2IBFA

Human vinculin's head domain (vh1, residues 1-258) in complex with two vinculin binding sites of shigella flexneri's ipaa (residues 565-587)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin binding in its closed conformation by a helix addition mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 107
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2006-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA01
2B0HA 2X0CA 2GDCA 3S90A 1U6HA 1RKEA 4E17A 2IBFA 1DOVA 1RKCA 5L0JA 1ZW3A 4PR9A 1SYQA 3TJ6A 1U89A 1TR2A 2GWWA 3MYIA 4DJ9A 4W8PA 1RKEB 4E18A 4IGGA 1H6GA 4P9TA 1L7CA 3H2UA 1DOWA 3ZDLA 5L0IA 1T01A 5L0FA 4EHPA 1ZW2A 2LQGA 2HSQA 3TJ5A 3VF0A 3T6GB 1YDIA 3RF3A 4ONSA 5L0DA 1QKRA 4K1OA 5FZTA 1XWJA 2L7AA 5L0CA 1ST6A 3H2VA 1ZVZA 5L0HA 5L0GA
chains in the Genus database with same CATH superfamily
3RKOF 2B0HA 3K1IC 2Y3GA 2YLDA 3TULA 1U6HA 3ZIBA 4E17A 5DLJA 3OA1A 1FMWA 4U9DA 4MVSA 2XL8A 3AGUA 5BQIA 2YRFA 4CS7A 4PR9A 1MMNA 2L9JA 2YVKA 3DM9B 1NG1A 5T3WA 2JX0A 5B3SC 1EQ1A 4JVSA 2OJQA 3SXMA 1ZHWA 2Q00A 3N24A 4OD5A 3S9OA 4U5FE 4YL3A 2IXNA 5HV9A 1VYIA 1G4US 1AVOB 1DOWA 1LI7A 4ULVA 3DD7A 1D1BA 3QMKA 2Q7RA 1F1MA 1CPQA 4MVZA 1MMAA 5CI8A 5JP7A 3NDBB 1ORYA 1MQVA 2YQYA 3HTKC 4YN0B 4WGYA 2CCYA 5KYXB 2YL7A 3HNKA 2QNLA 4J7TA 4E0IA 3DJUB 2ASRA 4MVQA 3IQCA 4RD9A 3SYNA 4N6HA 1Y4CA 2HV6A 3KPHA 3UMHA 3EH1A 2Y39A 4X0RA 2C03A 2Q9BA 1SYQA 2KSFA 2OKUA 4ZLDA 1JMWA 2L6HA 4HEAJ 5BQGA 3O10A 2AWYA 3RVYA 2Q3TA 4CX9A 5BQHA 4IJJA 3RFYA 2DB4A 4JTCB 4EBBA 4DRJB 1E85A 5T1DB 1APCA 2BC5A 1FR0A 1W2WA 1T6QA 1ZYRF 2KGOA 4M63A 1LM3B 2Z15A 4MVUA 5E2QA 3SNHA 2CW0F 5D92A 1JPJA 3QVYA 2NSGA 5EGYA 3U3FA 5KYYA 4C7OA 1M56C 4XPYA 3N0TA 3LEOA 1M2VA 2NUTA 4O6YA 2VC9A 5B3IA 5L0GA 4AE4B 3JYHA 1C17M 3PMRA 1NU7D 5EK0A 4DXWA 2OEVA 2MHRA 3VRCA 4XTKA 2CDQA 4DRHB 3EGDB 4XQ1A 3RQEA 2NUPA 4P9FA 3VAYA 1WGWA 1OCCC 3O55A 2OCCC 5KYUB 1TFOB 2HUJA 3CZ6A 3GORA 3T6BA 2A6HF 3LJBA 3QZCA 5EHHA 3GWNA 1V74B 3GEEA 2R7XA 3V7OA 2OQMA 3K66A 1Z3IX 3G4XA 3AQCA 5FZTA 3UR3C 1OKKD 2G62A 2NPUA 1WTYA 1B68A 3RQFA 1RJ9B 3H2VA 1H9TA 3KYIA 4XEFA 1FFHA 3JYYA 1TFKB 4NTBA 1N1CA 1NFOA 4A4AA 4I3MA 2VCAA 1WN0A 3HKKA 3EG9A 1VLTA 2LD6A 4I44A 3L0IA 2LP4A 3RH3A 2EPLX 3JCUQ 1FAPB 3G50A 3LLKA 2EIMC 3QW1A 5T3TA 4MVRA 4D4NA 1TR2A 2R03A 3I4UA 4KBLA 4JIOA 1TWAA 5DS6A 3U2LA 1YJGA 2R7VA 1L3PA 2P1AA 2I8BA 3R2PA 5FCLA 3T4RA 1H6GA 4W8KA 4MNDA 3H2UA 4JJFA 2ZD9A 3C62A 1TQGA 1ZU5A 1D0ZA 3AGTA 3M4BA 4PFOA 3DMDA 3PHF2 5A69A 2R7TA 2H8AA 2M64A 1C03A 2JPUA 2WVOA 2YL3A 3POVA 5L0DA 3MLGA 1VLSA 4MW8A 5F5FA 4CS8C 4XLPF 2RSEB 3C8GB 4CS8A 5BUOA 3EZHA 1V55C 1NU9C 3IQ5A 5K0IA 4DOZA 4LDQA 2ZPAA 3T9OA 2IBFA 1HMOA 1DOVA 1NZEA 1E83A 3IQ6A 1A41A 3KH2A 1ORJA 2LFDA 2Q9CA 2C04A 3J06A 2IM8A 4C7OB 1YYJA 4MTGA 3V5XA 3MYIA 1OQCA 4JTAB 3W8HA 1A0BA 3JRMO 2NSFA 4LDKA 2ZXWC 4OIRF 3RVZA 1HMDA 3WHNA 4EWCA 3U5SA 4U5DE 2HSBA 2L81A 1T01A 1LS4A 4G0HA 4FAPB 5CIVA 5KYXA 4EBJA 1ZW2A 3X1OA 3O39A 4G7OF 3AG3C 4AL0A 4JCZA 1HW2A 4G7HF 1I4ZA 1LE2A 2UUHA 2R7QA 1OR2A 5F28E 5DS4A 4IAQA 3LNMB 3V5YA 4D4XA 2XS8A 3W2VA 4ZLCA 5A6KA 2R05A 2R7RA 1KNYA 2GDCA 1LKXA 4NTFA 4YJWA 3FDQA 1AEPA 1OW7A 1QVXA 2IOQA 3FAPB 3OWTA 3CQZA 4GYTA 1YZCA 3G4ZA 4J7YA 2J7PD 5A6AA 1XZQA 4JZAA 4OIPF 2O9XA 1A7EA 1CPRA 1OW6A 3IPMO 4Z9JA 1D1AA 2PF4E 3X2QC 1L7CA 2KK1A 1TWGA 1WASA 2J0XA 4AE4A 4U5EE 4JCHA 5L0IA 3F46A 2AVKA 3VYWA 1FTSA 3NYLA 1YYXA 5L3VA 2XSEA 2ZXRA 1BZ4A 2DI3A 2G3KA 3EGDA 2WVQA 3HLZA 4NQFA 2L7AA 1LIHA 1T6UA 3S27A 1JPNA 3Q7GA 4NCQA 2EILC 2YWAA 3ZWIA 4YT2A 3NYJA 1NBBA 1Z7Qc 1CGNA 2XS1A 5B1AC 1UFBA 3U9MA 4ANJA 3HNLA 4E7ZA 5KYWB 2G3VA 1A7VA 2A0BA 1OXKA 2AU5A 2YLGA 2NG1A 2EPNA 3EFOB 1RKCA 3KL4A 4WGZA 2J45A 5JLIA 4K7BA 3JSZA 1BBHA 3TQOA 2WL8A 2W45A 2D5RB 3NRHA 4MW3A 3TOLA 3K1IA 2KNHA 4GEHA 2J46A 2WZGA 4JW1A 1J8MF 4OIOF 3AG2C 1YLMA 4Z9IA 4IB4A 3T6JA 2Y3HA 1JR8A 3LUTB 1UG7A 3VF0A 2XRHA 3L1MA 4XEVA 1EA8A 4YT8A 4WJ0A 1YAUO 2YL0A 4L6RA 4RBNA 2X51A 3FXHA 3K7DA 1Q0MA 4U5BE 5COFA 4BPMA 2YEVA 1ZVZA 4CSAC 2PBEA 3NKEA 4AK9A 1QQ3A 4OINF 4IWBA 1BDJB 1G8XA 3MFNA 4JEAA 1QPUA 3O6XA 4O7GA 4ULWA 4YT5A 5E3AA 3S90A 3RQGA 4KI2A 1WWPA 4CIPA 3L8IA 3AG1C 1GGQA 5GPGB 2YZSA 3U0CA 2PX3A 2YL1A 3TJ6A 1GS9A 1H7IA 1M2OA 2OEXA 2XXAA 2P7VA 2LSEA 1QZXA 1C02A 1U0BB 5CI9A 4B6IA 4CDAA 4AL1A 1Q0DA 2XL6A 3TD7A 3ZDLA 1QLEC 4KC9A 3ABLC 2BL2A 4PJMA 2F22A 2R25A 2W4BA 4XPWA 3TJ5A 3DE9A 2XM0A 3DAGA 3GODA 3KMIA 1FFTC 4Z9HA 5JUAA 1K40A 3B0PA 1A7DA 1VB5A 5F5HA 1XZPA 3WODF 1Y6DA 3KYJA 1GM5A 1VTMP 3Q7LA 4JRZA 3EH2A 3BRJA 2X0CA 2QY9A 1RKEA 1BR4A 2W9YA 1E86A 3IHUA 2D4UA 3JTLO 1K05A 4JURI 1TWHA 2ETSA 2ZXOA 3HJCA 5L3QA 2J9VA 3WG7C 256BA 3IQTA 1OXBA 4Q7CA 3TOMA 1MMDA 4E18A 1HW1A 4LDRA 5AGFA 3U2MA 2XL4A 5KYWA 1V4AA 1CGOA 1OCRC 1YVIA 1YARO 2VB6A 4JEBA 1YA7O 3TK0A 3U8VA 4CIHA 2H7OA 2P61A 2E87A 3A9CA 3DJNB 4IARA 1BR2A 5B1BC 5L0FA 3B0UX 5KYUA 1OR3A 3S0XA 3IEEA 4EIYA 1KU2A 5JT4A 4EKWA 1ST6A 3W2WA 1RMVA 4C3EA 2WVNA 1NLXA 2IYLD 4O6NA 2PX0A 4Q5SF 3UGPA 4H4KC 4CS9A 2PFDA 2Y3BA 2V3CC 4J32B 1RJ9A 2OU6A 3U8PA 4HFFB 1ZHXA 3ZTMA 1Q0KA 4DVYP 1ZZPA 2CNWA 2B0JA 4JKVA 3UGOA 3LS1A 3UMKA 1U89A 4KNWA 4CDVA 5JS5A 3ABKC 1RXQA 1R5ID 3NG1A 4C3DA 2XLDA 2XLMA 3AG4C 3GEHA 4QDLA 1QSPA 2CNWD 2XLVA 2HKVA 3ZTZA 2V26A 3W8IA 1OKKA 3PCVA 2HSQA 2FFHA 4HFKB 4G78A 2HS5A 4FX5A 4MVOA 3ZG1A 3C8ZA 1NSGB 3GM1A 1SR2A 2DYSC 2R9RB 1NFNA 4BJ5A 1AUEA 4XWJA 4E0HA 5DS5A 3EFOA 4HE8D 1JRAA 1PD0A 4LERA 2XLOA 1PD1A 2P6VA 1I5NA 2A6EF 4DVZA 1IZMA 1TKNA 1HE9A 2XLWA 1R4TA 2XM4A 3SP1A 4YT4A 2CGEA 4FESA 3C8GA 1ZW3A 3DKAA 4R32A 5L0JA 4U9EA 3NMJA 2R7SA 4N6CA 3SEOA 2H7VC 3U9JA 1JOGA 2PP4A 1M57C 2YKZA 2R7UA 2HZ8A 2L6FA 3M15A 4MQ9F 3EGXA 2IXOA 2OG2A 4EHPA 1O3UA 4XLNF 1SMYF 3K1HA 1SZIA 3MBGA 3KKBA 2M4EA 3LESA 4XPXA 5E33A 1O5HA 3RF3A 1QKRA 1MNEA 4CJGA 4EUKB 2OJED 1OCOC 2EPMX 5AC5A 2LIGA 1V54C 4U5CE 1PV3A 5L0HA 3R7CA 3DAFA 4AX2A 5JSLA 4K0DA 4P6IC 4PJLA 3ZQYA 4XEKA 2WB7A 3DZAA 3RYLA 3I5QA 3VM6A 1OCZC 3AOUA 5COGA 2FAPB 2HJMA 4BJ1A 2GWWA 3ASNC 4J30B 4U5GA 3C8GD 1LI5A 2LCHA 2YLIA 4YL0A 3BEHA 1WOLA 4LLEA 3S84A 3OEOA 2YHSA 2R7WA 3QTHA 2GAQA 4GQHA 4LLCA 1KTMA 2R02A 3AQBA 2A68F 3GM3A 3B9QA 3T6GB 1Z23A 2LFFA 3DE8A 4ONSA 1E2XA 3QW0A 4F4BA 2VCBA 1XWJA 3LEVA 3QVZA 5A6BD 5L0CA 2MWQA 4OIQF 2CYDA 2Q4FA 4RDAA 3SXZA 4BG0A 4CSAA 4JJGA 3JSEO 1FNTc 4A2NB 2HJ3A 3Q6NA 1JAFA 1VOMA 5KYNA 1TWCA 1VYKA 2Q9AA 2J8WA 3B71A 1RCPA 4OD4A 4NC3A 2HMQA 4PACA 4DJ9A 3C63A 3DXJF 4IRUA 3ZQVA 1HE1A 3PDMP 4DRIB 1YA9A 4JTDB 4NTAA 4U5HA 1EI7A 2RD9A 3C18A 3L8JA 3MX3A 2GFHA 3FVYA 1LPEA 2VASA 2WZFA 4BJ5C 1IW7F 3MYFA 3B29A 5E3CA 3M1CB 4K1OA 5JVEA 2KJGA 5IY5C 3EG9B 2Y3DA 4PJNA 3ZC4A 4CJOA 3EHMA 1D0YA 1SF8A 1VMAA 1ZHZA 2W4MA 5DQZA 5A6BA 1Z63A 5D91A 4C3BA 3LNRA 2EINC 2KC3A 2LK4A 1D1CA 2KW3C 2VH3A 4NY3A 2I15A 3FOPA 2A1DD 2EPOA 3LLIA 3K6BA 2AWCA 1Z5ZA 5A6JA 3ECSA 4PJJA 3M4CA 3EJNA 4PK4A 5TJ5E 1Q0FA 1Z6AA 2EIJC 2J9WA 3ABMC 4O79A 4W8PA 4IGGA 2MYSA 3ITFA 3GANA 2FGYA 3FAJA 4DBQA 4UDVA 1LE4A 2GA0A 5COMA 1I4YA 4IAOA 2J9BA 1LVKA 4I1OB 2XXAB 4BJTA 1ORSC 2IXMA 2L6GA 2LQGA 2XLHA 3LS0A 3SZRA 1CGME 4FWVA 4O6MA 1OW8A 1M6TA 3HNJA 1GQAA 3N2ZB 4PFPA 3NMKA 3US6A 3NKDA 3FMSA 3RIPA 2P0NA 3W4YA 4E7SA 5DQTA 3CAXA 2BE5F 4BEMJ 2PNOA 4H54A 3V5ZA 4BJ6A 2EPKX 4LACB 1ZHYA 1J8YF 4JC7A 2ZXPA 3SXYA 1YZAA 1O87A 3SXKA 5KYYB 3L34A 4MTFA 3RW0A 3DM5A 3E70C 3EGXB 2TMVP 2WZLA 3U3BA 1RKEB 3EHNA 4CDYA 3DI5A 1BR1A 1M2VB 2NUTB 2OOCA 3NMIA 3ZVRA 2J7PA 2JD3A 3ZSUA 4YWQA 2J0WA 3EQLF 3UMIA 4DBRA 3K33A 4CBEA 2KYHA 4MVMA 2QUPA 4CS9C 3EPVA 3CSKA 1H9GA 2IXPA 3S28A 1EKYA 2DYRC 3FHDA 4WABA 4QI0A 4EBKA 4JE9A 3M79A 4YK5A 3JT1A 4YL1A 2DGJA 1FMVA 1PCXA 1VK5A 3DWWA 3E9VA 2HMZA 2KQ9A 1MNDA 3GM2A 2ICWG 3CEXA 4KNVA 4MS2A 3I5PA 3A11A 2QE9A 2QTVA 3ASOC 3H65A 3WAQA 4G7ZF 3B0VC 3Q6MA 2H7BA 3HNIA 2A69F 1S7ZA 1G4WR 3GEIA 4ER9A 2A0UA 3UNGC 1ZU4A 2HV7A 3JZ0A 4P9TA 2R7OA 3F47A 3S29A 3LAYA 1HY5A 1ZHTA 3C7JA 2J9UA 3JRTA 4I1MA 1T9KA 1WATA 3FOOA 1E84A 3GWLA 2QLAA 4BJ6C 1T5OA 5DVWA 3EZIA 1G5ZA 1YDIA 4Q4ZF 2Y69C 3AJMA 1S05A 3ATPA 2VCCA 2UUIA 1MMGA 2NUPB 3NYMA 1Q0GA 2AP3A 5AC4A 2EIKC 1LS1A 4QI2A 1D0XA 1K04A 4MTOA 1T6IA 5JRAA 5HSWA 2HFIA 2XLEA 4N06A 4N4WA 4BEJA
chains in the Genus database with same CATH topology
2B0HA 2X0CA 2GDCA 3S90A 1U6HA 1RKEA 4E17A 2IBFA 1DOVA 1RKCA 5L0JA 1ZW3A 4PR9A 1SYQA 3TJ6A 1U89A 1TR2A 2GWWA 3MYIA 4DJ9A 4W8PA 1RKEB 4E18A 4IGGA 1H6GA 4P9TA 1L7CA 3H2UA 1DOWA 3ZDLA 5L0IA 1T01A 5L0FA 4EHPA 1ZW2A 2LQGA 2HSQA 3TJ5A 3VF0A 3T6GB 1YDIA 3RF3A 4ONSA 5L0DA 1QKRA 4K1OA 5FZTA 1XWJA 2L7AA 5L0CA 1ST6A 3H2VA 1ZVZA 5L0HA 5L0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0H A;  2X0C A;  2GDC A;  3S90 A;  1U6H A;  1RKE A;  4E17 A;  2IBF A;  1DOV A;  1RKC A;  5L0J A;  1ZW3 A;  4PR9 A;  1SYQ A;  3TJ6 A;  1U89 A;  1TR2 A;  2GWW A;  3MYI A;  4DJ9 A;  4W8P A;  1RKE B;  4E18 A;  4IGG A;  1H6G A;  4P9T A;  1L7C A;  3H2U A;  1DOW A;  3ZDL A;  5L0I A;  1T01 A;  5L0F A;  4EHP A;  1ZW2 A;  2LQG A;  2HSQ A;  3TJ5 A;  3VF0 A;  3T6G B;  1YDI A;  3RF3 A;  4ONS A;  5L0D A;  1QKR A;  4K1O A;  5FZT A;  1XWJ A;  2L7A A;  5L0C A;  1ST6 A;  3H2V A;  1ZVZ A;  5L0H A;  5L0G A; 
#chains in the Genus database with same CATH topology
 3RKO F;  2B0H A;  3K1I C;  2Y3G A;  2YLD A;  3TUL A;  1U6H A;  3ZIB A;  4E17 A;  5DLJ A;  3OA1 A;  1FMW A;  4U9D A;  4MVS A;  2XL8 A;  3AGU A;  5BQI A;  2YRF A;  4CS7 A;  4PR9 A;  1MMN A;  2L9J A;  2YVK A;  3DM9 B;  1NG1 A;  5T3W A;  2JX0 A;  5B3S C;  1EQ1 A;  4JVS A;  2OJQ A;  3SXM A;  1ZHW A;  2Q00 A;  3N24 A;  4OD5 A;  3S9O A;  4U5F E;  4YL3 A;  2IXN A;  5HV9 A;  1VYI A;  1G4U S;  1AVO B;  1DOW A;  1LI7 A;  4ULV A;  3DD7 A;  1D1B A;  3QMK A;  2Q7R A;  1F1M A;  1CPQ A;  4MVZ A;  1MMA A;  5CI8 A;  5JP7 A;  3NDB B;  1ORY A;  1MQV A;  2YQY A;  3HTK C;  4YN0 B;  4WGY A;  2CCY A;  5KYX B;  2YL7 A;  3HNK A;  2QNL A;  4J7T A;  4E0I A;  3DJU B;  2ASR A;  4MVQ A;  3IQC A;  4RD9 A;  3SYN A;  4N6H A;  1Y4C A;  2HV6 A;  3KPH A;  3UMH A;  3EH1 A;  2Y39 A;  4X0R A;  2C03 A;  2Q9B A;  1SYQ A;  2KSF A;  2OKU A;  4ZLD A;  1JMW A;  2L6H A;  4HEA J;  5BQG A;  3O10 A;  2AWY A;  3RVY A;  2Q3T A;  4CX9 A;  5BQH A;  4IJJ A;  3RFY A;  2DB4 A;  4JTC B;  4EBB A;  4DRJ B;  1E85 A;  5T1D B;  1APC A;  2BC5 A;  1FR0 A;  1W2W A;  1T6Q A;  1ZYR F;  2KGO A;  4M63 A;  1LM3 B;  2Z15 A;  4MVU A;  5E2Q A;  3SNH A;  2CW0 F;  5D92 A;  1JPJ A;  3QVY A;  2NSG A;  5EGY A;  3U3F A;  5KYY A;  4C7O A;  1M56 C;  4XPY A;  3N0T A;  3LEO A;  1M2V A;  2NUT A;  4O6Y A;  2VC9 A;  5B3I A;  5L0G A;  4AE4 B;  3JYH A;  1C17 M;  3PMR A;  1NU7 D;  5EK0 A;  4DXW A;  2OEV A;  2MHR A;  3VRC A;  4XTK A;  2CDQ A;  4DRH B;  3EGD B;  4XQ1 A;  3RQE A;  2NUP A;  4P9F A;  3VAY A;  1WGW A;  1OCC C;  3O55 A;  2OCC C;  5KYU B;  1TFO B;  2HUJ A;  3CZ6 A;  3GOR A;  3T6B A;  2A6H F;  3LJB A;  3QZC A;  5EHH A;  3GWN A;  1V74 B;  3GEE A;  2R7X A;  3V7O A;  2OQM A;  3K66 A;  1Z3I X;  3G4X A;  3AQC A;  5FZT A;  3UR3 C;  1OKK D;  2G62 A;  2NPU A;  1WTY A;  1B68 A;  3RQF A;  1RJ9 B;  3H2V A;  1H9T A;  3KYI A;  4XEF A;  1FFH A;  3JYY A;  1TFK B;  4NTB A;  1N1C A;  1NFO A;  4A4A A;  4I3M A;  2VCA A;  1WN0 A;  3HKK A;  3EG9 A;  1VLT A;  2LD6 A;  4I44 A;  3L0I A;  2LP4 A;  3RH3 A;  2EPL X;  3JCU Q;  1FAP B;  3G50 A;  3LLK A;  2EIM C;  3QW1 A;  5T3T A;  4MVR A;  4D4N A;  1TR2 A;  2R03 A;  3I4U A;  4KBL A;  4JIO A;  1TWA A;  5DS6 A;  3U2L A;  1YJG A;  2R7V A;  1L3P A;  2P1A A;  2I8B A;  3R2P A;  5FCL A;  3T4R A;  1H6G A;  4W8K A;  4MND A;  3H2U A;  4JJF A;  2ZD9 A;  3C62 A;  1TQG A;  1ZU5 A;  1D0Z A;  3AGT A;  3M4B A;  4PFO A;  3DMD A;  3PHF 2;  5A69 A;  2R7T A;  2H8A A;  2M64 A;  1C03 A;  2JPU A;  2WVO A;  2YL3 A;  3POV A;  5L0D A;  3MLG A;  1VLS A;  4MW8 A;  5F5F A;  4CS8 C;  4XLP F;  2RSE B;  3C8G B;  4CS8 A;  5BUO A;  3EZH A;  1V55 C;  1NU9 C;  3IQ5 A;  5K0I A;  4DOZ A;  4LDQ A;  2ZPA A;  3T9O A;  2IBF A;  1HMO A;  1DOV A;  1NZE A;  1E83 A;  3IQ6 A;  1A41 A;  3KH2 A;  1ORJ A;  2LFD A;  2Q9C A;  2C04 A;  3J06 A;  2IM8 A;  4C7O B;  1YYJ A;  4MTG A;  3V5X A;  3MYI A;  1OQC A;  4JTA B;  3W8H A;  1A0B A;  3JRM O;  2NSF A;  4LDK A;  2ZXW C;  4OIR F;  3RVZ A;  1HMD A;  3WHN A;  4EWC A;  3U5S A;  4U5D E;  2HSB A;  2L81 A;  1T01 A;  1LS4 A;  4G0H A;  4FAP B;  5CIV A;  5KYX A;  4EBJ A;  1ZW2 A;  3X1O A;  3O39 A;  4G7O F;  3AG3 C;  4AL0 A;  4JCZ A;  1HW2 A;  4G7H F;  1I4Z A;  1LE2 A;  2UUH A;  2R7Q A;  1OR2 A;  5F28 E;  5DS4 A;  4IAQ A;  3LNM B;  3V5Y A;  4D4X A;  2XS8 A;  3W2V A;  4ZLC A;  5A6K A;  2R05 A;  2R7R A;  1KNY A;  2GDC A;  1LKX A;  4NTF A;  4YJW A;  3FDQ A;  1AEP A;  1OW7 A;  1QVX A;  2IOQ A;  3FAP B;  3OWT A;  3CQZ A;  4GYT A;  1YZC A;  3G4Z A;  4J7Y A;  2J7P D;  5A6A A;  1XZQ A;  4JZA A;  4OIP F;  2O9X A;  1A7E A;  1CPR A;  1OW6 A;  3IPM O;  4Z9J A;  1D1A A;  2PF4 E;  3X2Q C;  1L7C A;  2KK1 A;  1TWG A;  1WAS A;  2J0X A;  4AE4 A;  4U5E E;  4JCH A;  5L0I A;  3F46 A;  2AVK A;  3VYW A;  1FTS A;  3NYL A;  1YYX A;  5L3V A;  2XSE A;  2ZXR A;  1BZ4 A;  2DI3 A;  2G3K A;  3EGD A;  2WVQ A;  3HLZ A;  4NQF A;  2L7A A;  1LIH A;  1T6U A;  3S27 A;  1JPN A;  3Q7G A;  4NCQ A;  2EIL C;  2YWA A;  3ZWI A;  4YT2 A;  3NYJ A;  1NBB A;  1Z7Q c;  1CGN A;  2XS1 A;  5B1A C;  1UFB A;  3U9M A;  4ANJ A;  3HNL A;  4E7Z A;  5KYW B;  2G3V A;  1A7V A;  2A0B A;  1OXK A;  2AU5 A;  2YLG A;  2NG1 A;  2EPN A;  3EFO B;  1RKC A;  3KL4 A;  4WGZ A;  2J45 A;  5JLI A;  4K7B A;  3JSZ A;  1BBH A;  3TQO A;  2WL8 A;  2W45 A;  2D5R B;  3NRH A;  4MW3 A;  3TOL A;  3K1I A;  2KNH A;  4GEH A;  2J46 A;  2WZG A;  4JW1 A;  1J8M F;  4OIO F;  3AG2 C;  1YLM A;  4Z9I A;  4IB4 A;  3T6J A;  2Y3H A;  1JR8 A;  3LUT B;  1UG7 A;  3VF0 A;  2XRH A;  3L1M A;  4XEV A;  1EA8 A;  4YT8 A;  4WJ0 A;  1YAU O;  2YL0 A;  4L6R A;  4RBN A;  2X51 A;  3FXH A;  3K7D A;  1Q0M A;  4U5B E;  5COF A;  4BPM A;  2YEV A;  1ZVZ A;  4CSA C;  2PBE A;  3NKE A;  4AK9 A;  1QQ3 A;  4OIN F;  4IWB A;  1BDJ B;  1G8X A;  3MFN A;  4JEA A;  1QPU A;  3O6X A;  4O7G A;  4ULW A;  4YT5 A;  5E3A A;  3S90 A;  3RQG A;  4KI2 A;  1WWP A;  4CIP A;  3L8I A;  3AG1 C;  1GGQ A;  5GPG B;  2YZS A;  3U0C A;  2PX3 A;  2YL1 A;  3TJ6 A;  1GS9 A;  1H7I A;  1M2O A;  2OEX A;  2XXA A;  2P7V A;  2LSE A;  1QZX A;  1C02 A;  1U0B B;  5CI9 A;  4B6I A;  4CDA A;  4AL1 A;  1Q0D A;  2XL6 A;  3TD7 A;  3ZDL A;  1QLE C;  4KC9 A;  3ABL C;  2BL2 A;  4PJM A;  2F22 A;  2R25 A;  2W4B A;  4XPW A;  3TJ5 A;  3DE9 A;  2XM0 A;  3DAG A;  3GOD A;  3KMI A;  1FFT C;  4Z9H A;  5JUA A;  1K40 A;  3B0P A;  1A7D A;  1VB5 A;  5F5H A;  1XZP A;  3WOD F;  1Y6D A;  3KYJ A;  1GM5 A;  1VTM P;  3Q7L A;  4JRZ A;  3EH2 A;  3BRJ A;  2X0C A;  2QY9 A;  1RKE A;  1BR4 A;  2W9Y A;  1E86 A;  3IHU A;  2D4U A;  3JTL O;  1K05 A;  4JUR I;  1TWH A;  2ETS A;  2ZXO A;  3HJC A;  5L3Q A;  2J9V A;  3WG7 C;  256B A;  3IQT A;  1OXB A;  4Q7C A;  3TOM A;  1MMD A;  4E18 A;  1HW1 A;  4LDR A;  5AGF A;  3U2M A;  2XL4 A;  5KYW A;  1V4A A;  1CGO A;  1OCR C;  1YVI A;  1YAR O;  2VB6 A;  4JEB A;  1YA7 O;  3TK0 A;  3U8V A;  4CIH A;  2H7O A;  2P61 A;  2E87 A;  3A9C A;  3DJN B;  4IAR A;  1BR2 A;  5B1B C;  5L0F A;  3B0U X;  5KYU A;  1OR3 A;  3S0X A;  3IEE A;  4EIY A;  1KU2 A;  5JT4 A;  4EKW A;  1ST6 A;  3W2W A;  1RMV A;  4C3E A;  2WVN A;  1NLX A;  2IYL D;  4O6N A;  2PX0 A;  4Q5S F;  3UGP A;  4H4K C;  4CS9 A;  2PFD A;  2Y3B A;  2V3C C;  4J32 B;  1RJ9 A;  2OU6 A;  3U8P A;  4HFF B;  1ZHX A;  3ZTM A;  1Q0K A;  4DVY P;  1ZZP A;  2CNW A;  2B0J A;  4JKV A;  3UGO A;  3LS1 A;  3UMK A;  1U89 A;  4KNW A;  4CDV A;  5JS5 A;  3ABK C;  1RXQ A;  1R5I D;  3NG1 A;  4C3D A;  2XLD A;  2XLM A;  3AG4 C;  3GEH A;  4QDL A;  1QSP A;  2CNW D;  2XLV A;  2HKV A;  3ZTZ A;  2V26 A;  3W8I A;  1OKK A;  3PCV A;  2HSQ A;  2FFH A;  4HFK B;  4G78 A;  2HS5 A;  4FX5 A;  4MVO A;  3ZG1 A;  3C8Z A;  1NSG B;  3GM1 A;  1SR2 A;  2DYS C;  2R9R B;  1NFN A;  4BJ5 A;  1AUE A;  4XWJ A;  4E0H A;  5DS5 A;  3EFO A;  4HE8 D;  1JRA A;  1PD0 A;  4LER A;  2XLO A;  1PD1 A;  2P6V A;  1I5N A;  2A6E F;  4DVZ A;  1IZM A;  1TKN A;  1HE9 A;  2XLW A;  1R4T A;  2XM4 A;  3SP1 A;  4YT4 A;  2CGE A;  4FES A;  3C8G A;  1ZW3 A;  3DKA A;  4R32 A;  5L0J A;  4U9E A;  3NMJ A;  2R7S A;  4N6C A;  3SEO A;  2H7V C;  3U9J A;  1JOG A;  2PP4 A;  1M57 C;  2YKZ A;  2R7U A;  2HZ8 A;  2L6F A;  3M15 A;  4MQ9 F;  3EGX A;  2IXO A;  2OG2 A;  4EHP A;  1O3U A;  4XLN F;  1SMY F;  3K1H A;  1SZI A;  3MBG A;  3KKB A;  2M4E A;  3LES A;  4XPX A;  5E33 A;  1O5H A;  3RF3 A;  1QKR A;  1MNE A;  4CJG A;  4EUK B;  2OJE D;  1OCO C;  2EPM X;  5AC5 A;  2LIG A;  1V54 C;  4U5C E;  1PV3 A;  5L0H A;  3R7C A;  3DAF A;  4AX2 A;  5JSL A;  4K0D A;  4P6I C;  4PJL A;  3ZQY A;  4XEK A;  2WB7 A;  3DZA A;  3RYL A;  3I5Q A;  3VM6 A;  1OCZ C;  3AOU A;  5COG A;  2FAP B;  2HJM A;  4BJ1 A;  2GWW A;  3ASN C;  4J30 B;  4U5G A;  3C8G D;  1LI5 A;  2LCH A;  2YLI A;  4YL0 A;  3BEH A;  1WOL A;  4LLE A;  3S84 A;  3OEO A;  2YHS A;  2R7W A;  3QTH A;  2GAQ A;  4GQH A;  4LLC A;  1KTM A;  2R02 A;  3AQB A;  2A68 F;  3GM3 A;  3B9Q A;  3T6G B;  1Z23 A;  2LFF A;  3DE8 A;  4ONS A;  1E2X A;  3QW0 A;  4F4B A;  2VCB A;  1XWJ A;  3LEV A;  3QVZ A;  5A6B D;  5L0C A;  2MWQ A;  4OIQ F;  2CYD A;  2Q4F A;  4RDA A;  3SXZ A;  4BG0 A;  4CSA A;  4JJG A;  3JSE O;  1FNT c;  4A2N B;  2HJ3 A;  3Q6N A;  1JAF A;  1VOM A;  5KYN A;  1TWC A;  1VYK A;  2Q9A A;  2J8W A;  3B71 A;  1RCP A;  4OD4 A;  4NC3 A;  2HMQ A;  4PAC A;  4DJ9 A;  3C63 A;  3DXJ F;  4IRU A;  3ZQV A;  1HE1 A;  3PDM P;  4DRI B;  1YA9 A;  4JTD B;  4NTA A;  4U5H A;  1EI7 A;  2RD9 A;  3C18 A;  3L8J A;  3MX3 A;  2GFH A;  3FVY A;  1LPE A;  2VAS A;  2WZF A;  4BJ5 C;  1IW7 F;  3MYF A;  3B29 A;  5E3C A;  3M1C B;  4K1O A;  5JVE A;  2KJG A;  5IY5 C;  3EG9 B;  2Y3D A;  4PJN A;  3ZC4 A;  4CJO A;  3EHM A;  1D0Y A;  1SF8 A;  1VMA A;  1ZHZ A;  2W4M A;  5DQZ A;  5A6B A;  1Z63 A;  5D91 A;  4C3B A;  3LNR A;  2EIN C;  2KC3 A;  2LK4 A;  1D1C A;  2KW3 C;  2VH3 A;  4NY3 A;  2I15 A;  3FOP A;  2A1D D;  2EPO A;  3LLI A;  3K6B A;  2AWC A;  1Z5Z A;  5A6J A;  3ECS A;  4PJJ A;  3M4C A;  3EJN A;  4PK4 A;  5TJ5 E;  1Q0F A;  1Z6A A;  2EIJ C;  2J9W A;  3ABM C;  4O79 A;  4W8P A;  4IGG A;  2MYS A;  3ITF A;  3GAN A;  2FGY A;  3FAJ A;  4DBQ A;  4UDV A;  1LE4 A;  2GA0 A;  5COM A;  1I4Y A;  4IAO A;  2J9B A;  1LVK A;  4I1O B;  2XXA B;  4BJT A;  1ORS C;  2IXM A;  2L6G A;  2LQG A;  2XLH A;  3LS0 A;  3SZR A;  1CGM E;  4FWV A;  4O6M A;  1OW8 A;  1M6T A;  3HNJ A;  1GQA A;  3N2Z B;  4PFP A;  3NMK A;  3US6 A;  3NKD A;  3FMS A;  3RIP A;  2P0N A;  3W4Y A;  4E7S A;  5DQT A;  3CAX A;  2BE5 F;  4BEM J;  2PNO A;  4H54 A;  3V5Z A;  4BJ6 A;  2EPK X;  4LAC B;  1ZHY A;  1J8Y F;  4JC7 A;  2ZXP A;  3SXY A;  1YZA A;  1O87 A;  3SXK A;  5KYY B;  3L34 A;  4MTF A;  3RW0 A;  3DM5 A;  3E70 C;  3EGX B;  2TMV P;  2WZL A;  3U3B A;  1RKE B;  3EHN A;  4CDY A;  3DI5 A;  1BR1 A;  1M2V B;  2NUT B;  2OOC A;  3NMI A;  3ZVR A;  2J7P A;  2JD3 A;  3ZSU A;  4YWQ A;  2J0W A;  3EQL F;  3UMI A;  4DBR A;  3K33 A;  4CBE A;  2KYH A;  4MVM A;  2QUP A;  4CS9 C;  3EPV A;  3CSK A;  1H9G A;  2IXP A;  3S28 A;  1EKY A;  2DYR C;  3FHD A;  4WAB A;  4QI0 A;  4EBK A;  4JE9 A;  3M79 A;  4YK5 A;  3JT1 A;  4YL1 A;  2DGJ A;  1FMV A;  1PCX A;  1VK5 A;  3DWW A;  3E9V A;  2HMZ A;  2KQ9 A;  1MND A;  3GM2 A;  2ICW G;  3CEX A;  4KNV A;  4MS2 A;  3I5P A;  3A11 A;  2QE9 A;  2QTV A;  3ASO C;  3H65 A;  3WAQ A;  4G7Z F;  3B0V C;  3Q6M A;  2H7B A;  3HNI A;  2A69 F;  1S7Z A;  1G4W R;  3GEI A;  4ER9 A;  2A0U A;  3UNG C;  1ZU4 A;  2HV7 A;  3JZ0 A;  4P9T A;  2R7O A;  3F47 A;  3S29 A;  3LAY A;  1HY5 A;  1ZHT A;  3C7J A;  2J9U A;  3JRT A;  4I1M A;  1T9K A;  1WAT A;  3FOO A;  1E84 A;  3GWL A;  2QLA A;  4BJ6 C;  1T5O A;  5DVW A;  3EZI A;  1G5Z A;  1YDI A;  4Q4Z F;  2Y69 C;  3AJM A;  1S05 A;  3ATP A;  2VCC A;  2UUI A;  1MMG A;  2NUP B;  3NYM A;  1Q0G A;  2AP3 A;  5AC4 A;  2EIK C;  1LS1 A;  4QI2 A;  1D0X A;  1K04 A;  4MTO A;  1T6I A;  5JRA A;  5HSW A;  2HFI A;  2XLE A;  4N06 A;  4N4W A;  4BEJ A; 
#chains in the Genus database with same CATH homology
 2B0H A;  2X0C A;  2GDC A;  3S90 A;  1U6H A;  1RKE A;  4E17 A;  2IBF A;  1DOV A;  1RKC A;  5L0J A;  1ZW3 A;  4PR9 A;  1SYQ A;  3TJ6 A;  1U89 A;  1TR2 A;  2GWW A;  3MYI A;  4DJ9 A;  4W8P A;  1RKE B;  4E18 A;  4IGG A;  1H6G A;  4P9T A;  1L7C A;  3H2U A;  1DOW A;  3ZDL A;  5L0I A;  1T01 A;  5L0F A;  4EHP A;  1ZW2 A;  2LQG A;  2HSQ A;  3TJ5 A;  3VF0 A;  3T6G B;  1YDI A;  3RF3 A;  4ONS A;  5L0D A;  1QKR A;  4K1O A;  5FZT A;  1XWJ A;  2L7A A;  5L0C A;  1ST6 A;  3H2V A;  1ZVZ A;  5L0H A;  5L0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...