4JURI

Crystal structure of the effector tae4 from salmonella typhimurium in complex with the immunity tai4 from enterobacter cloacae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
TLPDISTFSQQQIFENWVQNRCIGKIADSKSLKEDADASAAAWLEASNLPAENFEKADEVIVSLLKQKVGGTEPGHYQILKCTLIANSDAIRPLKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative cytoplasmic protein
publication title Insights into the cross-immunity mechanism within effector families of bacteria type VI secretion system from the structure of StTae4-EcTai4 complex
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 34
structure length 97
sequence length 97
chains with identical sequence J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jurI00
4HFFB 4B6IA 3ZIBA 4J30B 4JURI 4HFKB 4AX2A 4J32B
chains in the Genus database with same CATH superfamily
1M56C 2YKZA 2EIJC 2XS8A 4ONSA 2L81A 4PR9A 4FWVA 2FFHA 2WVQA 3ITFA 3NMJA 4JJFA 4OD5A 5A6BD 4LACB 3G4XA 4K0DA 4MVUA 3ZWIA 3VRCA 3K1IA 3S84A 1D1AA 3U0CA 5JSLA 4YT8A 3CEXA 1I5NA 2W4MA 3LS0A 1TQGA 1C02A 2YWAA 3AGTA 4P9FA 2D5RB 2W4BA 1LE4A 4EKWA 3WAQA 1KU2A 3EH2A 2NUPB 3EQLF 1E86A 3ZG1A 1AVOB 3POVA 1OKKA 3K66A 4CDYA 3AGUA 4X0RA 1HW2A 2G3KA 1FFTC 4JURI 4D4XA 1A7EA 3SXMA 1Z6AA 2YL1A 3DM5A 4JIOA 3QTHA 4YL3A 2Q9AA 1FFHA 4PFOA 2QNLA 1PD0A 2Q4FA 4HE8D 3RQFA 3HNKA 2J0WA 4I3MA 4U5FE 3MBGA 3C8GB 3QW0A 4K7BA 5KYXB 3ATPA 3TJ6A 3RKOF 2IYLD 3UMKA 4DXWA 1R4TA 4O7GA 3JYYA 4U5EE 2CW0F 5JRAA 1H6GA 3PHF2 1RMVA 2XM4A 1HW1A 4WGYA 1YAUO 5DQTA 1AUEA 2J9VA 1HY5A 2ZXWC 3ABLC 4YL0A 3ZQVA 5DS5A 3HNJA 4OD4A 1EKYA 1D0YA 1NSGB 3GORA 5B3IA 2Q00A 4NTAA 1LM3B 1ZHXA 3ZC4A 4MS2A 1Z23A 3TOLA 3GODA 2VASA 1LKXA 1LI7A 2OEXA 4XEFA 1M2VA 3MYIA 2A68F 5T3WA 1TWGA 2NG1A 2QUPA 1C17M 3AOUA 3DD7A 3WG7C 2J46A 4IAOA 1OXBA 2XS1A 1KTMA 2XLVA 1RKEB 3C8GD 4E7ZA 4FESA 3DE9A 1ORJA 1QPUA 3EGDB 4YL1A 3ZIBA 4BJ6C 4OIPF 3M1CB 2XXAA 3O6XA 5JS5A 3DMDA 2F22A 1XWJA 2UUHA 3T4RA 3W2VA 1S7ZA 4J7YA 1Z3IX 3GEEA 3KPHA 3L1MA 4N6CA 5KYUA 2CYDA 1QQ3A 3GEIA 3DAFA 4NCQA 2NSFA 1TKNA 4XLNF 2A6EF 4DVYP 3IEEA 1QLEC 1T5OA 4I1MA 2PP4A 2VB6A 4ANJA 4ER9A 4G7OF 1O87A 2BE5F 4EIYA 1MQVA 5L3VA 3ZQYA 4JEAA 1JRAA 1OCCC 3NKEA 4JTCB 5DS4A 1H9TA 5DLJA 4C7OA 3Q6NA 4E18A 2EINC 5T1DB 3SP1A 4YT5A 3V5YA 1ZZPA 4BJTA 2AP3A 2HUJA 5L0DA 2RSEB 2HMQA 3JT1A 3U9JA 3B29A 3M4BA 2B0HA 3N24A 1K40A 5DVWA 4U9DA 2A0BA 1I4ZA 3RVYA 4BJ5C 2J9UA 5HSWA 3ZTMA 4KNWA 2CNWA 4AL1A 2DB4A 5BUOA 3RFYA 2ETSA 3KMIA 3NKDA 1M6TA 3SZRA 4Q5SF 2WZLA 3ZTZA 2OOCA 3FAJA 3FDQA 3DAGA 3LEOA 5B3SC 4RDAA 3LAYA 4DBQA 4EUKB 3EG9A 4XWJA 2BL2A 2KJGA 1W2WA 4JW1A 2EPKX 3EHNA 2KYHA 4AE4B 1T9KA 2ZD9A 2GWWA 3S28A 1FMWA 2WZFA 1WOLA 5D91A 1YVIA 1GQAA 3EZHA 3K7DA 4XEVA 1YLMA 2XRHA 3H65A 5AGFA 2YLDA 1JOGA 2H8AA 2QTVA 2L9JA 2YRFA 3L8JA 4IGGA 4YWQA 5A69A 3LEVA 4JE9A 1NLXA 4OINF 3C7JA 4EBJA 1OKKD 2DI3A 4IWBA 2IOQA 2KNHA 1TWHA 2Y69C 2XL4A 1OCRC 2Y3BA 3NRHA 1WN0A 3RQEA 2L7AA 3PCVA 1XZPA 4IJJA 1E84A 1AEPA 2ZXPA 4ULVA 2A6HF 2YQYA 4BG0A 1M2VB 4CIPA 1A7DA 2WZGA 4IB4A 3NYMA 2A0UA 1OW6A 3KYIA 4LERA 1QKRA 3CSKA 3FHDA 3TK0A 3MX3A 1BZ4A 1WWPA 2H7BA 3ZDLA 4CS8A 3S27A 1SR2A 1LI5A 4CS9A 3N0TA 2XXAB 1OR3A 3F46A 2P61A 2FGYA 2D4UA 5EK0A 4CDVA 4ZLCA 2B0JA 3UMHA 4Z9HA 4PJNA 3OEOA 3T6JA 5KYUB 3GM1A 4CS7A 2J7PA 1F1MA 1YYXA 2QE9A 1CGNA 4PK4A 1EQ1A 3QZCA 1MMAA 3SYNA 2PF4E 4W8PA 1ZHZA 4J7TA 4U5CE 1V54C 2EPMX 2O9XA 3K1HA 3RVZA 2J0XA 3W4YA 4CSAA 4YK5A 1RKCA 3VYWA 4C7OB 1TWAA 3MYFA 2DYRC 2XL8A 4BJ1A 4KC9A 4KI2A 1D0ZA 1LVKA 3OWTA 1PD1A 4PJJA 5L0FA 2J9WA 4O79A 4IRUA 5EHHA 4XLPF 4LDRA 4BPMA 4IARA 1Y4CA 3QMKA 5KYYA 3B0UX 1QVXA 4XPYA 1MNDA 2NUTA 3NYLA 4LLCA 4LLEA 4XTKA 4R32A 4P6IC 3T6GB 3KKBA 5HV9A 3LUTB 2QLAA 4PJLA 3S0XA 4CJOA 4MVOA 2LK4A 3LLIA 1J8MF 2EPOA 1CPQA 2VH3A 5TJ5E 5L3QA 3KYJA 1DOVA 5DQZA 4AK9A 1MMGA 2V26A 2M64A 3EG9B 2OEVA 2LSEA 1OR2A 3SNHA 1VMAA 2HSBA 5E2QA 4U5DE 3TD7A 3UGOA 4Q4ZF 2P1AA 4U5BE 1RJ9A 1NFOA 3BRJA 1B68A 4A4AA 4AE4A 2JPUA 5E3CA 2IXOA 3V7OA 3U3BA 5KYNA 1D1CA 4MVZA 4AL0A 3IPMO 3VAYA 2YEVA 1BBHA 2A69F 2CNWD 3A9CA 3US6A 5JT4A 3JYHA 3K33A 1BR1A 1Q0KA 1FAPB 3JZ0A 4MNDA 1A7VA 2Z15A 2XLEA 3MFNA 2LFFA 2JD3A 3C18A 3IHUA 3EHMA 3FVYA 2ICWG 4K1OA 1HMDA 3M4CA 4JEBA 5B1AC 3DZAA 1D0XA 3U2LA 4BEMJ 5FCLA 3UMIA 1OCZC 1U0BB 4BJ5A 3SXYA 2Q9BA 2L6GA 3X1OA 3B0PA 5A6KA 3NDBB 4DVZA 1VYKA 2R7RA 3K1IC 3FXHA 1WTYA 3GWNA 4WABA 1BDJB 2I15A 1T6IA 3UR3C 1RXQA 3G4ZA 3U9MA 1ORYA 1Q0MA 1IW7F 1ZHWA 3N2ZB 4MW3A 2HKVA 4U9EA 4YN0B 3U5SA 2Q9CA 4JKVA 1ORSC 3AQCA 4D4NA 3R2PA 2Q3TA 1N1CA 1MMDA 1VK5A 3BEHA 3A11A 2Y39A 4O6YA 1T6UA 4YT4A 5AC4A 3E9VA 3O55A 3HNIA 2I8BA 3CZ6A 3R7CA 1JPJA 1SF8A 2VC9A 3FOPA 1NU9C 4C3DA 5KYYB 4EHPA 2ZXOA 3ABMC 3EPVA 5L0JA 5CI8A 2NUTB 3CAXA 2WL8A 3EJNA 4XQ1A 3TQOA 3WODF 2IXMA 2J7PD 5E33A 3B0VC 3UNGC 3W8HA 2R7QA 4A2NB 3JTLO 1V55C 2HFIA 3KL4A 4GQHA 4Z9IA 4JZAA 1APCA 3RF3A 1EI7A 1VYIA 4DRHB 1TR2A 2J45A 4RD9A 1G5ZA 3MLGA 3B71A 2WVOA 5BQHA 1OW8A 3TOMA 4E17A 2LD6A 1ZW2A 1SYQA 4G0HA 4DJ9A 2XLDA 3DM9B 2EPLX 1Z5ZA 1ZYRF 1Z7Qc 3DWWA 1RJ9B 4M63A 1KNYA 1TFKB 1A0BA 1WATA 3TJ5A 4O6MA 3ZVRA 2LCHA 2Y3HA 3S9OA 1VB5A 2CGEA 2PX0A 2Y3DA 1NG1A 2VCAA 4KBLA 1C03A 2BC5A 3VF0A 2CDQA 3GANA 2GDCA 3AQBA 2V3CC 3QVYA 1LS1A 5COFA 4DRJB 4B6IA 2OJED 1U89A 2EIKC 4JRZA 2OKUA 3Q7LA 1GM5A 4ZLDA 5BQIA 4LDQA 1E2XA 3EFOA 4W8KA 1G4US 4E0HA 2LP4A 2DGJA 3K6BA 2XL6A 4FX5A 4IAQA 4O6NA 1UFBA 4CX9A 4OIOF 1A41A 1G8XA 2YL0A 4FAPB 3NYJA 3O39A 4WGZA 5T3TA 3DJNB 1HMOA 3ECSA 1HE9A 3LESA 4XPWA 4PACA 3RIPA 3ASOC 5IY5C 256BA 2XLHA 3AJMA 2C03A 2HJ3A 2A1DD 3Q7GA 3FMSA 1E83A 2R7XA 1DOWA 3VM6A 4JJGA 2R7TA 4MQ9F 2R25A 1YJGA 4QDLA 2G3VA 1Q0FA 2AU5A 3U8VA 1Y6DA 1YZAA 3IQCA 3LS1A 1NU7D 3L34A 4LDKA 5FZTA 1FTSA 2ZPAA 5JVEA 4U5GA 4XPXA 4PFPA 4NQFA 2WVNA 1GS9A 4JC7A 5L0HA 4HEAJ 4I44A 2YL7A 1M57C 2HZ8A 3JSZA 3LJBA 2L6HA 3JRMO 4JVSA 1SMYF 2AWCA 3ZSUA 5A6JA 2GFHA 2UUIA 2R02A 3O10A 3LLKA 4U5HA 3L8IA 3RQGA 4E7SA 2YL3A 1O3UA 1OXKA 1ZU5A 3JCUQ 1LIHA 1JMWA 4J30B 5CI9A 4BJ6A 4DOZA 2HS5A 1K04A 2OG2A 5F5HA 2CCYA 2PX3A 1HE1A 1OW7A 1ST6A 1T01A 2KSFA 2XLMA 3IQ5A 1SZIA 2JX0A 1MMNA 5KYWA 4C3BA 2LIGA 4L6RA 3E70C 1H9GA 5D92A 5F5FA 3DKAA 3TULA 2XLOA 4Z9JA 4CS8C 5DS6A 2NPUA 1L3PA 2QY9A 3AG3C 1G4WR 2KK1A 3I5QA 4MW8A 3G50A 2XLWA 4CS9C 4EBBA 1YYJA 3C63A 5K0IA 3NMIA 3U3FA 2EPNA 2X51A 5JLIA 1ZHYA 2HJMA 3UGPA 3QW1A 2OCCC 1NZEA 4G78A 4WJ0A 1JR8A 2R7VA 4YJWA 1NBBA 3AG1C 2R7OA 2H7VC 3EFOB 1LE2A 4J32B 4MVMA 2PNOA 3RYLA 1CGME 2ASRA 4OIQF 2LQGA 2MYSA 3RW0A 4CSAC 1QSPA 1ZVZA 2ZXRA 1UG7A 3X2QC 2KQ9A 3HNLA 4CDAA 3V5XA 1JPNA 1D1BA 4MTOA 4OIRF 4NTFA 5CIVA 5JUAA 1V74B 4UDVA 4H54A 2XM0A 4DBRA 5L0CA 3DJUB 2R7SA 4HFKB 3C62A 2P6VA 1MNEA 4NY3A 3HJCA 4N06A 4NC3A 1JAFA 4H4KC 1CPRA 2R9RB 4CJGA 2R7UA 2HMZA 2H7OA 3T9OA 1L7CA 3J06A 3EGXA 4GYTA 5A6BA 1TFOB 2R03A 3ASNC 3EH1A 2L6FA 1EA8A 1WASA 4PJMA 1O5HA 4XEKA 5F28E 1FMVA 4N4WA 2EIMC 4GEHA 4DRIB 3C8ZA 2IXNA 3SXKA 4EWCA 1J8YF 2PBEA 3GM2A 4EBKA 3S90A 4G7ZF 2W9YA 4MVSA 5JP7A 1LPEA 3IQ6A 1YARO 1TWCA 2YLGA 4E0IA 2P7VA 3I5PA 4P9TA 2YLIA 3QVZA 2OQMA 4CIHA 1YA7O 4HFFB 1VLTA 1E85A 2LFDA 1OCOC 3AG4C 3L0IA 1Q0GA 1VLSA 2AWYA 2Q7RA 2HV7A 1PV3A 1FNTc 5KYWB 2OU6A 1XZQA 4JTAB 2GA0A 2P0NA 2YHSA 2Y3GA 3GM3A 1T6QA 3JRTA 1PCXA 4QI0A 3SXZA 3F47A 5B1BC 3SEOA 5COMA 3W2WA 1IZMA 4CBEA 1WGWA 2IM8A 3H2VA 3T6BA 3WHNA 4I1OB 3PDMP 2RD9A 5A6AA 3DI5A 3V5ZA 3I4UA 2NUPA 1YZCA 4AX2A 3FOOA 2R7WA 3GWLA 1NFNA 5GPGB 1CGOA 1R5ID 2IXPA 1V4AA 2KC3A 3B9QA 1RCPA 2FAPB 3H2UA 2YZSA 1M2OA 2HSQA 3CQZA 4MVRA 1LS4A 4MVQA 3OA1A 3S29A 3U2MA 2AVKA 2WB7A 2IBFA 1YA9A 2M4EA 5BQGA 3M79A 1FR0A 5KYXA 1BR2A 3C8GA 2PFDA 3KH2A 4JTDB 3HKKA 2J8WA 2R05A 2W45A 2NSGA 1BR4A 4C3EA 2E87A 1ZW3A 3RH3A 3Q6MA 3PMRA 4RBNA 5EGYA 1Q0DA 3LNRA 1U6HA 1VOMA 1Z63A 2TMVP 3M15A 2MWQA 4N6HA 3W8IA 3NG1A 2X0CA 5L0IA 3EGXB 4YT2A 5L0GA 4G7HF 4JCZA 4BEJA 1QZXA 1OQCA 2C04A 3GEHA 3LNMB 2EILC 1S05A 3JSEO 2OJQA 2DYSC 4MTGA 4ULWA 3EZIA 3FAPB 5COGA 1ZU4A 4Q7CA 3NMKA 1RKEA 3HTKC 3DE8A 3EGDA 2KW3C 1VTMP 4QI2A 2MHRA 2J9BA 2XSEA 4NTBA 2GAQA 1YDIA 1ZHTA 2G62A 2YVKA 1GGQA 5E3AA 2VCBA 1I4YA 3DXJF 4MTFA 3IQTA 2HV6A 4KNVA 2VCCA 1K05A 3ABKC 3HLZA 3U8PA 4F4BA 2KGOA 5AC5A 1H7IA 4JCHA 3AG2C
chains in the Genus database with same CATH topology
1M56C 2EIJC 2L81A 4FWVA 2FFHA 2WVQA 3ITFA 4JJFA 4OD5A 4LACB 4K0DA 1D1AA 4YT8A 2W4MA 3LS0A 2D5RB 2W4BA 1KU2A 3EH2A 2NUPB 3EQLF 3ZG1A 3POVA 1OKKA 3K66A 4X0RA 2G3KA 1FFTC 4JURI 1Z6AA 3DM5A 2Q9AA 1FFHA 4PFOA 1PD0A 4HE8D 4I3MA 2J0WA 4U5FE 5KYXB 4K7BA 3RKOF 2IYLD 3UMKA 4U5EE 4O7GA 2CW0F 3PHF2 5DQTA 2J9VA 2ZXWC 3ABLC 5DS5A 4OD4A 1D0YA 1ZHXA 3ZC4A 1Z23A 3GODA 2VASA 1LKXA 1M2VA 5T3WA 2A68F 1TWGA 2NG1A 3DD7A 3WG7C 2J46A 4IAOA 4E7ZA 4OIPF 4FESA 3ZIBA 3EGDB 2XXAA 4BJ6C 3M1CB 3O6XA 3DMDA 3T4RA 3W2VA 1S7ZA 1Z3IX 5KYUA 4XLNF 3DAFA 1TKNA 2A6EF 4DVYP 3IEEA 1QLEC 4I1MA 4ANJA 2PP4A 2VB6A 4G7OF 1O87A 2BE5F 5L3VA 1OCCC 3NKEA 5DS4A 4C7OA 5DLJA 3Q6NA 2EINC 5T1DB 3SP1A 4YT5A 4BJTA 3JT1A 3N24A 5DVWA 4BJ5C 5HSWA 2J9UA 4KNWA 2CNWA 5BUOA 3RFYA 3KMIA 3NKDA 3SZRA 4Q5SF 2WZLA 3FAJA 3FDQA 3DAGA 5B3SC 4RDAA 3LAYA 4DBQA 3EG9A 4XWJA 2KJGA 4JW1A 1W2WA 3EHNA 4AE4B 3S28A 1FMWA 2WZFA 5D91A 3EZHA 3K7DA 2XRHA 3H65A 2QTVA 2L9JA 4YWQA 3LEVA 4OINF 1OKKD 4IWBA 2IOQA 2KNHA 1TWHA 2Y69C 2XL4A 1OCRC 2Y3BA 3NRHA 4IJJA 2ZXPA 2A6HF 4BG0A 1M2VB 2WZGA 3NYMA 4LERA 3CSKA 3FHDA 4CS8A 3MX3A 2H7BA 3S27A 2XXAB 4CS9A 3N0TA 3F46A 2FGYA 4ZLCA 2B0JA 3UMHA 4PJNA 3OEOA 3T6JA 5KYUB 4CS7A 2J7PA 4PK4A 3QZCA 1MMAA 3SYNA 2PF4E 1ZHZA 4U5CE 1V54C 2O9XA 3K1HA 4CSAA 2J0XA 3VYWA 4C7OB 1TWAA 2DYRC 4BJ1A 4KC9A 4KI2A 1D0ZA 1LVKA 3OWTA 1PD1A 4PJJA 2J9WA 4O79A 4IRUA 5EHHA 4XLPF 3QMKA 5KYYA 3B0UX 1MNDA 2NUTA 3NYLA 4LLCA 4LLEA 4XTKA 4P6IC 3KKBA 4PJLA 3S0XA 3LLIA 1J8MF 5L3QA 2VH3A 5DQZA 4AK9A 1MMGA 2V26A 3EG9B 2LSEA 3SNHA 1VMAA 3TD7A 5E2QA 4U5DE 3UGOA 4Q4ZF 4U5BE 1RJ9A 4AE4A 5E3CA 2IXOA 3V7OA 5KYNA 1D1CA 3VAYA 2YEVA 2A69F 2CNWD 3JYHA 3K33A 1BR1A 4MNDA 2Z15A 2JD3A 4C3BA 3EHMA 3FVYA 5B1AC 4CIHA 5FCLA 3DZAA 1D0XA 3UMIA 1OCZC 4BJ5A 2Q9BA 3X1OA 3B0PA 3NDBB 4DVZA 1VYKA 2R7RA 3K1IC 3UR3C 3N2ZB 1IW7F 1ZHWA 4YN0B 2Q9CA 3AQCA 2Q3TA 1N1CA 1MMDA 1VK5A 2Y39A 4O6YA 4YT4A 3E9VA 2I8BA 3CZ6A 1JPJA 1SF8A 1NU9C 4C3DA 5KYYB 2ZXOA 3ABMC 3EPVA 5CI8A 2NUTB 2WL8A 3EJNA 3WODF 3B0VC 2IXMA 2J7PD 5E33A 3UNGC 3W8HA 2R7QA 4A2NB 1V55C 3KL4A 4JZAA 1VYIA 1TR2A 2J45A 4RD9A 3MLGA 2WVOA 4G0HA 3DM9B 1Z5ZA 1ZYRF 1RJ9B 4M63A 4O6MA 3ZVRA 2Y3HA 2CGEA 2PX0A 2Y3DA 1NG1A 4KBLA 2CDQA 3GANA 3AQBA 2V3CC 1LS1A 4B6IA 2EIKC 3Q7LA 4ZLDA 3EFOA 4W8KA 2DGJA 3K6BA 4FX5A 4O6NA 4OIOF 1G8XA 3NYJA 3O39A 5T3TA 3DJNB 3ECSA 3LESA 3RIPA 3ASOC 5IY5C 2C03A 3Q7GA 2A1DD 2R7XA 4JJGA 2R7TA 4MQ9F 4QDLA 2G3VA 3LS1A 1NU7D 3L34A 1FTSA 2ZPAA 4U5GA 4PFPA 2WVNA 4HEAJ 4I44A 1M57C 3JSZA 3LJBA 4JVSA 1SMYF 3ZSUA 2GFHA 3LLKA 4U5HA 4E7SA 3JCUQ 1ZU5A 5CI9A 4BJ6A 4J30B 4DOZA 2OG2A 5F5HA 2PX3A 1ST6A 1SZIA 5KYWA 1MMNA 3E70C 5D92A 5F5FA 4CS8C 5DS6A 3I5QA 2QY9A 3AG3C 4CS9C 4EBBA 2X51A 1ZHYA 3UGPA 2OCCC 1NZEA 4WJ0A 2R7VA 4YJWA 3AG1C 2R7OA 3EFOB 2H7VC 4J32B 3RYLA 4OIQF 2MYSA 4CSAC 2ZXRA 3X2QC 2KQ9A 1JPNA 1D1BA 4OIRF 4DBRA 2R7SA 3DJUB 4HFKB 2P6VA 1MNEA 4NY3A 3HJCA 4N06A 4H4KC 2R7UA 2H7OA 3EGXA 4GYTA 3ASNC 3EH1A 4PJMA 1O5HA 1FMVA 2EIMC 4GEHA 2IXNA 4EWCA 1J8YF 4G7ZF 2W9YA 1TWCA 2P7VA 3I5PA 4HFFB 1OCOC 3AG4C 3L0IA 2HV7A 5KYWB 4QI0A 2YHSA 3JRTA 2Y3GA 1PCXA 3F47A 5B1BC 3SEOA 3W2WA 1IZMA 4CBEA 1WGWA 3T6BA 4I1OB 3I4UA 2NUPA 4AX2A 2R7WA 2IXPA 3B9QA 2YZSA 1M2OA 3CQZA 3OA1A 3S29A 2WB7A 2M4EA 5KYXA 1BR2A 2PFDA 3KH2A 2W45A 1BR4A 4C3EA 2E87A 3RH3A 3Q6MA 3PMRA 4RBNA 5EGYA 3LNRA 1VOMA 1Z63A 2MWQA 3W8IA 3NG1A 3EGXB 4YT2A 4G7HF 4BEJA 1QZXA 2C04A 2EILC 4ULWA 2DYSC 3EZIA 1ZU4A 4Q7CA 3HTKC 3EGDA 2KW3C 4QI2A 2XSEA 1ZHTA 2G62A 5E3AA 3DXJF 4F4BA 2HV6A 4KNVA 3HLZA 3ABKC 2KGOA 4JCHA 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFF B;  4B6I A;  3ZIB A;  4J30 B;  4JUR I;  4HFK B;  4AX2 A;  4J32 B; 
#chains in the Genus database with same CATH topology
 1M56 C;  2YKZ A;  2EIJ C;  2XS8 A;  4ONS A;  2L81 A;  4PR9 A;  4FWV A;  2FFH A;  2WVQ A;  3ITF A;  3NMJ A;  4JJF A;  4OD5 A;  5A6B D;  4LAC B;  3G4X A;  4K0D A;  4MVU A;  3ZWI A;  3VRC A;  3K1I A;  3S84 A;  1D1A A;  3U0C A;  5JSL A;  4YT8 A;  3CEX A;  1I5N A;  2W4M A;  3LS0 A;  1TQG A;  1C02 A;  2YWA A;  3AGT A;  4P9F A;  2D5R B;  2W4B A;  1LE4 A;  4EKW A;  3WAQ A;  1KU2 A;  3EH2 A;  2NUP B;  3EQL F;  1E86 A;  3ZG1 A;  1AVO B;  3POV A;  1OKK A;  3K66 A;  4CDY A;  3AGU A;  4X0R A;  1HW2 A;  2G3K A;  1FFT C;  4JUR I;  4D4X A;  1A7E A;  3SXM A;  1Z6A A;  2YL1 A;  3DM5 A;  4JIO A;  3QTH A;  4YL3 A;  2Q9A A;  1FFH A;  4PFO A;  2QNL A;  1PD0 A;  2Q4F A;  4HE8 D;  3RQF A;  3HNK A;  2J0W A;  4I3M A;  4U5F E;  3MBG A;  3C8G B;  3QW0 A;  4K7B A;  5KYX B;  3ATP A;  3TJ6 A;  3RKO F;  2IYL D;  3UMK A;  4DXW A;  1R4T A;  4O7G A;  3JYY A;  4U5E E;  2CW0 F;  5JRA A;  1H6G A;  3PHF 2;  1RMV A;  2XM4 A;  1HW1 A;  4WGY A;  1YAU O;  5DQT A;  1AUE A;  2J9V A;  1HY5 A;  2ZXW C;  3ABL C;  4YL0 A;  3ZQV A;  5DS5 A;  3HNJ A;  4OD4 A;  1EKY A;  1D0Y A;  1NSG B;  3GOR A;  5B3I A;  2Q00 A;  4NTA A;  1LM3 B;  1ZHX A;  3ZC4 A;  4MS2 A;  1Z23 A;  3TOL A;  3GOD A;  2VAS A;  1LKX A;  1LI7 A;  2OEX A;  4XEF A;  1M2V A;  3MYI A;  2A68 F;  5T3W A;  1TWG A;  2NG1 A;  2QUP A;  1C17 M;  3AOU A;  3DD7 A;  3WG7 C;  2J46 A;  4IAO A;  1OXB A;  2XS1 A;  1KTM A;  2XLV A;  1RKE B;  3C8G D;  4E7Z A;  4FES A;  3DE9 A;  1ORJ A;  1QPU A;  3EGD B;  4YL1 A;  3ZIB A;  4BJ6 C;  4OIP F;  3M1C B;  2XXA A;  3O6X A;  5JS5 A;  3DMD A;  2F22 A;  1XWJ A;  2UUH A;  3T4R A;  3W2V A;  1S7Z A;  4J7Y A;  1Z3I X;  3GEE A;  3KPH A;  3L1M A;  4N6C A;  5KYU A;  2CYD A;  1QQ3 A;  3GEI A;  3DAF A;  4NCQ A;  2NSF A;  1TKN A;  4XLN F;  2A6E F;  4DVY P;  3IEE A;  1QLE C;  1T5O A;  4I1M A;  2PP4 A;  2VB6 A;  4ANJ A;  4ER9 A;  4G7O F;  1O87 A;  2BE5 F;  4EIY A;  1MQV A;  5L3V A;  3ZQY A;  4JEA A;  1JRA A;  1OCC C;  3NKE A;  4JTC B;  5DS4 A;  1H9T A;  5DLJ A;  4C7O A;  3Q6N A;  4E18 A;  2EIN C;  5T1D B;  3SP1 A;  4YT5 A;  3V5Y A;  1ZZP A;  4BJT A;  2AP3 A;  2HUJ A;  5L0D A;  2RSE B;  2HMQ A;  3JT1 A;  3U9J A;  3B29 A;  3M4B A;  2B0H A;  3N24 A;  1K40 A;  5DVW A;  4U9D A;  2A0B A;  1I4Z A;  3RVY A;  4BJ5 C;  2J9U A;  5HSW A;  3ZTM A;  4KNW A;  2CNW A;  4AL1 A;  2DB4 A;  5BUO A;  3RFY A;  2ETS A;  3KMI A;  3NKD A;  1M6T A;  3SZR A;  4Q5S F;  2WZL A;  3ZTZ A;  2OOC A;  3FAJ A;  3FDQ A;  3DAG A;  3LEO A;  5B3S C;  4RDA A;  3LAY A;  4DBQ A;  4EUK B;  3EG9 A;  4XWJ A;  2BL2 A;  2KJG A;  1W2W A;  4JW1 A;  2EPK X;  3EHN A;  2KYH A;  4AE4 B;  1T9K A;  2ZD9 A;  2GWW A;  3S28 A;  1FMW A;  2WZF A;  1WOL A;  5D91 A;  1YVI A;  1GQA A;  3EZH A;  3K7D A;  4XEV A;  1YLM A;  2XRH A;  3H65 A;  5AGF A;  2YLD A;  1JOG A;  2H8A A;  2QTV A;  2L9J A;  2YRF A;  3L8J A;  4IGG A;  4YWQ A;  5A69 A;  3LEV A;  4JE9 A;  1NLX A;  4OIN F;  3C7J A;  4EBJ A;  1OKK D;  2DI3 A;  4IWB A;  2IOQ A;  2KNH A;  1TWH A;  2Y69 C;  2XL4 A;  1OCR C;  2Y3B A;  3NRH A;  1WN0 A;  3RQE A;  2L7A A;  3PCV A;  1XZP A;  4IJJ A;  1E84 A;  1AEP A;  2ZXP A;  4ULV A;  2A6H F;  2YQY A;  4BG0 A;  1M2V B;  4CIP A;  1A7D A;  2WZG A;  4IB4 A;  3NYM A;  2A0U A;  1OW6 A;  3KYI A;  4LER A;  1QKR A;  3CSK A;  3FHD A;  3TK0 A;  3MX3 A;  1BZ4 A;  1WWP A;  2H7B A;  3ZDL A;  4CS8 A;  3S27 A;  1SR2 A;  1LI5 A;  4CS9 A;  3N0T A;  2XXA B;  1OR3 A;  3F46 A;  2P61 A;  2FGY A;  2D4U A;  5EK0 A;  4CDV A;  4ZLC A;  2B0J A;  3UMH A;  4Z9H A;  4PJN A;  3OEO A;  3T6J A;  5KYU B;  3GM1 A;  4CS7 A;  2J7P A;  1F1M A;  1YYX A;  2QE9 A;  1CGN A;  4PK4 A;  1EQ1 A;  3QZC A;  1MMA A;  3SYN A;  2PF4 E;  4W8P A;  1ZHZ A;  4J7T A;  4U5C E;  1V54 C;  2EPM X;  2O9X A;  3K1H A;  3RVZ A;  2J0X A;  3W4Y A;  4CSA A;  4YK5 A;  1RKC A;  3VYW A;  4C7O B;  1TWA A;  3MYF A;  2DYR C;  2XL8 A;  4BJ1 A;  4KC9 A;  4KI2 A;  1D0Z A;  1LVK A;  3OWT A;  1PD1 A;  4PJJ A;  5L0F A;  2J9W A;  4O79 A;  4IRU A;  5EHH A;  4XLP F;  4LDR A;  4BPM A;  4IAR A;  1Y4C A;  3QMK A;  5KYY A;  3B0U X;  1QVX A;  4XPY A;  1MND A;  2NUT A;  3NYL A;  4LLC A;  4LLE A;  4XTK A;  4R32 A;  4P6I C;  3T6G B;  3KKB A;  5HV9 A;  3LUT B;  2QLA A;  4PJL A;  3S0X A;  4CJO A;  4MVO A;  2LK4 A;  3LLI A;  1J8M F;  2EPO A;  1CPQ A;  2VH3 A;  5TJ5 E;  5L3Q A;  3KYJ A;  1DOV A;  5DQZ A;  4AK9 A;  1MMG A;  2V26 A;  2M64 A;  3EG9 B;  2OEV A;  2LSE A;  1OR2 A;  3SNH A;  1VMA A;  2HSB A;  5E2Q A;  4U5D E;  3TD7 A;  3UGO A;  4Q4Z F;  2P1A A;  4U5B E;  1RJ9 A;  1NFO A;  3BRJ A;  1B68 A;  4A4A A;  4AE4 A;  2JPU A;  5E3C A;  2IXO A;  3V7O A;  3U3B A;  5KYN A;  1D1C A;  4MVZ A;  4AL0 A;  3IPM O;  3VAY A;  2YEV A;  1BBH A;  2A69 F;  2CNW D;  3A9C A;  3US6 A;  5JT4 A;  3JYH A;  3K33 A;  1BR1 A;  1Q0K A;  1FAP B;  3JZ0 A;  4MND A;  1A7V A;  2Z15 A;  2XLE A;  3MFN A;  2LFF A;  2JD3 A;  3C18 A;  3IHU A;  3EHM A;  3FVY A;  2ICW G;  4K1O A;  1HMD A;  3M4C A;  4JEB A;  5B1A C;  3DZA A;  1D0X A;  3U2L A;  4BEM J;  5FCL A;  3UMI A;  1OCZ C;  1U0B B;  4BJ5 A;  3SXY A;  2Q9B A;  2L6G A;  3X1O A;  3B0P A;  5A6K A;  3NDB B;  4DVZ A;  1VYK A;  2R7R A;  3K1I C;  3FXH A;  1WTY A;  3GWN A;  4WAB A;  1BDJ B;  2I15 A;  1T6I A;  3UR3 C;  1RXQ A;  3G4Z A;  3U9M A;  1ORY A;  1Q0M A;  1IW7 F;  1ZHW A;  3N2Z B;  4MW3 A;  2HKV A;  4U9E A;  4YN0 B;  3U5S A;  2Q9C A;  4JKV A;  1ORS C;  3AQC A;  4D4N A;  3R2P A;  2Q3T A;  1N1C A;  1MMD A;  1VK5 A;  3BEH A;  3A11 A;  2Y39 A;  4O6Y A;  1T6U A;  4YT4 A;  5AC4 A;  3E9V A;  3O55 A;  3HNI A;  2I8B A;  3CZ6 A;  3R7C A;  1JPJ A;  1SF8 A;  2VC9 A;  3FOP A;  1NU9 C;  4C3D A;  5KYY B;  4EHP A;  2ZXO A;  3ABM C;  3EPV A;  5L0J A;  5CI8 A;  2NUT B;  3CAX A;  2WL8 A;  3EJN A;  4XQ1 A;  3TQO A;  3WOD F;  2IXM A;  2J7P D;  5E33 A;  3B0V C;  3UNG C;  3W8H A;  2R7Q A;  4A2N B;  3JTL O;  1V55 C;  2HFI A;  3KL4 A;  4GQH A;  4Z9I A;  4JZA A;  1APC A;  3RF3 A;  1EI7 A;  1VYI A;  4DRH B;  1TR2 A;  2J45 A;  4RD9 A;  1G5Z A;  3MLG A;  3B71 A;  2WVO A;  5BQH A;  1OW8 A;  3TOM A;  4E17 A;  2LD6 A;  1ZW2 A;  1SYQ A;  4G0H A;  4DJ9 A;  2XLD A;  3DM9 B;  2EPL X;  1Z5Z A;  1ZYR F;  1Z7Q c;  3DWW A;  1RJ9 B;  4M63 A;  1KNY A;  1TFK B;  1A0B A;  1WAT A;  3TJ5 A;  4O6M A;  3ZVR A;  2LCH A;  2Y3H A;  3S9O A;  1VB5 A;  2CGE A;  2PX0 A;  2Y3D A;  1NG1 A;  2VCA A;  4KBL A;  1C03 A;  2BC5 A;  3VF0 A;  2CDQ A;  3GAN A;  2GDC A;  3AQB A;  2V3C C;  3QVY A;  1LS1 A;  5COF A;  4DRJ B;  4B6I A;  2OJE D;  1U89 A;  2EIK C;  4JRZ A;  2OKU A;  3Q7L A;  1GM5 A;  4ZLD A;  5BQI A;  4LDQ A;  1E2X A;  3EFO A;  4W8K A;  1G4U S;  4E0H A;  2LP4 A;  2DGJ A;  3K6B A;  2XL6 A;  4FX5 A;  4IAQ A;  4O6N A;  1UFB A;  4CX9 A;  4OIO F;  1A41 A;  1G8X A;  2YL0 A;  4FAP B;  3NYJ A;  3O39 A;  4WGZ A;  5T3T A;  3DJN B;  1HMO A;  3ECS A;  1HE9 A;  3LES A;  4XPW A;  4PAC A;  3RIP A;  3ASO C;  5IY5 C;  256B A;  2XLH A;  3AJM A;  2C03 A;  2HJ3 A;  2A1D D;  3Q7G A;  3FMS A;  1E83 A;  2R7X A;  1DOW A;  3VM6 A;  4JJG A;  2R7T A;  4MQ9 F;  2R25 A;  1YJG A;  4QDL A;  2G3V A;  1Q0F A;  2AU5 A;  3U8V A;  1Y6D A;  1YZA A;  3IQC A;  3LS1 A;  1NU7 D;  3L34 A;  4LDK A;  5FZT A;  1FTS A;  2ZPA A;  5JVE A;  4U5G A;  4XPX A;  4PFP A;  4NQF A;  2WVN A;  1GS9 A;  4JC7 A;  5L0H A;  4HEA J;  4I44 A;  2YL7 A;  1M57 C;  2HZ8 A;  3JSZ A;  3LJB A;  2L6H A;  3JRM O;  4JVS A;  1SMY F;  2AWC A;  3ZSU A;  5A6J A;  2GFH A;  2UUI A;  2R02 A;  3O10 A;  3LLK A;  4U5H A;  3L8I A;  3RQG A;  4E7S A;  2YL3 A;  1O3U A;  1OXK A;  1ZU5 A;  3JCU Q;  1LIH A;  1JMW A;  4J30 B;  5CI9 A;  4BJ6 A;  4DOZ A;  2HS5 A;  1K04 A;  2OG2 A;  5F5H A;  2CCY A;  2PX3 A;  1HE1 A;  1OW7 A;  1ST6 A;  1T01 A;  2KSF A;  2XLM A;  3IQ5 A;  1SZI A;  2JX0 A;  1MMN A;  5KYW A;  4C3B A;  2LIG A;  4L6R A;  3E70 C;  1H9G A;  5D92 A;  5F5F A;  3DKA A;  3TUL A;  2XLO A;  4Z9J A;  4CS8 C;  5DS6 A;  2NPU A;  1L3P A;  2QY9 A;  3AG3 C;  1G4W R;  2KK1 A;  3I5Q A;  4MW8 A;  3G50 A;  2XLW A;  4CS9 C;  4EBB A;  1YYJ A;  3C63 A;  5K0I A;  3NMI A;  3U3F A;  2EPN A;  2X51 A;  5JLI A;  1ZHY A;  2HJM A;  3UGP A;  3QW1 A;  2OCC C;  1NZE A;  4G78 A;  4WJ0 A;  1JR8 A;  2R7V A;  4YJW A;  1NBB A;  3AG1 C;  2R7O A;  2H7V C;  3EFO B;  1LE2 A;  4J32 B;  4MVM A;  2PNO A;  3RYL A;  1CGM E;  2ASR A;  4OIQ F;  2LQG A;  2MYS A;  3RW0 A;  4CSA C;  1QSP A;  1ZVZ A;  2ZXR A;  1UG7 A;  3X2Q C;  2KQ9 A;  3HNL A;  4CDA A;  3V5X A;  1JPN A;  1D1B A;  4MTO A;  4OIR F;  4NTF A;  5CIV A;  5JUA A;  1V74 B;  4UDV A;  4H54 A;  2XM0 A;  4DBR A;  5L0C A;  3DJU B;  2R7S A;  4HFK B;  3C62 A;  2P6V A;  1MNE A;  4NY3 A;  3HJC A;  4N06 A;  4NC3 A;  1JAF A;  4H4K C;  1CPR A;  2R9R B;  4CJG A;  2R7U A;  2HMZ A;  2H7O A;  3T9O A;  1L7C A;  3J06 A;  3EGX A;  4GYT A;  5A6B A;  1TFO B;  2R03 A;  3ASN C;  3EH1 A;  2L6F A;  1EA8 A;  1WAS A;  4PJM A;  1O5H A;  4XEK A;  5F28 E;  1FMV A;  4N4W A;  2EIM C;  4GEH A;  4DRI B;  3C8Z A;  2IXN A;  3SXK A;  4EWC A;  1J8Y F;  2PBE A;  3GM2 A;  4EBK A;  3S90 A;  4G7Z F;  2W9Y A;  4MVS A;  5JP7 A;  1LPE A;  3IQ6 A;  1YAR O;  1TWC A;  2YLG A;  4E0I A;  2P7V A;  3I5P A;  4P9T A;  2YLI A;  3QVZ A;  2OQM A;  4CIH A;  1YA7 O;  4HFF B;  1VLT A;  1E85 A;  2LFD A;  1OCO C;  3AG4 C;  3L0I A;  1Q0G A;  1VLS A;  2AWY A;  2Q7R A;  2HV7 A;  1PV3 A;  1FNT c;  5KYW B;  2OU6 A;  1XZQ A;  4JTA B;  2GA0 A;  2P0N A;  2YHS A;  2Y3G A;  3GM3 A;  1T6Q A;  3JRT A;  1PCX A;  4QI0 A;  3SXZ A;  3F47 A;  5B1B C;  3SEO A;  5COM A;  3W2W A;  1IZM A;  4CBE A;  1WGW A;  2IM8 A;  3H2V A;  3T6B A;  3WHN A;  4I1O B;  3PDM P;  2RD9 A;  5A6A A;  3DI5 A;  3V5Z A;  3I4U A;  2NUP A;  1YZC A;  4AX2 A;  3FOO A;  2R7W A;  3GWL A;  1NFN A;  5GPG B;  1CGO A;  1R5I D;  2IXP A;  1V4A A;  2KC3 A;  3B9Q A;  1RCP A;  2FAP B;  3H2U A;  2YZS A;  1M2O A;  2HSQ A;  3CQZ A;  4MVR A;  1LS4 A;  4MVQ A;  3OA1 A;  3S29 A;  3U2M A;  2AVK A;  2WB7 A;  2IBF A;  1YA9 A;  2M4E A;  5BQG A;  3M79 A;  1FR0 A;  5KYX A;  1BR2 A;  3C8G A;  2PFD A;  3KH2 A;  4JTD B;  3HKK A;  2J8W A;  2R05 A;  2W45 A;  2NSG A;  1BR4 A;  4C3E A;  2E87 A;  1ZW3 A;  3RH3 A;  3Q6M A;  3PMR A;  4RBN A;  5EGY A;  1Q0D A;  3LNR A;  1U6H A;  1VOM A;  1Z63 A;  2TMV P;  3M15 A;  2MWQ A;  4N6H A;  3W8I A;  3NG1 A;  2X0C A;  5L0I A;  3EGX B;  4YT2 A;  5L0G A;  4G7H F;  4JCZ A;  4BEJ A;  1QZX A;  1OQC A;  2C04 A;  3GEH A;  3LNM B;  2EIL C;  1S05 A;  3JSE O;  2OJQ A;  2DYS C;  4MTG A;  4ULW A;  3EZI A;  3FAP B;  5COG A;  1ZU4 A;  4Q7C A;  3NMK A;  1RKE A;  3HTK C;  3DE8 A;  3EGD A;  2KW3 C;  1VTM P;  4QI2 A;  2MHR A;  2J9B A;  2XSE A;  4NTB A;  2GAQ A;  1YDI A;  1ZHT A;  2G62 A;  2YVK A;  1GGQ A;  5E3A A;  2VCB A;  1I4Y A;  3DXJ F;  4MTF A;  3IQT A;  2HV6 A;  4KNV A;  2VCC A;  1K05 A;  3ABK C;  3HLZ A;  3U8P A;  4F4B A;  2KGO A;  5AC5 A;  1H7I A;  4JCH A;  3AG2 C; 
#chains in the Genus database with same CATH homology
 1M56 C;  2EIJ C;  2L81 A;  4FWV A;  2FFH A;  2WVQ A;  3ITF A;  4JJF A;  4OD5 A;  4LAC B;  4K0D A;  1D1A A;  4YT8 A;  2W4M A;  3LS0 A;  2D5R B;  2W4B A;  1KU2 A;  3EH2 A;  2NUP B;  3EQL F;  3ZG1 A;  3POV A;  1OKK A;  3K66 A;  4X0R A;  2G3K A;  1FFT C;  4JUR I;  1Z6A A;  3DM5 A;  2Q9A A;  1FFH A;  4PFO A;  1PD0 A;  4HE8 D;  4I3M A;  2J0W A;  4U5F E;  5KYX B;  4K7B A;  3RKO F;  2IYL D;  3UMK A;  4U5E E;  4O7G A;  2CW0 F;  3PHF 2;  5DQT A;  2J9V A;  2ZXW C;  3ABL C;  5DS5 A;  4OD4 A;  1D0Y A;  1ZHX A;  3ZC4 A;  1Z23 A;  3GOD A;  2VAS A;  1LKX A;  1M2V A;  5T3W A;  2A68 F;  1TWG A;  2NG1 A;  3DD7 A;  3WG7 C;  2J46 A;  4IAO A;  4E7Z A;  4OIP F;  4FES A;  3ZIB A;  3EGD B;  2XXA A;  4BJ6 C;  3M1C B;  3O6X A;  3DMD A;  3T4R A;  3W2V A;  1S7Z A;  1Z3I X;  5KYU A;  4XLN F;  3DAF A;  1TKN A;  2A6E F;  4DVY P;  3IEE A;  1QLE C;  4I1M A;  4ANJ A;  2PP4 A;  2VB6 A;  4G7O F;  1O87 A;  2BE5 F;  5L3V A;  1OCC C;  3NKE A;  5DS4 A;  4C7O A;  5DLJ A;  3Q6N A;  2EIN C;  5T1D B;  3SP1 A;  4YT5 A;  4BJT A;  3JT1 A;  3N24 A;  5DVW A;  4BJ5 C;  5HSW A;  2J9U A;  4KNW A;  2CNW A;  5BUO A;  3RFY A;  3KMI A;  3NKD A;  3SZR A;  4Q5S F;  2WZL A;  3FAJ A;  3FDQ A;  3DAG A;  5B3S C;  4RDA A;  3LAY A;  4DBQ A;  3EG9 A;  4XWJ A;  2KJG A;  4JW1 A;  1W2W A;  3EHN A;  4AE4 B;  3S28 A;  1FMW A;  2WZF A;  5D91 A;  3EZH A;  3K7D A;  2XRH A;  3H65 A;  2QTV A;  2L9J A;  4YWQ A;  3LEV A;  4OIN F;  1OKK D;  4IWB A;  2IOQ A;  2KNH A;  1TWH A;  2Y69 C;  2XL4 A;  1OCR C;  2Y3B A;  3NRH A;  4IJJ A;  2ZXP A;  2A6H F;  4BG0 A;  1M2V B;  2WZG A;  3NYM A;  4LER A;  3CSK A;  3FHD A;  4CS8 A;  3MX3 A;  2H7B A;  3S27 A;  2XXA B;  4CS9 A;  3N0T A;  3F46 A;  2FGY A;  4ZLC A;  2B0J A;  3UMH A;  4PJN A;  3OEO A;  3T6J A;  5KYU B;  4CS7 A;  2J7P A;  4PK4 A;  3QZC A;  1MMA A;  3SYN A;  2PF4 E;  1ZHZ A;  4U5C E;  1V54 C;  2O9X A;  3K1H A;  4CSA A;  2J0X A;  3VYW A;  4C7O B;  1TWA A;  2DYR C;  4BJ1 A;  4KC9 A;  4KI2 A;  1D0Z A;  1LVK A;  3OWT A;  1PD1 A;  4PJJ A;  2J9W A;  4O79 A;  4IRU A;  5EHH A;  4XLP F;  3QMK A;  5KYY A;  3B0U X;  1MND A;  2NUT A;  3NYL A;  4LLC A;  4LLE A;  4XTK A;  4P6I C;  3KKB A;  4PJL A;  3S0X A;  3LLI A;  1J8M F;  5L3Q A;  2VH3 A;  5DQZ A;  4AK9 A;  1MMG A;  2V26 A;  3EG9 B;  2LSE A;  3SNH A;  1VMA A;  3TD7 A;  5E2Q A;  4U5D E;  3UGO A;  4Q4Z F;  4U5B E;  1RJ9 A;  4AE4 A;  5E3C A;  2IXO A;  3V7O A;  5KYN A;  1D1C A;  3VAY A;  2YEV A;  2A69 F;  2CNW D;  3JYH A;  3K33 A;  1BR1 A;  4MND A;  2Z15 A;  2JD3 A;  4C3B A;  3EHM A;  3FVY A;  5B1A C;  4CIH A;  5FCL A;  3DZA A;  1D0X A;  3UMI A;  1OCZ C;  4BJ5 A;  2Q9B A;  3X1O A;  3B0P A;  3NDB B;  4DVZ A;  1VYK A;  2R7R A;  3K1I C;  3UR3 C;  3N2Z B;  1IW7 F;  1ZHW A;  4YN0 B;  2Q9C A;  3AQC A;  2Q3T A;  1N1C A;  1MMD A;  1VK5 A;  2Y39 A;  4O6Y A;  4YT4 A;  3E9V A;  2I8B A;  3CZ6 A;  1JPJ A;  1SF8 A;  1NU9 C;  4C3D A;  5KYY B;  2ZXO A;  3ABM C;  3EPV A;  5CI8 A;  2NUT B;  2WL8 A;  3EJN A;  3WOD F;  3B0V C;  2IXM A;  2J7P D;  5E33 A;  3UNG C;  3W8H A;  2R7Q A;  4A2N B;  1V55 C;  3KL4 A;  4JZA A;  1VYI A;  1TR2 A;  2J45 A;  4RD9 A;  3MLG A;  2WVO A;  4G0H A;  3DM9 B;  1Z5Z A;  1ZYR F;  1RJ9 B;  4M63 A;  4O6M A;  3ZVR A;  2Y3H A;  2CGE A;  2PX0 A;  2Y3D A;  1NG1 A;  4KBL A;  2CDQ A;  3GAN A;  3AQB A;  2V3C C;  1LS1 A;  4B6I A;  2EIK C;  3Q7L A;  4ZLD A;  3EFO A;  4W8K A;  2DGJ A;  3K6B A;  4FX5 A;  4O6N A;  4OIO F;  1G8X A;  3NYJ A;  3O39 A;  5T3T A;  3DJN B;  3ECS A;  3LES A;  3RIP A;  3ASO C;  5IY5 C;  2C03 A;  3Q7G A;  2A1D D;  2R7X A;  4JJG A;  2R7T A;  4MQ9 F;  4QDL A;  2G3V A;  3LS1 A;  1NU7 D;  3L34 A;  1FTS A;  2ZPA A;  4U5G A;  4PFP A;  2WVN A;  4HEA J;  4I44 A;  1M57 C;  3JSZ A;  3LJB A;  4JVS A;  1SMY F;  3ZSU A;  2GFH A;  3LLK A;  4U5H A;  4E7S A;  3JCU Q;  1ZU5 A;  5CI9 A;  4BJ6 A;  4J30 B;  4DOZ A;  2OG2 A;  5F5H A;  2PX3 A;  1ST6 A;  1SZI A;  5KYW A;  1MMN A;  3E70 C;  5D92 A;  5F5F A;  4CS8 C;  5DS6 A;  3I5Q A;  2QY9 A;  3AG3 C;  4CS9 C;  4EBB A;  2X51 A;  1ZHY A;  3UGP A;  2OCC C;  1NZE A;  4WJ0 A;  2R7V A;  4YJW A;  3AG1 C;  2R7O A;  3EFO B;  2H7V C;  4J32 B;  3RYL A;  4OIQ F;  2MYS A;  4CSA C;  2ZXR A;  3X2Q C;  2KQ9 A;  1JPN A;  1D1B A;  4OIR F;  4DBR A;  2R7S A;  3DJU B;  4HFK B;  2P6V A;  1MNE A;  4NY3 A;  3HJC A;  4N06 A;  4H4K C;  2R7U A;  2H7O A;  3EGX A;  4GYT A;  3ASN C;  3EH1 A;  4PJM A;  1O5H A;  1FMV A;  2EIM C;  4GEH A;  2IXN A;  4EWC A;  1J8Y F;  4G7Z F;  2W9Y A;  1TWC A;  2P7V A;  3I5P A;  4HFF B;  1OCO C;  3AG4 C;  3L0I A;  2HV7 A;  5KYW B;  4QI0 A;  2YHS A;  3JRT A;  2Y3G A;  1PCX A;  3F47 A;  5B1B C;  3SEO A;  3W2W A;  1IZM A;  4CBE A;  1WGW A;  3T6B A;  4I1O B;  3I4U A;  2NUP A;  4AX2 A;  2R7W A;  2IXP A;  3B9Q A;  2YZS A;  1M2O A;  3CQZ A;  3OA1 A;  3S29 A;  2WB7 A;  2M4E A;  5KYX A;  1BR2 A;  2PFD A;  3KH2 A;  2W45 A;  1BR4 A;  4C3E A;  2E87 A;  3RH3 A;  3Q6M A;  3PMR A;  4RBN A;  5EGY A;  3LNR A;  1VOM A;  1Z63 A;  2MWQ A;  3W8I A;  3NG1 A;  3EGX B;  4YT2 A;  4G7H F;  4BEJ A;  1QZX A;  2C04 A;  2EIL C;  4ULW A;  2DYS C;  3EZI A;  1ZU4 A;  4Q7C A;  3HTK C;  3EGD A;  2KW3 C;  4QI2 A;  2XSE A;  1ZHT A;  2G62 A;  5E3A A;  3DXJ F;  4F4B A;  2HV6 A;  4KNV A;  3HLZ A;  3ABK C;  2KGO A;  4JCH A;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...