2IBFA

Human vinculin's head domain (vh1, residues 1-258) in complex with two vinculin binding sites of shigella flexneri's ipaa (residues 565-587)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin binding in its closed conformation by a helix addition mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 107
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2006-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2ibfA01
3RF3A 5L0IA 4IGGA 2GDCA 2HSQA 1SYQA 4K1OA 4E18A 2X0CA 1XWJA 3H2UA 4PR9A 1U6HA 5FZTA 1QKRA 1ST6A 5L0FA 3TJ6A 1ZW3A 4W8PA 5L0CA 1H6GA 2L7AA 1L7CA 1DOVA 1RKEB 2IBFA 1DOWA 3T6GB 5L0HA 5L0DA 2GWWA 2B0HA 1TR2A 1ZW2A 3S90A 5L0JA 1RKEA 2LQGA 3MYIA 4DJ9A 4P9TA 4E17A 5L0GA 3H2VA 1T01A 4ONSA 1ZVZA 4EHPA 1YDIA 3VF0A 1RKCA 1U89A 3TJ5A 3ZDLA
chains in the Genus database with same CATH superfamily
3NKDA 5KYWA 5DLJA 3RYLA 4YN0B 5K0IA 1BBHA 1Q0MA 2J0XA 1NFNA 3ASOC 3LAYA 2KJGA 3AQBA 5T3WA 1BZ4A 1YA7O 2XL6A 4CDAA 2IXPA 1TWCA 2OCCC 3DXJF 3ZG1A 1JMWA 2KGOA 3NRHA 1BR4A 2NPUA 4XEKA 5DVWA 3FAPB 1B68A 1T9KA 4Z9JA 3JZ0A 3ZC4A 2Q9CA 2BL2A 2LQGA 2OJQA 1YYJA 2IXOA 3EGXB 3G4XA 3OEOA 3TOLA 2EINC 2HFIA 2ZXRA 3HLZA 5KYNA 2R9RB 3ASNC 2PP4A 3QZCA 4WABA 1RKCA 4E17A 3GM1A 4J32B 2KC3A 3DAGA 3OWTA 2L9JA 3IQ6A 3SP1A 2Y3BA 1Q0FA 3W8IA 1I4ZA 4JJFA 1KTMA 4MQ9F 5F5FA 1N1CA 3L0IA 2LK4A 5BQHA 4CSAA 1RJ9B 2M4EA 1WWPA 2DI3A 4U5HA 2YQYA 2AWYA 1DOVA 1RKEB 3GM3A 4YL3A 3U9JA 4BG0A 2FGYA 1CPRA 2IM8A 5KYUB 3X1OA 4D4NA 2E87A 4I44A 1APCA 3HNLA 3C7JA 3RQGA 1TFKB 4P9FA 1J8YF 2Q7RA 2PFDA 4FWVA 5CIVA 4YT2A 3ZWIA 3O39A 3EFOA 1M56C 4H4KC 2ZPAA 3S84A 4ONSA 4R32A 3UR3C 3ZQYA 3EHNA 3EZIA 3U8PA 3EH2A 3IQ5A 3NYJA 2KYHA 2W4BA 4LDQA 5L0IA 1OCRC 3K1IA 2OQMA 2VB6A 1LE2A 5GPGB 2WZFA 1Z7Qc 1XZPA 1T6IA 2P1AA 1D0ZA 1VK5A 2WL8A 3V5XA 5B3IA 4MW3A 1JRAA 5EK0A 3ABKC 4U5CE 3HNIA 2JD3A 4CDYA 4CS9C 256BA 3GANA 3W8HA 3DKAA 5L0HA 2DYRC 2GWWA 4MNDA 4YL0A 3FDQA 2JX0A 2HKVA 1OCZC 3DI5A 1R4TA 2XLOA 4ULVA 5AGFA 5BQGA 3PHF2 3T6JA 4MTFA 4DRIB 2YVKA 2HJ3A 5AC5A 1PD1A 2P6VA 2J9UA 3FOOA 1VOMA 3ATPA 1WN0A 3RQFA 5B1BC 1OQCA 1WTYA 3EGDB 3MFNA 3RF3A 2HSQA 3Q6NA 5L3VA 3B0PA 5D92A 2X51A 4BJ5A 1HMDA 2Q9BA 2X0CA 1EI7A 1YJGA 4WJ0A 3U5SA 3GEEA 3U3BA 3SXYA 4PACA 4AL1A 4MVOA 4C3DA 2R7UA 1PV3A 2OG2A 3T4RA 3HNJA 3M1CB 1DOWA 1VB5A 2KQ9A 5KYXA 2A0BA 1RXQA 3TULA 2Q9AA 3PCVA 2XLMA 3MLGA 2D4UA 1LE4A 4HFKB 1EQ1A 1QLEC 1TKNA 3KMIA 2Q00A 4AK9A 1MMNA 4OIPF 4XQ1A 3IHUA 2EPKX 2MYSA 5E3AA 1ZVZA 3WODF 4G7ZF 1YLMA 4G7OF 1J8MF 4XTKA 5FCLA 1MQVA 1MMAA 2D5RB 2EPNA 4CSAC 4MVQA 3U2MA 2HS5A 2I8BA 4LACB 4HE8D 1OXKA 2XSEA 1FFTC 4O7GA 4ZLDA 3FOPA 5COFA 2WVNA 3A11A 3FXHA 3V5YA 2HV7A 2XLDA 3NKEA 3QTHA 5T1DB 5E2QA 2GAQA 3WAQA 4I3MA 4RD9A 3DZAA 2PF4E 3L8IA 4GQHA 2AP3A 1JOGA 3DMDA 2J45A 4JEAA 4CIHA 1ZHWA 2A0UA 2ZXOA 1QQ3A 3ZVRA 4NQFA 1FMVA 2CNWA 3KL4A 5JVEA 4CS7A 2XL4A 4OINF 2IXMA 1ORYA 4OIRF 3M15A 1H9TA 1IZMA 1T01A 3LNRA 4IWBA 4U9EA 1LPEA 1QVXA 1YDIA 2M64A 2R03A 2VCBA 3VF0A 1G4WR 2A6HF 3JCUQ 2NSFA 4MVZA 5EGYA 1SF8A 2AVKA 3FHDA 2PBEA 5E3CA 2OJED 1WOLA 2YL0A 1SYQA 4OIOF 3O6XA 2WB7A 2QE9A 5TJ5E 3VRCA 5JT4A 3H2UA 5A6BA 3ITFA 3SZRA 4HEAJ 3AG4C 4BPMA 2I15A 4MTOA 2CW0F 3KH2A 4XEVA 3C62A 1HW1A 4LDKA 3EQLF 1CGME 1YA9A 3FMSA 4G7HF 4KC9A 2G3VA 3C8GA 2KSFA 4U9DA 2YLIA 2B0HA 2V26A 3RVZA 3VM6A 4OD5A 3GEIA 4DVYP 1OR3A 1NSGB 1O87A 1Q0KA 2C03A 1GQAA 1MNDA 2EIJC 2Y69C 1WGWA 4CX9A 1SZIA 4WGZA 4E7SA 4D4XA 3Q6MA 3RKOF 2EPMX 3F47A 2XLVA 3DE8A 3GM2A 3V7OA 1FFHA 4JW1A 4BJ5C 4YT5A 1YARO 2ZXPA 3W2VA 1E86A 3AGUA 3QW0A 2W4MA 3QVZA 4JTDB 3US6A 4DOZA 1M2OA 2EPLX 3ZIBA 3U3FA 4EBKA 4MS2A 1D1CA 2PNOA 3NMKA 5DS6A 1ST6A 2L6FA 3JRMO 1QSPA 3M79A 4P6IC 4WGYA 5F28E 2VASA 2EIMC 2L7AA 3JYYA 4L6RA 2XXAA 2IBFA 4OIQF 2MWQA 1HMOA 2YEVA 1LS1A 1BR1A 2R7SA 3EJNA 3AJMA 3BRJA 3RFYA 2FFHA 4JJGA 3R7CA 3UNGC 1TWGA 1Z23A 4AX2A 3S90A 2C04A 4P9TA 1A41A 5A6AA 3AG2C 4CDVA 5KYYA 4N4WA 3LLIA 5A6JA 4C7OA 2H7VC 3UGOA 2NUPB 3EG9A 3UMKA 4YWQA 1YAUO 3B71A 1W2WA 3F46A 2HSBA 3RIPA 3CZ6A 4YL1A 3SXMA 3J06A 3E9VA 2AWCA 4ZLCA 1E85A 3NMJA 5A6KA 1QPUA 5CI8A 2AU5A 4BEJA 1VLSA 3M4CA 2XRHA 3ZSUA 3V5ZA 5FZTA 3PMRA 3NYLA 4Z9IA 3POVA 1OKKA 4C3BA 1Z6AA 4QI0A 1L7CA 4MVSA 2NUTB 4PJNA 1OW7A 4A4AA 2YKZA 3JRTA 2EILC 5JLIA 5JSLA 2EIKC 3OA1A 4IARA 4NY3A 1Y4CA 4JZAA 1GS9A 3HNKA 4MTGA 5F5HA 1D1AA 3B9QA 4EIYA 4PK4A 4FAPB 5L0GA 3UGPA 4AL0A 5KYWB 1ZU5A 1O3UA 1MNEA 1OXBA 5A6BD 1JPNA 5BUOA 5HSWA 2WVQA 4EUKB 4JIOA 3HJCA 2J9WA 4A2NB 4IB4A 4JTAB 3T6BA 1VYIA 4IGGA 2A6EF 2L6HA 4XPWA 2IOQA 2QLAA 4K7BA 3C8GD 1C17M 2A1DD 3DM5A 2IXNA 1HE1A 1YZCA 3C8GB 3LEOA 2ZXWC 5BQIA 1ZW3A 2J7PA 3K66A 3ABLC 4YT4A 4FESA 4JKVA 2LSEA 4U5GA 3B0UX 4PJMA 3GEHA 1K05A 2Y3DA 3K6BA 4IJJA 3S9OA 4DRJB 1H9GA 5EHHA 4NC3A 4DJ9A 3GODA 3S29A 1FTSA 1H7IA 1YVIA 4RBNA 3LJBA 5DQTA 2YZSA 1FMWA 4HFFB 2R7WA 3ZTMA 4LDRA 1TQGA 4XPYA 1UFBA 3A9CA 3EGXA 3H65A 2H7OA 4IAOA 1M2VA 1LS4A 4KNVA 2ETSA 3C18A 4KI2A 3L8JA 1S7ZA 1JPJA 3JSZA 1ORSC 1VLTA 5B1AC 1AUEA 2GDCA 1NFOA 2UUHA 4I1OB 4JEBA 1LVKA 1PCXA 4BJTA 4W8KA 2Y3GA 5E33A 3S27A 1NBBA 5COMA 4PFOA 4KBLA 4X0RA 1BR2A 2YHSA 4W8PA 1LI7A 3CEXA 3TD7A 2PX3A 4E7ZA 1VMAA 2H7BA 4PJJA 3PDMP 4RDAA 1RMVA 3Q7GA 1A7DA 1RJ9A 1V74B 5L0DA 4GEHA 1CGOA 1ZW2A 3GWLA 4XWJA 4G0HA 4LERA 2KW3C 2Q3TA 3EFOB 3CQZA 4XPXA 1RKEA 4C7OB 3SXZA 3SXKA 2XLHA 1V55C 4N6CA 1YYXA 3C8ZA 5KYUA 1GM5A 3JTLO 4CBEA 3SEOA 4DBQA 3QMKA 2XLWA 3NDBB 3K1IC 3IQCA 4CJGA 1EKYA 4JURI 1U89A 3K1HA 1M57C 4Q4ZF 3ZDLA 4Q5SF 2HUJA 1UG7A 4B6IA 2YL1A 3MYFA 3L34A 2L6GA 2XM4A 4AE4A 3U0CA 4K1OA 4E18A 1AVOB 1SR2A 1A7VA 1TWHA 1LM3B 1XWJA 3KPHA 4MVUA 1U6HA 4BEMJ 2HJMA 3N2ZB 4ER9A 1HY5A 1T5OA 3JYHA 5L0CA 1LIHA 2Q4FA 2VCAA 4H54A 1SMYF 3KYIA 4U5EE 3RW0A 3WG7C 2QNLA 3K33A 2EPOA 2P0NA 2CDQA 1L3PA 1G8XA 4JC7A 4MVRA 4CS9A 1K04A 1MMGA 2G62A 2CYDA 1HW2A 2QUPA 1C02A 2R7OA 4Z9HA 1ZZPA 2LFFA 4FX5A 2J8WA 4GYTA 3TK0A 2LFDA 1IW7F 2YRFA 3O10A 2YLGA 3I4UA 2R7TA 2XLEA 2MHRA 2J7PD 4DRHB 2DB4A 1O5HA 5DS5A 1YZAA 3AOUA 4YT8A 5DQZA 1ZHYA 4JVSA 3KKBA 4G78A 1PD0A 3I5QA 1D1BA 3EGDA 2R02A 5L0FA 3TJ6A 3ZQVA 4DXWA 4XEFA 3O55A 4EWCA 3NYMA 5KYXB 3G50A 2HMQA 1Y6DA 1F1MA 4JE9A 3HKKA 2YL3A 2HV6A 3JSEO 4O6YA 4DVZA 2V3CC 1OCCC 4Q7CA 2J0WA 1OW8A 1Z63A 1LI5A 1ORJA 3DWWA 1M2VB 2XS1A 3DAFA 2R05A 3W4YA 3IEEA 3AG1C 1D0YA 1Q0DA 2H8AA 3RVYA 3BEHA 1KNYA 2P7VA 1VYKA 3NG1A 4JCZA 3WHNA 4NTBA 5AC4A 1NU9C 3TJ5A 3G4ZA 2Z15A 3R2PA 4N06A 2HMZA 1CPQA 2Y3HA 3EH1A 4KNWA 2Y39A 3B0VC 4NCQA 5JP7A 4J30B 1ZHZA 1T6UA 3DM9B 2KK1A 4LLCA 4ULWA 1A0BA 2VCCA 3RQEA 3TQOA 4MW8A 1OR2A 2CNWD 4CS8A 1WASA 2GFHA 4F4BA 4N6HA 4JCHA 3LNMB 2UUIA 2KNHA 3LUTB 3U9MA 2P61A 2LD6A 4JTCB 2YWAA 4BJ6A 1C03A 2OEVA 4YJWA 4XLPF 4LLEA 4NTFA 3N24A 4OD4A 3ABMC 5IY5C 4JRZA 1NLXA 1TFOB 3CSKA 4PFPA 5DS4A 3MBGA 2A69F 5JRAA 3Q7LA 2DYSC 3H2VA 3TOMA 3L1MA 3FVYA 2QTVA 2LIGA 3SNHA 4AE4B 3DJNB 4O79A 2F22A 2WZLA 1S05A 3GWNA 3I5PA 3LS1A 2OKUA 3M4BA 4U5BE 4PR9A 1EA8A 4J7TA 3AQCA 1H6GA 4DBRA 3U8VA 3AGTA 2VH3A 2B0JA 3UMIA 3IPMO 4ANJA 1TR2A 1T6QA 2CCYA 1ZHXA 1QZXA 2LCHA 4CJOA 1TWAA 5B3SC 2J46A 3U2LA 5L0JA 2R7XA 4BJ1A 4O6NA 4YK5A 4M63A 1Z5ZA 1G4US 2O9XA 3LEVA 3KYJA 5COGA 4PJLA 2OOCA 2J9VA 1OW6A 1I4YA 1D0XA 1XZQA 2XM0A 2YLDA 3EHMA 3LS0A 1JAFA 3DD7A 3FAJA 2G3KA 1U0BB 4U5DE 4IRUA 1Q0GA 4QI2A 3HTKC 2ASRA 3JT1A 2XXAB 3ZTZA 1GGQA 2ICWG 2BE5F 1QKRA 1V54C 3S0XA 3SYNA 3K7DA 3B29A 4NTAA 5HV9A 1WATA 4E0IA 1A7EA 1V4AA 1OCOC 3T6GB 1JR8A 2CGEA 3CAXA 3W2WA 1G5ZA 3VYWA 4EBJA 2L81A 5CI9A 3E70C 5KYYB 4C3EA 1NZEA 2JPUA 3AG3C 2WZGA 3EG9B 1ZHTA 5T3TA 1K40A 4K0DA 2IYLD 1FAPB 4O6MA 4U5FE 3MX3A 1RCPA 4EBBA 4EKWA 1HE9A 1E2XA 2OU6A 1BDJB 3T9OA 3QVYA 4UDVA 3QW1A 3NMIA 4IAQA 4MVMA 2TMVP 2R7VA 3EZHA 2ZD9A 1NG1A 2XS8A 2R7QA 1FR0A 2NUPA 1OKKD 1ZYRF 2DGJA 2J9BA 2VC9A 4CS8C 4CIPA 5JUAA 3DE9A 1LKXA 5D91A 2R7RA 4I1MA 2W9YA 2NSGA 2R25A 2A68F 4BJ6C 1ZU4A 1VTMP 3ECSA 3IQTA 1E83A 1I5NA 1E84A 5JS5A 3GORA 1R5ID 5L3QA 4QDLA 4XLNF 2RD9A 2PX0A 4J7YA 2LP4A 2WVOA 3C63A 1M6TA 2YL7A 3EPVA 2XL8A 2BC5A 2NG1A 3MYIA 2NUTA 1NU7D 2OEXA 1CGNA 2RSEB 3UMHA 3S28A 3LESA 3DJUB 5A69A 1FNTc 2FAPB 1MMDA 1Z3IX 2W45A 3N0TA 3LLKA 2QY9A 4EHPA 2HZ8A 4E0HA 1KU2A 3VAYA 3X2QC 1AEPA 2GA0A 3RH3A
chains in the Genus database with same CATH topology
3RF3A 5L0IA 4IGGA 2GDCA 2HSQA 1SYQA 4K1OA 4E18A 2X0CA 1XWJA 3H2UA 4PR9A 1U6HA 5FZTA 1QKRA 1ST6A 5L0FA 3TJ6A 1ZW3A 4W8PA 5L0CA 1H6GA 2L7AA 1L7CA 1DOVA 1RKEB 2IBFA 1DOWA 3T6GB 5L0HA 5L0DA 2GWWA 2B0HA 1TR2A 1ZW2A 3S90A 5L0JA 1RKEA 2LQGA 3MYIA 4DJ9A 4P9TA 4E17A 5L0GA 3H2VA 1T01A 4ONSA 1ZVZA 4EHPA 1YDIA 3VF0A 1RKCA 1U89A 3TJ5A 3ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RF3 A;  5L0I A;  4IGG A;  2GDC A;  2HSQ A;  1SYQ A;  4K1O A;  4E18 A;  2X0C A;  1XWJ A;  3H2U A;  4PR9 A;  1U6H A;  5FZT A;  1QKR A;  1ST6 A;  5L0F A;  3TJ6 A;  1ZW3 A;  4W8P A;  5L0C A;  1H6G A;  2L7A A;  1L7C A;  1DOV A;  1RKE B;  2IBF A;  1DOW A;  3T6G B;  5L0H A;  5L0D A;  2GWW A;  2B0H A;  1TR2 A;  1ZW2 A;  3S90 A;  5L0J A;  1RKE A;  2LQG A;  3MYI A;  4DJ9 A;  4P9T A;  4E17 A;  5L0G A;  3H2V A;  1T01 A;  4ONS A;  1ZVZ A;  4EHP A;  1YDI A;  3VF0 A;  1RKC A;  1U89 A;  3TJ5 A;  3ZDL A; 
#chains in the Genus database with same CATH topology
 3NKD A;  5KYW A;  5DLJ A;  3RYL A;  4YN0 B;  5K0I A;  1BBH A;  1Q0M A;  2J0X A;  1NFN A;  3ASO C;  3LAY A;  2KJG A;  3AQB A;  5T3W A;  1BZ4 A;  1YA7 O;  2XL6 A;  4CDA A;  2IXP A;  1TWC A;  2OCC C;  3DXJ F;  3ZG1 A;  1JMW A;  2KGO A;  3NRH A;  1BR4 A;  2NPU A;  4XEK A;  5DVW A;  3FAP B;  1B68 A;  1T9K A;  4Z9J A;  3JZ0 A;  3ZC4 A;  2Q9C A;  2BL2 A;  2LQG A;  2OJQ A;  1YYJ A;  2IXO A;  3EGX B;  3G4X A;  3OEO A;  3TOL A;  2EIN C;  2HFI A;  2ZXR A;  3HLZ A;  5KYN A;  2R9R B;  3ASN C;  2PP4 A;  3QZC A;  4WAB A;  1RKC A;  4E17 A;  3GM1 A;  4J32 B;  2KC3 A;  3DAG A;  3OWT A;  2L9J A;  3IQ6 A;  3SP1 A;  2Y3B A;  1Q0F A;  3W8I A;  1I4Z A;  4JJF A;  1KTM A;  4MQ9 F;  5F5F A;  1N1C A;  3L0I A;  2LK4 A;  5BQH A;  4CSA A;  1RJ9 B;  2M4E A;  1WWP A;  2DI3 A;  4U5H A;  2YQY A;  2AWY A;  1DOV A;  1RKE B;  3GM3 A;  4YL3 A;  3U9J A;  4BG0 A;  2FGY A;  1CPR A;  2IM8 A;  5KYU B;  3X1O A;  4D4N A;  2E87 A;  4I44 A;  1APC A;  3HNL A;  3C7J A;  3RQG A;  1TFK B;  4P9F A;  1J8Y F;  2Q7R A;  2PFD A;  4FWV A;  5CIV A;  4YT2 A;  3ZWI A;  3O39 A;  3EFO A;  1M56 C;  4H4K C;  2ZPA A;  3S84 A;  4ONS A;  4R32 A;  3UR3 C;  3ZQY A;  3EHN A;  3EZI A;  3U8P A;  3EH2 A;  3IQ5 A;  3NYJ A;  2KYH A;  2W4B A;  4LDQ A;  5L0I A;  1OCR C;  3K1I A;  2OQM A;  2VB6 A;  1LE2 A;  5GPG B;  2WZF A;  1Z7Q c;  1XZP A;  1T6I A;  2P1A A;  1D0Z A;  1VK5 A;  2WL8 A;  3V5X A;  5B3I A;  4MW3 A;  1JRA A;  5EK0 A;  3ABK C;  4U5C E;  3HNI A;  2JD3 A;  4CDY A;  4CS9 C;  256B A;  3GAN A;  3W8H A;  3DKA A;  5L0H A;  2DYR C;  2GWW A;  4MND A;  4YL0 A;  3FDQ A;  2JX0 A;  2HKV A;  1OCZ C;  3DI5 A;  1R4T A;  2XLO A;  4ULV A;  5AGF A;  5BQG A;  3PHF 2;  3T6J A;  4MTF A;  4DRI B;  2YVK A;  2HJ3 A;  5AC5 A;  1PD1 A;  2P6V A;  2J9U A;  3FOO A;  1VOM A;  3ATP A;  1WN0 A;  3RQF A;  5B1B C;  1OQC A;  1WTY A;  3EGD B;  3MFN A;  3RF3 A;  2HSQ A;  3Q6N A;  5L3V A;  3B0P A;  5D92 A;  2X51 A;  4BJ5 A;  1HMD A;  2Q9B A;  2X0C A;  1EI7 A;  1YJG A;  4WJ0 A;  3U5S A;  3GEE A;  3U3B A;  3SXY A;  4PAC A;  4AL1 A;  4MVO A;  4C3D A;  2R7U A;  1PV3 A;  2OG2 A;  3T4R A;  3HNJ A;  3M1C B;  1DOW A;  1VB5 A;  2KQ9 A;  5KYX A;  2A0B A;  1RXQ A;  3TUL A;  2Q9A A;  3PCV A;  2XLM A;  3MLG A;  2D4U A;  1LE4 A;  4HFK B;  1EQ1 A;  1QLE C;  1TKN A;  3KMI A;  2Q00 A;  4AK9 A;  1MMN A;  4OIP F;  4XQ1 A;  3IHU A;  2EPK X;  2MYS A;  5E3A A;  1ZVZ A;  3WOD F;  4G7Z F;  1YLM A;  4G7O F;  1J8M F;  4XTK A;  5FCL A;  1MQV A;  1MMA A;  2D5R B;  2EPN A;  4CSA C;  4MVQ A;  3U2M A;  2HS5 A;  2I8B A;  4LAC B;  4HE8 D;  1OXK A;  2XSE A;  1FFT C;  4O7G A;  4ZLD A;  3FOP A;  5COF A;  2WVN A;  3A11 A;  3FXH A;  3V5Y A;  2HV7 A;  2XLD A;  3NKE A;  3QTH A;  5T1D B;  5E2Q A;  2GAQ A;  3WAQ A;  4I3M A;  4RD9 A;  3DZA A;  2PF4 E;  3L8I A;  4GQH A;  2AP3 A;  1JOG A;  3DMD A;  2J45 A;  4JEA A;  4CIH A;  1ZHW A;  2A0U A;  2ZXO A;  1QQ3 A;  3ZVR A;  4NQF A;  1FMV A;  2CNW A;  3KL4 A;  5JVE A;  4CS7 A;  2XL4 A;  4OIN F;  2IXM A;  1ORY A;  4OIR F;  3M15 A;  1H9T A;  1IZM A;  1T01 A;  3LNR A;  4IWB A;  4U9E A;  1LPE A;  1QVX A;  1YDI A;  2M64 A;  2R03 A;  2VCB A;  3VF0 A;  1G4W R;  2A6H F;  3JCU Q;  2NSF A;  4MVZ A;  5EGY A;  1SF8 A;  2AVK A;  3FHD A;  2PBE A;  5E3C A;  2OJE D;  1WOL A;  2YL0 A;  1SYQ A;  4OIO F;  3O6X A;  2WB7 A;  2QE9 A;  5TJ5 E;  3VRC A;  5JT4 A;  3H2U A;  5A6B A;  3ITF A;  3SZR A;  4HEA J;  3AG4 C;  4BPM A;  2I15 A;  4MTO A;  2CW0 F;  3KH2 A;  4XEV A;  3C62 A;  1HW1 A;  4LDK A;  3EQL F;  1CGM E;  1YA9 A;  3FMS A;  4G7H F;  4KC9 A;  2G3V A;  3C8G A;  2KSF A;  4U9D A;  2YLI A;  2B0H A;  2V26 A;  3RVZ A;  3VM6 A;  4OD5 A;  3GEI A;  4DVY P;  1OR3 A;  1NSG B;  1O87 A;  1Q0K A;  2C03 A;  1GQA A;  1MND A;  2EIJ C;  2Y69 C;  1WGW A;  4CX9 A;  1SZI A;  4WGZ A;  4E7S A;  4D4X A;  3Q6M A;  3RKO F;  2EPM X;  3F47 A;  2XLV A;  3DE8 A;  3GM2 A;  3V7O A;  1FFH A;  4JW1 A;  4BJ5 C;  4YT5 A;  1YAR O;  2ZXP A;  3W2V A;  1E86 A;  3AGU A;  3QW0 A;  2W4M A;  3QVZ A;  4JTD B;  3US6 A;  4DOZ A;  1M2O A;  2EPL X;  3ZIB A;  3U3F A;  4EBK A;  4MS2 A;  1D1C A;  2PNO A;  3NMK A;  5DS6 A;  1ST6 A;  2L6F A;  3JRM O;  1QSP A;  3M79 A;  4P6I C;  4WGY A;  5F28 E;  2VAS A;  2EIM C;  2L7A A;  3JYY A;  4L6R A;  2XXA A;  2IBF A;  4OIQ F;  2MWQ A;  1HMO A;  2YEV A;  1LS1 A;  1BR1 A;  2R7S A;  3EJN A;  3AJM A;  3BRJ A;  3RFY A;  2FFH A;  4JJG A;  3R7C A;  3UNG C;  1TWG A;  1Z23 A;  4AX2 A;  3S90 A;  2C04 A;  4P9T A;  1A41 A;  5A6A A;  3AG2 C;  4CDV A;  5KYY A;  4N4W A;  3LLI A;  5A6J A;  4C7O A;  2H7V C;  3UGO A;  2NUP B;  3EG9 A;  3UMK A;  4YWQ A;  1YAU O;  3B71 A;  1W2W A;  3F46 A;  2HSB A;  3RIP A;  3CZ6 A;  4YL1 A;  3SXM A;  3J06 A;  3E9V A;  2AWC A;  4ZLC A;  1E85 A;  3NMJ A;  5A6K A;  1QPU A;  5CI8 A;  2AU5 A;  4BEJ A;  1VLS A;  3M4C A;  2XRH A;  3ZSU A;  3V5Z A;  5FZT A;  3PMR A;  3NYL A;  4Z9I A;  3POV A;  1OKK A;  4C3B A;  1Z6A A;  4QI0 A;  1L7C A;  4MVS A;  2NUT B;  4PJN A;  1OW7 A;  4A4A A;  2YKZ A;  3JRT A;  2EIL C;  5JLI A;  5JSL A;  2EIK C;  3OA1 A;  4IAR A;  4NY3 A;  1Y4C A;  4JZA A;  1GS9 A;  3HNK A;  4MTG A;  5F5H A;  1D1A A;  3B9Q A;  4EIY A;  4PK4 A;  4FAP B;  5L0G A;  3UGP A;  4AL0 A;  5KYW B;  1ZU5 A;  1O3U A;  1MNE A;  1OXB A;  5A6B D;  1JPN A;  5BUO A;  5HSW A;  2WVQ A;  4EUK B;  4JIO A;  3HJC A;  2J9W A;  4A2N B;  4IB4 A;  4JTA B;  3T6B A;  1VYI A;  4IGG A;  2A6E F;  2L6H A;  4XPW A;  2IOQ A;  2QLA A;  4K7B A;  3C8G D;  1C17 M;  2A1D D;  3DM5 A;  2IXN A;  1HE1 A;  1YZC A;  3C8G B;  3LEO A;  2ZXW C;  5BQI A;  1ZW3 A;  2J7P A;  3K66 A;  3ABL C;  4YT4 A;  4FES A;  4JKV A;  2LSE A;  4U5G A;  3B0U X;  4PJM A;  3GEH A;  1K05 A;  2Y3D A;  3K6B A;  4IJJ A;  3S9O A;  4DRJ B;  1H9G A;  5EHH A;  4NC3 A;  4DJ9 A;  3GOD A;  3S29 A;  1FTS A;  1H7I A;  1YVI A;  4RBN A;  3LJB A;  5DQT A;  2YZS A;  1FMW A;  4HFF B;  2R7W A;  3ZTM A;  4LDR A;  1TQG A;  4XPY A;  1UFB A;  3A9C A;  3EGX A;  3H65 A;  2H7O A;  4IAO A;  1M2V A;  1LS4 A;  4KNV A;  2ETS A;  3C18 A;  4KI2 A;  3L8J A;  1S7Z A;  1JPJ A;  3JSZ A;  1ORS C;  1VLT A;  5B1A C;  1AUE A;  2GDC A;  1NFO A;  2UUH A;  4I1O B;  4JEB A;  1LVK A;  1PCX A;  4BJT A;  4W8K A;  2Y3G A;  5E33 A;  3S27 A;  1NBB A;  5COM A;  4PFO A;  4KBL A;  4X0R A;  1BR2 A;  2YHS A;  4W8P A;  1LI7 A;  3CEX A;  3TD7 A;  2PX3 A;  4E7Z A;  1VMA A;  2H7B A;  4PJJ A;  3PDM P;  4RDA A;  1RMV A;  3Q7G A;  1A7D A;  1RJ9 A;  1V74 B;  5L0D A;  4GEH A;  1CGO A;  1ZW2 A;  3GWL A;  4XWJ A;  4G0H A;  4LER A;  2KW3 C;  2Q3T A;  3EFO B;  3CQZ A;  4XPX A;  1RKE A;  4C7O B;  3SXZ A;  3SXK A;  2XLH A;  1V55 C;  4N6C A;  1YYX A;  3C8Z A;  5KYU A;  1GM5 A;  3JTL O;  4CBE A;  3SEO A;  4DBQ A;  3QMK A;  2XLW A;  3NDB B;  3K1I C;  3IQC A;  4CJG A;  1EKY A;  4JUR I;  1U89 A;  3K1H A;  1M57 C;  4Q4Z F;  3ZDL A;  4Q5S F;  2HUJ A;  1UG7 A;  4B6I A;  2YL1 A;  3MYF A;  3L34 A;  2L6G A;  2XM4 A;  4AE4 A;  3U0C A;  4K1O A;  4E18 A;  1AVO B;  1SR2 A;  1A7V A;  1TWH A;  1LM3 B;  1XWJ A;  3KPH A;  4MVU A;  1U6H A;  4BEM J;  2HJM A;  3N2Z B;  4ER9 A;  1HY5 A;  1T5O A;  3JYH A;  5L0C A;  1LIH A;  2Q4F A;  2VCA A;  4H54 A;  1SMY F;  3KYI A;  4U5E E;  3RW0 A;  3WG7 C;  2QNL A;  3K33 A;  2EPO A;  2P0N A;  2CDQ A;  1L3P A;  1G8X A;  4JC7 A;  4MVR A;  4CS9 A;  1K04 A;  1MMG A;  2G62 A;  2CYD A;  1HW2 A;  2QUP A;  1C02 A;  2R7O A;  4Z9H A;  1ZZP A;  2LFF A;  4FX5 A;  2J8W A;  4GYT A;  3TK0 A;  2LFD A;  1IW7 F;  2YRF A;  3O10 A;  2YLG A;  3I4U A;  2R7T A;  2XLE A;  2MHR A;  2J7P D;  4DRH B;  2DB4 A;  1O5H A;  5DS5 A;  1YZA A;  3AOU A;  4YT8 A;  5DQZ A;  1ZHY A;  4JVS A;  3KKB A;  4G78 A;  1PD0 A;  3I5Q A;  1D1B A;  3EGD A;  2R02 A;  5L0F A;  3TJ6 A;  3ZQV A;  4DXW A;  4XEF A;  3O55 A;  4EWC A;  3NYM A;  5KYX B;  3G50 A;  2HMQ A;  1Y6D A;  1F1M A;  4JE9 A;  3HKK A;  2YL3 A;  2HV6 A;  3JSE O;  4O6Y A;  4DVZ A;  2V3C C;  1OCC C;  4Q7C A;  2J0W A;  1OW8 A;  1Z63 A;  1LI5 A;  1ORJ A;  3DWW A;  1M2V B;  2XS1 A;  3DAF A;  2R05 A;  3W4Y A;  3IEE A;  3AG1 C;  1D0Y A;  1Q0D A;  2H8A A;  3RVY A;  3BEH A;  1KNY A;  2P7V A;  1VYK A;  3NG1 A;  4JCZ A;  3WHN A;  4NTB A;  5AC4 A;  1NU9 C;  3TJ5 A;  3G4Z A;  2Z15 A;  3R2P A;  4N06 A;  2HMZ A;  1CPQ A;  2Y3H A;  3EH1 A;  4KNW A;  2Y39 A;  3B0V C;  4NCQ A;  5JP7 A;  4J30 B;  1ZHZ A;  1T6U A;  3DM9 B;  2KK1 A;  4LLC A;  4ULW A;  1A0B A;  2VCC A;  3RQE A;  3TQO A;  4MW8 A;  1OR2 A;  2CNW D;  4CS8 A;  1WAS A;  2GFH A;  4F4B A;  4N6H A;  4JCH A;  3LNM B;  2UUI A;  2KNH A;  3LUT B;  3U9M A;  2P61 A;  2LD6 A;  4JTC B;  2YWA A;  4BJ6 A;  1C03 A;  2OEV A;  4YJW A;  4XLP F;  4LLE A;  4NTF A;  3N24 A;  4OD4 A;  3ABM C;  5IY5 C;  4JRZ A;  1NLX A;  1TFO B;  3CSK A;  4PFP A;  5DS4 A;  3MBG A;  2A69 F;  5JRA A;  3Q7L A;  2DYS C;  3H2V A;  3TOM A;  3L1M A;  3FVY A;  2QTV A;  2LIG A;  3SNH A;  4AE4 B;  3DJN B;  4O79 A;  2F22 A;  2WZL A;  1S05 A;  3GWN A;  3I5P A;  3LS1 A;  2OKU A;  3M4B A;  4U5B E;  4PR9 A;  1EA8 A;  4J7T A;  3AQC A;  1H6G A;  4DBR A;  3U8V A;  3AGT A;  2VH3 A;  2B0J A;  3UMI A;  3IPM O;  4ANJ A;  1TR2 A;  1T6Q A;  2CCY A;  1ZHX A;  1QZX A;  2LCH A;  4CJO A;  1TWA A;  5B3S C;  2J46 A;  3U2L A;  5L0J A;  2R7X A;  4BJ1 A;  4O6N A;  4YK5 A;  4M63 A;  1Z5Z A;  1G4U S;  2O9X A;  3LEV A;  3KYJ A;  5COG A;  4PJL A;  2OOC A;  2J9V A;  1OW6 A;  1I4Y A;  1D0X A;  1XZQ A;  2XM0 A;  2YLD A;  3EHM A;  3LS0 A;  1JAF A;  3DD7 A;  3FAJ A;  2G3K A;  1U0B B;  4U5D E;  4IRU A;  1Q0G A;  4QI2 A;  3HTK C;  2ASR A;  3JT1 A;  2XXA B;  3ZTZ A;  1GGQ A;  2ICW G;  2BE5 F;  1QKR A;  1V54 C;  3S0X A;  3SYN A;  3K7D A;  3B29 A;  4NTA A;  5HV9 A;  1WAT A;  4E0I A;  1A7E A;  1V4A A;  1OCO C;  3T6G B;  1JR8 A;  2CGE A;  3CAX A;  3W2W A;  1G5Z A;  3VYW A;  4EBJ A;  2L81 A;  5CI9 A;  3E70 C;  5KYY B;  4C3E A;  1NZE A;  2JPU A;  3AG3 C;  2WZG A;  3EG9 B;  1ZHT A;  5T3T A;  1K40 A;  4K0D A;  2IYL D;  1FAP B;  4O6M A;  4U5F E;  3MX3 A;  1RCP A;  4EBB A;  4EKW A;  1HE9 A;  1E2X A;  2OU6 A;  1BDJ B;  3T9O A;  3QVY A;  4UDV A;  3QW1 A;  3NMI A;  4IAQ A;  4MVM A;  2TMV P;  2R7V A;  3EZH A;  2ZD9 A;  1NG1 A;  2XS8 A;  2R7Q A;  1FR0 A;  2NUP A;  1OKK D;  1ZYR F;  2DGJ A;  2J9B A;  2VC9 A;  4CS8 C;  4CIP A;  5JUA A;  3DE9 A;  1LKX A;  5D91 A;  2R7R A;  4I1M A;  2W9Y A;  2NSG A;  2R25 A;  2A68 F;  4BJ6 C;  1ZU4 A;  1VTM P;  3ECS A;  3IQT A;  1E83 A;  1I5N A;  1E84 A;  5JS5 A;  3GOR A;  1R5I D;  5L3Q A;  4QDL A;  4XLN F;  2RD9 A;  2PX0 A;  4J7Y A;  2LP4 A;  2WVO A;  3C63 A;  1M6T A;  2YL7 A;  3EPV A;  2XL8 A;  2BC5 A;  2NG1 A;  3MYI A;  2NUT A;  1NU7 D;  2OEX A;  1CGN A;  2RSE B;  3UMH A;  3S28 A;  3LES A;  3DJU B;  5A69 A;  1FNT c;  2FAP B;  1MMD A;  1Z3I X;  2W45 A;  3N0T A;  3LLK A;  2QY9 A;  4EHP A;  2HZ8 A;  4E0H A;  1KU2 A;  3VAY A;  3X2Q C;  1AEP A;  2GA0 A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 3RF3 A;  5L0I A;  4IGG A;  2GDC A;  2HSQ A;  1SYQ A;  4K1O A;  4E18 A;  2X0C A;  1XWJ A;  3H2U A;  4PR9 A;  1U6H A;  5FZT A;  1QKR A;  1ST6 A;  5L0F A;  3TJ6 A;  1ZW3 A;  4W8P A;  5L0C A;  1H6G A;  2L7A A;  1L7C A;  1DOV A;  1RKE B;  2IBF A;  1DOW A;  3T6G B;  5L0H A;  5L0D A;  2GWW A;  2B0H A;  1TR2 A;  1ZW2 A;  3S90 A;  5L0J A;  1RKE A;  2LQG A;  3MYI A;  4DJ9 A;  4P9T A;  4E17 A;  5L0G A;  3H2V A;  1T01 A;  4ONS A;  1ZVZ A;  4EHP A;  1YDI A;  3VF0 A;  1RKC A;  1U89 A;  3TJ5 A;  3ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...