4JURI

Crystal structure of the effector tae4 from salmonella typhimurium in complex with the immunity tai4 from enterobacter cloacae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
b'TLPDISTFSQQQIFENWVQNRCIGKIADSKSLKEDADASAAAWLEASNLPAENFEKADEVIVSLLKQKVGGTEPGHYQILKCTLIANSDAIRPLKSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Insights into the cross-immunity mechanism within effector families of bacteria type VI secretion system from the structure of StTae4-EcTai4 complex
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 34
structure length 97
sequence length 97
chains with identical sequence J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4jurI00
4AX2A 4B6IA 4JURI 4HFFB 4J32B 4J30B 3ZIBA 4HFKB
chains in the Genus database with same CATH superfamily
2J7PD 2OJED 4JCHA 3LEVA 3E70C 3LJBA 4U5GA 1L3PA 1WATA 3W2VA 4JEBA 3B29A 3FHDA 4MTOA 1A0BA 3R2PA 2KK1A 1SF8A 1ORJA 2HFIA 4JC7A 4QDLA 4WGZA 3HNIA 3GM3A 3T6JA 2Y3BA 1T9KA 3EGXA 5BQHA 4O6YA 1HY5A 4LLEA 2YWAA 1BBHA 3LESA 4XPXA 5JT4A 4RBNA 2HMQA 4JJFA 3G4XA 5FCLA 1NU7D 2V3CC 2Q7RA 1WTYA 2I8BA 1ZHXA 3DM5A 4JIOA 3EGDB 1GQAA 2Q9AA 3ZQVA 3C7JA 2J9WA 2NUTA 4EBJA 2KSFA 2O9XA 3A11A 4DRJB 5KYUB 2L7AA 2XSEA 2G3VA 3LNRA 1ZYRF 3MYIA 4IWBA 4U9EA 4MS2A 4A2NB 1H9GA 1ZW2A 4I3MA 4U5EE 4CS8C 4EIYA 1V74B 3RIPA 5L3QA 3Q7LA 3L34A 4U5CE 2CNWD 3DD7A 1PV3A 4E0HA 3ASNC 3AQCA 3B0PA 4KNVA 1UG7A 3T9OA 4AE4A 4AL1A 3MYFA 3M4BA 5AC5A 5A6AA 4LLCA 1QVXA 3TOMA 3GEIA 3NMIA 2EPLX 2I15A 1H7IA 3IQTA 1V55C 1XWJA 1G4WR 4BEJA 1YJGA 4E7ZA 3SNHA 5KYWB 3AGTA 4RDAA 3EG9B 3IQ5A 1A7VA 4JJGA 4MQ9F 4N6HA 2B0JA 3RQEA 1QQ3A 2MWQA 1E2XA 1OXKA 5E3AA 4CDYA 2OKUA 1L7CA 1ZHYA 2QLAA 3C63A 1NLXA 3NKEA 4WJ0A 1JAFA 3M1CB 5L0DA 2WZLA 2Y69C 3UR3C 1YDIA 3K33A 1D0YA 1JMWA 1BR2A 1OXBA 2YLIA 3PDMP 1V4AA 4Q5SF 3ZTMA 1ST6A 3JRTA 3GEHA 4C7OA 2WZFA 3GWNA 5E33A 4CIHA 3HNJA 2ETSA 4LERA 1D1BA 2IOQA 2HSQA 5EK0A 1RKEB 1TFKB 3L8JA 3O55A 3TJ6A 2AWYA 4BJTA 3EPVA 1SMYF 2XM4A 5A6KA 5KYNA 4CDVA 1YZAA 3NMJA 3S27A 1MMAA 5EGYA 3PMRA 1LI5A 2J0WA 2L6HA 2A69F 1CPRA 1O87A 2MYSA 1BR4A 4I44A 4MVOA 3TD7A 1VOMA 2R05A 1B68A 1OKKD 1T6QA 2LCHA 4P6IC 3ITFA 3KL4A 3UMIA 3C8GB 2YEVA 2HKVA 3M4CA 2ASRA 3ABMC 1FNTc 4Q4ZF 1NU9C 5AC4A 2R7XA 2J9BA 1M2VA 1TQGA 2HV7A 1KU2A 3DAFA 3RKOF 3TOLA 5F5HA 4NC3A 4EHPA 4L6RA 1LPEA 3I5PA 2HJMA 2J0XA 1NZEA 2GWWA 2OU6A 2R7OA 3QMKA 4JRZA 2YZSA 3MLGA 2PFDA 2LIGA 3AJMA 4ULVA 3OWTA 1SR2A 3AG2C 3ATPA 3ASOC 2A6EF 2AWCA 2EIKC 2VC9A 1ZHTA 2LQGA 1ZHWA 1YAUO 4E17A 1QLEC 2PNOA 1WASA 1XZPA 4DBRA 1QPUA 3LS0A 3U8VA 1VYIA 1RJ9B 2DYSC 2VH3A 4C3DA 4EWCA 3DWWA 5JP7A 4YT5A 5D91A 3EZHA 1Z5ZA 1T6IA 3ZWIA 5DS5A 1HE9A 2DGJA 3SXMA 1JRAA 1W2WA 4OD5A 5TJ5E 3SZRA 1FTSA 3QVYA 1K04A 3WG7C 3DKAA 4RD9A 4PJMA 1IW7F 4YT8A 1CGME 2XRHA 1OR2A 1WGWA 4OINF 1MMDA 3RQGA 4YN0B 5KYYB 3JT1A 3RYLA 3FOOA 4OIOF 3T6BA 4IAOA 2IXNA 3WHNA 4Z9IA 1LE2A 2VB6A 3HLZA 3T4RA 3CEXA 3Q6MA 5COGA 4KNWA 2R7RA 1VMAA 1OR3A 3FAJA 2KNHA 3ABKC 4HE8D 1HE1A 4MNDA 5E2QA 3S28A 4CS9A 5A69A 2H7BA 1Y6DA 3A9CA 5COFA 3QW1A 1OQCA 3ZC4A 2AU5A 3DAGA 4PFPA 1CGNA 2EPNA 2HS5A 2EPOA 2Q9CA 2BL2A 3I4UA 4HFKB 1YYJA 4P9TA 2J8WA 4H4KC 3RFYA 2XM0A 4D4XA 5B3IA 5HV9A 3US6A 3DJUB 3KH2A 2Q3TA 5A6BA 4G7OF 2WZGA 2Y3GA 3W4YA 3EH2A 3DI5A 3W2WA 4PFOA 2V26A 3EFOA 4IB4A 1NG1A 2LFDA 3J06A 1IZMA 1TR2A 4O6MA 1YARO 2IXPA 2QTVA 3IEEA 3C8GD 4NQFA 3EQLF 3WAQA 4C3EA 4MW8A 5E3CA 2UUHA 5JS5A 1TWHA 3C8ZA 1V54C 3KYIA 4B6IA 3VM6A 2MHRA 4CJOA 5L0HA 3AQBA 1ZHZA 3OA1A 3R7CA 5DQZA 1E85A 4EBKA 5JUAA 3BRJA 3CQZA 3QW0A 4JTCB 1A41A 4E0IA 1YZCA 2KYHA 3CSKA 3S0XA 2AVKA 2XL6A 3O10A 1SYQA 5EHHA 2RD9A 2A0UA 4DRHB 1CGOA 2YL3A 1G4US 4KBLA 2KQ9A 1O3UA 1OCZC 2XLMA 3RQFA 2M64A 3X1OA 2ICWG 3NRHA 2IXMA 1WN0A 2XLEA 1M2OA 1EQ1A 2R25A 4CX9A 2HMZA 2IYLD 2XLOA 1QKRA 1JPJA 2A1DD 2ZXRA 3GM1A 4PK4A 4YK5A 2X0CA 2QNLA 3GORA 4CS8A 1RMVA 4NTBA 1BR1A 3JCUQ 2Q00A 2QY9A 4G7HF 1K05A 4CSAC 4I1OB 2R02A 2E87A 4W8KA 1NBBA 1J8YF 1VYKA 2L81A 3JYHA 4K7BA 4U5DE 4BJ5C 2UUIA 3EZIA 3V5YA 3AGUA 2XL8A 1I4ZA 5L0GA 2NSGA 3I5QA 2C03A 2YKZA 2AP3A 4BPMA 4DVZA 3V7OA 2ZXPA 4JTDB 5KYXA 4OIQF 3NYMA 3AG4C 2A68F 2W45A 2X51A 1Q0FA 1HMOA 1RXQA 3LLKA 2VASA 3N24A 4R32A 4BJ1A 1M6TA 1H9TA 1GM5A 1R5ID 2IBFA 2RSEB 1TWAA 4N4WA 3U3FA 4JW1A 1OCRC 1AUEA 1OCCC 1OCOC 2NUPA 2R7SA 4QI2A 1VLSA 1D0ZA 3FOPA 3HTKC 4J7YA 4WGYA 3UMKA 1UFBA 5K0IA 3DZAA 5DLJA 3NKDA 1TFOB 2W9YA 2Y3DA 4YL0A 4XLNF 2XXAA 3EGXB 1EKYA 3HNLA 3JZ0A 2OJQA 2G62A 2ZD9A 3KYJA 4NY3A 1MMNA 4WABA 5DVWA 3T6GB 3UNGC 3VYWA 4E18A 1PD0A 2Y3HA 3B9QA 3DE9A 3LEOA 4AX2A 4DRIB 4CSAA 2ZXOA 2LK4A 2HSBA 1LVKA 3SXZA 3RH3A 4JVSA 3NG1A 5B3SC 1T5OA 2IXOA 3LS1A 4LDQA 2NUTB 3IQCA 2VCCA 1D1CA 4YT4A 3LNMB 3MFNA 2EPMX 4JTAB 2R7UA 3CZ6A 1FFTC 2OQMA 3C62A 1M57C 4OIRF 3U9JA 3VF0A 4IARA 3NDBB 3W8HA 1TWCA 1OKKA 4I1MA 1T01A 3AG3C 5T3TA 4GQHA 4K0DA 2EPKX 5CI9A 4AE4B 1I5NA 3S84A 3RVZA 2P0NA 3GM2A 3JSEO 2Z15A 1MNEA 3NMKA 4G7ZF 2KC3A 2YL0A 3F47A 4OIPF 3AG1C 1LI7A 3X2QC 1EA8A 4FWVA 4U5FE 3TQOA 4F4BA 2JPUA 1JPNA 2PP4A 2YLGA 3U8PA 1WWPA 1U0BB 4LDKA 4ZLCA 2GAQA 3EGDA 5COMA 3PCVA 1A7DA 4MVZA 4O6NA 3TJ5A 4LACB 1ORSC 3H2UA 5KYUA 3U5SA 1ZW3A 4G0HA 3SXKA 4D4NA 5F5FA 2H7OA 4EKWA 4DOZA 3BEHA 2LSEA 5HSWA 2CGEA 5JRAA 3KPHA 2PX0A 3FVYA 3TK0A 1QZXA 4C7OB 2KJGA 2J9VA 5T1DB 4BJ6C 1MMGA 1HW1A 1HW2A 4NCQA 4P9FA 3QTHA 4LDRA 3K66A 4J32B 4MVQA 2ZPAA 1FFHA 3H65A 4PJLA 4JKVA 3SYNA 4CJGA 1EI7A 2L6GA 4FAPB 1JOGA 1RKCA 5KYWA 3EG9A 1D1AA 2G3KA 4N06A 1E86A 3IPMO 3GANA 2KGOA 4XEFA 3E9VA 3U3BA 4U5BE 4NTAA 4G78A 1NFNA 3JTLO 4JCZA 1Q0DA 5T3WA 3M79A 1JR8A 2FAPB 4N6CA 1VB5A 5A6JA 1OW6A 3JYYA 2HJ3A 3GEEA 5A6BD 1FMVA 1MQVA 4MW3A 2R7VA 2CYDA 1YLMA 2YL7A 3DM9B 4MVRA 4U9DA 2OEXA 4DBQA 1H6GA 4OD4A 1PCXA 3HNKA 4MVUA 4JE9A 5L0JA 1ZVZA 2D5RB 2HUJA 1M2VB 2WB7A 2A0BA 2H8AA 1F1MA 1RKEA 2J7PA 3QVZA 4K1OA 5CIVA 2XS8A 3VRCA 1BZ4A 3O6XA 5DQTA 2IM8A 5AGFA 5JLIA 3B71A 3K6BA 3HKKA 1GS9A 3UGPA 4YL3A 5FZTA 4EUKB 3DJNB 1TWGA 3IHUA 3FDQA 2YHSA 1MNDA 2FFHA 3SEOA 3K1HA 5B1BC 1TKNA 2FGYA 3B0VC 1Q0KA 3DMDA 5DS4A 1LKXA 3G4ZA 3C8GA 4Z9JA 3MBGA 2QE9A 2XL4A 1C17M 1U89A 2R7TA 3CAXA 2HV6A 4UDVA 2DYRC 3ZVRA 4PJJA 5GPGB 3S90A 1R4TA 4ULWA 2P6VA 2B0HA 1KNYA 3KKBA 2OOCA 2P1AA 2XLWA 3ECSA 2XS1A 2P61A 5JSLA 4XWJA 3RVYA 2CNWA 1PD1A 1K40A 4IRUA 1NSGB 3V5XA 2WVOA 3KMIA 2H7VC 4PJNA 3FXHA 4GYTA 1GGQA 1YYXA 2DB4A 2J9UA 2LD6A 3EHNA 1Z7Qc 1U6HA 1S05A 3POVA 2EIMC 1ZU5A 3GODA 4PR9A 2C04A 3RF3A 4CDAA 1RJ9A 1ZZPA 3W8IA 1CPQA 3DE8A 4ZLDA 3RW0A 4MVMA 1LM3B 1RCPA 2M4EA 3EHMA 2F22A 3C18A 3FAPB 3DXJF 3L8IA 3Q7GA 3ZQYA 4BJ5A 2LP4A 3B0UX 3M15A 3LAYA 3ZSUA 4C3BA 4FESA 5F28E 2OEVA 2P7VA 4AK9A 2Q9BA 3LUTB 3JRMO 2XLHA 2EILC 1VK5A 2PBEA 1DOVA 4MTGA 5L0CA 4MVSA 1FR0A 2WVNA 5KYYA 2DI3A 2NPUA 3FMSA 1D0XA 3EFOB 4QI0A 2PF4E 4FX5A 4XTKA 4X0RA 1ZU4A 4NTFA 1FAPB 3Q6NA 4M63A 3WODF 4AL0A 5JVEA 3HJCA 4Z9HA 3PHF2 1NFOA 1LS4A 4CBEA 2R9RB 2W4MA 2GFHA 2YLDA 4XEVA 2BE5F 3ZIBA 2WVQA 3N2ZB 5BUOA 1T6UA 1LE4A 3EJNA 3N0TA 1BDJB 1OW7A 4EBBA 4IAQA 2XLDA 3SXYA 1E83A 1Q0MA 1Y4CA 2D4UA 3EH1A 3TULA 1FMWA 2YL1A 2R7WA 5BQGA 1APCA 4W8PA 2L6FA 1LIHA 4XEKA 3S9OA 3SP1A 4KI2A 2HZ8A 2NSFA 4DJ9A 1I4YA 2L9JA 2ZXWC 3MX3A 1S7ZA 1G8XA 1N1CA 1O5HA 3GWLA 4JURI 4HEAJ 4IGGA 4BEMJ 4GEHA 4E7SA 1WOLA 4J30B 4YWQA 2OCCC 4XPYA 3U0CA 4YT2A 2GA0A 3OEOA 2CDQA 3L1MA 4PACA 3IQ6A 1YA9A 1Z3IX 3UMHA 1ORYA 2J45A 1C03A 4XLPF 5BQIA 2EINC 2QUPA 4Q7CA 3U9MA 1XZQA 3V5ZA 4IJJA 2YRFA 2JX0A 1Z6AA 1AEPA 3G50A 3ABLC 2YVKA 2VCBA 4MTFA 5D92A 3VAYA 5KYXB 3F46A 256BA 2A6HF 3S29A 1Q0GA 3QZCA 4DVYP 3ZTZA 3U2LA 5L0IA 4ONSA 4XQ1A 4O79A 3UGOA 2LFFA 1KTMA 2YQYA 2VCAA 2NUPB 3K1IC 1M56C 1VLTA 2R7QA 2OG2A 3ZDLA 1E84A 2R03A 2PX3A 2CW0F 2NG1A 3O39A 4H54A 1A7EA 4J7TA 2Y39A 4U5HA 3JSZA 4CS9C 5L0FA 3L0IA 2GDCA 3NYJA 3NYLA 4CS7A 1VTMP 2KW3C 4O7GA 4BJ6A 2XXAB 5L3VA 1OW8A 5DS6A 4YJWA 5IY5C 2TMVP 3H2VA 4JZAA 1Z23A 3AOUA 4KC9A 4A4AA 3K7DA 1J8MF 2W4BA 1YVIA 4HFFB 1G5ZA 4XPWA 2JD3A 3K1IA 3LLIA 1AVOB 3U2MA 2BC5A 1HMDA 2XLVA 2WL8A 4ANJA 5B1AC 4ER9A 3ZG1A 1LS1A 2CCYA 4JEAA 1SZIA 2Q4FA 2EIJC 4BG0A 1QSPA 4YL1A 1Z63A 5CI8A 4DXWA 1C02A 4CIPA 2J46A 1YA7O 1DOWA
chains in the Genus database with same CATH topology
2J7PD 4JCHA 3LEVA 3E70C 3LJBA 4U5GA 3W2VA 3FHDA 1SF8A 4QDLA 3T6JA 2Y3BA 3EGXA 4O6YA 4LLEA 3LESA 4RBNA 4JJFA 5FCLA 1NU7D 2V3CC 2I8BA 1ZHXA 3DM5A 3EGDB 2Q9AA 2NUTA 2J9WA 2O9XA 5KYUB 2XSEA 2G3VA 3LNRA 1ZYRF 4IWBA 4A2NB 4I3MA 4U5EE 4CS8C 5L3QA 3RIPA 3Q7LA 3L34A 4U5CE 2CNWD 3DD7A 3ASNC 3AQCA 3B0PA 4KNVA 4AE4A 4LLCA 4BEJA 1V55C 4E7ZA 3SNHA 5KYWB 4RDAA 3EG9B 4JJGA 4MQ9F 2B0JA 2MWQA 5E3AA 1ZHYA 4WJ0A 3NKEA 3M1CB 2WZLA 2Y69C 3UR3C 3K33A 1D0YA 1BR2A 4Q5SF 1ST6A 3JRTA 4C7OA 2WZFA 5E33A 4CIHA 4LERA 1D1BA 2IOQA 3EPVA 1SMYF 5KYNA 3S27A 1MMAA 5EGYA 3PMRA 2J0WA 2A69F 2MYSA 1O87A 1BR4A 4I44A 3TD7A 1VOMA 1OKKD 4P6IC 3ITFA 3KL4A 2YEVA 3ABMC 4Q4ZF 1NU9C 2R7XA 1M2VA 2HV7A 1KU2A 3DAFA 3RKOF 5F5HA 3I5PA 2J0XA 1NZEA 2R7OA 3QMKA 2YZSA 3MLGA 2PFDA 3OWTA 3AG2C 3ASOC 2A6EF 2EIKC 1ZHTA 1ZHWA 1QLEC 4DBRA 3LS0A 1VYIA 2VH3A 1RJ9B 2DYSC 4C3DA 4EWCA 4YT5A 5D91A 3EZHA 1Z5ZA 5DS5A 2DGJA 1W2WA 3WG7C 4OD5A 3SZRA 1FTSA 4RD9A 4PJMA 1IW7F 4YT8A 2XRHA 1WGWA 4OINF 1MMDA 5KYYB 4YN0B 3JT1A 3RYLA 4OIOF 3T6BA 4IAOA 2IXNA 2VB6A 3HLZA 3T4RA 3Q6MA 4KNWA 2R7RA 1VMAA 3FAJA 2KNHA 3ABKC 4HE8D 5E2QA 4MNDA 3S28A 4CS9A 2H7BA 3ZC4A 3DAGA 4PFPA 2Q9CA 3I4UA 4HFKB 4H4KC 3RFYA 3DJUB 3KH2A 2Q3TA 4G7OF 2WZGA 2Y3GA 3W2WA 3EH2A 4PFOA 2V26A 3EFOA 1NG1A 1IZMA 1TR2A 4O6MA 4C3EA 2IXPA 2QTVA 3IEEA 3EQLF 5E3CA 1TWHA 4B6IA 1V54C 3AQBA 1ZHZA 3OA1A 5DQZA 3CQZA 3CSKA 3S0XA 5EHHA 4KBLA 2KQ9A 3X1OA 1OCZC 3NRHA 2IXMA 1M2OA 2IYLD 3UMIA 4BJTA 4PK4A 1JPJA 2A1DD 2ZXRA 4CS8A 1BR1A 3JCUQ 2QY9A 4G7HF 4CSAC 4I1OB 2E87A 4W8KA 1VYKA 1J8YF 2L81A 3JYHA 4K7BA 4U5DE 4BJ5C 3EZIA 3I5QA 2C03A 4DVZA 3V7OA 2ZXPA 5KYXA 4OIQF 3NYMA 3AG4C 2A68F 2W45A 2X51A 3N24A 3LLKA 2VASA 4BJ1A 4CSAA 1TWAA 4JW1A 1OCRC 1OCOC 1OCCC 2NUPA 4QI2A 1D0ZA 3UMKA 3HTKC 3DZAA 5DLJA 3NKDA 2W9YA 2Y3DA 2XXAA 4XLNF 3EGXB 4NY3A 2G62A 3UNGC 1MMNA 5DVWA 2R7SA 3VYWA 1PD0A 3B9QA 2Y3HA 4AX2A 2ZXOA 1LVKA 3RH3A 4JVSA 3NG1A 5B3SC 2IXOA 3LS1A 2NUTB 1D1CA 4YT4A 2R7UA 3CZ6A 1FFTC 1M57C 4OIRF 3NDBB 3W8HA 1TWCA 1OKKA 4I1MA 3AG3C 5T3TA 4K0DA 5CI9A 4AE4B 2Z15A 1MNEA 4G7ZF 3F47A 4OIPF 3AG1C 3X2QC 4FWVA 4U5FE 4F4BA 1JPNA 2PP4A 4ZLCA 3EGDA 4O6NA 4LACB 5KYUA 4G0HA 5F5FA 2H7OA 4DOZA 2LSEA 5HSWA 2CGEA 2PX0A 3FVYA 1QZXA 4C7OB 2KJGA 2J9VA 5T1DB 4BJ6C 1MMGA 3K66A 4J32B 2ZPAA 1FFHA 3H65A 4PJLA 3SYNA 5KYWA 3EG9A 1D1AA 2G3KA 4N06A 3GANA 2KGOA 3E9VA 4U5BE 5T3WA 1FMVA 2R7VA 3DM9B 4DBQA 4OD4A 1PCXA 2D5RB 2WB7A 1M2VB 2J7PA 3O6XA 5DQTA 3K6BA 3UGPA 3DJNB 1TWGA 3FDQA 2YHSA 1MNDA 2FFHA 3SEOA 3K1HA 5B1BC 1TKNA 2FGYA 3B0VC 3DMDA 5DS4A 1LKXA 2XL4A 2R7TA 2HV6A 2DYRC 3ZVRA 4PJJA 4ULWA 2P6VA 3KKBA 3ECSA 4XWJA 2CNWA 1PD1A 4IRUA 2WVOA 3KMIA 2H7VC 4PJNA 4GYTA 2J9UA 3EHNA 3POVA 2EIMC 1ZU5A 3GODA 2C04A 1RJ9A 3W8IA 4ZLDA 2M4EA 3EHMA 3DXJF 4BJ5A 3Q7GA 3B0UX 3ZSUA 3LAYA 4C3BA 4FESA 4AK9A 2P7VA 2Q9BA 2EILC 1VK5A 2WVNA 5KYYA 4QI0A 1D0XA 3EFOB 2PF4E 4FX5A 4XTKA 4X0RA 1ZU4A 3Q6NA 4M63A 3WODF 3HJCA 3PHF2 4CBEA 2W4MA 2GFHA 2BE5F 3ZIBA 2WVQA 3N2ZB 5BUOA 4EBBA 3EJNA 3N0TA 3EH1A 1FMWA 2R7WA 3SP1A 4KI2A 2L9JA 2ZXWC 3MX3A 1S7ZA 1G8XA 1N1CA 1O5HA 4E7SA 4JURI 4HEAJ 4YWQA 4GEHA 4J30B 2OCCC 4YT2A 3OEOA 2CDQA 3UMHA 1Z3IX 2J45A 4XLPF 2EINC 4Q7CA 4IJJA 1Z6AA 3ABLC 5D92A 3VAYA 5KYXB 3F46A 3S29A 2A6HF 3QZCA 4DVYP 3UGOA 4O79A 2NUPB 3K1IC 1M56C 2R7QA 2OG2A 2PX3A 2CW0F 2NG1A 3O39A 2Y39A 4U5HA 3JSZA 4CS9C 3L0IA 3NYLA 3NYJA 2XXAB 4CS7A 2KW3C 4O7GA 4BJ6A 5L3VA 5DS6A 4YJWA 5IY5C 4JZAA 1Z23A 4KC9A 3K7DA 1J8MF 2W4BA 4HFFB 2JD3A 3LLIA 2WL8A 4ANJA 5B1AC 3ZG1A 1LS1A 1SZIA 2EIJC 4BG0A 1Z63A 5CI8A 2J46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  4B6I A;  4JUR I;  4HFF B;  4J32 B;  4J30 B;  3ZIB A;  4HFK B; 
#chains in the Genus database with same CATH topology
 2J7P D;  2OJE D;  4JCH A;  3LEV A;  3E70 C;  3LJB A;  4U5G A;  1L3P A;  1WAT A;  3W2V A;  4JEB A;  3B29 A;  3FHD A;  4MTO A;  1A0B A;  3R2P A;  2KK1 A;  1SF8 A;  1ORJ A;  2HFI A;  4JC7 A;  4QDL A;  4WGZ A;  3HNI A;  3GM3 A;  3T6J A;  2Y3B A;  1T9K A;  3EGX A;  5BQH A;  4O6Y A;  1HY5 A;  4LLE A;  2YWA A;  1BBH A;  3LES A;  4XPX A;  5JT4 A;  4RBN A;  2HMQ A;  4JJF A;  3G4X A;  5FCL A;  1NU7 D;  2V3C C;  2Q7R A;  1WTY A;  2I8B A;  1ZHX A;  3DM5 A;  4JIO A;  3EGD B;  1GQA A;  2Q9A A;  3ZQV A;  3C7J A;  2J9W A;  2NUT A;  4EBJ A;  2KSF A;  2O9X A;  3A11 A;  4DRJ B;  5KYU B;  2L7A A;  2XSE A;  2G3V A;  3LNR A;  1ZYR F;  3MYI A;  4IWB A;  4U9E A;  4MS2 A;  4A2N B;  1H9G A;  1ZW2 A;  4I3M A;  4U5E E;  4CS8 C;  4EIY A;  1V74 B;  3RIP A;  5L3Q A;  3Q7L A;  3L34 A;  4U5C E;  2CNW D;  3DD7 A;  1PV3 A;  4E0H A;  3ASN C;  3AQC A;  3B0P A;  4KNV A;  1UG7 A;  3T9O A;  4AE4 A;  4AL1 A;  3MYF A;  3M4B A;  5AC5 A;  5A6A A;  4LLC A;  1QVX A;  3TOM A;  3GEI A;  3NMI A;  2EPL X;  2I15 A;  1H7I A;  3IQT A;  1V55 C;  1XWJ A;  1G4W R;  4BEJ A;  1YJG A;  4E7Z A;  3SNH A;  5KYW B;  3AGT A;  4RDA A;  3EG9 B;  3IQ5 A;  1A7V A;  4JJG A;  4MQ9 F;  4N6H A;  2B0J A;  3RQE A;  1QQ3 A;  2MWQ A;  1E2X A;  1OXK A;  5E3A A;  4CDY A;  2OKU A;  1L7C A;  1ZHY A;  2QLA A;  3C63 A;  1NLX A;  3NKE A;  4WJ0 A;  1JAF A;  3M1C B;  5L0D A;  2WZL A;  2Y69 C;  3UR3 C;  1YDI A;  3K33 A;  1D0Y A;  1JMW A;  1BR2 A;  1OXB A;  2YLI A;  3PDM P;  1V4A A;  4Q5S F;  3ZTM A;  1ST6 A;  3JRT A;  3GEH A;  4C7O A;  2WZF A;  3GWN A;  5E33 A;  4CIH A;  3HNJ A;  2ETS A;  4LER A;  1D1B A;  2IOQ A;  2HSQ A;  5EK0 A;  1RKE B;  1TFK B;  3L8J A;  3O55 A;  3TJ6 A;  2AWY A;  4BJT A;  3EPV A;  1SMY F;  2XM4 A;  5A6K A;  5KYN A;  4CDV A;  1YZA A;  3NMJ A;  3S27 A;  1MMA A;  5EGY A;  3PMR A;  1LI5 A;  2J0W A;  2L6H A;  2A69 F;  1CPR A;  1O87 A;  2MYS A;  1BR4 A;  4I44 A;  4MVO A;  3TD7 A;  1VOM A;  2R05 A;  1B68 A;  1OKK D;  1T6Q A;  2LCH A;  4P6I C;  3ITF A;  3KL4 A;  3UMI A;  3C8G B;  2YEV A;  2HKV A;  3M4C A;  2ASR A;  3ABM C;  1FNT c;  4Q4Z F;  1NU9 C;  5AC4 A;  2R7X A;  2J9B A;  1M2V A;  1TQG A;  2HV7 A;  1KU2 A;  3DAF A;  3RKO F;  3TOL A;  5F5H A;  4NC3 A;  4EHP A;  4L6R A;  1LPE A;  3I5P A;  2HJM A;  2J0X A;  1NZE A;  2GWW A;  2OU6 A;  2R7O A;  3QMK A;  4JRZ A;  2YZS A;  3MLG A;  2PFD A;  2LIG A;  3AJM A;  4ULV A;  3OWT A;  1SR2 A;  3AG2 C;  3ATP A;  3ASO C;  2A6E F;  2AWC A;  2EIK C;  2VC9 A;  1ZHT A;  2LQG A;  1ZHW A;  1YAU O;  4E17 A;  1QLE C;  2PNO A;  1WAS A;  1XZP A;  4DBR A;  1QPU A;  3LS0 A;  3U8V A;  1VYI A;  1RJ9 B;  2DYS C;  2VH3 A;  4C3D A;  4EWC A;  3DWW A;  5JP7 A;  4YT5 A;  5D91 A;  3EZH A;  1Z5Z A;  1T6I A;  3ZWI A;  5DS5 A;  1HE9 A;  2DGJ A;  3SXM A;  1JRA A;  1W2W A;  4OD5 A;  5TJ5 E;  3SZR A;  1FTS A;  3QVY A;  1K04 A;  3WG7 C;  3DKA A;  4RD9 A;  4PJM A;  1IW7 F;  4YT8 A;  1CGM E;  2XRH A;  1OR2 A;  1WGW A;  4OIN F;  1MMD A;  3RQG A;  4YN0 B;  5KYY B;  3JT1 A;  3RYL A;  3FOO A;  4OIO F;  3T6B A;  4IAO A;  2IXN A;  3WHN A;  4Z9I A;  1LE2 A;  2VB6 A;  3HLZ A;  3T4R A;  3CEX A;  3Q6M A;  5COG A;  4KNW A;  2R7R A;  1VMA A;  1OR3 A;  3FAJ A;  2KNH A;  3ABK C;  4HE8 D;  1HE1 A;  4MND A;  5E2Q A;  3S28 A;  4CS9 A;  5A69 A;  2H7B A;  1Y6D A;  3A9C A;  5COF A;  3QW1 A;  1OQC A;  3ZC4 A;  2AU5 A;  3DAG A;  4PFP A;  1CGN A;  2EPN A;  2HS5 A;  2EPO A;  2Q9C A;  2BL2 A;  3I4U A;  4HFK B;  1YYJ A;  4P9T A;  2J8W A;  4H4K C;  3RFY A;  2XM0 A;  4D4X A;  5B3I A;  5HV9 A;  3US6 A;  3DJU B;  3KH2 A;  2Q3T A;  5A6B A;  4G7O F;  2WZG A;  2Y3G A;  3W4Y A;  3EH2 A;  3DI5 A;  3W2W A;  4PFO A;  2V26 A;  3EFO A;  4IB4 A;  1NG1 A;  2LFD A;  3J06 A;  1IZM A;  1TR2 A;  4O6M A;  1YAR O;  2IXP A;  2QTV A;  3IEE A;  3C8G D;  4NQF A;  3EQL F;  3WAQ A;  4C3E A;  4MW8 A;  5E3C A;  2UUH A;  5JS5 A;  1TWH A;  3C8Z A;  1V54 C;  3KYI A;  4B6I A;  3VM6 A;  2MHR A;  4CJO A;  5L0H A;  3AQB A;  1ZHZ A;  3OA1 A;  3R7C A;  5DQZ A;  1E85 A;  4EBK A;  5JUA A;  3BRJ A;  3CQZ A;  3QW0 A;  4JTC B;  1A41 A;  4E0I A;  1YZC A;  2KYH A;  3CSK A;  3S0X A;  2AVK A;  2XL6 A;  3O10 A;  1SYQ A;  5EHH A;  2RD9 A;  2A0U A;  4DRH B;  1CGO A;  2YL3 A;  1G4U S;  4KBL A;  2KQ9 A;  1O3U A;  1OCZ C;  2XLM A;  3RQF A;  2M64 A;  3X1O A;  2ICW G;  3NRH A;  2IXM A;  1WN0 A;  2XLE A;  1M2O A;  1EQ1 A;  2R25 A;  4CX9 A;  2HMZ A;  2IYL D;  2XLO A;  1QKR A;  1JPJ A;  2A1D D;  2ZXR A;  3GM1 A;  4PK4 A;  4YK5 A;  2X0C A;  2QNL A;  3GOR A;  4CS8 A;  1RMV A;  4NTB A;  1BR1 A;  3JCU Q;  2Q00 A;  2QY9 A;  4G7H F;  1K05 A;  4CSA C;  4I1O B;  2R02 A;  2E87 A;  4W8K A;  1NBB A;  1J8Y F;  1VYK A;  2L81 A;  3JYH A;  4K7B A;  4U5D E;  4BJ5 C;  2UUI A;  3EZI A;  3V5Y A;  3AGU A;  2XL8 A;  1I4Z A;  5L0G A;  2NSG A;  3I5Q A;  2C03 A;  2YKZ A;  2AP3 A;  4BPM A;  4DVZ A;  3V7O A;  2ZXP A;  4JTD B;  5KYX A;  4OIQ F;  3NYM A;  3AG4 C;  2A68 F;  2W45 A;  2X51 A;  1Q0F A;  1HMO A;  1RXQ A;  3LLK A;  2VAS A;  3N24 A;  4R32 A;  4BJ1 A;  1M6T A;  1H9T A;  1GM5 A;  1R5I D;  2IBF A;  2RSE B;  1TWA A;  4N4W A;  3U3F A;  4JW1 A;  1OCR C;  1AUE A;  1OCC C;  1OCO C;  2NUP A;  2R7S A;  4QI2 A;  1VLS A;  1D0Z A;  3FOP A;  3HTK C;  4J7Y A;  4WGY A;  3UMK A;  1UFB A;  5K0I A;  3DZA A;  5DLJ A;  3NKD A;  1TFO B;  2W9Y A;  2Y3D A;  4YL0 A;  4XLN F;  2XXA A;  3EGX B;  1EKY A;  3HNL A;  3JZ0 A;  2OJQ A;  2G62 A;  2ZD9 A;  3KYJ A;  4NY3 A;  1MMN A;  4WAB A;  5DVW A;  3T6G B;  3UNG C;  3VYW A;  4E18 A;  1PD0 A;  2Y3H A;  3B9Q A;  3DE9 A;  3LEO A;  4AX2 A;  4DRI B;  4CSA A;  2ZXO A;  2LK4 A;  2HSB A;  1LVK A;  3SXZ A;  3RH3 A;  4JVS A;  3NG1 A;  5B3S C;  1T5O A;  2IXO A;  3LS1 A;  4LDQ A;  2NUT B;  3IQC A;  2VCC A;  1D1C A;  4YT4 A;  3LNM B;  3MFN A;  2EPM X;  4JTA B;  2R7U A;  3CZ6 A;  1FFT C;  2OQM A;  3C62 A;  1M57 C;  4OIR F;  3U9J A;  3VF0 A;  4IAR A;  3NDB B;  3W8H A;  1TWC A;  1OKK A;  4I1M A;  1T01 A;  3AG3 C;  5T3T A;  4GQH A;  4K0D A;  2EPK X;  5CI9 A;  4AE4 B;  1I5N A;  3S84 A;  3RVZ A;  2P0N A;  3GM2 A;  3JSE O;  2Z15 A;  1MNE A;  3NMK A;  4G7Z F;  2KC3 A;  2YL0 A;  3F47 A;  4OIP F;  3AG1 C;  1LI7 A;  3X2Q C;  1EA8 A;  4FWV A;  4U5F E;  3TQO A;  4F4B A;  2JPU A;  1JPN A;  2PP4 A;  2YLG A;  3U8P A;  1WWP A;  1U0B B;  4LDK A;  4ZLC A;  2GAQ A;  3EGD A;  5COM A;  3PCV A;  1A7D A;  4MVZ A;  4O6N A;  3TJ5 A;  4LAC B;  1ORS C;  3H2U A;  5KYU A;  3U5S A;  1ZW3 A;  4G0H A;  3SXK A;  4D4N A;  5F5F A;  2H7O A;  4EKW A;  4DOZ A;  3BEH A;  2LSE A;  5HSW A;  2CGE A;  5JRA A;  3KPH A;  2PX0 A;  3FVY A;  3TK0 A;  1QZX A;  4C7O B;  2KJG A;  2J9V A;  5T1D B;  4BJ6 C;  1MMG A;  1HW1 A;  1HW2 A;  4NCQ A;  4P9F A;  3QTH A;  4LDR A;  3K66 A;  4J32 B;  4MVQ A;  2ZPA A;  1FFH A;  3H65 A;  4PJL A;  4JKV A;  3SYN A;  4CJG A;  1EI7 A;  2L6G A;  4FAP B;  1JOG A;  1RKC A;  5KYW A;  3EG9 A;  1D1A A;  2G3K A;  4N06 A;  1E86 A;  3IPM O;  3GAN A;  2KGO A;  4XEF A;  3E9V A;  3U3B A;  4U5B E;  4NTA A;  4G78 A;  1NFN A;  3JTL O;  4JCZ A;  1Q0D A;  5T3W A;  3M79 A;  1JR8 A;  2FAP B;  4N6C A;  1VB5 A;  5A6J A;  1OW6 A;  3JYY A;  2HJ3 A;  3GEE A;  5A6B D;  1FMV A;  1MQV A;  4MW3 A;  2R7V A;  2CYD A;  1YLM A;  2YL7 A;  3DM9 B;  4MVR A;  4U9D A;  2OEX A;  4DBQ A;  1H6G A;  4OD4 A;  1PCX A;  3HNK A;  4MVU A;  4JE9 A;  5L0J A;  1ZVZ A;  2D5R B;  2HUJ A;  1M2V B;  2WB7 A;  2A0B A;  2H8A A;  1F1M A;  1RKE A;  2J7P A;  3QVZ A;  4K1O A;  5CIV A;  2XS8 A;  3VRC A;  1BZ4 A;  3O6X A;  5DQT A;  2IM8 A;  5AGF A;  5JLI A;  3B71 A;  3K6B A;  3HKK A;  1GS9 A;  3UGP A;  4YL3 A;  5FZT A;  4EUK B;  3DJN B;  1TWG A;  3IHU A;  3FDQ A;  2YHS A;  1MND A;  2FFH A;  3SEO A;  3K1H A;  5B1B C;  1TKN A;  2FGY A;  3B0V C;  1Q0K A;  3DMD A;  5DS4 A;  1LKX A;  3G4Z A;  3C8G A;  4Z9J A;  3MBG A;  2QE9 A;  2XL4 A;  1C17 M;  1U89 A;  2R7T A;  3CAX A;  2HV6 A;  4UDV A;  2DYR C;  3ZVR A;  4PJJ A;  5GPG B;  3S90 A;  1R4T A;  4ULW A;  2P6V A;  2B0H A;  1KNY A;  3KKB A;  2OOC A;  2P1A A;  2XLW A;  3ECS A;  2XS1 A;  2P61 A;  5JSL A;  4XWJ A;  3RVY A;  2CNW A;  1PD1 A;  1K40 A;  4IRU A;  1NSG B;  3V5X A;  2WVO A;  3KMI A;  2H7V C;  4PJN A;  3FXH A;  4GYT A;  1GGQ A;  1YYX A;  2DB4 A;  2J9U A;  2LD6 A;  3EHN A;  1Z7Q c;  1U6H A;  1S05 A;  3POV A;  2EIM C;  1ZU5 A;  3GOD A;  4PR9 A;  2C04 A;  3RF3 A;  4CDA A;  1RJ9 A;  1ZZP A;  3W8I A;  1CPQ A;  3DE8 A;  4ZLD A;  3RW0 A;  4MVM A;  1LM3 B;  1RCP A;  2M4E A;  3EHM A;  2F22 A;  3C18 A;  3FAP B;  3DXJ F;  3L8I A;  3Q7G A;  3ZQY A;  4BJ5 A;  2LP4 A;  3B0U X;  3M15 A;  3LAY A;  3ZSU A;  4C3B A;  4FES A;  5F28 E;  2OEV A;  2P7V A;  4AK9 A;  2Q9B A;  3LUT B;  3JRM O;  2XLH A;  2EIL C;  1VK5 A;  2PBE A;  1DOV A;  4MTG A;  5L0C A;  4MVS A;  1FR0 A;  2WVN A;  5KYY A;  2DI3 A;  2NPU A;  3FMS A;  1D0X A;  3EFO B;  4QI0 A;  2PF4 E;  4FX5 A;  4XTK A;  4X0R A;  1ZU4 A;  4NTF A;  1FAP B;  3Q6N A;  4M63 A;  3WOD F;  4AL0 A;  5JVE A;  3HJC A;  4Z9H A;  3PHF 2;  1NFO A;  1LS4 A;  4CBE A;  2R9R B;  2W4M A;  2GFH A;  2YLD A;  4XEV A;  2BE5 F;  3ZIB A;  2WVQ A;  3N2Z B;  5BUO A;  1T6U A;  1LE4 A;  3EJN A;  3N0T A;  1BDJ B;  1OW7 A;  4EBB A;  4IAQ A;  2XLD A;  3SXY A;  1E83 A;  1Q0M A;  1Y4C A;  2D4U A;  3EH1 A;  3TUL A;  1FMW A;  2YL1 A;  2R7W A;  5BQG A;  1APC A;  4W8P A;  2L6F A;  1LIH A;  4XEK A;  3S9O A;  3SP1 A;  4KI2 A;  2HZ8 A;  2NSF A;  4DJ9 A;  1I4Y A;  2L9J A;  2ZXW C;  3MX3 A;  1S7Z A;  1G8X A;  1N1C A;  1O5H A;  3GWL A;  4JUR I;  4HEA J;  4IGG A;  4BEM J;  4GEH A;  4E7S A;  1WOL A;  4J30 B;  4YWQ A;  2OCC C;  4XPY A;  3U0C A;  4YT2 A;  2GA0 A;  3OEO A;  2CDQ A;  3L1M A;  4PAC A;  3IQ6 A;  1YA9 A;  1Z3I X;  3UMH A;  1ORY A;  2J45 A;  1C03 A;  4XLP F;  5BQI A;  2EIN C;  2QUP A;  4Q7C A;  3U9M A;  1XZQ A;  3V5Z A;  4IJJ A;  2YRF A;  2JX0 A;  1Z6A A;  1AEP A;  3G50 A;  3ABL C;  2YVK A;  2VCB A;  4MTF A;  5D92 A;  3VAY A;  5KYX B;  3F46 A;  256B A;  2A6H F;  3S29 A;  1Q0G A;  3QZC A;  4DVY P;  3ZTZ A;  3U2L A;  5L0I A;  4ONS A;  4XQ1 A;  4O79 A;  3UGO A;  2LFF A;  1KTM A;  2YQY A;  2VCA A;  2NUP B;  3K1I C;  1M56 C;  1VLT A;  2R7Q A;  2OG2 A;  3ZDL A;  1E84 A;  2R03 A;  2PX3 A;  2CW0 F;  2NG1 A;  3O39 A;  4H54 A;  1A7E A;  4J7T A;  2Y39 A;  4U5H A;  3JSZ A;  4CS9 C;  5L0F A;  3L0I A;  2GDC A;  3NYJ A;  3NYL A;  4CS7 A;  1VTM P;  2KW3 C;  4O7G A;  4BJ6 A;  2XXA B;  5L3V A;  1OW8 A;  5DS6 A;  4YJW A;  5IY5 C;  2TMV P;  3H2V A;  4JZA A;  1Z23 A;  3AOU A;  4KC9 A;  4A4A A;  3K7D A;  1J8M F;  2W4B A;  1YVI A;  4HFF B;  1G5Z A;  4XPW A;  2JD3 A;  3K1I A;  3LLI A;  1AVO B;  3U2M A;  2BC5 A;  1HMD A;  2XLV A;  2WL8 A;  4ANJ A;  5B1A C;  4ER9 A;  3ZG1 A;  1LS1 A;  2CCY A;  4JEA A;  1SZI A;  2Q4F A;  2EIJ C;  4BG0 A;  1QSP A;  4YL1 A;  1Z63 A;  5CI8 A;  4DXW A;  1C02 A;  4CIP A;  2J46 A;  1YA7 O;  1DOW A; 
#chains in the Genus database with same CATH homology
 2J7P D;  4JCH A;  3LEV A;  3E70 C;  3LJB A;  4U5G A;  3W2V A;  3FHD A;  1SF8 A;  4QDL A;  3T6J A;  2Y3B A;  3EGX A;  4O6Y A;  4LLE A;  3LES A;  4RBN A;  4JJF A;  5FCL A;  1NU7 D;  2V3C C;  2I8B A;  1ZHX A;  3DM5 A;  3EGD B;  2Q9A A;  2NUT A;  2J9W A;  2O9X A;  5KYU B;  2XSE A;  2G3V A;  3LNR A;  1ZYR F;  4IWB A;  4A2N B;  4I3M A;  4U5E E;  4CS8 C;  5L3Q A;  3RIP A;  3Q7L A;  3L34 A;  4U5C E;  2CNW D;  3DD7 A;  3ASN C;  3AQC A;  3B0P A;  4KNV A;  4AE4 A;  4LLC A;  4BEJ A;  1V55 C;  4E7Z A;  3SNH A;  5KYW B;  4RDA A;  3EG9 B;  4JJG A;  4MQ9 F;  2B0J A;  2MWQ A;  5E3A A;  1ZHY A;  4WJ0 A;  3NKE A;  3M1C B;  2WZL A;  2Y69 C;  3UR3 C;  3K33 A;  1D0Y A;  1BR2 A;  4Q5S F;  1ST6 A;  3JRT A;  4C7O A;  2WZF A;  5E33 A;  4CIH A;  4LER A;  1D1B A;  2IOQ A;  3EPV A;  1SMY F;  5KYN A;  3S27 A;  1MMA A;  5EGY A;  3PMR A;  2J0W A;  2A69 F;  2MYS A;  1O87 A;  1BR4 A;  4I44 A;  3TD7 A;  1VOM A;  1OKK D;  4P6I C;  3ITF A;  3KL4 A;  2YEV A;  3ABM C;  4Q4Z F;  1NU9 C;  2R7X A;  1M2V A;  2HV7 A;  1KU2 A;  3DAF A;  3RKO F;  5F5H A;  3I5P A;  2J0X A;  1NZE A;  2R7O A;  3QMK A;  2YZS A;  3MLG A;  2PFD A;  3OWT A;  3AG2 C;  3ASO C;  2A6E F;  2EIK C;  1ZHT A;  1ZHW A;  1QLE C;  4DBR A;  3LS0 A;  1VYI A;  2VH3 A;  1RJ9 B;  2DYS C;  4C3D A;  4EWC A;  4YT5 A;  5D91 A;  3EZH A;  1Z5Z A;  5DS5 A;  2DGJ A;  1W2W A;  3WG7 C;  4OD5 A;  3SZR A;  1FTS A;  4RD9 A;  4PJM A;  1IW7 F;  4YT8 A;  2XRH A;  1WGW A;  4OIN F;  1MMD A;  5KYY B;  4YN0 B;  3JT1 A;  3RYL A;  4OIO F;  3T6B A;  4IAO A;  2IXN A;  2VB6 A;  3HLZ A;  3T4R A;  3Q6M A;  4KNW A;  2R7R A;  1VMA A;  3FAJ A;  2KNH A;  3ABK C;  4HE8 D;  5E2Q A;  4MND A;  3S28 A;  4CS9 A;  2H7B A;  3ZC4 A;  3DAG A;  4PFP A;  2Q9C A;  3I4U A;  4HFK B;  4H4K C;  3RFY A;  3DJU B;  3KH2 A;  2Q3T A;  4G7O F;  2WZG A;  2Y3G A;  3W2W A;  3EH2 A;  4PFO A;  2V26 A;  3EFO A;  1NG1 A;  1IZM A;  1TR2 A;  4O6M A;  4C3E A;  2IXP A;  2QTV A;  3IEE A;  3EQL F;  5E3C A;  1TWH A;  4B6I A;  1V54 C;  3AQB A;  1ZHZ A;  3OA1 A;  5DQZ A;  3CQZ A;  3CSK A;  3S0X A;  5EHH A;  4KBL A;  2KQ9 A;  3X1O A;  1OCZ C;  3NRH A;  2IXM A;  1M2O A;  2IYL D;  3UMI A;  4BJT A;  4PK4 A;  1JPJ A;  2A1D D;  2ZXR A;  4CS8 A;  1BR1 A;  3JCU Q;  2QY9 A;  4G7H F;  4CSA C;  4I1O B;  2E87 A;  4W8K A;  1VYK A;  1J8Y F;  2L81 A;  3JYH A;  4K7B A;  4U5D E;  4BJ5 C;  3EZI A;  3I5Q A;  2C03 A;  4DVZ A;  3V7O A;  2ZXP A;  5KYX A;  4OIQ F;  3NYM A;  3AG4 C;  2A68 F;  2W45 A;  2X51 A;  3N24 A;  3LLK A;  2VAS A;  4BJ1 A;  4CSA A;  1TWA A;  4JW1 A;  1OCR C;  1OCO C;  1OCC C;  2NUP A;  4QI2 A;  1D0Z A;  3UMK A;  3HTK C;  3DZA A;  5DLJ A;  3NKD A;  2W9Y A;  2Y3D A;  2XXA A;  4XLN F;  3EGX B;  4NY3 A;  2G62 A;  3UNG C;  1MMN A;  5DVW A;  2R7S A;  3VYW A;  1PD0 A;  3B9Q A;  2Y3H A;  4AX2 A;  2ZXO A;  1LVK A;  3RH3 A;  4JVS A;  3NG1 A;  5B3S C;  2IXO A;  3LS1 A;  2NUT B;  1D1C A;  4YT4 A;  2R7U A;  3CZ6 A;  1FFT C;  1M57 C;  4OIR F;  3NDB B;  3W8H A;  1TWC A;  1OKK A;  4I1M A;  3AG3 C;  5T3T A;  4K0D A;  5CI9 A;  4AE4 B;  2Z15 A;  1MNE A;  4G7Z F;  3F47 A;  4OIP F;  3AG1 C;  3X2Q C;  4FWV A;  4U5F E;  4F4B A;  1JPN A;  2PP4 A;  4ZLC A;  3EGD A;  4O6N A;  4LAC B;  5KYU A;  4G0H A;  5F5F A;  2H7O A;  4DOZ A;  2LSE A;  5HSW A;  2CGE A;  2PX0 A;  3FVY A;  1QZX A;  4C7O B;  2KJG A;  2J9V A;  5T1D B;  4BJ6 C;  1MMG A;  3K66 A;  4J32 B;  2ZPA A;  1FFH A;  3H65 A;  4PJL A;  3SYN A;  5KYW A;  3EG9 A;  1D1A A;  2G3K A;  4N06 A;  3GAN A;  2KGO A;  3E9V A;  4U5B E;  5T3W A;  1FMV A;  2R7V A;  3DM9 B;  4DBQ A;  4OD4 A;  1PCX A;  2D5R B;  2WB7 A;  1M2V B;  2J7P A;  3O6X A;  5DQT A;  3K6B A;  3UGP A;  3DJN B;  1TWG A;  3FDQ A;  2YHS A;  1MND A;  2FFH A;  3SEO A;  3K1H A;  5B1B C;  1TKN A;  2FGY A;  3B0V C;  3DMD A;  5DS4 A;  1LKX A;  2XL4 A;  2R7T A;  2HV6 A;  2DYR C;  3ZVR A;  4PJJ A;  4ULW A;  2P6V A;  3KKB A;  3ECS A;  4XWJ A;  2CNW A;  1PD1 A;  4IRU A;  2WVO A;  3KMI A;  2H7V C;  4PJN A;  4GYT A;  2J9U A;  3EHN A;  3POV A;  2EIM C;  1ZU5 A;  3GOD A;  2C04 A;  1RJ9 A;  3W8I A;  4ZLD A;  2M4E A;  3EHM A;  3DXJ F;  4BJ5 A;  3Q7G A;  3B0U X;  3ZSU A;  3LAY A;  4C3B A;  4FES A;  4AK9 A;  2P7V A;  2Q9B A;  2EIL C;  1VK5 A;  2WVN A;  5KYY A;  4QI0 A;  1D0X A;  3EFO B;  2PF4 E;  4FX5 A;  4XTK A;  4X0R A;  1ZU4 A;  3Q6N A;  4M63 A;  3WOD F;  3HJC A;  3PHF 2;  4CBE A;  2W4M A;  2GFH A;  2BE5 F;  3ZIB A;  2WVQ A;  3N2Z B;  5BUO A;  4EBB A;  3EJN A;  3N0T A;  3EH1 A;  1FMW A;  2R7W A;  3SP1 A;  4KI2 A;  2L9J A;  2ZXW C;  3MX3 A;  1S7Z A;  1G8X A;  1N1C A;  1O5H A;  4E7S A;  4JUR I;  4HEA J;  4YWQ A;  4GEH A;  4J30 B;  2OCC C;  4YT2 A;  3OEO A;  2CDQ A;  3UMH A;  1Z3I X;  2J45 A;  4XLP F;  2EIN C;  4Q7C A;  4IJJ A;  1Z6A A;  3ABL C;  5D92 A;  3VAY A;  5KYX B;  3F46 A;  3S29 A;  2A6H F;  3QZC A;  4DVY P;  3UGO A;  4O79 A;  2NUP B;  3K1I C;  1M56 C;  2R7Q A;  2OG2 A;  2PX3 A;  2CW0 F;  2NG1 A;  3O39 A;  2Y39 A;  4U5H A;  3JSZ A;  4CS9 C;  3L0I A;  3NYL A;  3NYJ A;  2XXA B;  4CS7 A;  2KW3 C;  4O7G A;  4BJ6 A;  5L3V A;  5DS6 A;  4YJW A;  5IY5 C;  4JZA A;  1Z23 A;  4KC9 A;  3K7D A;  1J8M F;  2W4B A;  4HFF B;  2JD3 A;  3LLI A;  2WL8 A;  4ANJ A;  5B1A C;  3ZG1 A;  1LS1 A;  1SZI A;  2EIJ C;  4BG0 A;  1Z63 A;  5CI8 A;  2J46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...