4JURI

Crystal structure of the effector tae4 from salmonella typhimurium in complex with the immunity tai4 from enterobacter cloacae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
TLPDISTFSQQQIFENWVQNRCIGKIADSKSLKEDADASAAAWLEASNLPAENFEKADEVIVSLLKQKVGGTEPGHYQILKCTLIANSDAIRPLKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Insights into the cross-immunity mechanism within effector families of bacteria type VI secretion system from the structure of StTae4-EcTai4 complex
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 34
structure length 97
sequence length 97
chains with identical sequence J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jurI00
4AX2A 3ZIBA 4J30B 4JURI 4HFKB 4B6IA 4HFFB 4J32B
chains in the Genus database with same CATH superfamily
1BR4A 1KNYA 3IQCA 3B71A 1M57C 2KW3C 3M4CA 4G7OF 3NRHA 3RQFA 5DS6A 3HNIA 1QKRA 2EPMX 5E33A 2OJED 2YLIA 3DI5A 5K0IA 2NUPA 1ZHZA 1UFBA 4DRJB 1OW7A 5FCLA 3ABLC 1G4WR 5L3QA 3C18A 2VH3A 4O6NA 1L3PA 4FWVA 3PHF2 1JAFA 3TULA 1AUEA 4PR9A 2D5RB 4CS8C 1HY5A 2IBFA 3F46A 4IRUA 4ER9A 4XLPF 1A7DA 4PFOA 3FMSA 4OIOF 3QTHA 1JR8A 2HSQA 3O55A 1YYJA 3MX3A 1FMVA 1NFOA 2EINC 1V4AA 1RCPA 3RF3A 5COFA 4O7GA 1RKCA 4LACB 1T6UA 2GA0A 2XL6A 4NTBA 3EH1A 5F5HA 4BPMA 4CJGA 4CIHA 4J7YA 3IHUA 3GM2A 5JVEA 3EG9B 4AE4A 3W2WA 2NG1A 3U8VA 3WHNA 3BRJA 5KYXA 5CI9A 3JZ0A 4JTAB 1C17M 4WGYA 4LLCA 2YRFA 4H4KC 4W8KA 4N6CA 1T5OA 4ULWA 4C3EA 2J45A 2L6HA 3GEHA 1RKEB 3SXMA 2XL8A 3FOOA 256BA 5L0FA 1QZXA 4JURI 2WVNA 4CX9A 3LESA 2Z15A 4J32B 3L34A 1D0ZA 3HNJA 2KQ9A 3QW1A 1IW7F 3LEVA 3U9MA 1ZHYA 2KJGA 2I15A 3LS1A 3RVZA 4U5FE 2AWCA 2Q4FA 3GEEA 2PX0A 2R02A 3UMHA 3U5SA 3S0XA 2PFDA 3JYYA 3B29A 2X0CA 1T9KA 1SZIA 4KI2A 2EILC 1LVKA 5KYYA 3MFNA 3A9CA 5COGA 3B9QA 3ABMC 2R7OA 1Z23A 2TMVP 2LSEA 2KYHA 3NYJA 1BBHA 2A1DD 4YT8A 4EHPA 4OIPF 2J9VA 3ASNC 4C7OA 1ZHWA 1TFOB 4Z9JA 2V3CC 3UMIA 4ANJA 2LIGA 1LE4A 1LS1A 2PNOA 3DWWA 5KYUB 3ZWIA 5DQZA 3RVYA 3RFYA 4ONSA 4WABA 1D0YA 2PX3A 1Z7Qc 4U5GA 1HE9A 3SXYA 4EIYA 1TQGA 4DXWA 2XXAB 1ZHTA 3IPMO 2HMZA 4M63A 3DMDA 3JT1A 1YJGA 1E2XA 3EGXA 3I5QA 4RDAA 4Z9HA 3OEOA 3WAQA 1C02A 2Q9AA 1QLEC 1TWAA 2KNHA 3K66A 3NYMA 2J9BA 2JX0A 2BE5F 1OQCA 3K1IA 4JCZA 4MTGA 3LLKA 5KYNA 5TJ5E 3H2UA 3T9OA 5COMA 4HE8D 5BUOA 2IXPA 4H54A 4HFFB 2J8WA 4DBRA 3ASOC 2OCCC 2W4BA 2L81A 4YT4A 5A6BA 5KYWB 3LJBA 5IY5C 3AOUA 2QE9A 1GQAA 4IARA 3SP1A 1GS9A 1A7EA 3G4XA 3C8GA 4K1OA 4NQFA 3U3FA 1BZ4A 2VCBA 1PV3A 1TKNA 2GAQA 2OG2A 1WTYA 3QVZA 4KNVA 4P6IC 1WASA 3AJMA 2LP4A 3RKOF 4EBKA 4MVUA 2CGEA 2VC9A 2LCHA 3DKAA 3KH2A 1VYIA 3N2ZB 4L6RA 5DVWA 5BQGA 1Y6DA 4F4BA 5L3VA 4CS7A 2WZGA 2B0HA 1AEPA 1D1CA 2J9UA 5L0JA 3NG1A 2HS5A 1NG1A 3IQTA 4I3MA 4JZAA 4EBJA 3AG1C 3W8HA 4U9DA 3L8IA 2R9RB 2G62A 3KYIA 3U0CA 4MW3A 2FAPB 4Q4ZF 2J46A 3LNRA 3K1IC 1M2OA 3KPHA 5D92A 3SYNA 3N0TA 4YT5A 2MYSA 2P61A 3M15A 2GWWA 1CGME 2OJQA 1Q0FA 2A0BA 2NSGA 4XQ1A 4DVZA 1MMGA 2R05A 4G78A 1BDJB 4YT2A 3EHMA 4O6MA 3NKEA 3GEIA 1GGQA 1Q0GA 4MVSA 4MVZA 2GDCA 2HV7A 4YL3A 2NSFA 3CAXA 4QI2A 1ORSC 5T3WA 1MQVA 5B3SC 4JEBA 4JVSA 4EWCA 3S29A 1D1AA 4C3DA 5KYXB 3F47A 4LERA 1BR2A 3B0PA 2FGYA 2A6EF 2XLEA 4YN0B 5HSWA 1U6HA 2YHSA 1NU7D 3EGDA 3ZG1A 2IXMA 5EGYA 3JSEO 2I8BA 4CDAA 2AVKA 3C7JA 4FAPB 1W2WA 2Q3TA 3O39A 2BL2A 1XZQA 2VASA 4OIQF 1ZU5A 2QNLA 4NCQA 5JUAA 3FDQA 4I44A 2UUIA 3OA1A 5L0CA 4U9EA 1TWHA 1ZVZA 1G4US 3Q6NA 3EQLF 2M64A 5EHHA 4I1OB 2DGJA 4IAQA 2KK1A 1SR2A 4JTCB 2MWQA 3DAGA 3G4ZA 2YKZA 5KYYB 3QVYA 3JSZA 3ZVRA 3V5ZA 1XWJA 4QDLA 1OKKA 4ZLCA 1HMDA 3A11A 5CI8A 5F5FA 2V26A 4Q7CA 3FVYA 3FXHA 3VRCA 1FMWA 4HEAJ 2OEVA 3LEOA 2HJMA 1OW6A 2A0UA 1OCOC 2KSFA 1F1MA 4U5HA 3BEHA 4N06A 5A69A 4IWBA 5DS4A 2EPOA 1FNTc 2XLWA 2IM8A 1NLXA 4E17A 4PJLA 1E86A 1HE1A 2HUJA 2WL8A 3EHNA 1QVXA 3EZHA 3IQ5A 1HMOA 4MVRA 5JSLA 3T6JA 2R7VA 2W4MA 3ZTMA 3TOLA 2NPUA 1VLTA 4X0RA 3ZDLA 2L7AA 2O9XA 2Q9CA 1CGNA 2YLGA 4BJ5A 2HZ8A 2HMQA 1AVOB 1JPNA 3L8JA 1OW8A 2KGOA 3TQOA 1YYXA 2Y3DA 2HSBA 4K0DA 3V5YA 1I4YA 5JP7A 4GEHA 4JJGA 3FAPB 1D1BA 3PDMP 4JTDB 2PP4A 4XPXA 3LS0A 1LI5A 1OR3A 1LPEA 1ZU4A 2A69F 2OEXA 4FESA 5L0GA 3Q6MA 3MBGA 3SXZA 2M4EA 1WWPA 2QTVA 4XWJA 2L6GA 4CIPA 2Y39A 5F28E 3TK0A 3S90A 1SMYF 1JMWA 3POVA 4NTFA 4P9TA 1EI7A 1LE2A 2WB7A 4CS9A 4BJ6A 4PK4A 2W45A 3DZAA 3EH2A 4OIRF 2J9WA 3GWNA 3DE8A 3AG2C 3QW0A 2YQYA 3AQCA 1E83A 5T1DB 1QPUA 3JYHA 2XLVA 3CZ6A 3LAYA 3NMKA 4RD9A 2R7RA 4G0HA 4JRZA 5CIVA 4BJ5C 2L6FA 1U0BB 4BJTA 1CGOA 3RW0A 3TJ6A 1BR1A 4DRIB 2G3KA 2DYSC 4A2NB 2ZPAA 3T6GB 4CSAA 1S7ZA 2R7UA 1SYQA 3W4YA 1J8MF 5DQTA 5JRAA 4CDYA 1HW2A 1FFHA 1G5ZA 1E85A 3GODA 2FFHA 4LLEA 2IYLD 4JW1A 5EK0A 5L0IA 3I5PA 3EFOB 3AGUA 4MQ9F 2LFFA 1LIHA 1ZZPA 2XS8A 3LNMB 1B68A 1O87A 3M79A 5FZTA 4UDVA 1M2VA 2R7SA 1MMNA 3WODF 1YDIA 4OINF 1CPRA 4MTOA 2H7OA 4DOZA 4XPWA 1YARO 4CS9C 4BJ6C 4ULVA 3U2MA 2Y3BA 3FAJA 3GM1A 4A4AA 2XLDA 3HNKA 3B0UX 2Q7RA 2ASRA 4CJOA 1VOMA 2RD9A 3E70C 3EGDB 2YL7A 1LKXA 1H9TA 3AQBA 2JD3A 1EA8A 2NUPB 3DJUB 3MYFA 3VF0A 5AC4A 3NDBB 1WATA 2HFIA 3U9JA 1C03A 4YL0A 2P6VA 5GPGB 4CSAC 5A6BD 1Z63A 3W8IA 3DM5A 4MW8A 1FFTC 2LFDA 2X51A 1MNEA 3H2VA 4O79A 2VCCA 3S27A 3PMRA 2J7PA 2XL4A 3C8GD 5T3TA 3JCUQ 2ZXOA 3FOPA 4QI0A 1WOLA 2CDQA 1TWGA 3K7DA 4RBNA 3K6BA 2A68F 4KNWA 1Z5ZA 1OR2A 3U3BA 3X2QC 3ZQVA 4D4NA 2HV6A 4XLNF 1KU2A 1N1CA 2YL0A 4C3BA 1RXQA 1FAPB 4Z9IA 1TFKB 2A6HF 2XXAA 2WVQA 2D4UA 4JJFA 1J8YF 1QSPA 1UG7A 1KTMA 3DAFA 5BQHA 4AE4B 4MTFA 5A6JA 2BC5A 2CNWA 2EIKC 3MYIA 5D91A 3S9OA 2Q00A 4E0IA 1Z3IX 1HW1A 2QUPA 2RSEB 4EUKB 1LS4A 4AL1A 1E84A 4N6HA 3SNHA 2XRHA 1LI7A 2R7TA 2WZLA 1U89A 2EIMC 4MVOA 1TWCA 5L0DA 1Q0MA 3ZC4A 1S05A 4FX5A 5KYWA 2J7PD 3L0IA 3QZCA 4G7ZF 1JPJA 2XM4A 3Q7GA 3JRMO 1LM3B 4JKVA 1NFNA 4MVMA 1V74B 2QLAA 1QQ3A 4NY3A 1H6GA 2P1AA 2DB4A 4E7SA 3I4UA 1H9GA 3FHDA 2EPNA 3NMJA 3AG4C 1T01A 2PF4E 2J0XA 4O6YA 1OCRC 1OXKA 1K05A 1Z6AA 2YEVA 4P9FA 3HTKC 2H8AA 2CNWD 5B1AC 3ATPA 2NUTA 1VLSA 2CW0F 3IQ6A 3KMIA 1ZHXA 2ETSA 2YLDA 1A41A 1ZW3A 2H7BA 2LD6A 3DE9A 4KC9A 5BQIA 4C7OB 4IGGA 4Q5SF 4LDQA 5A6AA 3G50A 3N24A 1YLMA 4U5DE 4YL1A 3SZRA 1RMVA 3ITFA 2P7VA 2C04A 5B3IA 1MNDA 2C03A 3C62A 3OWTA 3U8PA 1APCA 1RJ9A 4DRHB 2EPLX 3GM3A 3MLGA 3QMKA 4BG0A 4BJ1A 1Q0KA 3RYLA 2YVKA 4OD4A 3V7OA 4DVYP 3J06A 4KBLA 3EGXB 4JCHA 1VMAA 1K04A 4JC7A 1OCZC 4GYTA 1A0BA 2ICWG 3JRTA 4D4XA 3UNGC 3UGPA 2MHRA 4XEFA 1OKKD 2LK4A 4GQHA 3RIPA 1H7IA 2IXNA 1ZYRF 3ECSA 2R7QA 4JE9A 3T4RA 4EBBA 2Q9BA 1NZEA 3M1CB 5A6KA 3HKKA 2P0NA 2XM0A 3CSKA 4OD5A 4ZLDA 3Q7LA 1MMDA 4PACA 3C8ZA 2AP3A 1IZMA 2OQMA 1PCXA 3GWLA 4LDKA 3NYLA 2KC3A 1WN0A 4AK9A 3C8GB 1SF8A 3ZSUA 3S84A 4DJ9A 3UGOA 3E9VA 1M2VB 1TR2A 3UMKA 2CCYA 3SXKA 1DOWA 4XEVA 1YZAA 1T6IA 2ZXWC 4MNDA 2AWYA 4K7BA 3EZIA 4U5EE 2XLMA 4E0HA 3UR3C 3GORA 4PJJA 1EKYA 2B0JA 2Y3HA 2OU6A 1JRAA 1V54C 2VCAA 4YJWA 1R5ID 3CQZA 4IB4A 2OOCA 4JIOA 4MVQA 5AC5A 3R7CA 4WGZA 2CYDA 1K40A 4XEKA 1ST6A 5E3CA 2IOQA 1EQ1A 4LDRA 3EG9A 1YA9A 1FTSA 1YVIA 3KKBA 3C63A 4HFKB 4B6IA 3DXJF 1PD1A 4PJMA 3O10A 3DD7A 1CPQA 3K1HA 4BEJA 4JEAA 2YWAA 4R32A 5DLJA 1RKEA 2H7VC 3RQEA 4MS2A 3TOMA 4E7ZA 3HLZA 3L1MA 2YZSA 1M56C 4YK5A 2E87A 3SEOA 4G7HF 3CEXA 2J0WA 2R03A 4W8PA 1R4TA 3HNLA 4PJNA 3ZTZA 1OXBA 2WVOA 3S28A 3WG7C 5L0HA 1D0XA 2Y69C 2ZXRA 4NC3A 3PCVA 2Y3GA 1ORJA 3RH3A 2HKVA 3V5XA 2XSEA 1I4ZA 4U5CE 2F22A 3DM9B 1OCCC 2OKUA 4WJ0A 4XPYA 3IEEA 5HV9A 4XTKA 1VK5A 1MMAA 2WZFA 1M6TA 1NU9C 2XLHA 4J30B 4N4WA 2JPUA 3TD7A 4IAOA 3TJ5A 5KYUA 3US6A 5DS5A 2G3VA 5JS5A 3W2VA 1WGWA 1Y4CA 3EJNA 1G8XA 3NKDA 3RQGA 3JTLO 1O3UA 1GM5A 2NUTB 2HJ3A 1JOGA 3GANA 2AU5A 4NTAA 3ZQYA 2DYRC 2IXOA 1T6QA 3H65A 1PD0A 4CDVA 2YL1A 3VM6A 5E2QA 4BEMJ 2R7XA 3X1OA 3K33A 4I1MA 2QY9A 1I5NA 1NBBA 3AGTA 1ORYA 4U5BE 3O6XA 4IJJA 2GFHA 5AGFA 4AL0A 2YL3A 2ZD9A 2EIJC 2VB6A 3DJNB 5JT4A 1VTMP 1O5HA 1YA7O 2DI3A 1NSGB 3KL4A 3T6BA 4CS8A 3AG3C 3B0VC 2EPKX 1DOVA 4DBQA 1XZPA 2W9YA 1YZCA 2R25A 3EPVA 1VYKA 4YWQA 1RJ9B 2LQGA 3LLIA 1A7VA 2XLOA 3KYJA 2PBEA 2UUHA 1FR0A 3EFOA 1VB5A 4E18A 2XS1A 1ZW2A 3VYWA 5JLIA 3ZIBA 4J7TA 4EKWA 3M4BA 3VAYA 3R2PA 1YAUO 2L9JA 4PFPA 4AX2A 3HJCA 3U2LA 5B1BC 4CBEA 3ABKC 1L7CA 1Q0DA 2R7WA 3LUTB 2ZXPA 5E3AA 3NMIA 1V55C
chains in the Genus database with same CATH topology
1BR4A 1M57C 2KW3C 4G7OF 3NRHA 5DS6A 5E33A 2NUPA 1ZHZA 5FCLA 3ABLC 5L3QA 2VH3A 4O6NA 4FWVA 3PHF2 4CS8C 2D5RB 3F46A 4IRUA 4XLPF 4PFOA 4OIOF 3MX3A 1FMVA 2EINC 4O7GA 4LACB 3EH1A 5F5HA 4CIHA 3EG9B 4AE4A 3W2WA 2NG1A 5KYXA 5CI9A 4LLCA 4W8KA 4H4KC 4ULWA 4C3EA 2J45A 1QZXA 4JURI 2WVNA 3LESA 2Z15A 4J32B 3L34A 1D0ZA 2KQ9A 3LEVA 1IW7F 1ZHYA 2KJGA 3LS1A 4U5FE 2PX0A 3UMHA 2PFDA 1SZIA 4KI2A 2EILC 1LVKA 5KYYA 3B9QA 3ABMC 2R7OA 1Z23A 2LSEA 3NYJA 2A1DD 4YT8A 4OIPF 2J9VA 3ASNC 4C7OA 1ZHWA 2V3CC 3UMIA 4ANJA 5KYUB 1LS1A 5DQZA 3RFYA 1D0YA 2PX3A 4U5GA 2XXAB 1ZHTA 4M63A 3DMDA 3JT1A 4RDAA 3EGXA 3I5QA 3OEOA 2Q9AA 1QLEC 1TWAA 2KNHA 3K66A 3NYMA 2BE5F 5KYNA 3LLKA 4HE8D 5BUOA 2IXPA 4HFFB 4DBRA 3ASOC 2OCCC 2W4BA 2L81A 4YT4A 5KYWB 3LJBA 5IY5C 3SP1A 1TKNA 4P6IC 3SYNA 2OG2A 4KNVA 3RKOF 2CGEA 3KH2A 5DVWA 1VYIA 3N2ZB 5L3VA 4F4BA 4CS7A 2WZGA 1D1CA 2J9UA 3NG1A 1NG1A 4I3MA 4JZAA 3AG1C 3W8HA 2G62A 4Q4ZF 2J46A 3LNRA 3K1IC 1M2OA 5D92A 3N0TA 4YT5A 2MYSA 4DVZA 1MMGA 4YT2A 3EHMA 4O6MA 3NKEA 2HV7A 4QI2A 5T3WA 5B3SC 4JVSA 4EWCA 3S29A 1D1AA 4C3DA 5KYXB 3F47A 4LERA 1BR2A 3B0PA 2FGYA 2A6EF 4YN0B 5HSWA 2YHSA 1NU7D 3EGDA 3ZG1A 2IXMA 5EGYA 2I8BA 1W2WA 2Q3TA 3O39A 2VASA 4OIQF 1ZU5A 3FDQA 4I44A 3OA1A 1TWHA 3Q6NA 3EQLF 5EHHA 4I1OB 2DGJA 2MWQA 3DAGA 5KYYB 3JSZA 3ZVRA 4QDLA 1OKKA 4ZLCA 5CI8A 5F5FA 2V26A 4Q7CA 3FVYA 1FMWA 4HEAJ 1OCOC 4U5HA 4N06A 4IWBA 5DS4A 4PJLA 2WL8A 3EZHA 3EHNA 3T6JA 2R7VA 2W4MA 4X0RA 2O9XA 2Q9CA 4BJ5A 1JPNA 2KGOA 2Y3DA 4K0DA 4GEHA 4JJGA 1D1BA 2PP4A 3LS0A 4FESA 1ZU4A 2A69F 3Q6MA 2M4EA 2QTVA 4XWJA 2Y39A 1SMYF 3POVA 2WB7A 4CS9A 4BJ6A 4PK4A 2W45A 3DZAA 3EH2A 4OIRF 2J9WA 3AG2C 3AQCA 5T1DB 3JYHA 3CZ6A 3LAYA 4RD9A 2R7RA 4G0HA 4BJ5C 4BJTA 1BR1A 4CSAA 2G3KA 2DYSC 4A2NB 2ZPAA 2R7UA 1S7ZA 1J8MF 5DQTA 1FFHA 3GODA 2FFHA 4LLEA 2IYLD 4JW1A 3I5PA 3EFOB 4MQ9F 1O87A 1M2VA 2R7SA 1MMNA 3WODF 4OINF 2H7OA 4DOZA 4CS9C 4BJ6C 2Y3BA 3FAJA 3B0UX 1VOMA 3E70C 3EGDB 1LKXA 3AQBA 2JD3A 2NUPB 3DJUB 3NDBB 2P6VA 4CSAC 1Z63A 3W8IA 3DM5A 1FFTC 2X51A 1MNEA 4O79A 3S27A 3PMRA 2J7PA 2XL4A 5T3TA 3JCUQ 2ZXOA 4QI0A 2CDQA 1TWGA 3K7DA 4RBNA 3K6BA 2A68F 4KNWA 1Z5ZA 3X2QC 2HV6A 4XLNF 1KU2A 1N1CA 3S0XA 4C3BA 2XXAA 2A6HF 2WVQA 4JJFA 1J8YF 3DAFA 4AE4B 2CNWA 2EIKC 5D91A 1Z3IX 3SNHA 2XRHA 2R7TA 2WZLA 2EIMC 1TWCA 3ZC4A 4FX5A 5KYWA 2J7PD 3L0IA 3QZCA 4G7ZF 1JPJA 3Q7GA 4NY3A 4E7SA 3I4UA 3FHDA 3AG4C 2PF4E 2J0XA 4O6YA 1OCRC 2YEVA 1Z6AA 5B1AC 3HTKC 2CNWD 2NUTA 2CW0F 3KMIA 1ZHXA 2H7BA 4KC9A 4C7OB 4Q5SF 3N24A 4U5DE 3SZRA 3ITFA 2P7VA 2C04A 1MNDA 2C03A 3OWTA 1RJ9A 3MLGA 3QMKA 4BG0A 4BJ1A 3RYLA 4OD4A 4DVYP 3V7OA 4KBLA 3EGXB 4JCHA 1VMAA 1OCZC 4GYTA 3UGPA 3JRTA 3UNGC 1OKKD 3RIPA 2IXNA 1ZYRF 3ECSA 2R7QA 3T4RA 4EBBA 2Q9BA 1NZEA 3M1CB 3CSKA 4ZLDA 4OD5A 3Q7LA 1MMDA 1IZMA 1PCXA 3NYLA 4AK9A 1SF8A 3ZSUA 3UGOA 3E9VA 1M2VB 1TR2A 3UMKA 2ZXWC 4MNDA 4K7BA 4U5EE 3EZIA 3UR3C 4PJJA 2B0JA 2Y3HA 4YJWA 1V54C 3CQZA 1ST6A 5E3CA 2IOQA 3EG9A 1FTSA 3KKBA 4HFKB 4B6IA 3DXJF 1PD1A 4PJMA 3DD7A 4BEJA 3K1HA 5DLJA 2H7VC 4E7ZA 3HLZA 2YZSA 1M56C 3SEOA 2E87A 4G7HF 2J0WA 4PJNA 2WVOA 3S28A 3WG7C 1D0XA 2Y69C 2ZXRA 2Y3GA 3RH3A 2XSEA 4U5CE 3DM9B 1OCCC 4WJ0A 3IEEA 4XTKA 1VK5A 1MMAA 2WZFA 1NU9C 4J30B 3TD7A 4IAOA 5KYUA 5DS5A 2G3VA 3W2VA 1WGWA 3EJNA 1G8XA 3NKDA 2NUTB 3GANA 2DYRC 2IXOA 3H65A 1PD0A 5E2QA 2R7XA 3X1OA 3K33A 4I1MA 2QY9A 4U5BE 3O6XA 4IJJA 2GFHA 2EIJC 2VB6A 3DJNB 1O5HA 3T6BA 3KL4A 4CS8A 3AG3C 3B0VC 4DBQA 2W9YA 3EPVA 4YWQA 1VYKA 1RJ9B 3LLIA 3EFOA 3VYWA 3ZIBA 3VAYA 2L9JA 4PFPA 4AX2A 3HJCA 5B1BC 4CBEA 3ABKC 2R7WA 2ZXPA 5E3AA 1V55C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  3ZIB A;  4J30 B;  4JUR I;  4HFK B;  4B6I A;  4HFF B;  4J32 B; 
#chains in the Genus database with same CATH topology
 1BR4 A;  1KNY A;  3IQC A;  3B71 A;  1M57 C;  2KW3 C;  3M4C A;  4G7O F;  3NRH A;  3RQF A;  5DS6 A;  3HNI A;  1QKR A;  2EPM X;  5E33 A;  2OJE D;  2YLI A;  3DI5 A;  5K0I A;  2NUP A;  1ZHZ A;  1UFB A;  4DRJ B;  1OW7 A;  5FCL A;  3ABL C;  1G4W R;  5L3Q A;  3C18 A;  2VH3 A;  4O6N A;  1L3P A;  4FWV A;  3PHF 2;  1JAF A;  3TUL A;  1AUE A;  4PR9 A;  2D5R B;  4CS8 C;  1HY5 A;  2IBF A;  3F46 A;  4IRU A;  4ER9 A;  4XLP F;  1A7D A;  4PFO A;  3FMS A;  4OIO F;  3QTH A;  1JR8 A;  2HSQ A;  3O55 A;  1YYJ A;  3MX3 A;  1FMV A;  1NFO A;  2EIN C;  1V4A A;  1RCP A;  3RF3 A;  5COF A;  4O7G A;  1RKC A;  4LAC B;  1T6U A;  2GA0 A;  2XL6 A;  4NTB A;  3EH1 A;  5F5H A;  4BPM A;  4CJG A;  4CIH A;  4J7Y A;  3IHU A;  3GM2 A;  5JVE A;  3EG9 B;  4AE4 A;  3W2W A;  2NG1 A;  3U8V A;  3WHN A;  3BRJ A;  5KYX A;  5CI9 A;  3JZ0 A;  4JTA B;  1C17 M;  4WGY A;  4LLC A;  2YRF A;  4H4K C;  4W8K A;  4N6C A;  1T5O A;  4ULW A;  4C3E A;  2J45 A;  2L6H A;  3GEH A;  1RKE B;  3SXM A;  2XL8 A;  3FOO A;  256B A;  5L0F A;  1QZX A;  4JUR I;  2WVN A;  4CX9 A;  3LES A;  2Z15 A;  4J32 B;  3L34 A;  1D0Z A;  3HNJ A;  2KQ9 A;  3QW1 A;  1IW7 F;  3LEV A;  3U9M A;  1ZHY A;  2KJG A;  2I15 A;  3LS1 A;  3RVZ A;  4U5F E;  2AWC A;  2Q4F A;  3GEE A;  2PX0 A;  2R02 A;  3UMH A;  3U5S A;  3S0X A;  2PFD A;  3JYY A;  3B29 A;  2X0C A;  1T9K A;  1SZI A;  4KI2 A;  2EIL C;  1LVK A;  5KYY A;  3MFN A;  3A9C A;  5COG A;  3B9Q A;  3ABM C;  2R7O A;  1Z23 A;  2TMV P;  2LSE A;  2KYH A;  3NYJ A;  1BBH A;  2A1D D;  4YT8 A;  4EHP A;  4OIP F;  2J9V A;  3ASN C;  4C7O A;  1ZHW A;  1TFO B;  4Z9J A;  2V3C C;  3UMI A;  4ANJ A;  2LIG A;  1LE4 A;  1LS1 A;  2PNO A;  3DWW A;  5KYU B;  3ZWI A;  5DQZ A;  3RVY A;  3RFY A;  4ONS A;  4WAB A;  1D0Y A;  2PX3 A;  1Z7Q c;  4U5G A;  1HE9 A;  3SXY A;  4EIY A;  1TQG A;  4DXW A;  2XXA B;  1ZHT A;  3IPM O;  2HMZ A;  4M63 A;  3DMD A;  3JT1 A;  1YJG A;  1E2X A;  3EGX A;  3I5Q A;  4RDA A;  4Z9H A;  3OEO A;  3WAQ A;  1C02 A;  2Q9A A;  1QLE C;  1TWA A;  2KNH A;  3K66 A;  3NYM A;  2J9B A;  2JX0 A;  2BE5 F;  1OQC A;  3K1I A;  4JCZ A;  4MTG A;  3LLK A;  5KYN A;  5TJ5 E;  3H2U A;  3T9O A;  5COM A;  4HE8 D;  5BUO A;  2IXP A;  4H54 A;  4HFF B;  2J8W A;  4DBR A;  3ASO C;  2OCC C;  2W4B A;  2L81 A;  4YT4 A;  5A6B A;  5KYW B;  3LJB A;  5IY5 C;  3AOU A;  2QE9 A;  1GQA A;  4IAR A;  3SP1 A;  1GS9 A;  1A7E A;  3G4X A;  3C8G A;  4K1O A;  4NQF A;  3U3F A;  1BZ4 A;  2VCB A;  1PV3 A;  1TKN A;  2GAQ A;  2OG2 A;  1WTY A;  3QVZ A;  4KNV A;  4P6I C;  1WAS A;  3AJM A;  2LP4 A;  3RKO F;  4EBK A;  4MVU A;  2CGE A;  2VC9 A;  2LCH A;  3DKA A;  3KH2 A;  1VYI A;  3N2Z B;  4L6R A;  5DVW A;  5BQG A;  1Y6D A;  4F4B A;  5L3V A;  4CS7 A;  2WZG A;  2B0H A;  1AEP A;  1D1C A;  2J9U A;  5L0J A;  3NG1 A;  2HS5 A;  1NG1 A;  3IQT A;  4I3M A;  4JZA A;  4EBJ A;  3AG1 C;  3W8H A;  4U9D A;  3L8I A;  2R9R B;  2G62 A;  3KYI A;  3U0C A;  4MW3 A;  2FAP B;  4Q4Z F;  2J46 A;  3LNR A;  3K1I C;  1M2O A;  3KPH A;  5D92 A;  3SYN A;  3N0T A;  4YT5 A;  2MYS A;  2P61 A;  3M15 A;  2GWW A;  1CGM E;  2OJQ A;  1Q0F A;  2A0B A;  2NSG A;  4XQ1 A;  4DVZ A;  1MMG A;  2R05 A;  4G78 A;  1BDJ B;  4YT2 A;  3EHM A;  4O6M A;  3NKE A;  3GEI A;  1GGQ A;  1Q0G A;  4MVS A;  4MVZ A;  2GDC A;  2HV7 A;  4YL3 A;  2NSF A;  3CAX A;  4QI2 A;  1ORS C;  5T3W A;  1MQV A;  5B3S C;  4JEB A;  4JVS A;  4EWC A;  3S29 A;  1D1A A;  4C3D A;  5KYX B;  3F47 A;  4LER A;  1BR2 A;  3B0P A;  2FGY A;  2A6E F;  2XLE A;  4YN0 B;  5HSW A;  1U6H A;  2YHS A;  1NU7 D;  3EGD A;  3ZG1 A;  2IXM A;  5EGY A;  3JSE O;  2I8B A;  4CDA A;  2AVK A;  3C7J A;  4FAP B;  1W2W A;  2Q3T A;  3O39 A;  2BL2 A;  1XZQ A;  2VAS A;  4OIQ F;  1ZU5 A;  2QNL A;  4NCQ A;  5JUA A;  3FDQ A;  4I44 A;  2UUI A;  3OA1 A;  5L0C A;  4U9E A;  1TWH A;  1ZVZ A;  1G4U S;  3Q6N A;  3EQL F;  2M64 A;  5EHH A;  4I1O B;  2DGJ A;  4IAQ A;  2KK1 A;  1SR2 A;  4JTC B;  2MWQ A;  3DAG A;  3G4Z A;  2YKZ A;  5KYY B;  3QVY A;  3JSZ A;  3ZVR A;  3V5Z A;  1XWJ A;  4QDL A;  1OKK A;  4ZLC A;  1HMD A;  3A11 A;  5CI8 A;  5F5F A;  2V26 A;  4Q7C A;  3FVY A;  3FXH A;  3VRC A;  1FMW A;  4HEA J;  2OEV A;  3LEO A;  2HJM A;  1OW6 A;  2A0U A;  1OCO C;  2KSF A;  1F1M A;  4U5H A;  3BEH A;  4N06 A;  5A69 A;  4IWB A;  5DS4 A;  2EPO A;  1FNT c;  2XLW A;  2IM8 A;  1NLX A;  4E17 A;  4PJL A;  1E86 A;  1HE1 A;  2HUJ A;  2WL8 A;  3EHN A;  1QVX A;  3EZH A;  3IQ5 A;  1HMO A;  4MVR A;  5JSL A;  3T6J A;  2R7V A;  2W4M A;  3ZTM A;  3TOL A;  2NPU A;  1VLT A;  4X0R A;  3ZDL A;  2L7A A;  2O9X A;  2Q9C A;  1CGN A;  2YLG A;  4BJ5 A;  2HZ8 A;  2HMQ A;  1AVO B;  1JPN A;  3L8J A;  1OW8 A;  2KGO A;  3TQO A;  1YYX A;  2Y3D A;  2HSB A;  4K0D A;  3V5Y A;  1I4Y A;  5JP7 A;  4GEH A;  4JJG A;  3FAP B;  1D1B A;  3PDM P;  4JTD B;  2PP4 A;  4XPX A;  3LS0 A;  1LI5 A;  1OR3 A;  1LPE A;  1ZU4 A;  2A69 F;  2OEX A;  4FES A;  5L0G A;  3Q6M A;  3MBG A;  3SXZ A;  2M4E A;  1WWP A;  2QTV A;  4XWJ A;  2L6G A;  4CIP A;  2Y39 A;  5F28 E;  3TK0 A;  3S90 A;  1SMY F;  1JMW A;  3POV A;  4NTF A;  4P9T A;  1EI7 A;  1LE2 A;  2WB7 A;  4CS9 A;  4BJ6 A;  4PK4 A;  2W45 A;  3DZA A;  3EH2 A;  4OIR F;  2J9W A;  3GWN A;  3DE8 A;  3AG2 C;  3QW0 A;  2YQY A;  3AQC A;  1E83 A;  5T1D B;  1QPU A;  3JYH A;  2XLV A;  3CZ6 A;  3LAY A;  3NMK A;  4RD9 A;  2R7R A;  4G0H A;  4JRZ A;  5CIV A;  4BJ5 C;  2L6F A;  1U0B B;  4BJT A;  1CGO A;  3RW0 A;  3TJ6 A;  1BR1 A;  4DRI B;  2G3K A;  2DYS C;  4A2N B;  2ZPA A;  3T6G B;  4CSA A;  1S7Z A;  2R7U A;  1SYQ A;  3W4Y A;  1J8M F;  5DQT A;  5JRA A;  4CDY A;  1HW2 A;  1FFH A;  1G5Z A;  1E85 A;  3GOD A;  2FFH A;  4LLE A;  2IYL D;  4JW1 A;  5EK0 A;  5L0I A;  3I5P A;  3EFO B;  3AGU A;  4MQ9 F;  2LFF A;  1LIH A;  1ZZP A;  2XS8 A;  3LNM B;  1B68 A;  1O87 A;  3M79 A;  5FZT A;  4UDV A;  1M2V A;  2R7S A;  1MMN A;  3WOD F;  1YDI A;  4OIN F;  1CPR A;  4MTO A;  2H7O A;  4DOZ A;  4XPW A;  1YAR O;  4CS9 C;  4BJ6 C;  4ULV A;  3U2M A;  2Y3B A;  3FAJ A;  3GM1 A;  4A4A A;  2XLD A;  3HNK A;  3B0U X;  2Q7R A;  2ASR A;  4CJO A;  1VOM A;  2RD9 A;  3E70 C;  3EGD B;  2YL7 A;  1LKX A;  1H9T A;  3AQB A;  2JD3 A;  1EA8 A;  2NUP B;  3DJU B;  3MYF A;  3VF0 A;  5AC4 A;  3NDB B;  1WAT A;  2HFI A;  3U9J A;  1C03 A;  4YL0 A;  2P6V A;  5GPG B;  4CSA C;  5A6B D;  1Z63 A;  3W8I A;  3DM5 A;  4MW8 A;  1FFT C;  2LFD A;  2X51 A;  1MNE A;  3H2V A;  4O79 A;  2VCC A;  3S27 A;  3PMR A;  2J7P A;  2XL4 A;  3C8G D;  5T3T A;  3JCU Q;  2ZXO A;  3FOP A;  4QI0 A;  1WOL A;  2CDQ A;  1TWG A;  3K7D A;  4RBN A;  3K6B A;  2A68 F;  4KNW A;  1Z5Z A;  1OR2 A;  3U3B A;  3X2Q C;  3ZQV A;  4D4N A;  2HV6 A;  4XLN F;  1KU2 A;  1N1C A;  2YL0 A;  4C3B A;  1RXQ A;  1FAP B;  4Z9I A;  1TFK B;  2A6H F;  2XXA A;  2WVQ A;  2D4U A;  4JJF A;  1J8Y F;  1QSP A;  1UG7 A;  1KTM A;  3DAF A;  5BQH A;  4AE4 B;  4MTF A;  5A6J A;  2BC5 A;  2CNW A;  2EIK C;  3MYI A;  5D91 A;  3S9O A;  2Q00 A;  4E0I A;  1Z3I X;  1HW1 A;  2QUP A;  2RSE B;  4EUK B;  1LS4 A;  4AL1 A;  1E84 A;  4N6H A;  3SNH A;  2XRH A;  1LI7 A;  2R7T A;  2WZL A;  1U89 A;  2EIM C;  4MVO A;  1TWC A;  5L0D A;  1Q0M A;  3ZC4 A;  1S05 A;  4FX5 A;  5KYW A;  2J7P D;  3L0I A;  3QZC A;  4G7Z F;  1JPJ A;  2XM4 A;  3Q7G A;  3JRM O;  1LM3 B;  4JKV A;  1NFN A;  4MVM A;  1V74 B;  2QLA A;  1QQ3 A;  4NY3 A;  1H6G A;  2P1A A;  2DB4 A;  4E7S A;  3I4U A;  1H9G A;  3FHD A;  2EPN A;  3NMJ A;  3AG4 C;  1T01 A;  2PF4 E;  2J0X A;  4O6Y A;  1OCR C;  1OXK A;  1K05 A;  1Z6A A;  2YEV A;  4P9F A;  3HTK C;  2H8A A;  2CNW D;  5B1A C;  3ATP A;  2NUT A;  1VLS A;  2CW0 F;  3IQ6 A;  3KMI A;  1ZHX A;  2ETS A;  2YLD A;  1A41 A;  1ZW3 A;  2H7B A;  2LD6 A;  3DE9 A;  4KC9 A;  5BQI A;  4C7O B;  4IGG A;  4Q5S F;  4LDQ A;  5A6A A;  3G50 A;  3N24 A;  1YLM A;  4U5D E;  4YL1 A;  3SZR A;  1RMV A;  3ITF A;  2P7V A;  2C04 A;  5B3I A;  1MND A;  2C03 A;  3C62 A;  3OWT A;  3U8P A;  1APC A;  1RJ9 A;  4DRH B;  2EPL X;  3GM3 A;  3MLG A;  3QMK A;  4BG0 A;  4BJ1 A;  1Q0K A;  3RYL A;  2YVK A;  4OD4 A;  3V7O A;  4DVY P;  3J06 A;  4KBL A;  3EGX B;  4JCH A;  1VMA A;  1K04 A;  4JC7 A;  1OCZ C;  4GYT A;  1A0B A;  2ICW G;  3JRT A;  4D4X A;  3UNG C;  3UGP A;  2MHR A;  4XEF A;  1OKK D;  2LK4 A;  4GQH A;  3RIP A;  1H7I A;  2IXN A;  1ZYR F;  3ECS A;  2R7Q A;  4JE9 A;  3T4R A;  4EBB A;  2Q9B A;  1NZE A;  3M1C B;  5A6K A;  3HKK A;  2P0N A;  2XM0 A;  3CSK A;  4OD5 A;  4ZLD A;  3Q7L A;  1MMD A;  4PAC A;  3C8Z A;  2AP3 A;  1IZM A;  2OQM A;  1PCX A;  3GWL A;  4LDK A;  3NYL A;  2KC3 A;  1WN0 A;  4AK9 A;  3C8G B;  1SF8 A;  3ZSU A;  3S84 A;  4DJ9 A;  3UGO A;  3E9V A;  1M2V B;  1TR2 A;  3UMK A;  2CCY A;  3SXK A;  1DOW A;  4XEV A;  1YZA A;  1T6I A;  2ZXW C;  4MND A;  2AWY A;  4K7B A;  3EZI A;  4U5E E;  2XLM A;  4E0H A;  3UR3 C;  3GOR A;  4PJJ A;  1EKY A;  2B0J A;  2Y3H A;  2OU6 A;  1JRA A;  1V54 C;  2VCA A;  4YJW A;  1R5I D;  3CQZ A;  4IB4 A;  2OOC A;  4JIO A;  4MVQ A;  5AC5 A;  3R7C A;  4WGZ A;  2CYD A;  1K40 A;  4XEK A;  1ST6 A;  5E3C A;  2IOQ A;  1EQ1 A;  4LDR A;  3EG9 A;  1YA9 A;  1FTS A;  1YVI A;  3KKB A;  3C63 A;  4HFK B;  4B6I A;  3DXJ F;  1PD1 A;  4PJM A;  3O10 A;  3DD7 A;  1CPQ A;  3K1H A;  4BEJ A;  4JEA A;  2YWA A;  4R32 A;  5DLJ A;  1RKE A;  2H7V C;  3RQE A;  4MS2 A;  3TOM A;  4E7Z A;  3HLZ A;  3L1M A;  2YZS A;  1M56 C;  4YK5 A;  2E87 A;  3SEO A;  4G7H F;  3CEX A;  2J0W A;  2R03 A;  4W8P A;  1R4T A;  3HNL A;  4PJN A;  3ZTZ A;  1OXB A;  2WVO A;  3S28 A;  3WG7 C;  5L0H A;  1D0X A;  2Y69 C;  2ZXR A;  4NC3 A;  3PCV A;  2Y3G A;  1ORJ A;  3RH3 A;  2HKV A;  3V5X A;  2XSE A;  1I4Z A;  4U5C E;  2F22 A;  3DM9 B;  1OCC C;  2OKU A;  4WJ0 A;  4XPY A;  3IEE A;  5HV9 A;  4XTK A;  1VK5 A;  1MMA A;  2WZF A;  1M6T A;  1NU9 C;  2XLH A;  4J30 B;  4N4W A;  2JPU A;  3TD7 A;  4IAO A;  3TJ5 A;  5KYU A;  3US6 A;  5DS5 A;  2G3V A;  5JS5 A;  3W2V A;  1WGW A;  1Y4C A;  3EJN A;  1G8X A;  3NKD A;  3RQG A;  3JTL O;  1O3U A;  1GM5 A;  2NUT B;  2HJ3 A;  1JOG A;  3GAN A;  2AU5 A;  4NTA A;  3ZQY A;  2DYR C;  2IXO A;  1T6Q A;  3H65 A;  1PD0 A;  4CDV A;  2YL1 A;  3VM6 A;  5E2Q A;  4BEM J;  2R7X A;  3X1O A;  3K33 A;  4I1M A;  2QY9 A;  1I5N A;  1NBB A;  3AGT A;  1ORY A;  4U5B E;  3O6X A;  4IJJ A;  2GFH A;  5AGF A;  4AL0 A;  2YL3 A;  2ZD9 A;  2EIJ C;  2VB6 A;  3DJN B;  5JT4 A;  1VTM P;  1O5H A;  1YA7 O;  2DI3 A;  1NSG B;  3KL4 A;  3T6B A;  4CS8 A;  3AG3 C;  3B0V C;  2EPK X;  1DOV A;  4DBQ A;  1XZP A;  2W9Y A;  1YZC A;  2R25 A;  3EPV A;  1VYK A;  4YWQ A;  1RJ9 B;  2LQG A;  3LLI A;  1A7V A;  2XLO A;  3KYJ A;  2PBE A;  2UUH A;  1FR0 A;  3EFO A;  1VB5 A;  4E18 A;  2XS1 A;  1ZW2 A;  3VYW A;  5JLI A;  3ZIB A;  4J7T A;  4EKW A;  3M4B A;  3VAY A;  3R2P A;  1YAU O;  2L9J A;  4PFP A;  4AX2 A;  3HJC A;  3U2L A;  5B1B C;  4CBE A;  3ABK C;  1L7C A;  1Q0D A;  2R7W A;  3LUT B;  2ZXP A;  5E3A A;  3NMI A;  1V55 C; 
#chains in the Genus database with same CATH homology
 1BR4 A;  1M57 C;  2KW3 C;  4G7O F;  3NRH A;  5DS6 A;  5E33 A;  2NUP A;  1ZHZ A;  5FCL A;  3ABL C;  5L3Q A;  2VH3 A;  4O6N A;  4FWV A;  3PHF 2;  4CS8 C;  2D5R B;  3F46 A;  4IRU A;  4XLP F;  4PFO A;  4OIO F;  3MX3 A;  1FMV A;  2EIN C;  4O7G A;  4LAC B;  3EH1 A;  5F5H A;  4CIH A;  3EG9 B;  4AE4 A;  3W2W A;  2NG1 A;  5KYX A;  5CI9 A;  4LLC A;  4W8K A;  4H4K C;  4ULW A;  4C3E A;  2J45 A;  1QZX A;  4JUR I;  2WVN A;  3LES A;  2Z15 A;  4J32 B;  3L34 A;  1D0Z A;  2KQ9 A;  3LEV A;  1IW7 F;  1ZHY A;  2KJG A;  3LS1 A;  4U5F E;  2PX0 A;  3UMH A;  2PFD A;  1SZI A;  4KI2 A;  2EIL C;  1LVK A;  5KYY A;  3B9Q A;  3ABM C;  2R7O A;  1Z23 A;  2LSE A;  3NYJ A;  2A1D D;  4YT8 A;  4OIP F;  2J9V A;  3ASN C;  4C7O A;  1ZHW A;  2V3C C;  3UMI A;  4ANJ A;  5KYU B;  1LS1 A;  5DQZ A;  3RFY A;  1D0Y A;  2PX3 A;  4U5G A;  2XXA B;  1ZHT A;  4M63 A;  3DMD A;  3JT1 A;  4RDA A;  3EGX A;  3I5Q A;  3OEO A;  2Q9A A;  1QLE C;  1TWA A;  2KNH A;  3K66 A;  3NYM A;  2BE5 F;  5KYN A;  3LLK A;  4HE8 D;  5BUO A;  2IXP A;  4HFF B;  4DBR A;  3ASO C;  2OCC C;  2W4B A;  2L81 A;  4YT4 A;  5KYW B;  3LJB A;  5IY5 C;  3SP1 A;  1TKN A;  4P6I C;  3SYN A;  2OG2 A;  4KNV A;  3RKO F;  2CGE A;  3KH2 A;  5DVW A;  1VYI A;  3N2Z B;  5L3V A;  4F4B A;  4CS7 A;  2WZG A;  1D1C A;  2J9U A;  3NG1 A;  1NG1 A;  4I3M A;  4JZA A;  3AG1 C;  3W8H A;  2G62 A;  4Q4Z F;  2J46 A;  3LNR A;  3K1I C;  1M2O A;  5D92 A;  3N0T A;  4YT5 A;  2MYS A;  4DVZ A;  1MMG A;  4YT2 A;  3EHM A;  4O6M A;  3NKE A;  2HV7 A;  4QI2 A;  5T3W A;  5B3S C;  4JVS A;  4EWC A;  3S29 A;  1D1A A;  4C3D A;  5KYX B;  3F47 A;  4LER A;  1BR2 A;  3B0P A;  2FGY A;  2A6E F;  4YN0 B;  5HSW A;  2YHS A;  1NU7 D;  3EGD A;  3ZG1 A;  2IXM A;  5EGY A;  2I8B A;  1W2W A;  2Q3T A;  3O39 A;  2VAS A;  4OIQ F;  1ZU5 A;  3FDQ A;  4I44 A;  3OA1 A;  1TWH A;  3Q6N A;  3EQL F;  5EHH A;  4I1O B;  2DGJ A;  2MWQ A;  3DAG A;  5KYY B;  3JSZ A;  3ZVR A;  4QDL A;  1OKK A;  4ZLC A;  5CI8 A;  5F5F A;  2V26 A;  4Q7C A;  3FVY A;  1FMW A;  4HEA J;  1OCO C;  4U5H A;  4N06 A;  4IWB A;  5DS4 A;  4PJL A;  2WL8 A;  3EZH A;  3EHN A;  3T6J A;  2R7V A;  2W4M A;  4X0R A;  2O9X A;  2Q9C A;  4BJ5 A;  1JPN A;  2KGO A;  2Y3D A;  4K0D A;  4GEH A;  4JJG A;  1D1B A;  2PP4 A;  3LS0 A;  4FES A;  1ZU4 A;  2A69 F;  3Q6M A;  2M4E A;  2QTV A;  4XWJ A;  2Y39 A;  1SMY F;  3POV A;  2WB7 A;  4CS9 A;  4BJ6 A;  4PK4 A;  2W45 A;  3DZA A;  3EH2 A;  4OIR F;  2J9W A;  3AG2 C;  3AQC A;  5T1D B;  3JYH A;  3CZ6 A;  3LAY A;  4RD9 A;  2R7R A;  4G0H A;  4BJ5 C;  4BJT A;  1BR1 A;  4CSA A;  2G3K A;  2DYS C;  4A2N B;  2ZPA A;  2R7U A;  1S7Z A;  1J8M F;  5DQT A;  1FFH A;  3GOD A;  2FFH A;  4LLE A;  2IYL D;  4JW1 A;  3I5P A;  3EFO B;  4MQ9 F;  1O87 A;  1M2V A;  2R7S A;  1MMN A;  3WOD F;  4OIN F;  2H7O A;  4DOZ A;  4CS9 C;  4BJ6 C;  2Y3B A;  3FAJ A;  3B0U X;  1VOM A;  3E70 C;  3EGD B;  1LKX A;  3AQB A;  2JD3 A;  2NUP B;  3DJU B;  3NDB B;  2P6V A;  4CSA C;  1Z63 A;  3W8I A;  3DM5 A;  1FFT C;  2X51 A;  1MNE A;  4O79 A;  3S27 A;  3PMR A;  2J7P A;  2XL4 A;  5T3T A;  3JCU Q;  2ZXO A;  4QI0 A;  2CDQ A;  1TWG A;  3K7D A;  4RBN A;  3K6B A;  2A68 F;  4KNW A;  1Z5Z A;  3X2Q C;  2HV6 A;  4XLN F;  1KU2 A;  1N1C A;  3S0X A;  4C3B A;  2XXA A;  2A6H F;  2WVQ A;  4JJF A;  1J8Y F;  3DAF A;  4AE4 B;  2CNW A;  2EIK C;  5D91 A;  1Z3I X;  3SNH A;  2XRH A;  2R7T A;  2WZL A;  2EIM C;  1TWC A;  3ZC4 A;  4FX5 A;  5KYW A;  2J7P D;  3L0I A;  3QZC A;  4G7Z F;  1JPJ A;  3Q7G A;  4NY3 A;  4E7S A;  3I4U A;  3FHD A;  3AG4 C;  2PF4 E;  2J0X A;  4O6Y A;  1OCR C;  2YEV A;  1Z6A A;  5B1A C;  3HTK C;  2CNW D;  2NUT A;  2CW0 F;  3KMI A;  1ZHX A;  2H7B A;  4KC9 A;  4C7O B;  4Q5S F;  3N24 A;  4U5D E;  3SZR A;  3ITF A;  2P7V A;  2C04 A;  1MND A;  2C03 A;  3OWT A;  1RJ9 A;  3MLG A;  3QMK A;  4BG0 A;  4BJ1 A;  3RYL A;  4OD4 A;  4DVY P;  3V7O A;  4KBL A;  3EGX B;  4JCH A;  1VMA A;  1OCZ C;  4GYT A;  3UGP A;  3JRT A;  3UNG C;  1OKK D;  3RIP A;  2IXN A;  1ZYR F;  3ECS A;  2R7Q A;  3T4R A;  4EBB A;  2Q9B A;  1NZE A;  3M1C B;  3CSK A;  4ZLD A;  4OD5 A;  3Q7L A;  1MMD A;  1IZM A;  1PCX A;  3NYL A;  4AK9 A;  1SF8 A;  3ZSU A;  3UGO A;  3E9V A;  1M2V B;  1TR2 A;  3UMK A;  2ZXW C;  4MND A;  4K7B A;  4U5E E;  3EZI A;  3UR3 C;  4PJJ A;  2B0J A;  2Y3H A;  4YJW A;  1V54 C;  3CQZ A;  1ST6 A;  5E3C A;  2IOQ A;  3EG9 A;  1FTS A;  3KKB A;  4HFK B;  4B6I A;  3DXJ F;  1PD1 A;  4PJM A;  3DD7 A;  4BEJ A;  3K1H A;  5DLJ A;  2H7V C;  4E7Z A;  3HLZ A;  2YZS A;  1M56 C;  3SEO A;  2E87 A;  4G7H F;  2J0W A;  4PJN A;  2WVO A;  3S28 A;  3WG7 C;  1D0X A;  2Y69 C;  2ZXR A;  2Y3G A;  3RH3 A;  2XSE A;  4U5C E;  3DM9 B;  1OCC C;  4WJ0 A;  3IEE A;  4XTK A;  1VK5 A;  1MMA A;  2WZF A;  1NU9 C;  4J30 B;  3TD7 A;  4IAO A;  5KYU A;  5DS5 A;  2G3V A;  3W2V A;  1WGW A;  3EJN A;  1G8X A;  3NKD A;  2NUT B;  3GAN A;  2DYR C;  2IXO A;  3H65 A;  1PD0 A;  5E2Q A;  2R7X A;  3X1O A;  3K33 A;  4I1M A;  2QY9 A;  4U5B E;  3O6X A;  4IJJ A;  2GFH A;  2EIJ C;  2VB6 A;  3DJN B;  1O5H A;  3T6B A;  3KL4 A;  4CS8 A;  3AG3 C;  3B0V C;  4DBQ A;  2W9Y A;  3EPV A;  4YWQ A;  1VYK A;  1RJ9 B;  3LLI A;  3EFO A;  3VYW A;  3ZIB A;  3VAY A;  2L9J A;  4PFP A;  4AX2 A;  3HJC A;  5B1B C;  4CBE A;  3ABK C;  2R7W A;  2ZXP A;  5E3A A;  1V55 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...