2IBFA

Human vinculin's head domain (vh1, residues 1-258) in complex with two vinculin binding sites of shigella flexneri's ipaa (residues 565-587)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin binding in its closed conformation by a helix addition mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 107
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2006-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA01
1QKRA 2X0CA 1RKEB 2IBFA 1DOWA 5L0HA 1ZW2A 3TJ5A 5L0DA 4E17A 4EHPA 1YDIA 1ZVZA 5L0GA 3S90A 4ONSA 1XWJA 1TR2A 1RKEA 1T01A 2L7AA 1H6GA 2LQGA 1DOVA 1RKCA 4P9TA 3TJ6A 3H2VA 4DJ9A 1SYQA 4PR9A 3T6GB 3RF3A 3MYIA 5L0CA 2GDCA 5FZTA 2HSQA 4W8PA 1L7CA 4IGGA 5L0FA 1ST6A 2B0HA 2GWWA 4K1OA 4E18A 1U6HA 5L0IA 1U89A 1ZW3A 3H2UA 3ZDLA 3VF0A 5L0JA
chains in the Genus database with same CATH superfamily
2XRHA 4CX9A 3VAYA 1T6UA 1QPUA 2CNWA 2A6HF 4YL0A 1OR3A 4C3EA 4CJOA 5L0HA 3EFOA 4AL1A 1Z7Qc 2OJQA 1XZPA 3SXMA 1T9KA 3MLGA 4ER9A 1HMOA 1YDIA 3FDQA 4C7OB 3C18A 1Z23A 3SYNA 1HE1A 1MNDA 2Q9CA 3OWTA 5FCLA 5CI9A 1MMDA 4E0IA 5CI8A 4O6NA 3U2LA 5JT4A 2KYHA 1C17M 4G7OF 1BR1A 2MYSA 1T6IA 2OEVA 1K04A 3ZQVA 4IARA 5E2QA 4N4WA 2HJMA 5FZTA 2IXNA 4W8PA 3UMKA 4WABA 4NCQA 1U6HA 2Q7RA 2PFDA 3DE9A 2QUPA 2L6FA 3VF0A 5A6JA 4L6RA 1LS4A 2X0CA 1RKEB 2PNOA 5COFA 2OKUA 1RJ9A 3AQCA 3HTKC 4PJNA 1NFOA 4JW1A 1AUEA 1LS1A 3AGUA 4KC9A 5HSWA 2L81A 2LFFA 2ZXRA 1ZU5A 3SXKA 1VOMA 2DYSC 3GODA 3IQ5A 1E84A 2KW3C 4YT2A 5B1AC 3FXHA 3ZSUA 3C8GB 5COGA 1VB5A 2YL0A 2HZ8A 2XLHA 1M6TA 4P6IC 1YJGA 3HNJA 3U3FA 1JPJA 3EQLF 3QVYA 4LERA 5JP7A 3RF3A 4DRIB 5B3SC 1Z6AA 4JTDB 3KYIA 2EPKX 1L7CA 1VLSA 1D0ZA 3ITFA 5BUOA 3PHF2 3K7DA 1IZMA 1MQVA 2M64A 5DQZA 5AGFA 1F1MA 4MTGA 3JT1A 2KGOA 1YA9A 2EIKC 3L8JA 3L1MA 4F4BA 1QSPA 1RMVA 1NU7D 1ZHWA 4CS7A 1YYXA 1ZHYA 2NUPB 3MBGA 5KYYA 4MTFA 4PFOA 4CBEA 2FAPB 1CGNA 4NC3A 3F47A 2LIGA 3ECSA 3AQBA 1AVOB 4U9DA 3TK0A 5KYXA 1E85A 1DOVA 3GM2A 5F5FA 3FAJA 3RH3A 2YZSA 3MFNA 4JJFA 1N1CA 5EGYA 4QI2A 3V7OA 2Y3HA 1M2VB 5A6BA 3AG3C 1ZZPA 2GDCA 4CDVA 2YL1A 3LLKA 2CGEA 3GM1A 2D5RB 3O6XA 2KC3A 3FVYA 1G4WR 1KU2A 2CW0F 3K33A 2VB6A 4IAOA 3ZIBA 2A0BA 5B3IA 2WB7A 2IXMA 5DQTA 3Q6NA 1D0YA 2A6EF 4O79A 1HW2A 3EPVA 1GQAA 4E7SA 1OW6A 2R02A 4HE8D 3J06A 2TMVP 1H9TA 4E17A 4NY3A 4YJWA 3EH1A 1Q0FA 2CCYA 2P0NA 1ORJA 3LLIA 3VRCA 3NDBB 3NKDA 4DBQA 1FMVA 1QLEC 2KSFA 3NMIA 3S27A 2WVNA 3DWWA 3O39A 1WATA 3SEOA 4WGZA 2J46A 2JX0A 3EHNA 4MW8A 4YL3A 5KYWA 1WN0A 1ZHTA 2R05A 5D92A 4U5EE 3B0VC 1TQGA 3DXJF 4J7YA 3LEOA 4ULVA 2BC5A 2VASA 3V5XA 2G3VA 3C8ZA 2UUIA 3EFOB 1ST6A 3GEHA 3KPHA 5D91A 5L0IA 1BDJB 2R7SA 4MTOA 1ZHXA 1A41A 5L0JA 2Q4FA 3DJNB 3M4CA 1BR2A 5T3TA 1JOGA 1K05A 3Q7GA 2QE9A 1FNTc 4CDAA 4HEAJ 3FOPA 3X1OA 1LM3B 3JYHA 5GPGB 4G7HF 2MWQA 1OW7A 3CEXA 2EIMC 3W4YA 5JS5A 5EK0A 4CDYA 5JSLA 1VMAA 3C63A 4GEHA 1OCZC 4Z9IA 3US6A 4DRHB 3FOOA 4BG0A 3T9OA 4EUKB 3TJ6A 4H54A 3MYFA 4A4AA 2R7OA 1RXQA 1J8YF 4LDQA 3SXYA 1OCOC 2B0JA 2IXOA 3EZHA 2J9UA 3HJCA 2YL3A 2R7XA 1D1CA 2FGYA 3IPMO 1SR2A 1RJ9B 2WZLA 3WODF 2DB4A 4D4NA 4K1OA 4X0RA 3EZIA 3JZ0A 3H2UA 1QQ3A 4MNDA 3ZDLA 2J0WA 5DVWA 3T6BA 1S05A 2L6HA 1YYJA 2W9YA 2ZD9A 4Z9HA 1NBBA 2AU5A 3TOLA 5JLIA 3L8IA 3GM3A 2KQ9A 4YWQA 2R7TA 3RYLA 2OU6A 2HUJA 3KL4A 4DRJB 2DYRC 3G4ZA 4U5CE 2PX0A 1TFKB 2J0XA 2R9RB 4JTAB 1G4US 4HFFB 2RD9A 2PP4A 5BQHA 3S90A 3UGPA 2XL8A 2ZXOA 3K6BA 3QMKA 2LQGA 2A69F 4CIPA 3GANA 4PJMA 2H7BA 2VH3A 1TWAA 4YN0B 2Q00A 1FR0A 4MVMA 3QZCA 4DOZA 2EPMX 5L0CA 4JURI 2JD3A 2WZFA 3LAYA 4G78A 4RBNA 1D1AA 1LE4A 1LI7A 3JYYA 3EHMA 1PD0A 5KYYB 2H8AA 2XLWA 3GWLA 3BRJA 4BJ5A 4XPWA 1FFTC 1M56C 4YT8A 4D4XA 3DAFA 5COMA 5KYXB 2MHRA 3JCUQ 1OKKD 3DKAA 2R25A 4KBLA 3IHUA 1TWHA 4XLNF 2YRFA 2R7UA 3ATPA 3DMDA 4C3BA 1GGQA 1H9GA 3M1CB 1Q0DA 4IWBA 2Y3DA 1FMWA 3JSEO 2G62A 1A0BA 1T01A 2XM0A 4QDLA 1MMNA 1H6GA 4XWJA 2J9VA 3ZQYA 1Y6DA 1R5ID 3S0XA 3UGOA 1Z3IX 4CSAA 2XLOA 1I4ZA 3R2PA 4PACA 2IYLD 2J8WA 4IJJA 2J9WA 5L0FA 1PCXA 2EPLX 2KNHA 2FFHA 2J45A 3ZWIA 2AVKA 2LD6A 3C7JA 4KNWA 2AP3A 2Z15A 4PFPA 4U9EA 4XEVA 3OEOA 4N6CA 4QI0A 4DVYP 1VK5A 3S84A 5DS5A 4I3MA 1QKRA 1Q0GA 1WASA 2IXPA 3OA1A 1QVXA 3DJUB 4JCZA 3L0IA 2PX3A 3LNMB 2QTVA 4BJ5C 1OR2A 2EINC 2D4UA 4J32B 2HS5A 2HV7A 4JIOA 5KYUA 4OD4A 3RVZA 2WZGA 4JZAA 4MVOA 3RVYA 5KYWB 2QLAA 3K1IA 3LEVA 3R7CA 5L0GA 3I5QA 3RFYA 2WL8A 1LIHA 4ONSA 4FX5A 2ZXPA 3SXZA 2GA0A 1C03A 3K66A 3W2WA 4AK9A 5E3AA 3N2ZB 4DXWA 5T3WA 4LLEA 1NSGB 5DS4A 3WAQA 1JPNA 4FWVA 1NU9C 1OCCC 2C03A 2HJ3A 2NPUA 4CSAC 4OIPF 3NYMA 4XQ1A 2KK1A 3S9OA 2EIJC 1UG7A 1G5ZA 2A1DD 3DZAA 2XL6A 1YZAA 2UUHA 4JCHA 1SMYF 3IQCA 5AC5A 5JVEA 3B0UX 1L3PA 3EG9B 2YWAA 4OD5A 3IQTA 2IM8A 4W8KA 3UMHA 3B0PA 2HMZA 2YLDA 2XL4A 1LPEA 3K1IC 1LKXA 2ZPAA 2YLGA 1CGME 4P9FA 1RCPA 3NMKA 4BEMJ 4K7BA 4XEKA 5JUAA 2R7WA 2CNWD 3RW0A 1KNYA 4LDRA 4E0HA 2OQMA 1JRAA 4R32A 3NKEA 4EBBA 2F22A 1D1BA 3T6GB 4AE4A 3ASOC 3AJMA 2YHSA 4YT5A 2P1AA 3RQEA 4JEBA 4UDVA 3M79A 3FMSA 4GYTA 3JSZA 2DI3A 2PBEA 4C3DA 4JRZA 3QW0A 5TJ5E 3CZ6A 3DD7A 2R03A 4IAQA 1M2OA 2W4MA 3WG7C 3ZTZA 3G50A 4O6MA 1Q0KA 3QW1A 4EHPA 4CIHA 2LSEA 4OIQF 1TWCA 2W4BA 3L34A 2P61A 3PCVA 1Q0MA 3U5SA 1Z5ZA 3LESA 4U5FE 1WTYA 1XWJA 1EA8A 3HNKA 1FAPB 2YLIA 1QZXA 1VTMP 1YVIA 4P9TA 5DLJA 2R7QA 2V26A 3KYJA 2BL2A 2XLEA 1IW7F 2YKZA 3H65A 4MS2A 4U5HA 3S29A 3U3BA 3G4XA 1HE9A 2ICWG 3JRMO 3A11A 3AG2C 4I44A 1FTSA 3KH2A 5E3CA 1OXKA 2GWWA 3LJBA 4ZLCA 1S7ZA 2P6VA 3IQ6A 3V5YA 5AC4A 1NG1A 4N06A 3GEIA 3VM6A 2V3CC 1G8XA 2VCBA 2RSEB 4IRUA 2A0UA 5K0IA 1AEPA 4JVSA 3NYJA 3Q6MA 4LDKA 2VC9A 3EGXA 2W45A 4NTBA 2LCHA 3T6JA 3Q7LA 4OINF 3N0TA 4RD9A 3K1HA 3M4BA 3T4RA 1U0BB 2HSBA 2P7VA 3GWNA 4NQFA 4EKWA 3ABMC 3U9JA 1V74B 1TR2A 3ZG1A 3ZVRA 4OIOF 2ASRA 1ORYA 3I5PA 1GS9A 1WGWA 1Y4CA 4B6IA 3LNRA 3H2VA 1SYQA 4BJTA 3AG1C 1HW1A 3EGDA 4BJ6A 2O9XA 2HFIA 4LLCA 2HV6A 3W8IA 3KMIA 1EQ1A 3E70C 4IGGA 1UFBA 2XLMA 2I15A 4HFKB 2OJED 4G0HA 5KYUB 3TQOA 3QVZA 3VYWA 4KI2A 4N6HA 1XZQA 2L6GA 4O6YA 4E7ZA 4NTFA 4XEFA 3UMIA 1EKYA 5E33A 5A6BD 2KJGA 5A6KA 2IBFA 1SF8A 3FAPB 4CS9A 1H7IA 1YARO 2OG2A 4XPXA 4AX2A 1NFNA 3C8GD 4NTAA 2NUTA 5L3VA 4JTCB 1VYKA 1YZCA 4OIRF 3PMRA 3SP1A 3U8PA 3TD7A 3DI5A 4I1OB 4MVRA 3B29A 2E87A 3DAGA 3JTLO 3KKBA 1RKCA 3SZRA 5HV9A 1M57C 3QTHA 1YAUO 3HNLA 3B71A 4GQHA 1OCRC 2BE5F 2J7PD 3TULA 3PDMP 2HSQA 2WVQA 4BJ6C 4DBRA 2GAQA 1T5OA 3LUTB 4AL0A 4XLPF 1I5NA 1YLMA 1A7VA 3RQFA 3UR3C 3GEEA 1C02A 2H7VC 5A69A 4JE9A 2XLVA 1YA7O 1HY5A 3LS0A 3POVA 3TOMA 1B68A 3AG4C 3UNGC 4WGYA 1VYIA 4MVSA 4PJJA 5T1DB 4PJLA 1NZEA 3NG1A 1TWGA 1O87A 4RDAA 4JKVA 3WHNA 2IOQA 4CS9C 4I1MA 3ABKC 1MMAA 4KNVA 3W8HA 4WJ0A 4AE4B 1ZU4A 1ZVZA 2YVKA 4JEAA 1R4TA 4BEJA 3EJNA 2Y3GA 2DGJA 4G7ZF 1ZHZA 2QY9A 1T6QA 4EIYA 3C62A 2NSGA 5KYNA 4A2NB 1J8MF 1LE2A 1GM5A 4C7OA 1HMDA 3ASNC 3MYIA 3NMJA 3AGTA 5A6AA 1PV3A 1MNEA 2Q9AA 3HLZA 2AWYA 4O7GA 4YL1A 4YK5A 3M15A 2OEXA 3RKOF 4MVZA 2XM4A 2A68F 5L3QA 1CPQA 4FAPB 5BQGA 1BR4A 1SZIA 4YT4A 3ZTMA 2Q9BA 1A7EA 256BA 4U5GA 3NRHA 1CGOA 4U5BE 5L0DA 1JR8A 2ZXWC 2YQYA 3X2QC 2XXAA 2C04A 1O5HA 1VLTA 2QNLA 3O10A 1E83A 4XTKA 1ORSC 1RKEA 4J7TA 2L7AA 2Y3BA 2NG1A 3NYLA 1NLXA 3ZC4A 4J30B 3HNIA 4Q4ZF 5F28E 1KTMA 2JPUA 2LFDA 4FESA 2Q3TA 4JJGA 2G3KA 3CAXA 1OKKA 2I8BA 1CPRA 3F46A 1APCA 3C8GA 4U5DE 3EGXB 1ZYRF 4MW3A 1V54C 1OQCA 2J9BA 3U2MA 2X51A 3W2VA 3CSKA 1U89A 2XS1A 3SNHA 3O55A 3HKKA 3U9MA 1JAFA 2LK4A 3N24A 2CYDA 4MVQA 1JMWA 2OCCC 2ETSA 4ULWA 4XPYA 4Z9JA 4CJGA 4DVZA 3TJ5A 4EBJA 4EBKA 1Z63A 1E86A 2J7PA 1MMGA 2R7VA 3LS1A 3U8VA 4EWCA 3I4UA 1D0XA 3EGDB 5B1BC 2Y39A 3DM5A 5F5HA 1BBHA 3U0CA 2AWCA 4CS8A 3RQGA 2XSEA 1V4AA 1WOLA 2NUPA 1A7DA 2EPOA 2EPNA 2WVOA 5JRAA 4PR9A 3E9VA 3BEHA 4MVUA 2L9JA 4H4KC 2H7OA 4IB4A 1BZ4A 4K0DA 1K40A 1OXBA 2B0HA 4E18A 3EH2A 3ABLC 2NUTB 1ZW3A 5DS6A 1FFHA 5BQIA 2PF4E 2HMQA 1M2VA 2XLDA 4LACB 1DOWA 2NSFA 1ZW2A 1EI7A 3A9CA 3DM9B 2VCCA 4JC7A 3RIPA 1TKNA 4Q7CA 5IY5C 2EILC 4ZLDA 3AOUA 3S28A 3EG9A 3MX3A 2XS8A 4ANJA 4BJ1A 1LVKA 3V5ZA 2GFHA 3GORA 4M63A 4PK4A 1I4YA 1LI5A 4CS8C 4MQ9F 1TFOB 2HKVA 1V55C 2Y69C 4DJ9A 5CIVA 2CDQA 2YL7A 1OW8A 2YEVA 1W2WA 4BPMA 2LP4A 1O3UA 2VCAA 3FHDA 3CQZA 2OOCA 3JRTA 4Q5SF 3B9QA 5EHHA 1PD1A 2R7RA 3IEEA 2XXAB 2M4EA 1WWPA 3DE8A 1E2XA
chains in the Genus database with same CATH topology
1QKRA 2X0CA 1RKEB 2IBFA 1DOWA 5L0HA 1ZW2A 3TJ5A 5L0DA 4E17A 4EHPA 1YDIA 1ZVZA 5L0GA 3S90A 4ONSA 1XWJA 1TR2A 1RKEA 1T01A 2L7AA 1H6GA 2LQGA 1DOVA 1RKCA 4P9TA 3TJ6A 3H2VA 4DJ9A 1SYQA 4PR9A 3T6GB 3RF3A 3MYIA 5L0CA 2GDCA 5FZTA 2HSQA 4W8PA 1L7CA 4IGGA 5L0FA 1ST6A 2B0HA 2GWWA 4K1OA 4E18A 1U6HA 5L0IA 1U89A 1ZW3A 3H2UA 3ZDLA 3VF0A 5L0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKR A;  2X0C A;  1RKE B;  2IBF A;  1DOW A;  5L0H A;  1ZW2 A;  3TJ5 A;  5L0D A;  4E17 A;  4EHP A;  1YDI A;  1ZVZ A;  5L0G A;  3S90 A;  4ONS A;  1XWJ A;  1TR2 A;  1RKE A;  1T01 A;  2L7A A;  1H6G A;  2LQG A;  1DOV A;  1RKC A;  4P9T A;  3TJ6 A;  3H2V A;  4DJ9 A;  1SYQ A;  4PR9 A;  3T6G B;  3RF3 A;  3MYI A;  5L0C A;  2GDC A;  5FZT A;  2HSQ A;  4W8P A;  1L7C A;  4IGG A;  5L0F A;  1ST6 A;  2B0H A;  2GWW A;  4K1O A;  4E18 A;  1U6H A;  5L0I A;  1U89 A;  1ZW3 A;  3H2U A;  3ZDL A;  3VF0 A;  5L0J A; 
#chains in the Genus database with same CATH topology
 2XRH A;  4CX9 A;  3VAY A;  1T6U A;  1QPU A;  2CNW A;  2A6H F;  4YL0 A;  1OR3 A;  4C3E A;  4CJO A;  5L0H A;  3EFO A;  4AL1 A;  1Z7Q c;  2OJQ A;  1XZP A;  3SXM A;  1T9K A;  3MLG A;  4ER9 A;  1HMO A;  1YDI A;  3FDQ A;  4C7O B;  3C18 A;  1Z23 A;  3SYN A;  1HE1 A;  1MND A;  2Q9C A;  3OWT A;  5FCL A;  5CI9 A;  1MMD A;  4E0I A;  5CI8 A;  4O6N A;  3U2L A;  5JT4 A;  2KYH A;  1C17 M;  4G7O F;  1BR1 A;  2MYS A;  1T6I A;  2OEV A;  1K04 A;  3ZQV A;  4IAR A;  5E2Q A;  4N4W A;  2HJM A;  5FZT A;  2IXN A;  4W8P A;  3UMK A;  4WAB A;  4NCQ A;  1U6H A;  2Q7R A;  2PFD A;  3DE9 A;  2QUP A;  2L6F A;  3VF0 A;  5A6J A;  4L6R A;  1LS4 A;  2X0C A;  1RKE B;  2PNO A;  5COF A;  2OKU A;  1RJ9 A;  3AQC A;  3HTK C;  4PJN A;  1NFO A;  4JW1 A;  1AUE A;  1LS1 A;  3AGU A;  4KC9 A;  5HSW A;  2L81 A;  2LFF A;  2ZXR A;  1ZU5 A;  3SXK A;  1VOM A;  2DYS C;  3GOD A;  3IQ5 A;  1E84 A;  2KW3 C;  4YT2 A;  5B1A C;  3FXH A;  3ZSU A;  3C8G B;  5COG A;  1VB5 A;  2YL0 A;  2HZ8 A;  2XLH A;  1M6T A;  4P6I C;  1YJG A;  3HNJ A;  3U3F A;  1JPJ A;  3EQL F;  3QVY A;  4LER A;  5JP7 A;  3RF3 A;  4DRI B;  5B3S C;  1Z6A A;  4JTD B;  3KYI A;  2EPK X;  1L7C A;  1VLS A;  1D0Z A;  3ITF A;  5BUO A;  3PHF 2;  3K7D A;  1IZM A;  1MQV A;  2M64 A;  5DQZ A;  5AGF A;  1F1M A;  4MTG A;  3JT1 A;  2KGO A;  1YA9 A;  2EIK C;  3L8J A;  3L1M A;  4F4B A;  1QSP A;  1RMV A;  1NU7 D;  1ZHW A;  4CS7 A;  1YYX A;  1ZHY A;  2NUP B;  3MBG A;  5KYY A;  4MTF A;  4PFO A;  4CBE A;  2FAP B;  1CGN A;  4NC3 A;  3F47 A;  2LIG A;  3ECS A;  3AQB A;  1AVO B;  4U9D A;  3TK0 A;  5KYX A;  1E85 A;  1DOV A;  3GM2 A;  5F5F A;  3FAJ A;  3RH3 A;  2YZS A;  3MFN A;  4JJF A;  1N1C A;  5EGY A;  4QI2 A;  3V7O A;  2Y3H A;  1M2V B;  5A6B A;  3AG3 C;  1ZZP A;  2GDC A;  4CDV A;  2YL1 A;  3LLK A;  2CGE A;  3GM1 A;  2D5R B;  3O6X A;  2KC3 A;  3FVY A;  1G4W R;  1KU2 A;  2CW0 F;  3K33 A;  2VB6 A;  4IAO A;  3ZIB A;  2A0B A;  5B3I A;  2WB7 A;  2IXM A;  5DQT A;  3Q6N A;  1D0Y A;  2A6E F;  4O79 A;  1HW2 A;  3EPV A;  1GQA A;  4E7S A;  1OW6 A;  2R02 A;  4HE8 D;  3J06 A;  2TMV P;  1H9T A;  4E17 A;  4NY3 A;  4YJW A;  3EH1 A;  1Q0F A;  2CCY A;  2P0N A;  1ORJ A;  3LLI A;  3VRC A;  3NDB B;  3NKD A;  4DBQ A;  1FMV A;  1QLE C;  2KSF A;  3NMI A;  3S27 A;  2WVN A;  3DWW A;  3O39 A;  1WAT A;  3SEO A;  4WGZ A;  2J46 A;  2JX0 A;  3EHN A;  4MW8 A;  4YL3 A;  5KYW A;  1WN0 A;  1ZHT A;  2R05 A;  5D92 A;  4U5E E;  3B0V C;  1TQG A;  3DXJ F;  4J7Y A;  3LEO A;  4ULV A;  2BC5 A;  2VAS A;  3V5X A;  2G3V A;  3C8Z A;  2UUI A;  3EFO B;  1ST6 A;  3GEH A;  3KPH A;  5D91 A;  5L0I A;  1BDJ B;  2R7S A;  4MTO A;  1ZHX A;  1A41 A;  5L0J A;  2Q4F A;  3DJN B;  3M4C A;  1BR2 A;  5T3T A;  1JOG A;  1K05 A;  3Q7G A;  2QE9 A;  1FNT c;  4CDA A;  4HEA J;  3FOP A;  3X1O A;  1LM3 B;  3JYH A;  5GPG B;  4G7H F;  2MWQ A;  1OW7 A;  3CEX A;  2EIM C;  3W4Y A;  5JS5 A;  5EK0 A;  4CDY A;  5JSL A;  1VMA A;  3C63 A;  4GEH A;  1OCZ C;  4Z9I A;  3US6 A;  4DRH B;  3FOO A;  4BG0 A;  3T9O A;  4EUK B;  3TJ6 A;  4H54 A;  3MYF A;  4A4A A;  2R7O A;  1RXQ A;  1J8Y F;  4LDQ A;  3SXY A;  1OCO C;  2B0J A;  2IXO A;  3EZH A;  2J9U A;  3HJC A;  2YL3 A;  2R7X A;  1D1C A;  2FGY A;  3IPM O;  1SR2 A;  1RJ9 B;  2WZL A;  3WOD F;  2DB4 A;  4D4N A;  4K1O A;  4X0R A;  3EZI A;  3JZ0 A;  3H2U A;  1QQ3 A;  4MND A;  3ZDL A;  2J0W A;  5DVW A;  3T6B A;  1S05 A;  2L6H A;  1YYJ A;  2W9Y A;  2ZD9 A;  4Z9H A;  1NBB A;  2AU5 A;  3TOL A;  5JLI A;  3L8I A;  3GM3 A;  2KQ9 A;  4YWQ A;  2R7T A;  3RYL A;  2OU6 A;  2HUJ A;  3KL4 A;  4DRJ B;  2DYR C;  3G4Z A;  4U5C E;  2PX0 A;  1TFK B;  2J0X A;  2R9R B;  4JTA B;  1G4U S;  4HFF B;  2RD9 A;  2PP4 A;  5BQH A;  3S90 A;  3UGP A;  2XL8 A;  2ZXO A;  3K6B A;  3QMK A;  2LQG A;  2A69 F;  4CIP A;  3GAN A;  4PJM A;  2H7B A;  2VH3 A;  1TWA A;  4YN0 B;  2Q00 A;  1FR0 A;  4MVM A;  3QZC A;  4DOZ A;  2EPM X;  5L0C A;  4JUR I;  2JD3 A;  2WZF A;  3LAY A;  4G78 A;  4RBN A;  1D1A A;  1LE4 A;  1LI7 A;  3JYY A;  3EHM A;  1PD0 A;  5KYY B;  2H8A A;  2XLW A;  3GWL A;  3BRJ A;  4BJ5 A;  4XPW A;  1FFT C;  1M56 C;  4YT8 A;  4D4X A;  3DAF A;  5COM A;  5KYX B;  2MHR A;  3JCU Q;  1OKK D;  3DKA A;  2R25 A;  4KBL A;  3IHU A;  1TWH A;  4XLN F;  2YRF A;  2R7U A;  3ATP A;  3DMD A;  4C3B A;  1GGQ A;  1H9G A;  3M1C B;  1Q0D A;  4IWB A;  2Y3D A;  1FMW A;  3JSE O;  2G62 A;  1A0B A;  1T01 A;  2XM0 A;  4QDL A;  1MMN A;  1H6G A;  4XWJ A;  2J9V A;  3ZQY A;  1Y6D A;  1R5I D;  3S0X A;  3UGO A;  1Z3I X;  4CSA A;  2XLO A;  1I4Z A;  3R2P A;  4PAC A;  2IYL D;  2J8W A;  4IJJ A;  2J9W A;  5L0F A;  1PCX A;  2EPL X;  2KNH A;  2FFH A;  2J45 A;  3ZWI A;  2AVK A;  2LD6 A;  3C7J A;  4KNW A;  2AP3 A;  2Z15 A;  4PFP A;  4U9E A;  4XEV A;  3OEO A;  4N6C A;  4QI0 A;  4DVY P;  1VK5 A;  3S84 A;  5DS5 A;  4I3M A;  1QKR A;  1Q0G A;  1WAS A;  2IXP A;  3OA1 A;  1QVX A;  3DJU B;  4JCZ A;  3L0I A;  2PX3 A;  3LNM B;  2QTV A;  4BJ5 C;  1OR2 A;  2EIN C;  2D4U A;  4J32 B;  2HS5 A;  2HV7 A;  4JIO A;  5KYU A;  4OD4 A;  3RVZ A;  2WZG A;  4JZA A;  4MVO A;  3RVY A;  5KYW B;  2QLA A;  3K1I A;  3LEV A;  3R7C A;  5L0G A;  3I5Q A;  3RFY A;  2WL8 A;  1LIH A;  4ONS A;  4FX5 A;  2ZXP A;  3SXZ A;  2GA0 A;  1C03 A;  3K66 A;  3W2W A;  4AK9 A;  5E3A A;  3N2Z B;  4DXW A;  5T3W A;  4LLE A;  1NSG B;  5DS4 A;  3WAQ A;  1JPN A;  4FWV A;  1NU9 C;  1OCC C;  2C03 A;  2HJ3 A;  2NPU A;  4CSA C;  4OIP F;  3NYM A;  4XQ1 A;  2KK1 A;  3S9O A;  2EIJ C;  1UG7 A;  1G5Z A;  2A1D D;  3DZA A;  2XL6 A;  1YZA A;  2UUH A;  4JCH A;  1SMY F;  3IQC A;  5AC5 A;  5JVE A;  3B0U X;  1L3P A;  3EG9 B;  2YWA A;  4OD5 A;  3IQT A;  2IM8 A;  4W8K A;  3UMH A;  3B0P A;  2HMZ A;  2YLD A;  2XL4 A;  1LPE A;  3K1I C;  1LKX A;  2ZPA A;  2YLG A;  1CGM E;  4P9F A;  1RCP A;  3NMK A;  4BEM J;  4K7B A;  4XEK A;  5JUA A;  2R7W A;  2CNW D;  3RW0 A;  1KNY A;  4LDR A;  4E0H A;  2OQM A;  1JRA A;  4R32 A;  3NKE A;  4EBB A;  2F22 A;  1D1B A;  3T6G B;  4AE4 A;  3ASO C;  3AJM A;  2YHS A;  4YT5 A;  2P1A A;  3RQE A;  4JEB A;  4UDV A;  3M79 A;  3FMS A;  4GYT A;  3JSZ A;  2DI3 A;  2PBE A;  4C3D A;  4JRZ A;  3QW0 A;  5TJ5 E;  3CZ6 A;  3DD7 A;  2R03 A;  4IAQ A;  1M2O A;  2W4M A;  3WG7 C;  3ZTZ A;  3G50 A;  4O6M A;  1Q0K A;  3QW1 A;  4EHP A;  4CIH A;  2LSE A;  4OIQ F;  1TWC A;  2W4B A;  3L34 A;  2P61 A;  3PCV A;  1Q0M A;  3U5S A;  1Z5Z A;  3LES A;  4U5F E;  1WTY A;  1XWJ A;  1EA8 A;  3HNK A;  1FAP B;  2YLI A;  1QZX A;  1VTM P;  1YVI A;  4P9T A;  5DLJ A;  2R7Q A;  2V26 A;  3KYJ A;  2BL2 A;  2XLE A;  1IW7 F;  2YKZ A;  3H65 A;  4MS2 A;  4U5H A;  3S29 A;  3U3B A;  3G4X A;  1HE9 A;  2ICW G;  3JRM O;  3A11 A;  3AG2 C;  4I44 A;  1FTS A;  3KH2 A;  5E3C A;  1OXK A;  2GWW A;  3LJB A;  4ZLC A;  1S7Z A;  2P6V A;  3IQ6 A;  3V5Y A;  5AC4 A;  1NG1 A;  4N06 A;  3GEI A;  3VM6 A;  2V3C C;  1G8X A;  2VCB A;  2RSE B;  4IRU A;  2A0U A;  5K0I A;  1AEP A;  4JVS A;  3NYJ A;  3Q6M A;  4LDK A;  2VC9 A;  3EGX A;  2W45 A;  4NTB A;  2LCH A;  3T6J A;  3Q7L A;  4OIN F;  3N0T A;  4RD9 A;  3K1H A;  3M4B A;  3T4R A;  1U0B B;  2HSB A;  2P7V A;  3GWN A;  4NQF A;  4EKW A;  3ABM C;  3U9J A;  1V74 B;  1TR2 A;  3ZG1 A;  3ZVR A;  4OIO F;  2ASR A;  1ORY A;  3I5P A;  1GS9 A;  1WGW A;  1Y4C A;  4B6I A;  3LNR A;  3H2V A;  1SYQ A;  4BJT A;  3AG1 C;  1HW1 A;  3EGD A;  4BJ6 A;  2O9X A;  2HFI A;  4LLC A;  2HV6 A;  3W8I A;  3KMI A;  1EQ1 A;  3E70 C;  4IGG A;  1UFB A;  2XLM A;  2I15 A;  4HFK B;  2OJE D;  4G0H A;  5KYU B;  3TQO A;  3QVZ A;  3VYW A;  4KI2 A;  4N6H A;  1XZQ A;  2L6G A;  4O6Y A;  4E7Z A;  4NTF A;  4XEF A;  3UMI A;  1EKY A;  5E33 A;  5A6B D;  2KJG A;  5A6K A;  2IBF A;  1SF8 A;  3FAP B;  4CS9 A;  1H7I A;  1YAR O;  2OG2 A;  4XPX A;  4AX2 A;  1NFN A;  3C8G D;  4NTA A;  2NUT A;  5L3V A;  4JTC B;  1VYK A;  1YZC A;  4OIR F;  3PMR A;  3SP1 A;  3U8P A;  3TD7 A;  3DI5 A;  4I1O B;  4MVR A;  3B29 A;  2E87 A;  3DAG A;  3JTL O;  3KKB A;  1RKC A;  3SZR A;  5HV9 A;  1M57 C;  3QTH A;  1YAU O;  3HNL A;  3B71 A;  4GQH A;  1OCR C;  2BE5 F;  2J7P D;  3TUL A;  3PDM P;  2HSQ A;  2WVQ A;  4BJ6 C;  4DBR A;  2GAQ A;  1T5O A;  3LUT B;  4AL0 A;  4XLP F;  1I5N A;  1YLM A;  1A7V A;  3RQF A;  3UR3 C;  3GEE A;  1C02 A;  2H7V C;  5A69 A;  4JE9 A;  2XLV A;  1YA7 O;  1HY5 A;  3LS0 A;  3POV A;  3TOM A;  1B68 A;  3AG4 C;  3UNG C;  4WGY A;  1VYI A;  4MVS A;  4PJJ A;  5T1D B;  4PJL A;  1NZE A;  3NG1 A;  1TWG A;  1O87 A;  4RDA A;  4JKV A;  3WHN A;  2IOQ A;  4CS9 C;  4I1M A;  3ABK C;  1MMA A;  4KNV A;  3W8H A;  4WJ0 A;  4AE4 B;  1ZU4 A;  1ZVZ A;  2YVK A;  4JEA A;  1R4T A;  4BEJ A;  3EJN A;  2Y3G A;  2DGJ A;  4G7Z F;  1ZHZ A;  2QY9 A;  1T6Q A;  4EIY A;  3C62 A;  2NSG A;  5KYN A;  4A2N B;  1J8M F;  1LE2 A;  1GM5 A;  4C7O A;  1HMD A;  3ASN C;  3MYI A;  3NMJ A;  3AGT A;  5A6A A;  1PV3 A;  1MNE A;  2Q9A A;  3HLZ A;  2AWY A;  4O7G A;  4YL1 A;  4YK5 A;  3M15 A;  2OEX A;  3RKO F;  4MVZ A;  2XM4 A;  2A68 F;  5L3Q A;  1CPQ A;  4FAP B;  5BQG A;  1BR4 A;  1SZI A;  4YT4 A;  3ZTM A;  2Q9B A;  1A7E A;  256B A;  4U5G A;  3NRH A;  1CGO A;  4U5B E;  5L0D A;  1JR8 A;  2ZXW C;  2YQY A;  3X2Q C;  2XXA A;  2C04 A;  1O5H A;  1VLT A;  2QNL A;  3O10 A;  1E83 A;  4XTK A;  1ORS C;  1RKE A;  4J7T A;  2L7A A;  2Y3B A;  2NG1 A;  3NYL A;  1NLX A;  3ZC4 A;  4J30 B;  3HNI A;  4Q4Z F;  5F28 E;  1KTM A;  2JPU A;  2LFD A;  4FES A;  2Q3T A;  4JJG A;  2G3K A;  3CAX A;  1OKK A;  2I8B A;  1CPR A;  3F46 A;  1APC A;  3C8G A;  4U5D E;  3EGX B;  1ZYR F;  4MW3 A;  1V54 C;  1OQC A;  2J9B A;  3U2M A;  2X51 A;  3W2V A;  3CSK A;  1U89 A;  2XS1 A;  3SNH A;  3O55 A;  3HKK A;  3U9M A;  1JAF A;  2LK4 A;  3N24 A;  2CYD A;  4MVQ A;  1JMW A;  2OCC C;  2ETS A;  4ULW A;  4XPY A;  4Z9J A;  4CJG A;  4DVZ A;  3TJ5 A;  4EBJ A;  4EBK A;  1Z63 A;  1E86 A;  2J7P A;  1MMG A;  2R7V A;  3LS1 A;  3U8V A;  4EWC A;  3I4U A;  1D0X A;  3EGD B;  5B1B C;  2Y39 A;  3DM5 A;  5F5H A;  1BBH A;  3U0C A;  2AWC A;  4CS8 A;  3RQG A;  2XSE A;  1V4A A;  1WOL A;  2NUP A;  1A7D A;  2EPO A;  2EPN A;  2WVO A;  5JRA A;  4PR9 A;  3E9V A;  3BEH A;  4MVU A;  2L9J A;  4H4K C;  2H7O A;  4IB4 A;  1BZ4 A;  4K0D A;  1K40 A;  1OXB A;  2B0H A;  4E18 A;  3EH2 A;  3ABL C;  2NUT B;  1ZW3 A;  5DS6 A;  1FFH A;  5BQI A;  2PF4 E;  2HMQ A;  1M2V A;  2XLD A;  4LAC B;  1DOW A;  2NSF A;  1ZW2 A;  1EI7 A;  3A9C A;  3DM9 B;  2VCC A;  4JC7 A;  3RIP A;  1TKN A;  4Q7C A;  5IY5 C;  2EIL C;  4ZLD A;  3AOU A;  3S28 A;  3EG9 A;  3MX3 A;  2XS8 A;  4ANJ A;  4BJ1 A;  1LVK A;  3V5Z A;  2GFH A;  3GOR A;  4M63 A;  4PK4 A;  1I4Y A;  1LI5 A;  4CS8 C;  4MQ9 F;  1TFO B;  2HKV A;  1V55 C;  2Y69 C;  4DJ9 A;  5CIV A;  2CDQ A;  2YL7 A;  1OW8 A;  2YEV A;  1W2W A;  4BPM A;  2LP4 A;  1O3U A;  2VCA A;  3FHD A;  3CQZ A;  2OOC A;  3JRT A;  4Q5S F;  3B9Q A;  5EHH A;  1PD1 A;  2R7R A;  3IEE A;  2XXA B;  2M4E A;  1WWP A;  3DE8 A;  1E2X A; 
#chains in the Genus database with same CATH homology
 1QKR A;  2X0C A;  1RKE B;  2IBF A;  1DOW A;  5L0H A;  1ZW2 A;  3TJ5 A;  5L0D A;  4E17 A;  4EHP A;  1YDI A;  1ZVZ A;  5L0G A;  3S90 A;  4ONS A;  1XWJ A;  1TR2 A;  1RKE A;  1T01 A;  2L7A A;  1H6G A;  2LQG A;  1DOV A;  1RKC A;  4P9T A;  3TJ6 A;  3H2V A;  4DJ9 A;  1SYQ A;  4PR9 A;  3T6G B;  3RF3 A;  3MYI A;  5L0C A;  2GDC A;  5FZT A;  2HSQ A;  4W8P A;  1L7C A;  4IGG A;  5L0F A;  1ST6 A;  2B0H A;  2GWW A;  4K1O A;  4E18 A;  1U6H A;  5L0I A;  1U89 A;  1ZW3 A;  3H2U A;  3ZDL A;  3VF0 A;  5L0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...