FZTA 4Q4ZF 4BEMJ 4NTFA 1CGOA 3CSKA 1YZCA 3FHDA 2CYDA 2KYHA 3GM2A 4YJWA 1QLEC 1OXKA 5B1AC 4EIYA 4YT8A 4AL0A 3UGPA 1VLTA 2NPUA 3HNIA 4I1MA 3KPHA 2NUPA
chains in the Genus database with same CATH topology
3EFOA 2WVNA 3KMIA 1SMYF 3EGXA 2R7UA 3LS0A 4U5EE 3N2ZB 3T4RA 1TR2A 3DM9B 2P6VA 3NKDA 4BEJA 2B0JA 4U5DE 2CGEA 3ZSUA 3AG3C 3HJCA 4CIHA 2R7XA 5T1DB 3NYLA 1OCCC 1NG1A 4PK4A 2IYLD 3DZAA 2IXMA 2HV6A 4YT4A 4BJTA 4AE4B 3EG9A 3O39A 3FDQA 2XRHA 4A2NB 3HTKC 4JZAA 1SF8A 4LERA 3DMDA 3MX3A 5KYNA 4LLCA 5DQZA 2QTVA 4JJGA 2Z15A 3RYLA 2A6EF 4OIQF 3X1OA 1Z23A 1ZYRF 2ZXRA 4CBEA 4ULWA 2J45A 3ABKC 3OA1A 2JD3A 4XLPF 4QDLA 1VYIA 4C3BA 3SZRA 4DBQA 1W2WA 1VMAA 4M63A 5KYXA 3K1HA 2XXAB 1JPJA 4O6YA 1S7ZA 4GEHA 1J8MF 4O7GA 1TWCA 2PF4E 5E3AA 4JW1A 2Y69C 3RKOF 5DQTA 2P7VA 3IEEA 3LEVA 3S28A 1RJ9A 4F4BA 3O6XA 4U5HA 4IWBA 3EHMA 2XSEA 4OD4A 3H65A 3EGDA 2OG2A 2Y39A 3EH2A 5DS6A 1MMAA 2ZXPA 4OIPF 2OCCC 2FGYA 4YWQA 4NY3A 4U5GA 4BJ6A 4K7BA 3SNHA 3QZCA 3I5PA 4LACB 3W8HA 1V54C 3K66A 4YT5A 3UMHA 2KGOA 3ASOC 3B0VC 1ZU5A 4DBRA 2Q3TA 1ST6A 4CSAA 1O5HA 5KYYA 3SYNA 2WZGA 4PJMA 4Q7CA 2X51A 3LLKA 4CS8A 2IXOA 4JVSA 2EIKC 4JJFA 2Q9CA 4I44A 3RIPA 3NYJA 2J0WA 3KH2A 3JSZA 1Z3IX 4BJ5A 5T3TA 4RDAA 3L0IA 4OINF 5KYWA 2J0XA 3E70C 2R7SA 4CSAC 3DAFA 3FVYA 4KNWA 4OIOF 3LJBA 4XTKA 1M2OA 5E33A 1TWAA 3ZVRA 2Y3HA 3HLZA 2A6HF 2J7PD 3X2QC 1N1CA 4GYTA 4CS7A 4CS8C 3ZIBA 1D0ZA 3EH1A 3LS1A 4HE8D 2QY9A 4WJ0A 4BJ5C 3OWTA 3AG1C 2J9WA 4IRUA 1PD1A 4O79A 4C7OB 1M2VA 4ZLDA 1NU7D 5L3VA 2W45A 2H7VC 3DXJF 1D1BA 3NG1A 2CNWA 5T3WA 2WZLA 2XXAA 2G3KA 1TKNA 2Y3GA 4U5BE 3DAGA 3K7DA 3SEOA 2XL4A 2H7BA 4I1OB 4U5CE 2R7QA 3Q7LA 3KL4A 4DOZA 2IXPA 3EFOB 4O6NA 3DD7A 1SZIA 3EGXB 4QI2A 3OEOA 2NG1A 3K6BA 4BG0A 4PJLA 4H4KC 3LESA 2G3VA 1ZHTA 3F47A 1O87A 2KJGA 3E9VA 1ZHZA 2J7PA 1LKXA 4MQ9F 2J46A 3EZHA 3LLIA 4CS9A 3ITFA 3UMKA 2R7WA 4J30B 4PFPA 1VYKA 1QZXA 2CW0F 2WL8A 5FCLA 4YT2A 1D1CA 2Q9AA 4C3EA 3V7OA 3UR3C 2YHSA 2A68F 3EHNA 4G7ZF 1Z5ZA 1MMGA 3AG4C 1KU2A 3M1CB 2J9UA 3W8IA 3F46A 3S27A 4B6IA 1Z6AA 4XWJA 3I4UA 2FFHA 3W2VA 4CS9C 2CDQA 3PHF2 1IW7F 5KYXB 5F5FA 1JPNA 4DVYP 1J8YF 1WGWA 3NRHA 5CI9A 2WB7A 1FTSA 1D0XA 3ECSA 4Q5SF 2ZPAA 4DVZA 3ABMC 1VOMA 1RJ9B 4FX5A 4I3MA 1MMDA 3Q6NA 4C3DA 4BJ6C 2PP4A 1BR2A 2J9VA 3EGDB 4KI2A 1Z63A 1PCXA 3TD7A 4RD9A 3N0TA 4AK9A 3L34A 2YEVA 5BUOA 3NKEA 1D0YA 3EQLF 4HFKB 1G8XA 2NUTB 5DS5A 2EILC 4C7OA 1BR1A 1ZHXA 1NZEA 3K33A 3PMRA 4IAOA 5KYUB 3ABLC 2EIMC 2M4EA 3B9QA 4OD5A 4AE4A 1TWGA 2LSEA 2DYSC 4KBLA 4P6IC 5DLJA 1M56C 5DVWA 1IZMA 4N06A 2W4BA 2C03A 1OCRC 3FAJA 5EHHA 2ZXOA 3Q6MA 2L9JA 5KYYB 2HV7A 3NYMA 2R7RA 3UMIA 4MNDA 1MNDA 4G7HF 2V26A 2L81A 2VASA 4FWVA 4YN0B 3MLGA 4EWCA 2DGJA 4ZLCA 4PJJA 3GANA 2EIJC 3N24A 2V3CC 4K0DA 3ZC4A 4JURI 1FMVA 2G62A 3DM5A 1TWHA 3WODF 5KYWB 2PFDA 3NDBB 1VK5A 4JCHA 2W9YA 1OKKD 2O9XA 1ZHYA 3W2WA 2VH3A 2NUPB 3ZG1A 2EINC 3CQZA 3UNGC 4QI0A 2Q9BA 2GFHA 2E87A 3CZ6A 4BJ1A 3AG2C 1OCOC 3EPVA 5L3QA 3RH3A 1OCZC 3JT1A 1LVKA 2PX0A 3T6JA 5B1BC 3SP1A 2H7OA 3AQCA 4HEAJ 1M2VB 2BE5F 2WVOA 5D91A 2WZFA 4LLEA 4XLNF 2ZXWC 4IJJA 4O6MA 5E3CA 3EG9B 5HSWA 2I8BA 3UGOA 2KNHA 1FFTC 1D1AA 4FESA 3I5QA 4PFOA 1V55C 3EZIA 2MYSA 4OIRF 3DJUB 3KKBA 3ASNC 2WVQA 2Y3BA 3VAYA 1PD0A 1LS1A 4G0HA 3POVA 2DYRC 3RFYA 2PX3A 3AQBA 4EBBA 3LAYA 3JCUQ 4E7ZA 2MWQA 1FFHA 3Q7GA 4KC9A 1OKKA 3WG7C 5EGYA 2YZSA 2R7VA 5CI8A 3K1IC 3B0PA 3JRTA 2NUTA 1BR4A 3LNRA 4KNVA 5F5HA 2IXNA 3VYWA 5KYUA 1M57C 3EJNA 1ZHWA 4RBNA 3S29A 1NU9C 2Y3DA 4E7SA 1MNEA 4U5FE 3T6BA 5E2QA 3DJNB 2C04A 2A69F 2KW3C 5D92A 2CNWD 1MMNA 2KQ9A 4G7OF 3GODA 4ANJA 4PJNA 2A1DD 4W8KA 2R7TA 2D5RB 3S0XA 2VB6A 2R7OA 3QMKA 4X0RA 4AX2A 5IY5C 5DS4A 4HFFB 1FMWA 2IOQA 2W4MA 4J32B 1ZU4A 3JYHA 5B3SC 3B0UX 4Q4ZF 3CSKA 3FHDA 4YJWA 5B1AC 1QLEC 4YT8A 3UGPA 4I1MA 2NUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6B A;  3UMK A;  4RDA A;  3Q7L A;  3NYL A;  3UMH A;  3NYJ A;  1TKN A;  3UMI A;  3PMR A;  3QMK A;  4RD9 A;  5BUO A;  4YN0 B;  3K66 A;  3Q7G A; 
#chains in the Genus database with same CATH topology
 3EFO A;  2WVN A;  3KMI A;  2BC5 A;  1SMY F;  4MTF A;  3EGX A;  1WTY A;  3FAP B;  2R7U A;  3LS0 A;  4U5E E;  3N2Z B;  3T4R A;  1A7V A;  3MYI A;  1TR2 A;  3DM9 B;  2GA0 A;  2P6V A;  3NKD A;  4BEJ A;  1XZQ A;  2B0J A;  2YWA A;  4U5D E;  5BQG A;  2CGE A;  4MVZ A;  2IBF A;  4JKV A;  1V74 B;  2EPL X;  3U2L A;  3ZSU A;  3AG3 C;  1U6H A;  3HJC A;  1YAR O;  4MW8 A;  4N6H A;  4CIH A;  5T1D B;  2R7X A;  3L8J A;  3NYL A;  1OCC C;  1NG1 A;  4PK4 A;  4E18 A;  2IYL D;  3DZA A;  1KTM A;  1U0B B;  2IXM A;  3GEE A;  4LDQ A;  2XLO A;  4JTC B;  4IB4 A;  2HV6 A;  4YK5 A;  1MQV A;  4AE4 B;  4BJT A;  4YT4 A;  2VCB A;  3EG9 A;  3O39 A;  1QSP A;  3FDQ A;  2XRH A;  2XL8 A;  4A2N B;  3HTK C;  4D4X A;  4JZA A;  1F1M A;  1KNY A;  1SF8 A;  2ASR A;  4LER A;  3DMD A;  3MX3 A;  1L3P A;  1A7E A;  1C17 M;  5KYN A;  4LLC A;  4CIP A;  2GDC A;  2P1A A;  5DQZ A;  2QTV A;  2J9B A;  4JJG A;  2HJM A;  2Z15 A;  3RYL A;  2A6E F;  2LK4 A;  2L6F A;  4MVM A;  3M4B A;  3X1O A;  5EHH A;  1Z23 A;  1ZYR F;  4OIQ F;  4NTB A;  2OKU A;  2ZXR A;  1GQA A;  5JP7 A;  4CBE A;  3WHN A;  4ULW A;  2J45 A;  3ABK C;  3OA1 A;  4P9T A;  2YL1 A;  3VRC A;  2JD3 A;  3ZQY A;  4XLP F;  4QDL A;  1VYI A;  3FXH A;  4C3B A;  3RVZ A;  3SZR A;  4DBQ A;  4J7Y A;  1FAP B;  1E83 A;  1VTM P;  3V5X A;  1EKY A;  1W2W A;  1Q0F A;  1VMA A;  2CCY A;  2BL2 A;  4M63 A;  5EK0 A;  1SR2 A;  4WAB A;  1WWP A;  4JTD B;  3NMI A;  3K1H A;  5KYX A;  2XXA B;  3TJ5 A;  2LFF A;  4CJO A;  1JPJ A;  4O6Y A;  4EKW A;  5A69 A;  1S7Z A;  4GEH A;  1J8M F;  2UUI A;  4O7G A;  1TWC A;  2PF4 E;  4PR9 A;  1M6T A;  5E3A A;  1T6Q A;  4A4A A;  4JW1 A;  2Y69 C;  3RKO F;  5K0I A;  2JX0 A;  5DQT A;  2P7V A;  3IEE A;  3DKA A;  3LEV A;  2HUJ A;  2EPK X;  3S28 A;  5L0C A;  1RJ9 A;  1I4Y A;  4F4B A;  2AWC A;  3O6X A;  4U5H A;  4CX9 A;  4IWB A;  2YKZ A;  1G5Z A;  3EHM A;  4JEA A;  3TQO A;  5JT4 A;  2XSE A;  4OD4 A;  3H65 A;  3EGD A;  2OG2 A;  1NBB A;  1LPE A;  2Y39 A;  3EH2 A;  4JE9 A;  3U8P A;  4DJ9 A;  5DS6 A;  1LI5 A;  2XLH A;  3AGU A;  4NC3 A;  1H6G A;  4ER9 A;  2R05 A;  4MVO A;  2AWY A;  5A6J A;  1RXQ A;  1MMA A;  2XLV A;  1E2X A;  2ZXP A;  3M15 A;  4OIP F;  1O3U A;  4DXW A;  2ETS A;  2OCC C;  2FGY A;  4YWQ A;  4NY3 A;  4U5G A;  4BJ6 A;  2YLD A;  3H2V A;  2NSF A;  2VCA A;  5DLJ A;  2HJ3 A;  1AEP A;  4K7B A;  3SNH A;  1WOL A;  2YLI A;  3QZC A;  3I5P A;  3QW0 A;  4LAC B;  2HSQ A;  3W8H A;  1V54 C;  3K66 A;  1SYQ A;  2HMQ A;  4YT5 A;  3UMH A;  2KGO A;  3ASO C;  4FAP B;  2AP3 A;  1E85 A;  3B0V C;  1JMW A;  5AC4 A;  5L0F A;  1ZU5 A;  5GPG B;  4DBR A;  2Q3T A;  1EQ1 A;  1HE9 A;  3QVY A;  1ST6 A;  1G4W R;  3V5Y A;  4CSA A;  1O5H A;  4J7T A;  3SYN A;  2WZG A;  5KYY A;  4PJM A;  4Q7C A;  4G78 A;  1K40 A;  2X51 A;  2X0C A;  3LLK A;  4CS8 A;  2IXO A;  1RCP A;  4JVS A;  4WGZ A;  1GS9 A;  1YYX A;  2EIK C;  1T9K A;  4JJF A;  2Q9C A;  2DI3 A;  4I44 A;  3GM3 A;  3RIP A;  3NYJ A;  1UFB A;  2J0W A;  3NMK A;  5JVE A;  1I4Z A;  3S9O A;  1T6U A;  3C8G A;  3KH2 A;  1B68 A;  1YVI A;  1Z3I X;  3JSZ A;  4BJ5 A;  1XZP A;  5T3T A;  3DWW A;  1CGM E;  4RDA A;  3L0I A;  3GM1 A;  5A6B D;  3A9C A;  1Q0K A;  4MS2 A;  4OIN F;  2HMZ A;  2J0X A;  5KYW A;  1FNT c;  3AOU A;  1YZA A;  3E70 C;  2R7S A;  5AC5 A;  3DAF A;  3FVY A;  3G4X A;  4KNW A;  4CSA C;  4OIO F;  1CPR A;  2RSE B;  3LJB A;  4XTK A;  1M2O A;  1VLS A;  1ZZP A;  5E33 A;  1TWA A;  3LEO A;  2H8A A;  3ZVR A;  1TFO B;  2XM0 A;  2Y3H A;  3HLZ A;  2A6H F;  2J7P D;  2R9R B;  1N1C A;  2XLM A;  3MBG A;  4GYT A;  3TOL A;  3X2Q C;  1D0Z A;  3EH1 A;  3ZIB A;  4CS8 C;  4DRI B;  3HNJ A;  2GAQ A;  1I5N A;  2HFI A;  1LE2 A;  3LS1 A;  5A6K A;  2OEV A;  4U9E A;  1E84 A;  3S90 A;  3IQ5 A;  3GWL A;  4JCZ A;  4HE8 D;  2QY9 A;  4WJ0 A;  1DOW A;  3T6G B;  4LDK A;  4BJ5 C;  2A0B A;  2Q4F A;  3KYI A;  3ZWI A;  3AGT A;  3OWT A;  4NQF A;  4W8P A;  4XQ1 A;  3AG1 C;  2J9W A;  4IRU A;  1PD1 A;  4O79 A;  3C8Z A;  4C7O B;  5BQI A;  2OQM A;  4WGY A;  1M2V A;  3VF0 A;  1AVO B;  3JYY A;  1A0B A;  4ZLD A;  3M4C A;  1NU7 D;  3FMS A;  2I15 A;  5L3V A;  2ICW G;  3SXK A;  3TUL A;  1OR3 A;  2W45 A;  1HY5 A;  2H7V C;  4U9D A;  3DXJ F;  4JRZ A;  4E0I A;  1D1B A;  3NG1 A;  4NCQ A;  2CNW A;  5T3W A;  2WZL A;  3U9J A;  4MVR A;  2XXA A;  2G3K A;  2P61 A;  1HE1 A;  1TKN A;  2OU6 A;  2Y3G A;  4U5B E;  3DAG A;  3GEI A;  4DRH B;  3K7D A;  1LI7 A;  2XL4 A;  2H7B A;  4I1O B;  4PAC A;  4U5C E;  3SEO A;  3ZTZ A;  2R7Q A;  3Q7L A;  4EUK B;  3KL4 A;  4DOZ A;  3R7C A;  2L7A A;  2OJQ A;  4XEK A;  2IXP A;  3EFO B;  4O6N A;  3PCV A;  3DD7 A;  4MVU A;  1OW7 A;  3J06 A;  1SZI A;  3EGX B;  3IQC A;  4QI2 A;  3OEO A;  2NG1 A;  2YL0 A;  3JSE O;  3K6B A;  3KYJ A;  4L6R A;  4PJL A;  3IQT A;  4H4K C;  4BG0 A;  3US6 A;  3LES A;  1QQ3 A;  2G3V A;  2ZD9 A;  5HV9 A;  1ZHT A;  3F47 A;  3DE8 A;  1O87 A;  2KJG A;  3E9V A;  1ORY A;  2R25 A;  2RD9 A;  4MVQ A;  1ZHZ A;  2J7P A;  5JRA A;  1LKX A;  4MQ9 F;  2J46 A;  3EZH A;  3LLI A;  3RQE A;  5L0G A;  1C02 A;  4CS9 A;  4N4W A;  3ITF A;  3UMK A;  1GGQ A;  1Q0G A;  5JSL A;  4IAQ A;  4JC7 A;  2R7W A;  3LUT B;  4ONS A;  4J30 B;  4PFP A;  4XPY A;  1VYK A;  1QZX A;  2CW0 F;  2IM8 A;  3QTH A;  3HKK A;  2WL8 A;  1EA8 A;  1BBH A;  2L6G A;  5FCL A;  4YT2 A;  1D1C A;  1K04 A;  2Q9A A;  4C3E A;  1A41 A;  3ATP A;  3V7O A;  3UR3 C;  2YHS A;  2A68 F;  3EHN A;  4G7Z F;  1LM3 B;  1Z5Z A;  1MMG A;  3AG4 C;  1LS4 A;  1KU2 A;  2YL3 A;  3M1C B;  2J9U A;  3W8I A;  3ZTM A;  1NSG B;  3NMJ A;  4EBK A;  3F46 A;  1QKR A;  2XL6 A;  3S27 A;  4B6I A;  3BRJ A;  1JRA A;  1JOG A;  3JZ0 A;  1Z6A A;  3RQF A;  3U3B A;  4XWJ A;  1CGN A;  3I4U A;  5F28 E;  4NTA A;  1V4A A;  2FFH A;  3W2V A;  1NFO A;  2Q00 A;  4CS9 C;  3V5Z A;  2CDQ A;  3PHF 2;  1IW7 F;  5KYX B;  5F5F A;  1JPN A;  2B0H A;  4LDR A;  4DVY P;  1J8Y F;  1WGW A;  2HZ8 A;  3NRH A;  4ULV A;  3LNM B;  5CI9 A;  1NFN A;  1T5O A;  1Y6D A;  2WB7 A;  1FTS A;  1RKE A;  1D0X A;  1ZW3 A;  3ECS A;  2ZPA A;  4JTA B;  4XPX A;  4UDV A;  3R2P A;  4DVZ A;  5COG A;  3ABM C;  5JLI A;  1QVX A;  1Z7Q c;  1VOM A;  1RJ9 B;  2AU5 A;  2LCH A;  4FX5 A;  4I3M A;  1MMD A;  4N6C A;  1APC A;  1YJG A;  3Q6N A;  4C3D A;  4BJ6 C;  1LIH A;  3TJ6 A;  2PP4 A;  1BR2 A;  2J9V A;  4CDY A;  3EGD B;  1LE4 A;  1R5I D;  4KI2 A;  4K1O A;  1Z63 A;  1PCX A;  3TD7 A;  4RD9 A;  3N0T A;  2EPO A;  4AK9 A;  3L34 A;  2YEV A;  3A11 A;  3U5S A;  1JR8 A;  2FAP B;  3BEH A;  1OW6 A;  3W4Y A;  1VB5 A;  2A0U A;  5BUO A;  1ZVZ A;  3NKE A;  4P9F A;  1D0Y A;  1K05 A;  1G4U S;  3EQL F;  4HFK B;  1G8X A;  2NUT B;  5TJ5 E;  2EIL C;  5DS5 A;  1GM5 A;  1AUE A;  1T01 A;  3L1M A;  4C7O A;  1BR1 A;  1ZHX A;  1NZE A;  3K33 A;  3PMR A;  1HW2 A;  5COM A;  4IAO A;  5KYU B;  5COF A;  3ABL C;  1JAF A;  2EIM C;  2M4E A;  5L0D A;  3B9Q A;  2OEX A;  1H9G A;  1QPU A;  4OD5 A;  4DRJ B;  4CJG A;  4AE4 A;  1TWG A;  4H54 A;  5L0H A;  2LSE A;  1WAS A;  2LQG A;  4EBJ A;  5A6A A;  2DYS C;  3VM6 A;  4KBL A;  1CPQ A;  3DE9 A;  4P6I C;  3FOO A;  2YRF A;  5JUA A;  1A7D A;  3G50 A;  1M56 C;  5DVW A;  2VCC A;  1IZM A;  3JRM O;  2W4B A;  2C03 A;  4N06 A;  2LFD A;  4MTO A;  1OCR C;  2JPU A;  3FAJ A;  2ZXO A;  1YDI A;  1R4T A;  2L9J A;  3Q6M A;  2L6H A;  2HV7 A;  3NYM A;  4E17 A;  4D4N A;  5KYY B;  3UMI A;  3U0C A;  2M64 A;  2R7R A;  4MND A;  3QW1 A;  4IAR A;  1C03 A;  1MND A;  3C62 A;  4G7H F;  1YA9 A;  3O55 A;  2V26 A;  1Q0D A;  2L81 A;  2QLA A;  2VAS A;  4FWV A;  4YN0 B;  3MLG A;  4EWC A;  3MYF A;  2DGJ A;  3C8G B;  1HW1 A;  2XS8 A;  2VC9 A;  4XEV A;  4ZLC A;  2XLW A;  5L0I A;  1FR0 A;  4PJJ A;  3G4Z A;  3C63 A;  3GAN A;  2EIJ C;  2YQY A;  3N24 A;  4Z9J A;  3O10 A;  2V3C C;  4Q5S F;  4K0D A;  3ZC4 A;  4JUR I;  1FMV A;  2G62 A;  3DM5 A;  1TWH A;  4YL1 A;  5B3I A;  4YL0 A;  3WOD F;  5KYW B;  2PFD A;  3NDB B;  1VK5 A;  4JCH A;  5AGF A;  4XPW A;  3U3F A;  2AVK A;  2W9Y A;  4Z9H A;  5L0J A;  1OKK D;  1WN0 A;  1YA7 O;  2O9X A;  1ZHY A;  3W2W A;  2VH3 A;  2YL7 A;  2NUP B;  3ZG1 A;  1RMV A;  2EIN C;  2EPN A;  3CQZ A;  4GQH A;  3UNG C;  4QI0 A;  3PDM P;  2Q9B A;  1HMD A;  2GFH A;  3T9O A;  2Q7R A;  1UG7 A;  2KSF A;  5A6B A;  3DI5 A;  2E87 A;  3CZ6 A;  3IQ6 A;  4BJ1 A;  1HMO A;  2LP4 A;  3AG2 C;  1OCO C;  3EPV A;  2DB4 A;  2HS5 A;  2XLD A;  5L3Q A;  3RH3 A;  1OCZ C;  3ZDL A;  3JT1 A;  1LVK A;  2F22 A;  2PX0 A;  2GWW A;  3C7J A;  3T6J A;  5B1B C;  3RQG A;  2R03 A;  3B71 A;  3S84 A;  3SP1 A;  2H7O A;  3AQC A;  4HEA J;  4MVS A;  1M2V B;  2BE5 F;  2WVO A;  5D91 A;  3IPM O;  2WZF A;  1RKC A;  3GWN A;  4LLE A;  4XLN F;  3HNK A;  2ZXW C;  4IJJ A;  4O6M A;  3WAQ A;  3U8V A;  5JS5 A;  3TOM A;  1U89 A;  5E3C A;  4XEF A;  3EG9 B;  4CS7 A;  3RF3 A;  5HSW A;  2I8B A;  3UGO A;  1BZ4 A;  3MFN A;  2KNH A;  2KK1 A;  2YVK A;  1FFT C;  3ZQV A;  3B29 A;  1D1A A;  4FES A;  3I5Q A;  4R32 A;  4PFO A;  1V55 C;  2QNL A;  1L7C A;  3EZI A;  2MYS A;  4OIR F;  3SXZ A;  3DJU B;  3K1I A;  3KKB A;  2QE9 A;  3ASN C;  3M79 A;  2PBE A;  2WVQ A;  2Y3B A;  3C8G D;  3VAY A;  1PD0 A;  1LS1 A;  4G0H A;  3POV A;  3CEX A;  1YYJ A;  1ZW2 A;  2DYR C;  1Y4C A;  3QVZ A;  2D4U A;  3GEH A;  4IGG A;  3RFY A;  4Z9I A;  1DOV A;  5CIV A;  4BPM A;  2OJE D;  2PX3 A;  4JEB A;  2KC3 A;  3AQB A;  4EBB A;  3RW0 A;  3LAY A;  2TMV P;  3RVY A;  3JCU Q;  4CDV A;  4CDA A;  1ORS C;  2OOC A;  4E7Z A;  2MWQ A;  1FFH A;  3Q7G A;  4KC9 A;  3TK0 A;  4EHP A;  1WAT A;  2LIG A;  1OKK A;  3WG7 C;  5EGY A;  2YZS A;  1PV3 A;  2R7V A;  3SXY A;  3HNL A;  5CI8 A;  3K1I C;  2MHR A;  2XLE A;  2R02 A;  4JIO A;  2NSG A;  3B0P A;  3JRT A;  4MTG A;  2NUT A;  1S05 A;  1YAU O;  1Q0M A;  1BR4 A;  3LNR A;  3U9M A;  4E0H A;  1OQC A;  2EPM X;  1NLX A;  2QUP A;  4KNV A;  2IXN A;  5F5H A;  3VYW A;  5KYU A;  1M57 C;  2PNO A;  3EJN A;  1ZHW A;  3JTL O;  4RBN A;  2LD6 A;  3S29 A;  3CAX A;  1YLM A;  2HSB A;  4YL3 A;  1NU9 C;  1OR2 A;  2Y3D A;  3C18 A;  4E7S A;  2XM4 A;  1TQG A;  1EI7 A;  1MNE A;  1ORJ A;  4MW3 A;  1H7I A;  4U5F E;  1T6I A;  3T6B A;  1TFK B;  1OXB A;  5E2Q A;  3SXM A;  5BQH A;  2P0N A;  3DJN B;  2C04 A;  2A69 F;  2KW3 C;  2UUH A;  1E86 A;  5D92 A;  3U2M A;  2CNW D;  1MMN A;  2KQ9 A;  2XS1 A;  1OW8 A;  3GOD A;  4G7O F;  4ANJ A;  4PJN A;  2A1D D;  4W8K A;  3H2U A;  2R7T A;  256B A;  2YLG A;  2D5R B;  3S0X A;  2VB6 A;  2R7O A;  3FOP A;  3QMK A;  1XWJ A;  4X0R A;  2HKV A;  4AX2 A;  5IY5 C;  3AJM A;  5DS4 A;  4HFF B;  1H9T A;  1FMW A;  2IOQ A;  2W4M A;  2J8W A;  3L8I A;  4J32 B;  4AL1 A;  1RKE B;  1ZU4 A;  3JYH A;  5B3S C;  3B0U X;  3GOR A;  3IHU A;  1BDJ B;  5FZT A;  4Q4Z F;  4BEM J;  4NTF A;  1CGO A;  3CSK A;  1YZC A;  3FHD A;  2CYD A;  2KYH A;  3GM2 A;  4YJW A;  1QLE C;  1OXK A;  5B1A C;  4EIY A;  4YT8 A;  4AL0 A;  3UGP A;  1VLT A;  2NPU A;  3HNI A;  4I1M A;  3KPH A;  2NUP A; 
#chains in the Genus database with same CATH homology
 3EFO A;  2WVN A;  3KMI A;  1SMY F;  3EGX A;  2R7U A;  3LS0 A;  4U5E E;  3N2Z B;  3T4R A;  1TR2 A;  3DM9 B;  2P6V A;  3NKD A;  4BEJ A;  2B0J A;  4U5D E;  2CGE A;  3ZSU A;  3AG3 C;  3HJC A;  4CIH A;  2R7X A;  5T1D B;  3NYL A;  1OCC C;  1NG1 A;  4PK4 A;  2IYL D;  3DZA A;  2IXM A;  2HV6 A;  4YT4 A;  4BJT A;  4AE4 B;  3EG9 A;  3O39 A;  3FDQ A;  2XRH A;  4A2N B;  3HTK C;  4JZA A;  1SF8 A;  4LER A;  3DMD A;  3MX3 A;  5KYN A;  4LLC A;  5DQZ A;  2QTV A;  4JJG A;  2Z15 A;  3RYL A;  2A6E F;  4OIQ F;  3X1O A;  1Z23 A;  1ZYR F;  2ZXR A;  4CBE A;  4ULW A;  2J45 A;  3ABK C;  3OA1 A;  2JD3 A;  4XLP F;  4QDL A;  1VYI A;  4C3B A;  3SZR A;  4DBQ A;  1W2W A;  1VMA A;  4M63 A;  5KYX A;  3K1H A;  2XXA B;  1JPJ A;  4O6Y A;  1S7Z A;  4GEH A;  1J8M F;  4O7G A;  1TWC A;  2PF4 E;  5E3A A;  4JW1 A;  2Y69 C;  3RKO F;  5DQT A;  2P7V A;  3IEE A;  3LEV A;  3S28 A;  1RJ9 A;  4F4B A;  3O6X A;  4U5H A;  4IWB A;  3EHM A;  2XSE A;  4OD4 A;  3H65 A;  3EGD A;  2OG2 A;  2Y39 A;  3EH2 A;  5DS6 A;  1MMA A;  2ZXP A;  4OIP F;  2OCC C;  2FGY A;  4YWQ A;  4NY3 A;  4U5G A;  4BJ6 A;  4K7B A;  3SNH A;  3QZC A;  3I5P A;  4LAC B;  3W8H A;  1V54 C;  3K66 A;  4YT5 A;  3UMH A;  2KGO A;  3ASO C;  3B0V C;  1ZU5 A;  4DBR A;  2Q3T A;  1ST6 A;  4CSA A;  1O5H A;  5KYY A;  3SYN A;  2WZG A;  4PJM A;  4Q7C A;  2X51 A;  3LLK A;  4CS8 A;  2IXO A;  4JVS A;  2EIK C;  4JJF A;  2Q9C A;  4I44 A;  3RIP A;  3NYJ A;  2J0W A;  3KH2 A;  3JSZ A;  1Z3I X;  4BJ5 A;  5T3T A;  4RDA A;  3L0I A;  4OIN F;  5KYW A;  2J0X A;  3E70 C;  2R7S A;  4CSA C;  3DAF A;  3FVY A;  4KNW A;  4OIO F;  3LJB A;  4XTK A;  1M2O A;  5E33 A;  1TWA A;  3ZVR A;  2Y3H A;  3HLZ A;  2A6H F;  2J7P D;  3X2Q C;  1N1C A;  4GYT A;  4CS7 A;  4CS8 C;  3ZIB A;  1D0Z A;  3EH1 A;  3LS1 A;  4HE8 D;  2QY9 A;  4WJ0 A;  4BJ5 C;  3OWT A;  3AG1 C;  2J9W A;  4IRU A;  1PD1 A;  4O79 A;  4C7O B;  1M2V A;  4ZLD A;  1NU7 D;  5L3V A;  2W45 A;  2H7V C;  3DXJ F;  1D1B A;  3NG1 A;  2CNW A;  5T3W A;  2WZL A;  2XXA A;  2G3K A;  1TKN A;  2Y3G A;  4U5B E;  3DAG A;  3K7D A;  3SEO A;  2XL4 A;  2H7B A;  4I1O B;  4U5C E;  2R7Q A;  3Q7L A;  3KL4 A;  4DOZ A;  2IXP A;  3EFO B;  4O6N A;  3DD7 A;  1SZI A;  3EGX B;  4QI2 A;  3OEO A;  2NG1 A;  3K6B A;  4BG0 A;  4PJL A;  4H4K C;  3LES A;  2G3V A;  1ZHT A;  3F47 A;  1O87 A;  2KJG A;  3E9V A;  1ZHZ A;  2J7P A;  1LKX A;  4MQ9 F;  2J46 A;  3EZH A;  3LLI A;  4CS9 A;  3ITF A;  3UMK A;  2R7W A;  4J30 B;  4PFP A;  1VYK A;  1QZX A;  2CW0 F;  2WL8 A;  5FCL A;  4YT2 A;  1D1C A;  2Q9A A;  4C3E A;  3V7O A;  3UR3 C;  2YHS A;  2A68 F;  3EHN A;  4G7Z F;  1Z5Z A;  1MMG A;  3AG4 C;  1KU2 A;  3M1C B;  2J9U A;  3W8I A;  3F46 A;  3S27 A;  4B6I A;  1Z6A A;  4XWJ A;  3I4U A;  2FFH A;  3W2V A;  4CS9 C;  2CDQ A;  3PHF 2;  1IW7 F;  5KYX B;  5F5F A;  1JPN A;  4DVY P;  1J8Y F;  1WGW A;  3NRH A;  5CI9 A;  2WB7 A;  1FTS A;  1D0X A;  3ECS A;  4Q5S F;  2ZPA A;  4DVZ A;  3ABM C;  1VOM A;  1RJ9 B;  4FX5 A;  4I3M A;  1MMD A;  3Q6N A;  4C3D A;  4BJ6 C;  2PP4 A;  1BR2 A;  2J9V A;  3EGD B;  4KI2 A;  1Z63 A;  1PCX A;  3TD7 A;  4RD9 A;  3N0T A;  4AK9 A;  3L34 A;  2YEV A;  5BUO A;  3NKE A;  1D0Y A;  3EQL F;  4HFK B;  1G8X A;  2NUT B;  5DS5 A;  2EIL C;  4C7O A;  1BR1 A;  1ZHX A;  1NZE A;  3K33 A;  3PMR A;  4IAO A;  5KYU B;  3ABL C;  2EIM C;  2M4E A;  3B9Q A;  4OD5 A;  4AE4 A;  1TWG A;  2LSE A;  2DYS C;  4KBL A;  4P6I C;  5DLJ A;  1M56 C;  5DVW A;  1IZM A;  4N06 A;  2W4B A;  2C03 A;  1OCR C;  3FAJ A;  5EHH A;  2ZXO A;  3Q6M A;  2L9J A;  5KYY B;  2HV7 A;  3NYM A;  2R7R A;  3UMI A;  4MND A;  1MND A;  4G7H F;  2V26 A;  2L81 A;  2VAS A;  4FWV A;  4YN0 B;  3MLG A;  4EWC A;  2DGJ A;  4ZLC A;  4PJJ A;  3GAN A;  2EIJ C;  3N24 A;  2V3C C;  4K0D A;  3ZC4 A;  4JUR I;  1FMV A;  2G62 A;  3DM5 A;  1TWH A;  3WOD F;  5KYW B;  2PFD A;  3NDB B;  1VK5 A;  4JCH A;  2W9Y A;  1OKK D;  2O9X A;  1ZHY A;  3W2W A;  2VH3 A;  2NUP B;  3ZG1 A;  2EIN C;  3CQZ A;  3UNG C;  4QI0 A;  2Q9B A;  2GFH A;  2E87 A;  3CZ6 A;  4BJ1 A;  3AG2 C;  1OCO C;  3EPV A;  5L3Q A;  3RH3 A;  1OCZ C;  3JT1 A;  1LVK A;  2PX0 A;  3T6J A;  5B1B C;  3SP1 A;  2H7O A;  3AQC A;  4HEA J;  1M2V B;  2BE5 F;  2WVO A;  5D91 A;  2WZF A;  4LLE A;  4XLN F;  2ZXW C;  4IJJ A;  4O6M A;  5E3C A;  3EG9 B;  5HSW A;  2I8B A;  3UGO A;  2KNH A;  1FFT C;  1D1A A;  4FES A;  3I5Q A;  4PFO A;  1V55 C;  3EZI A;  2MYS A;  4OIR F;  3DJU B;  3KKB A;  3ASN C;  2WVQ A;  2Y3B A;  3VAY A;  1PD0 A;  1LS1 A;  4G0H A;  3POV A;  2DYR C;  3RFY A;  2PX3 A;  3AQB A;  4EBB A;  3LAY A;  3JCU Q;  4E7Z A;  2MWQ A;  1FFH A;  3Q7G A;  4KC9 A;  1OKK A;  3WG7 C;  5EGY A;  2YZS A;  2R7V A;  5CI8 A;  3K1I C;  3B0P A;  3JRT A;  2NUT A;  1BR4 A;  3LNR A;  4KNV A;  5F5H A;  2IXN A;  3VYW A;  5KYU A;  1M57 C;  3EJN A;  1ZHW A;  4RBN A;  3S29 A;  1NU9 C;  2Y3D A;  4E7S A;  1MNE A;  4U5F E;  3T6B A;  5E2Q A;  3DJN B;  2C04 A;  2A69 F;  2KW3 C;  5D92 A;  2CNW D;  1MMN A;  2KQ9 A;  4G7O F;  3GOD A;  4ANJ A;  4PJN A;  2A1D D;  4W8K A;  2R7T A;  2D5R B;  3S0X A;  2VB6 A;  2R7O A;  3QMK A;  4X0R A;  4AX2 A;  5IY5 C;  5DS4 A;  4HFF B;  1FMW A;  2IOQ A;  2W4M A;  4J32 B;  1ZU4 A;  3JYH A;  5B3S C;  3B0U X;  4Q4Z F;  3CSK A;  3FHD A;  4YJW A;  5B1A C;  1QLE C;  4YT8 A;  3UGP A;  4I1M A;  2NUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...