2IBFA

Human vinculin's head domain (vh1, residues 1-258) in complex with two vinculin binding sites of shigella flexneri's ipaa (residues 565-587)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
publication title Vinculin binding in its closed conformation by a helix addition mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2006-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA01
2GDCA 3VF0A 3H2VA 3RF3A 3H2UA 3ZDLA 1U89A 1YDIA 2IBFA 4E18A 3MYIA 1SYQA 5L0JA 2HSQA 4P9TA 1RKEA 5FZTA 1RKCA 4K1OA 4ONSA 1QKRA 4DJ9A 5L0GA 1U6HA 5L0IA 1ZVZA 5L0DA 2B0HA 2LQGA 1L7CA 1DOWA 3T6GB 4W8PA 3TJ5A 2X0CA 2L7AA 1T01A 1H6GA 2GWWA 1DOVA 4EHPA 5L0HA 1ZW3A 1XWJA 4PR9A 3TJ6A 5L0CA 3S90A 1ST6A 5L0FA 4E17A 1TR2A 4IGGA 1RKEB 1ZW2A
chains in the Genus database with same CATH superfamily
3LESA 1EKYA 1ORSC 1R5ID 2BC5A 4DBQA 2AWCA 1OR2A 2J46A 2HKVA 1A0BA 1C02A 2UUHA 3CSKA 4QI0A 3ZQYA 4XLNF 4LLEA 3GWLA 1YDIA 2Y69C 1AUEA 3K6BA 3UMHA 5T3WA 3MYFA 3PMRA 2H7OA 4E18A 2AU5A 3W2VA 4CS8A 2EPMX 2IM8A 4OIQF 2AVKA 4EBJA 3C18A 1M6TA 1PD0A 2CGEA 5KYXB 2LIGA 5A69A 2DYSC 4QDLA 3L1MA 3JYYA 4U5HA 2Q9CA 1LVKA 1W2WA 2WZFA 4I1MA 2J45A 4IB4A 3S0XA 1Y4CA 4KBLA 3OWTA 3U0CA 3DJUB 3GM1A 3T6BA 2XL6A 1ZHTA 1H6GA 4EHPA 1D1BA 1HE1A 3RKOF 5KYXA 2WVOA 3RQFA 3U3BA 1A41A 3UGOA 2J7PD 1CGME 4MVUA 5E33A 3QW0A 4XEFA 3B71A 4L6RA 3TD7A 4C3EA 3GM2A 3W2WA 4YT8A 5DS5A 2J8WA 1LE2A 1LPEA 1CPRA 5JRAA 1BBHA 3LS1A 3R2PA 2NUPB 3EH1A 1ZHXA 5DS6A 2R7WA 3DE9A 2Y3GA 2R02A 1HMDA 4X0RA 4KC9A 4CJGA 2I8BA 4I1OB 4NC3A 4AK9A 4GYTA 5K0IA 2HZ8A 3K7DA 4RDAA 4IAQA 2OJQA 3KL4A 3O39A 2KJGA 2NUPA 3UR3C 1XWJA 5L0HA 1TWGA 3POVA 3RW0A 2VC9A 4WGYA 4QI2A 1PD1A 2LD6A 1H7IA 3ITFA 1OW8A 1D1CA 4NTBA 4U5GA 1I5NA 4PJNA 1EQ1A 1OKKD 1Q0MA 4DVYP 4E7SA 2W4BA 5JP7A 4IJJA 1C17M 1K40A 2J9UA 3FDQA 1FFHA 5JT4A 2OU6A 4A4AA 3PDMP 4XEVA 3FAPB 2LQGA 3EQLF 3RQEA 1ZZPA 4MTGA 4MTOA 1EI7A 2P61A 5B1BC 2CNWD 4NY3A 1RMVA 4BEMJ 1UG7A 4CX9A 5AC4A 1EA8A 2VB6A 2PNOA 3EH2A 3RYLA 4IAOA 2L6FA 4XWJA 5TJ5E 4MQ9F 3Q7GA 4ULVA 1YYXA 4YN0B 4JEAA 3W4YA 3V5ZA 4F4BA 4OD4A 1IW7F 1ORJA 3G4ZA 2ETSA 3AGTA 3TOLA 1OXKA 1U89A 3LLKA 4Q4ZF 3AG3C 3K1HA 1OCZC 3ABMC 4MVSA 1Q0GA 3TULA 1OW6A 2Q9BA 4N4WA 1RKCA 2A6HF 1ZHWA 1S7ZA 2HUJA 3GM3A 1UFBA 2CYDA 2Y39A 2ZXRA 2FAPB 3C8GB 4Q7CA 1WATA 3EJNA 4MW3A 4CS8C 4H54A 2EPKX 2IXMA 4RBNA 2YZSA 4FAPB 4EKWA 4JVSA 4CS9A 4J7TA 2Q3TA 2HJMA 3HNKA 1FR0A 1Z63A 1V54C 4EBKA 1JR8A 3S90A 2P7VA 5E3CA 4BJTA 5L0FA 2YL3A 4MNDA 2RSEB 3C8GA 4PJMA 3SEOA 2YHSA 3ATPA 1FNTc 3DE8A 3EFOB 4ER9A 3DKAA 4G7ZF 3UGPA 2RD9A 4CDAA 3U8PA 1FTSA 1SR2A 4XQ1A 3Q6MA 3RVZA 3KKBA 3ZDLA 3G50A 2R25A 3DD7A 5T3TA 3ZSUA 1A7DA 1TQGA 3B0VC 3LEOA 2LFFA 2WVQA 1YA7O 1KU2A 2EPOA 3JCUQ 4XTKA 4JC7A 2XLEA 2VCAA 4WJ0A 2X51A 3EFOA 1NSGB 2BL2A 3IQ5A 2VCCA 1A7VA 2PF4E 4KNVA 4DBRA 5B1AC 4PJLA 4AE4A 2J0XA 1V74B 1VLTA 2WB7A 3ZQVA 4BJ6C 1MNDA 4C3BA 3E70C 4JIOA 4CBEA 3HNIA 2L7AA 2XLVA 1M56C 4CDYA 3DJNB 1ZW3A 3N24A 3V7OA 3FMSA 3MLGA 4E17A 1T6QA 4U9EA 4EIYA 3FVYA 1ZW2A 4XPXA 2A68F 1OR3A 1SF8A 1IZMA 1WOLA 1F1MA 2YL0A 3L8IA 1ZHYA 1HW1A 1OCCC 2YQYA 4J30B 1NBBA 4R32A 4BJ5A 4CS7A 1SYQA 1YJGA 2YRFA 3CQZA 1TKNA 4K7BA 2D5RB 2EPNA 2A0UA 1J8YF 2WL8A 3LNMB 5F5FA 2PBEA 1HY5A 3CEXA 3HLZA 3LAYA 4N6HA 1VMAA 2YWAA 1PV3A 5COFA 3U8VA 5GPGB 3UMIA 5L0DA 1GM5A 4GQHA 1OQCA 2EILC 3LLIA 1BR2A 2KSFA 4E7ZA 3L34A 4K0DA 4DRJB 2MWQA 4PFPA 3B9QA 4NTAA 4U5DE 1YARO 2KK1A 1ORYA 2F22A 1O5HA 4FWVA 1TR2A 3BEHA 3NYLA 4IGGA 4AL1A 1YZAA 2XLMA 4JJFA 5CI8A 2P0NA 3JSEO 4DXWA 2J9WA 3GEIA 4LDKA 2NSFA 3JTLO 3R7CA 3L8JA 2LCHA 3WODF 2R7SA 4U5FE 3T4RA 1YA9A 3TQOA 4C3DA 5L0JA 4CIPA 3QW1A 5JS5A 3TK0A 5CI9A 1XZPA 2CCYA 5DLJA 1H9TA 1QKRA 4XPWA 2NUTB 1MMDA 1WTYA 1Z5ZA 1WGWA 2OKUA 2QY9A 3JYHA 2Z15A 1T6IA 4MTFA 2R05A 4W8PA 1MQVA 1CPQA 1VB5A 4A2NB 1KTMA 1DOVA 2J9BA 2OEVA 1TWAA 5BQIA 2Y3DA 2L6GA 4OIOF 2LK4A 2J7PA 2PFDA 1E85A 2QLAA 4CJOA 3QTHA 2E87A 1D1AA 2G3KA 1RKEB 5KYNA 1M57C 3PCVA 2NUTA 2QNLA 2XLDA 2NSGA 3H2VA 3IHUA 2W9YA 3E9VA 3N0TA 1Z7Qc 2Y3BA 4Q5SF 3S29A 3LUTB 1Q0KA 2OG2A 3EZIA 3NRHA 4JJGA 5DQTA 4DRHB 1NZEA 2YKZA 3F47A 1BR4A 1YLMA 3NMJA 1D0YA 4LDQA 1C03A 1RKEA 4RD9A 2Q9AA 2YEVA 3JRMO 1OCOC 5FZTA 5A6BD 4OIPF 4ONSA 2YL7A 4U9DA 1VOMA 4FESA 1G4US 1K05A 3G4XA 1WN0A 3I5PA 4O7GA 5E2QA 1DOWA 3WAQA 1JPJA 4JW1A 4YWQA 1I4YA 2JD3A 3DM5A 3EG9B 1Q0FA 2XL4A 2Y3HA 4PK4A 2HSBA 1KNYA 4XLPF 1VLSA 3NMIA 1YVIA 2IXNA 2XLOA 3ZIBA 2R7TA 4LACB 2XLWA 4AL0A 4MW8A 1BZ4A 1OKKA 2YLDA 3EZHA 2Q00A 2DB4A 2DYRC 3HJCA 3U5SA 3T9OA 3EG9A 3NMKA 1JPNA 2KYHA 3A11A 3KYIA 1RJ9B 1K04A 1HMOA 3M4CA 3Q7LA 3S28A 1SZIA 2IYLD 1T9KA 2B0JA 2HFIA 2OOCA 4JCZA 3DM9B 3SXYA 1NFNA 1TFOB 2AWYA 3JRTA 4OD5A 1MMNA 3U2LA 2CNWA 4AX2A 3FAJA 5F28E 5E3AA 3RFYA 2HV7A 3CAXA 5B3IA 2B0HA 1RJ9A 3C63A 4HFFB 4N6CA 256BA 4LLCA 4JURI 1HE9A 2IOQA 2Q4FA 2UUIA 3OA1A 2LSEA 2OCCC 4JZAA 2XSEA 3SNHA 2YLIA 3M4BA 3X2QC 3N2ZB 5BQGA 3SYNA 2DI3A 1LS1A 4IARA 1BR1A 2LFDA 5T1DB 3ZG1A 2CDQA 2P1AA 4U5BE 1PCXA 5D92A 3AQBA 1JRAA 1BDJB 3HNJA 2GFHA 3IPMO 3NYMA 2WZGA 4JCHA 3ZWIA 3K1IA 4G7HF 2L6HA 1LKXA 4Z9JA 2Q7RA 3LJBA 5A6KA 1QLEC 4P9TA 4O6MA 1E2XA 4MVQA 3S84A 2R7XA 4M63A 3LEVA 1CGNA 4ANJA 4DJ9A 3PHF2 4NTFA 4BEJA 2W4MA 3EHMA 4EWCA 3RVYA 4UDVA 4YL1A 5L0IA 4YL3A 3ABLC 3DAFA 4C7OB 4NCQA 2PX0A 1YZCA 3IQCA 1NFOA 4YT5A 2A1DD 3ECSA 3A9CA 3RIPA 2IXPA 5EGYA 1B68A 3EGDB 1HW2A 1FFTC 1FAPB 3MX3A 1NLXA 4KNWA 3F46A 3KMIA 1GGQA 2V3CC 1Z3IX 4C7OA 3RF3A 4BPMA 1NG1A 4YT2A 3OEOA 5KYWB 2A6EF 5L3VA 3EGDA 4FX5A 3ZTMA 3B29A 3S27A 5IY5C 3NG1A 3M1CB 1T5OA 2KNHA 2QE9A 2NG1A 3ZTZA 1LI7A 4P9FA 2R9RB 3AJMA 3NKDA 1YYJA 1LS4A 2EIMC 4HE8D 3FOOA 5KYUB 2V26A 5KYWA 4JRZA 3TJ5A 4OIRF 1ZU5A 3GEHA 1T01A 1V55C 1XZQA 2C03A 1MMGA 1VYIA 2EINC 3V5YA 5JVEA 2BE5F 5FCLA 4PR9A 5L0CA 4D4NA 3DI5A 5HV9A 1ST6A 1QVXA 4IWBA 2J9VA 2XLHA 5KYUA 3SXKA 3QVYA 2M64A 1Y6DA 2GDCA 1LI5A 2FFHA 3GEEA 2VH3A 4GEHA 1Z23A 1AVOB 4PFOA 3WHNA 4JEBA 5F5HA 4E0IA 2H7VC 1I4ZA 3EGXB 5D91A 5DVWA 3VYWA 2NPUA 3KYJA 3HNLA 3I5QA 4JTCB 4JTDB 2KW3C 4P6IC 4Z9HA 3SXMA 2XXAB 3B0UX 2XS1A 1ZHZA 2WZLA 4PACA 3JSZA 4JKVA 3CZ6A 2R03A 1O87A 3X1OA 3JZ0A 2ZD9A 1TFKB 3US6A 1A7EA 1RCPA 3NKEA 3UNGC 3DAGA 2GA0A 3EGXA 1VK5A 3S9OA 3SP1A 3U9JA 5A6JA 1E83A 2ICWG 2GWWA 2QUPA 3AQCA 1J8MF 2XXAA 4LERA 3T6JA 2HV6A 4BJ1A 4MVMA 2KGOA 4DRIB 1LE4A 3DXJF 4WABA 5L3QA 2I15A 1D0ZA 1FMVA 2OQMA 2WVNA 3QVZA 1H9GA 2EIJC 4CS9C 4JE9A 4WGZA 3M15A 3ABKC 2TMVP 5AC5A 3ASNC 3DWWA 1G8XA 4W8KA 4ZLCA 4MVRA 3FOPA 4CSAA 2P6VA 3C8ZA 3L0IA 4YT4A 2C04A 2ZXWC 1QPUA 2M4EA 3EPVA 4Z9IA 2QTVA 4BJ6A 2HSQA 4MVOA 2L9JA 2HS5A 3NYJA 4NQFA 4XPYA 5BUOA 2G3VA 2XRHA 5JLIA 2R7RA 2R7UA 3K1IC 1JOGA 3HTKC 3GWNA 2YL1A 4U5EE 1N1CA 4N06A 1MMAA 3UMKA 5L0GA 3FXHA 3C7JA 2R7OA 4YJWA 3MBGA 1APCA 1OW7A 2A0BA 5JSLA 2VASA 4ULWA 3SZRA 5CIVA 4JTAB 4DOZA 4HFKB 1AEPA 3U9MA 5BQHA 2PP4A 2XL8A 1S05A 4EUKB 3MYIA 3IEEA 3IQ6A 2HJ3A 4O79A 2JPUA 4E0HA 3V5XA 5EHHA 1E84A 4J7YA 2KQ9A 3VRCA 4D4XA 3W8HA 3TOMA 3WG7C 4CDVA 1E86A 5A6AA 2G62A 5A6BA 3VM6A 5JUAA 1O3UA 3ZC4A 3M79A 4PJJA 2YLGA 4O6NA 5HSWA 1ZYRF 1JMWA 1NU7D 1L3PA 4KI2A 3H65A 5COMA 4B6IA 4G0HA 2XM4A 2VCBA 4G78A 3AOUA 1FMWA 1VTMP 4J32B 3ZVRA 1LIHA 4BJ5C 4ZLDA 5B3SC 1T6UA 1Q0DA 1G5ZA 4LDRA 2LP4A 2ASRA 2X0CA 3O6XA 3K33A 3QMKA 2L81A 3W8IA 1SMYF 4CIHA 3KH2A 1RXQA 1U0BB 3AGUA 3BRJA 3RQGA 3T6GB 2O9XA 5KYYB 2JX0A 3VF0A 2EPLX 3RH3A 4EBBA 2ZPAA 1QQ3A 2DGJA 3H2UA 1GQAA 1Z6AA 3C8GD 5DS4A 4DVZA 2IBFA 2IXOA 2R7VA 1R4TA 1CGOA 3LNRA 2XS8A 3U2MA 3QZCA 1TWCA 3B0PA 2HMZA 4I44A 2HMQA 5KYYA 3LS0A 4HEAJ 3GORA 4H4KC 3J06A 1WASA 1U6HA 2FGYA 2ZXPA 4BG0A 5AGFA 2CW0F 4OINF 3C62A 2YVKA 1NU9C 1WWPA 3EHNA 2OJED 2AP3A 3SXZA 3GODA 5EK0A 3O55A 3K66A 1M2VB 2ZXOA 3I4UA 3Q6NA 5DQZA 3KPHA 2J0WA 4AE4B 1G4WR 2PX3A 1YAUO 3AG1C 3U3FA 2EIKC 4U5CE 3IQTA 3DMDA 1GS9A 4I3MA 3MFNA 4XEKA 1QZXA 2D4UA 4IRUA 4O6YA 1M2VA 3JT1A 2OEXA 2XM0A 4K1OA 1MNEA 3FHDA 1QSPA 1JAFA 2MYSA 4CSAC 1TWHA 2MHRA 1ZVZA 3VAYA 4G7OF 1L7CA 3AG2C 2R7QA 4YK5A 1OXBA 3HKKA 3NDBB 3DZAA 1ZU4A 1V4AA 2GAQA 1LM3B 1D0XA 1OCRC 1VYKA 2A69F 1M2OA 3AG4C 4MVZA 4YL0A 3TJ6A 4MS2A 3ASOC 2H7BA 3GANA 2W45A 3O10A 2KC3A 5COGA 2H8AA
chains in the Genus database with same CATH topology
2GDCA 3VF0A 3H2VA 3RF3A 3H2UA 3ZDLA 1U89A 1YDIA 2IBFA 4E18A 3MYIA 1SYQA 5L0JA 2HSQA 4P9TA 1RKEA 5FZTA 1RKCA 4K1OA 4ONSA 1QKRA 4DJ9A 5L0GA 1U6HA 5L0IA 1ZVZA 5L0DA 2B0HA 2LQGA 1L7CA 1DOWA 3T6GB 4W8PA 3TJ5A 2X0CA 2L7AA 1T01A 1H6GA 2GWWA 1DOVA 4EHPA 5L0HA 1ZW3A 1XWJA 4PR9A 3TJ6A 5L0CA 3S90A 1ST6A 5L0FA 4E17A 1TR2A 4IGGA 1RKEB 1ZW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDC A;  3VF0 A;  3H2V A;  3RF3 A;  3H2U A;  3ZDL A;  1U89 A;  1YDI A;  2IBF A;  4E18 A;  3MYI A;  1SYQ A;  5L0J A;  2HSQ A;  4P9T A;  1RKE A;  5FZT A;  1RKC A;  4K1O A;  4ONS A;  1QKR A;  4DJ9 A;  5L0G A;  1U6H A;  5L0I A;  1ZVZ A;  5L0D A;  2B0H A;  2LQG A;  1L7C A;  1DOW A;  3T6G B;  4W8P A;  3TJ5 A;  2X0C A;  2L7A A;  1T01 A;  1H6G A;  2GWW A;  1DOV A;  4EHP A;  5L0H A;  1ZW3 A;  1XWJ A;  4PR9 A;  3TJ6 A;  5L0C A;  3S90 A;  1ST6 A;  5L0F A;  4E17 A;  1TR2 A;  4IGG A;  1RKE B;  1ZW2 A; 
#chains in the Genus database with same CATH topology
 3LES A;  1EKY A;  1ORS C;  1R5I D;  2BC5 A;  4DBQ A;  2AWC A;  1OR2 A;  2J46 A;  2HKV A;  1A0B A;  1C02 A;  2UUH A;  3CSK A;  4QI0 A;  3ZQY A;  4XLN F;  4LLE A;  3GWL A;  1YDI A;  2Y69 C;  1AUE A;  3K6B A;  3UMH A;  5T3W A;  3MYF A;  3PMR A;  2H7O A;  4E18 A;  2AU5 A;  3W2V A;  4CS8 A;  2EPM X;  2IM8 A;  4OIQ F;  2AVK A;  4EBJ A;  3C18 A;  1M6T A;  1PD0 A;  2CGE A;  5KYX B;  2LIG A;  5A69 A;  2DYS C;  4QDL A;  3L1M A;  3JYY A;  4U5H A;  2Q9C A;  1LVK A;  1W2W A;  2WZF A;  4I1M A;  2J45 A;  4IB4 A;  3S0X A;  1Y4C A;  4KBL A;  3OWT A;  3U0C A;  3DJU B;  3GM1 A;  3T6B A;  2XL6 A;  1ZHT A;  1H6G A;  4EHP A;  1D1B A;  1HE1 A;  3RKO F;  5KYX A;  2WVO A;  3RQF A;  3U3B A;  1A41 A;  3UGO A;  2J7P D;  1CGM E;  4MVU A;  5E33 A;  3QW0 A;  4XEF A;  3B71 A;  4L6R A;  3TD7 A;  4C3E A;  3GM2 A;  3W2W A;  4YT8 A;  5DS5 A;  2J8W A;  1LE2 A;  1LPE A;  1CPR A;  5JRA A;  1BBH A;  3LS1 A;  3R2P A;  2NUP B;  3EH1 A;  1ZHX A;  5DS6 A;  2R7W A;  3DE9 A;  2Y3G A;  2R02 A;  1HMD A;  4X0R A;  4KC9 A;  4CJG A;  2I8B A;  4I1O B;  4NC3 A;  4AK9 A;  4GYT A;  5K0I A;  2HZ8 A;  3K7D A;  4RDA A;  4IAQ A;  2OJQ A;  3KL4 A;  3O39 A;  2KJG A;  2NUP A;  3UR3 C;  1XWJ A;  5L0H A;  1TWG A;  3POV A;  3RW0 A;  2VC9 A;  4WGY A;  4QI2 A;  1PD1 A;  2LD6 A;  1H7I A;  3ITF A;  1OW8 A;  1D1C A;  4NTB A;  4U5G A;  1I5N A;  4PJN A;  1EQ1 A;  1OKK D;  1Q0M A;  4DVY P;  4E7S A;  2W4B A;  5JP7 A;  4IJJ A;  1C17 M;  1K40 A;  2J9U A;  3FDQ A;  1FFH A;  5JT4 A;  2OU6 A;  4A4A A;  3PDM P;  4XEV A;  3FAP B;  2LQG A;  3EQL F;  3RQE A;  1ZZP A;  4MTG A;  4MTO A;  1EI7 A;  2P61 A;  5B1B C;  2CNW D;  4NY3 A;  1RMV A;  4BEM J;  1UG7 A;  4CX9 A;  5AC4 A;  1EA8 A;  2VB6 A;  2PNO A;  3EH2 A;  3RYL A;  4IAO A;  2L6F A;  4XWJ A;  5TJ5 E;  4MQ9 F;  3Q7G A;  4ULV A;  1YYX A;  4YN0 B;  4JEA A;  3W4Y A;  3V5Z A;  4F4B A;  4OD4 A;  1IW7 F;  1ORJ A;  3G4Z A;  2ETS A;  3AGT A;  3TOL A;  1OXK A;  1U89 A;  3LLK A;  4Q4Z F;  3AG3 C;  3K1H A;  1OCZ C;  3ABM C;  4MVS A;  1Q0G A;  3TUL A;  1OW6 A;  2Q9B A;  4N4W A;  1RKC A;  2A6H F;  1ZHW A;  1S7Z A;  2HUJ A;  3GM3 A;  1UFB A;  2CYD A;  2Y39 A;  2ZXR A;  2FAP B;  3C8G B;  4Q7C A;  1WAT A;  3EJN A;  4MW3 A;  4CS8 C;  4H54 A;  2EPK X;  2IXM A;  4RBN A;  2YZS A;  4FAP B;  4EKW A;  4JVS A;  4CS9 A;  4J7T A;  2Q3T A;  2HJM A;  3HNK A;  1FR0 A;  1Z63 A;  1V54 C;  4EBK A;  1JR8 A;  3S90 A;  2P7V A;  5E3C A;  4BJT A;  5L0F A;  2YL3 A;  4MND A;  2RSE B;  3C8G A;  4PJM A;  3SEO A;  2YHS A;  3ATP A;  1FNT c;  3DE8 A;  3EFO B;  4ER9 A;  3DKA A;  4G7Z F;  3UGP A;  2RD9 A;  4CDA A;  3U8P A;  1FTS A;  1SR2 A;  4XQ1 A;  3Q6M A;  3RVZ A;  3KKB A;  3ZDL A;  3G50 A;  2R25 A;  3DD7 A;  5T3T A;  3ZSU A;  1A7D A;  1TQG A;  3B0V C;  3LEO A;  2LFF A;  2WVQ A;  1YA7 O;  1KU2 A;  2EPO A;  3JCU Q;  4XTK A;  4JC7 A;  2XLE A;  2VCA A;  4WJ0 A;  2X51 A;  3EFO A;  1NSG B;  2BL2 A;  3IQ5 A;  2VCC A;  1A7V A;  2PF4 E;  4KNV A;  4DBR A;  5B1A C;  4PJL A;  4AE4 A;  2J0X A;  1V74 B;  1VLT A;  2WB7 A;  3ZQV A;  4BJ6 C;  1MND A;  4C3B A;  3E70 C;  4JIO A;  4CBE A;  3HNI A;  2L7A A;  2XLV A;  1M56 C;  4CDY A;  3DJN B;  1ZW3 A;  3N24 A;  3V7O A;  3FMS A;  3MLG A;  4E17 A;  1T6Q A;  4U9E A;  4EIY A;  3FVY A;  1ZW2 A;  4XPX A;  2A68 F;  1OR3 A;  1SF8 A;  1IZM A;  1WOL A;  1F1M A;  2YL0 A;  3L8I A;  1ZHY A;  1HW1 A;  1OCC C;  2YQY A;  4J30 B;  1NBB A;  4R32 A;  4BJ5 A;  4CS7 A;  1SYQ A;  1YJG A;  2YRF A;  3CQZ A;  1TKN A;  4K7B A;  2D5R B;  2EPN A;  2A0U A;  1J8Y F;  2WL8 A;  3LNM B;  5F5F A;  2PBE A;  1HY5 A;  3CEX A;  3HLZ A;  3LAY A;  4N6H A;  1VMA A;  2YWA A;  1PV3 A;  5COF A;  3U8V A;  5GPG B;  3UMI A;  5L0D A;  1GM5 A;  4GQH A;  1OQC A;  2EIL C;  3LLI A;  1BR2 A;  2KSF A;  4E7Z A;  3L34 A;  4K0D A;  4DRJ B;  2MWQ A;  4PFP A;  3B9Q A;  4NTA A;  4U5D E;  1YAR O;  2KK1 A;  1ORY A;  2F22 A;  1O5H A;  4FWV A;  1TR2 A;  3BEH A;  3NYL A;  4IGG A;  4AL1 A;  1YZA A;  2XLM A;  4JJF A;  5CI8 A;  2P0N A;  3JSE O;  4DXW A;  2J9W A;  3GEI A;  4LDK A;  2NSF A;  3JTL O;  3R7C A;  3L8J A;  2LCH A;  3WOD F;  2R7S A;  4U5F E;  3T4R A;  1YA9 A;  3TQO A;  4C3D A;  5L0J A;  4CIP A;  3QW1 A;  5JS5 A;  3TK0 A;  5CI9 A;  1XZP A;  2CCY A;  5DLJ A;  1H9T A;  1QKR A;  4XPW A;  2NUT B;  1MMD A;  1WTY A;  1Z5Z A;  1WGW A;  2OKU A;  2QY9 A;  3JYH A;  2Z15 A;  1T6I A;  4MTF A;  2R05 A;  4W8P A;  1MQV A;  1CPQ A;  1VB5 A;  4A2N B;  1KTM A;  1DOV A;  2J9B A;  2OEV A;  1TWA A;  5BQI A;  2Y3D A;  2L6G A;  4OIO F;  2LK4 A;  2J7P A;  2PFD A;  1E85 A;  2QLA A;  4CJO A;  3QTH A;  2E87 A;  1D1A A;  2G3K A;  1RKE B;  5KYN A;  1M57 C;  3PCV A;  2NUT A;  2QNL A;  2XLD A;  2NSG A;  3H2V A;  3IHU A;  2W9Y A;  3E9V A;  3N0T A;  1Z7Q c;  2Y3B A;  4Q5S F;  3S29 A;  3LUT B;  1Q0K A;  2OG2 A;  3EZI A;  3NRH A;  4JJG A;  5DQT A;  4DRH B;  1NZE A;  2YKZ A;  3F47 A;  1BR4 A;  1YLM A;  3NMJ A;  1D0Y A;  4LDQ A;  1C03 A;  1RKE A;  4RD9 A;  2Q9A A;  2YEV A;  3JRM O;  1OCO C;  5FZT A;  5A6B D;  4OIP F;  4ONS A;  2YL7 A;  4U9D A;  1VOM A;  4FES A;  1G4U S;  1K05 A;  3G4X A;  1WN0 A;  3I5P A;  4O7G A;  5E2Q A;  1DOW A;  3WAQ A;  1JPJ A;  4JW1 A;  4YWQ A;  1I4Y A;  2JD3 A;  3DM5 A;  3EG9 B;  1Q0F A;  2XL4 A;  2Y3H A;  4PK4 A;  2HSB A;  1KNY A;  4XLP F;  1VLS A;  3NMI A;  1YVI A;  2IXN A;  2XLO A;  3ZIB A;  2R7T A;  4LAC B;  2XLW A;  4AL0 A;  4MW8 A;  1BZ4 A;  1OKK A;  2YLD A;  3EZH A;  2Q00 A;  2DB4 A;  2DYR C;  3HJC A;  3U5S A;  3T9O A;  3EG9 A;  3NMK A;  1JPN A;  2KYH A;  3A11 A;  3KYI A;  1RJ9 B;  1K04 A;  1HMO A;  3M4C A;  3Q7L A;  3S28 A;  1SZI A;  2IYL D;  1T9K A;  2B0J A;  2HFI A;  2OOC A;  4JCZ A;  3DM9 B;  3SXY A;  1NFN A;  1TFO B;  2AWY A;  3JRT A;  4OD5 A;  1MMN A;  3U2L A;  2CNW A;  4AX2 A;  3FAJ A;  5F28 E;  5E3A A;  3RFY A;  2HV7 A;  3CAX A;  5B3I A;  2B0H A;  1RJ9 A;  3C63 A;  4HFF B;  4N6C A;  256B A;  4LLC A;  4JUR I;  1HE9 A;  2IOQ A;  2Q4F A;  2UUI A;  3OA1 A;  2LSE A;  2OCC C;  4JZA A;  2XSE A;  3SNH A;  2YLI A;  3M4B A;  3X2Q C;  3N2Z B;  5BQG A;  3SYN A;  2DI3 A;  1LS1 A;  4IAR A;  1BR1 A;  2LFD A;  5T1D B;  3ZG1 A;  2CDQ A;  2P1A A;  4U5B E;  1PCX A;  5D92 A;  3AQB A;  1JRA A;  1BDJ B;  3HNJ A;  2GFH A;  3IPM O;  3NYM A;  2WZG A;  4JCH A;  3ZWI A;  3K1I A;  4G7H F;  2L6H A;  1LKX A;  4Z9J A;  2Q7R A;  3LJB A;  5A6K A;  1QLE C;  4P9T A;  4O6M A;  1E2X A;  4MVQ A;  3S84 A;  2R7X A;  4M63 A;  3LEV A;  1CGN A;  4ANJ A;  4DJ9 A;  3PHF 2;  4NTF A;  4BEJ A;  2W4M A;  3EHM A;  4EWC A;  3RVY A;  4UDV A;  4YL1 A;  5L0I A;  4YL3 A;  3ABL C;  3DAF A;  4C7O B;  4NCQ A;  2PX0 A;  1YZC A;  3IQC A;  1NFO A;  4YT5 A;  2A1D D;  3ECS A;  3A9C A;  3RIP A;  2IXP A;  5EGY A;  1B68 A;  3EGD B;  1HW2 A;  1FFT C;  1FAP B;  3MX3 A;  1NLX A;  4KNW A;  3F46 A;  3KMI A;  1GGQ A;  2V3C C;  1Z3I X;  4C7O A;  3RF3 A;  4BPM A;  1NG1 A;  4YT2 A;  3OEO A;  5KYW B;  2A6E F;  5L3V A;  3EGD A;  4FX5 A;  3ZTM A;  3B29 A;  3S27 A;  5IY5 C;  3NG1 A;  3M1C B;  1T5O A;  2KNH A;  2QE9 A;  2NG1 A;  3ZTZ A;  1LI7 A;  4P9F A;  2R9R B;  3AJM A;  3NKD A;  1YYJ A;  1LS4 A;  2EIM C;  4HE8 D;  3FOO A;  5KYU B;  2V26 A;  5KYW A;  4JRZ A;  3TJ5 A;  4OIR F;  1ZU5 A;  3GEH A;  1T01 A;  1V55 C;  1XZQ A;  2C03 A;  1MMG A;  1VYI A;  2EIN C;  3V5Y A;  5JVE A;  2BE5 F;  5FCL A;  4PR9 A;  5L0C A;  4D4N A;  3DI5 A;  5HV9 A;  1ST6 A;  1QVX A;  4IWB A;  2J9V A;  2XLH A;  5KYU A;  3SXK A;  3QVY A;  2M64 A;  1Y6D A;  2GDC A;  1LI5 A;  2FFH A;  3GEE A;  2VH3 A;  4GEH A;  1Z23 A;  1AVO B;  4PFO A;  3WHN A;  4JEB A;  5F5H A;  4E0I A;  2H7V C;  1I4Z A;  3EGX B;  5D91 A;  5DVW A;  3VYW A;  2NPU A;  3KYJ A;  3HNL A;  3I5Q A;  4JTC B;  4JTD B;  2KW3 C;  4P6I C;  4Z9H A;  3SXM A;  2XXA B;  3B0U X;  2XS1 A;  1ZHZ A;  2WZL A;  4PAC A;  3JSZ A;  4JKV A;  3CZ6 A;  2R03 A;  1O87 A;  3X1O A;  3JZ0 A;  2ZD9 A;  1TFK B;  3US6 A;  1A7E A;  1RCP A;  3NKE A;  3UNG C;  3DAG A;  2GA0 A;  3EGX A;  1VK5 A;  3S9O A;  3SP1 A;  3U9J A;  5A6J A;  1E83 A;  2ICW G;  2GWW A;  2QUP A;  3AQC A;  1J8M F;  2XXA A;  4LER A;  3T6J A;  2HV6 A;  4BJ1 A;  4MVM A;  2KGO A;  4DRI B;  1LE4 A;  3DXJ F;  4WAB A;  5L3Q A;  2I15 A;  1D0Z A;  1FMV A;  2OQM A;  2WVN A;  3QVZ A;  1H9G A;  2EIJ C;  4CS9 C;  4JE9 A;  4WGZ A;  3M15 A;  3ABK C;  2TMV P;  5AC5 A;  3ASN C;  3DWW A;  1G8X A;  4W8K A;  4ZLC A;  4MVR A;  3FOP A;  4CSA A;  2P6V A;  3C8Z A;  3L0I A;  4YT4 A;  2C04 A;  2ZXW C;  1QPU A;  2M4E A;  3EPV A;  4Z9I A;  2QTV A;  4BJ6 A;  2HSQ A;  4MVO A;  2L9J A;  2HS5 A;  3NYJ A;  4NQF A;  4XPY A;  5BUO A;  2G3V A;  2XRH A;  5JLI A;  2R7R A;  2R7U A;  3K1I C;  1JOG A;  3HTK C;  3GWN A;  2YL1 A;  4U5E E;  1N1C A;  4N06 A;  1MMA A;  3UMK A;  5L0G A;  3FXH A;  3C7J A;  2R7O A;  4YJW A;  3MBG A;  1APC A;  1OW7 A;  2A0B A;  5JSL A;  2VAS A;  4ULW A;  3SZR A;  5CIV A;  4JTA B;  4DOZ A;  4HFK B;  1AEP A;  3U9M A;  5BQH A;  2PP4 A;  2XL8 A;  1S05 A;  4EUK B;  3MYI A;  3IEE A;  3IQ6 A;  2HJ3 A;  4O79 A;  2JPU A;  4E0H A;  3V5X A;  5EHH A;  1E84 A;  4J7Y A;  2KQ9 A;  3VRC A;  4D4X A;  3W8H A;  3TOM A;  3WG7 C;  4CDV A;  1E86 A;  5A6A A;  2G62 A;  5A6B A;  3VM6 A;  5JUA A;  1O3U A;  3ZC4 A;  3M79 A;  4PJJ A;  2YLG A;  4O6N A;  5HSW A;  1ZYR F;  1JMW A;  1NU7 D;  1L3P A;  4KI2 A;  3H65 A;  5COM A;  4B6I A;  4G0H A;  2XM4 A;  2VCB A;  4G78 A;  3AOU A;  1FMW A;  1VTM P;  4J32 B;  3ZVR A;  1LIH A;  4BJ5 C;  4ZLD A;  5B3S C;  1T6U A;  1Q0D A;  1G5Z A;  4LDR A;  2LP4 A;  2ASR A;  2X0C A;  3O6X A;  3K33 A;  3QMK A;  2L81 A;  3W8I A;  1SMY F;  4CIH A;  3KH2 A;  1RXQ A;  1U0B B;  3AGU A;  3BRJ A;  3RQG A;  3T6G B;  2O9X A;  5KYY B;  2JX0 A;  3VF0 A;  2EPL X;  3RH3 A;  4EBB A;  2ZPA A;  1QQ3 A;  2DGJ A;  3H2U A;  1GQA A;  1Z6A A;  3C8G D;  5DS4 A;  4DVZ A;  2IBF A;  2IXO A;  2R7V A;  1R4T A;  1CGO A;  3LNR A;  2XS8 A;  3U2M A;  3QZC A;  1TWC A;  3B0P A;  2HMZ A;  4I44 A;  2HMQ A;  5KYY A;  3LS0 A;  4HEA J;  3GOR A;  4H4K C;  3J06 A;  1WAS A;  1U6H A;  2FGY A;  2ZXP A;  4BG0 A;  5AGF A;  2CW0 F;  4OIN F;  3C62 A;  2YVK A;  1NU9 C;  1WWP A;  3EHN A;  2OJE D;  2AP3 A;  3SXZ A;  3GOD A;  5EK0 A;  3O55 A;  3K66 A;  1M2V B;  2ZXO A;  3I4U A;  3Q6N A;  5DQZ A;  3KPH A;  2J0W A;  4AE4 B;  1G4W R;  2PX3 A;  1YAU O;  3AG1 C;  3U3F A;  2EIK C;  4U5C E;  3IQT A;  3DMD A;  1GS9 A;  4I3M A;  3MFN A;  4XEK A;  1QZX A;  2D4U A;  4IRU A;  4O6Y A;  1M2V A;  3JT1 A;  2OEX A;  2XM0 A;  4K1O A;  1MNE A;  3FHD A;  1QSP A;  1JAF A;  2MYS A;  4CSA C;  1TWH A;  2MHR A;  1ZVZ A;  3VAY A;  4G7O F;  1L7C A;  3AG2 C;  2R7Q A;  4YK5 A;  1OXB A;  3HKK A;  3NDB B;  3DZA A;  1ZU4 A;  1V4A A;  2GAQ A;  1LM3 B;  1D0X A;  1OCR C;  1VYK A;  2A69 F;  1M2O A;  3AG4 C;  4MVZ A;  4YL0 A;  3TJ6 A;  4MS2 A;  3ASO C;  2H7B A;  3GAN A;  2W45 A;  3O10 A;  2KC3 A;  5COG A;  2H8A A; 
#chains in the Genus database with same CATH homology
 2GDC A;  3VF0 A;  3H2V A;  3RF3 A;  3H2U A;  3ZDL A;  1U89 A;  1YDI A;  2IBF A;  4E18 A;  3MYI A;  1SYQ A;  5L0J A;  2HSQ A;  4P9T A;  1RKE A;  5FZT A;  1RKC A;  4K1O A;  4ONS A;  1QKR A;  4DJ9 A;  5L0G A;  1U6H A;  5L0I A;  1ZVZ A;  5L0D A;  2B0H A;  2LQG A;  1L7C A;  1DOW A;  3T6G B;  4W8P A;  3TJ5 A;  2X0C A;  2L7A A;  1T01 A;  1H6G A;  2GWW A;  1DOV A;  4EHP A;  5L0H A;  1ZW3 A;  1XWJ A;  4PR9 A;  3TJ6 A;  5L0C A;  3S90 A;  1ST6 A;  5L0F A;  4E17 A;  1TR2 A;  4IGG A;  1RKE B;  1ZW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...