1E86A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with co bound to distal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e86A00
2XM4A 4CJOA 3QW1A 3FOPA 1CGNA 2CCYA 5JRAA 3ZTMA 2J9BA 3HNLA 3QVYA 5JSLA 2YL0A 2YL3A 2XL8A 3HNIA 2XLOA 3ZWIA 1GQAA 1E86A 2XM0A 4U9DA 1CGOA 3L1MA 3TOLA 4ULVA 2YKZA 3M79A 2YLDA 2XLHA 2YL7A 4JE9A 4IARA 3ZQVA 4IB4A 2XLDA 5B3IA 1CPQA 4CDVA 5AGFA 5JVEA 2YLGA 3QW0A 4JKVA 1A7VA 1YZCA 1S05A 5JP7A 1E85A 3DE8A 3M4CA 1NBBA 1CPRA 4CDYA 3HNJA 3C63A 1E84A 4WGYA 3ZTZA 3FOOA 4D4NA 4L6RA 4U9EA 2XLVA 1YZAA 256BA 1EKYA 4N6HA 3ZQYA 2YL1A 1LM3B 3QVZA 4N4WA 5JLIA 1YYJA 3U8PA 2BC5A 3TOMA 4WGZA 4NC3A 2QLAA 4EIYA 3C62A 4CX9A 2J8WA 1QPUA 4D4XA 4JEBA 5JT4A 1QQ3A 1YYXA 4IAQA 3NMIA 3M4BA 1RCPA 2XL6A 2XLMA 1E83A 3NMKA 4ER9A 3HNKA 4JEAA 3NMJA 3M15A 4CJGA 3IQ6A 5JUAA 1BBHA 3VRCA 2XLWA 5JS5A 2YLIA 2XLEA 1JAFA 1MQVA 4CDAA 4CIPA 3DE9A 1M6TA 1APCA 3IQ5A
chains in the Genus database with same CATH superfamily
1PD0A 2XS1A 4KNVA 5T3WA 3QMKA 1ZHZA 2Y3DA 1ORSC 3FHDA 4JTAB 3LJBA 5HSWA 2J9WA 3ASNC 3H65A 4CJOA 2X51A 3U5SA 3IEEA 2YHSA 2J7PD 1JR8A 1LI5A 2Q9AA 3LEOA 2J9BA 3M1CB 1XZQA 2GDCA 1E2XA 3HNLA 1JOGA 3QVYA 3HTKC 1NU9C 3UNGC 5L3QA 2XL8A 2L7AA 1CGME 2EPOA 2YEVA 2HSBA 2PF4E 3L34A 2HJ3A 3CAXA 2FFHA 4B6IA 1Q0KA 1JPJA 4MNDA 4J30B 2D5RB 3B9QA 3KYIA 3X2QC 3AGUA 1FFTC 2Q9BA 4NQFA 1AEPA 4QDLA 2LK4A 3DM9B 4H54A 4WABA 4JC7A 2J9UA 1F1MA 2E87A 2YKZA 4YL0A 3SP1A 4IAOA 1NFNA 3CQZA 4XEFA 4Z9JA 4JRZA 4DBRA 4C7OB 3LLIA 3GWLA 1NSGB 2Y69C 4Z9IA 4XEVA 3W8IA 2XLDA 1D0ZA 3NYJA 3JRMO 4BPMA 1IZMA 3EGXB 3L0IA 4JKVA 4K7BA 4I1MA 5BQHA 3EJNA 1YZCA 1S05A 4I44A 3R2PA 3U3FA 4C7OA 2GAQA 3DE8A 1A7EA 4QI0A 5L0JA 2JPUA 1BZ4A 3HNJA 4PJJA 5E2QA 2YZSA 4LLEA 2PBEA 3E70C 4KC9A 1OCOC 1GM5A 2R02A 1HMDA 3AQCA 2R7RA 2EIMC 3EG9B 1T6IA 2A0UA 2OJQA 4NY3A 4A4AA 2EILC 4L6RA 1FNTc 3S0XA 3B0UX 3R7CA 1D1AA 1OXBA 2YL1A 1LM3B 4AL0A 4AE4B 2EPLX 3B71A 2A6HF 4H4KC 1HY5A 3TOMA 4WGZA 3AG2C 3VF0A 3ZDLA 1ZW3A 2QLAA 1J8MF 2W4BA 1T01A 2X0CA 4EIYA 2OQMA 2WVOA 4G78A 2GWWA 4CIHA 2CNWA 2J8WA 2LFDA 2ZXOA 4HE8D 3NG1A 4MTGA 1OW8A 4AE4A 3HJCA 4YT5A 3RVYA 5L3VA 1TQGA 5DVWA 5JT4A 5E3AA 1Z6AA 3FXHA 4R32A 2WVNA 3W2VA 3EQLF 3C18A 1G5ZA 4IAQA 4LERA 3FAPB 3POVA 2DB4A 3NMIA 4FAPB 2XRHA 3TJ5A 2DI3A 1ZHTA 2HV6A 2J45A 5B3SC 1H6GA 1OR2A 1YDIA 2KQ9A 2XLMA 4NTFA 4BG0A 4DBQA 1S7ZA 2UUIA 1U6HA 1WTYA 4ER9A 2A69F 1AVOB 5L0DA 2JX0A 4JEAA 4LDQA 1M2OA 1TFOB 3I5QA 3KPHA 3NMJA 1SF8A 2WZGA 3Q7GA 4JZAA 3US6A 4CS8C 3EGDA 2R7VA 3F46A 5JS5A 1ZVZA 2XLWA 1JPNA 3AJMA 4E7SA 2A6EF 2XLEA 3LESA 1DOWA 4FX5A 1TFKB 3K66A 3RVZA 5A69A 1RMVA 3J06A 3DE9A 1MNEA 4N6CA 4OIQF 3DMDA 3DZAA 4JVSA 3RYLA 2CYDA 4IJJA 2EINC 2CDQA 3S29A 4DVZA 1YJGA 2AWYA 3I5PA 4E7ZA 1OW7A 3G4XA 3MBGA 4MVRA 5CIVA 1C17M 1SYQA 3Q7LA 1Z63A 4DRHB 4YN0B 3L8IA 4C3DA 2J9VA 3EFOB 2CCYA 4PJLA 1R5ID 1ZHYA 3FDQA 3GWNA 3ZTMA 4YT2A 2QUPA 1LE4A 1U89A 2YQYA 5BUOA 3MLGA 1WOLA 5E3CA 2KYHA 2F22A 4XQ1A 1I4YA 2DYSC 2EIJC 2A1DD 2ZXRA 4OIOF 2EIKC 2OKUA 3HNIA 2XLOA 2XS8A 4U5EE 1Q0DA 3NKEA 3S28A 1PD1A 4MW8A 4RDAA 3TK0A 1WATA 5T3TA 2R7QA 4QI2A 1NG1A 1TWAA 1ZHXA 2BL2A 1QSPA 2M64A 1BR2A 1CGOA 2TMVP 3ABLC 4Q4ZF 1U0BB 5A6BA 4EUKB 1C03A 1AUEA 2AVKA 2PX3A 1M57C 3K33A 2VC9A 1YA9A 3WHNA 3GANA 4FESA 1WN0A 3BRJA 2XLHA 3G50A 2QY9A 4JE9A 4I3MA 4IARA 4IB4A 4JCZA 3IHUA 2YRFA 4KI2A 3ASOC 2HV7A 2R7XA 3K1HA 1SR2A 1VMAA 1RKEB 3QW0A 3PHF2 1A7VA 1D0YA 2GFHA 4O6MA 1LVKA 4YT4A 1RXQA 3DXJF 3C8GD 1E85A 3I4UA 3N0TA 4YT8A 3DAFA 4J7TA 3UMHA 3UGOA 4G7ZF 2L6HA 2J0WA 1IW7F 2HJMA 3T6JA 4XPWA 4HFFB 1RKEA 4IWBA 1NLXA 1ST6A 1T9KA 3G4ZA 2P7VA 3EZIA 1ZHWA 3JYHA 1K04A 1RKCA 4D4NA 4U9EA 2XLVA 256BA 1LI7A 1EKYA 3NRHA 4CS8A 2NSGA 4IGGA 4E18A 1HW1A 2J0XA 4PFOA 5A6KA 5JLIA 5COMA 4F4BA 2FGYA 4EWCA 1V4AA 1VYIA 4NC3A 1LPEA 4GYTA 1TR2A 4RBNA 1A7DA 2R05A 3U9JA 4E17A 3U2MA 4OIPF 3LAYA 2IXNA 3NDBB 1L7CA 1A0BA 2IXMA 1FR0A 3DWWA 4NTBA 2EPNA 4P9TA 1DOVA 3IQCA 3TULA 2YVKA 3QTHA 2PNOA 4EBKA 5BQIA 4D4XA 3A9CA 4XWJA 3VAYA 4EBJA 2XL4A 4YWQA 1NZEA 5L0GA 4JW1A 3DJUB 1WGWA 3DD7A 2ZXWC 2HUJA 4ZLDA 2QTVA 2H7OA 5B1AC 2PFDA 2Y3GA 4MW3A 4W8PA 2XL6A 2W4MA 3SXKA 3VYWA 1E83A 1VK5A 3NMKA 4KBLA 3EZHA 4OD5A 1RJ9B 1L3PA 2R9RB 1QKRA 4FWVA 2OEXA 4MVQA 4X0RA 5L0IA 2L81A 2AU5A 2I8BA 2V26A 2QNLA 4JURI 2ZXPA 2IM8A 4OINF 2Y3BA 2RD9A 4GEHA 3VRCA 2P61A 3DKAA 4N06A 4GQHA 3SEOA 3MYIA 4DRJB 1PV3A 5F28E 1OCZC 2R7SA 2ZD9A 1MQVA 4ANJA 3DAGA 4CDAA 1RJ9A 1Q0FA 4ONSA 1APCA 5HV9A 1BDJB 1Q0MA 4BEMJ 2HZ8A 3KL4A 3E9VA 5AC4A 5KYWB 5KYUB 1TKNA 2YWAA 2IXOA 2R7OA 1EA8A 3BEHA 3EGDB 5DQZA 2KNHA 1A41A 2P1AA 4DVYP 2XXAB 2VCAA 1HE1A 1CGNA 1G8XA 1ZU5A 3GEIA 4U5BE 5JRAA 1QZXA 1V55C 3O6XA 5KYWA 2HMZA 5KYUA 1T5OA 1VOMA 2H7VC 3CEXA 5JSLA 1Z5ZA 2R7WA 3K6BA 1VLTA 4IRUA 1MMDA 4MVUA 3GM3A 2XXAA 4WJ0A 4MVMA 4CS7A 3TD7A 3U9MA 4PJNA 3V5XA 5DQTA 3DJNB 3Q6NA 2NPUA 2XM0A 1K05A 3WG7C 2WB7A 1OKKD 5GPGB 2J7PA 4CS9C 3S9OA 1O5HA 3PCVA 2NG1A 2PP4A 1JMWA 4I1OB 3L1MA 3L8JA 3WAQA 4BJ1A 3GODA 4XLPF 4Q5SF 3T9OA 5KYXB 2V3CC 3ZC4A 3N2ZB 2A68F 3M79A 2YLDA 1O3UA 1SMYF 4NTAA 5FZTA 1VB5A 1ZW2A 5COFA 2YL7A 3K1IA 3V5ZA 3SZRA 3ZQVA 1BR1A 4U5HA 3RH3A 1KTMA 1Z23A 1ZYRF 2VCCA 5JVEA 1HMOA 5AGFA 1O87A 2YLGA 3JT1A 4E0IA 3RW0A 2C04A 4RD9A 5KYXA 2W45A 1Q0GA 5DLJA 1OXKA 4AX2A 3NYLA 5F5HA 5DS4A 1QVXA 3H2VA 1Z7Qc 3EPVA 1LE2A 3EH2A 3GM2A 3AQBA 2JD3A 3JCUQ 4JJGA 2R7TA 1NBBA 1FMVA 1CPRA 2DGJA 2NSFA 2M4EA 3FVYA 3O55A 3RIPA 3U2LA 3V5YA 4CDYA 1TWCA 3U8VA 3O10A 4BEJA 3SYNA 5EHHA 2LP4A 3ZTZA 1TWGA 2CNWD 2Y3HA 4U5CE 2OG2A 2WVQA 3ATPA 2OCCC 2LCHA 5EK0A 1OCRC 4K1OA 4AK9A 1LKXA 1HE9A 3HKKA 3QVZA 1JRAA 2RSEB 1Y4CA 3AG1C 3NYMA 3F47A 3UR3C 4ZLCA 2MWQA 4JTDB 1MMNA 1EI7A 1YVIA 2BC5A 2O9XA 1I4ZA 4LACB 4PJMA 4MQ9F 2ICWG 5BQGA 4EKWA 2AWCA 2Q3TA 2VH3A 1I5NA 2KK1A 3EH1A 5KYNA 4MVSA 2B0HA 2OU6A 4CX9A 1T6QA 1ORJA 5DS6A 4C3BA 2LQGA 2MYSA 5FCLA 4JEBA 4BJ5A 4HFKB 3UGPA 2R25A 1LIHA 2J46A 4MVOA 3VM6A 3W8HA 1T6UA 2Z15A 4PR9A 2HS5A 2KC3A 1RCPA 2Q9CA 3KKBA 1V74B 2CGEA 2VCBA 3H2UA 4JIOA 2VASA 4XPXA 3ZG1A 2HMQA 1D1CA 4Q7CA 5CI8A 1R4TA 2LIGA 3JTLO 1GGQA 3KMIA 4P9FA 1D1BA 3M15A 3B0VC 3GEHA 3MX3A 3IQ6A 3Q6MA 4A2NB 5JUAA 5L0FA 3LEVA 1FTSA 3JYYA 3K1IC 3TQOA 3SNHA 2OOCA 3U3BA 1SZIA 3EHMA 4BJ6A 4CS9A 4UDVA 3RFYA 4U5FE 3OWTA 1FFHA 3N24A 2R03A 4CIPA 2I15A 3GM1A 1QLEC 3IQ5A 1LS4A 2Q7RA 2GA0A 2LFFA 4MTFA 4CBEA 4DXWA 3IQTA 3S90A 3W2WA 2XM4A 4CSAA 2NUTB 3S84A 3DM5A 2WZFA 4YJWA 1J8YF 1G4WR 3QW1A 5B1BC 4PK4A 2H7BA 3ZIBA 3FOPA 3U8PA 1PCXA 2L6GA 3RQGA 2H8AA 1N1CA 1WASA 1Y6DA 3JSZA 4LDKA 4O6NA 2WZLA 4YK5A 2G3KA 5A6BD 2VB6A 1H9GA 4XEKA 3PDMP 4XTKA 1FMWA 4JJFA 5KYYB 3JZ0A 2NUTA 3AG4C 3O39A 3OEOA 4JCHA 3LUTB 3OA1A 4MS2A 3B0PA 3V7OA 4KNWA 2YL0A 1OKKA 2YL3A 3LNMB 4O7GA 4U5GA 3ZVRA 3ABKC 4G7HF 1NFOA 2BE5F 4AL1A 4ULWA 3LLKA 1HW2A 5T1DB 3ZWIA 1GQAA 2G62A 2CW0F 4EBBA 4OD4A 4EHPA 2HSQA 2OEVA 3EGXA 4LDRA 5KYYA 2KW3C 1E86A 2XSEA 3PMRA 4U9DA 5E33A 5IY5C 1K40A 1XWJA 1OCCC 1V54C 3MYFA 5AC5A 1UG7A 2PX0A 4J32B 4DOZA 3TOLA 4ULVA 3GEEA 1TWHA 2IYLD 3JRTA 4NCQA 4BJ5C 4BJTA 1VTMP 5D91A 5L0CA 1ZU4A 3FMSA 2C03A 1W2WA 4O6YA 3ZSUA 5B3IA 3U0CA 1CPQA 2D4UA 2DYRC 1H7IA 3EG9A 4CDVA 3AOUA 5EGYA 1MMAA 1VLSA 2FAPB 3FAJA 3RQEA 3UMKA 4M63A 1C02A 3C8ZA 1MNDA 5DS5A 5JP7A 3IPMO 3WODF 5COGA 1YARO 3DI5A 3M4CA 3T4RA 2NUPB 5L0HA 3CZ6A 1OW6A 2KJGA 4J7YA 1GS9A 2Y39A 1LS1A 2KGOA 3C63A 3KH2A 3C8GB 3KYJA 3ITFA 3LNRA 4E0HA 4LLCA 1E84A 4WGYA 2L6FA 4MTOA 1M2VB 1WWPA 3SXMA 4OIRF 4BJ6C 2R7UA 1BR4A 3FOOA 1YLMA 1OQCA 1YZAA 4JTCB 1ZZPA 3UMIA 4DRIB 5F5FA 4N6HA 3ZQYA 2NUPA 3RKOF 2L9JA 1EQ1A 2B0JA 4CSAC 1FAPB 1UFBA 4N4WA 1YYJA 2IOQA 3C8GA 1VYKA 2UUHA 2P0NA 4MVZA 1KNYA 1M2VA 2AP3A 2EPKX 2KSFA 2Q00A 4YL1A 4PACA 2EPMX 3NKDA 3C62A 3ECSA 1YAUO 2LSEA 3C7JA 1D0XA 3TJ6A 4XLNF 2G3VA 3HLZA 3AG3C 1M56C 1QPUA 3QZCA 3SXZA 4HEAJ 4K0DA 4O79A 1QQ3A 4W8KA 2IBFA 1YYXA 3RQFA 3B29A 1G4US 3A11A 4Z9HA 2OJED 2WL8A 2Q4FA 3M4BA 2W9YA 4U5DE 4G0HA 3EHNA 1MMGA 1NU7D 3LS1A 1YA7O 3MFNA 5K0IA 3GORA 3K7DA 2HKVA 4G7OF 3HNKA 1ORYA 2A0BA 2ETSA 3X1OA 1OR3A 3LS0A 5TJ5E 2MHRA 2ASRA 3S27A 2HFIA 1XZPA 2LD6A 2P6VA 4CJGA 4DJ9A 3AGTA 5D92A 2QE9A 1BBHA 1B68A 2YLIA 2IXPA 3SXYA 3W4YA 4C3EA 3CSKA 4XPYA 5CI9A 3T6GB 3EFOA 2ZPAA 3JSEO 1JAFA 4P6IC 4PFPA 4YL3A 3RF3A 1H9TA 5A6JA 1M6TA 3T6BA 1Z3IX 3ABMC 1KU2A 5A6AA
chains in the Genus database with same CATH topology
2XM4A 4CJOA 3QW1A 3FOPA 1CGNA 2CCYA 5JRAA 3ZTMA 2J9BA 3HNLA 3QVYA 5JSLA 2YL0A 2YL3A 2XL8A 3HNIA 2XLOA 3ZWIA 1GQAA 1E86A 2XM0A 4U9DA 1CGOA 3L1MA 3TOLA 4ULVA 2YKZA 3M79A 2YLDA 2XLHA 2YL7A 4JE9A 4IARA 3ZQVA 4IB4A 2XLDA 5B3IA 1CPQA 4CDVA 5AGFA 5JVEA 2YLGA 3QW0A 4JKVA 1A7VA 1YZCA 1S05A 5JP7A 1E85A 3DE8A 3M4CA 1NBBA 1CPRA 4CDYA 3HNJA 3C63A 1E84A 4WGYA 3ZTZA 3FOOA 4D4NA 4L6RA 4U9EA 2XLVA 1YZAA 256BA 1EKYA 4N6HA 3ZQYA 2YL1A 1LM3B 3QVZA 4N4WA 5JLIA 1YYJA 3U8PA 2BC5A 3TOMA 4WGZA 4NC3A 2QLAA 4EIYA 3C62A 4CX9A 2J8WA 1QPUA 4D4XA 4JEBA 5JT4A 1QQ3A 1YYXA 4IAQA 3NMIA 3M4BA 1RCPA 2XL6A 2XLMA 1E83A 3NMKA 4ER9A 3HNKA 4JEAA 3NMJA 3M15A 4CJGA 3IQ6A 5JUAA 1BBHA 3VRCA 2XLWA 5JS5A 2YLIA 2XLEA 1JAFA 1MQVA 4CDAA 4CIPA 3DE9A 1M6TA 1APCA 3IQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM4 A;  4CJO A;  3QW1 A;  3FOP A;  1CGN A;  2CCY A;  5JRA A;  3ZTM A;  2J9B A;  3HNL A;  3QVY A;  5JSL A;  2YL0 A;  2YL3 A;  2XL8 A;  3HNI A;  2XLO A;  3ZWI A;  1GQA A;  1E86 A;  2XM0 A;  4U9D A;  1CGO A;  3L1M A;  3TOL A;  4ULV A;  2YKZ A;  3M79 A;  2YLD A;  2XLH A;  2YL7 A;  4JE9 A;  4IAR A;  3ZQV A;  4IB4 A;  2XLD A;  5B3I A;  1CPQ A;  4CDV A;  5AGF A;  5JVE A;  2YLG A;  3QW0 A;  4JKV A;  1A7V A;  1YZC A;  1S05 A;  5JP7 A;  1E85 A;  3DE8 A;  3M4C A;  1NBB A;  1CPR A;  4CDY A;  3HNJ A;  3C63 A;  1E84 A;  4WGY A;  3ZTZ A;  3FOO A;  4D4N A;  4L6R A;  4U9E A;  2XLV A;  1YZA A;  256B A;  1EKY A;  4N6H A;  3ZQY A;  2YL1 A;  1LM3 B;  3QVZ A;  4N4W A;  5JLI A;  1YYJ A;  3U8P A;  2BC5 A;  3TOM A;  4WGZ A;  4NC3 A;  2QLA A;  4EIY A;  3C62 A;  4CX9 A;  2J8W A;  1QPU A;  4D4X A;  4JEB A;  5JT4 A;  1QQ3 A;  1YYX A;  4IAQ A;  3NMI A;  3M4B A;  1RCP A;  2XL6 A;  2XLM A;  1E83 A;  3NMK A;  4ER9 A;  3HNK A;  4JEA A;  3NMJ A;  3M15 A;  4CJG A;  3IQ6 A;  5JUA A;  1BBH A;  3VRC A;  2XLW A;  5JS5 A;  2YLI A;  2XLE A;  1JAF A;  1MQV A;  4CDA A;  4CIP A;  3DE9 A;  1M6T A;  1APC A;  3IQ5 A; 
#chains in the Genus database with same CATH topology
 1PD0 A;  2XS1 A;  4KNV A;  5T3W A;  3QMK A;  1ZHZ A;  2Y3D A;  1ORS C;  3FHD A;  4JTA B;  3LJB A;  5HSW A;  2J9W A;  3ASN C;  3H65 A;  4CJO A;  2X51 A;  3U5S A;  3IEE A;  2YHS A;  2J7P D;  1JR8 A;  1LI5 A;  2Q9A A;  3LEO A;  2J9B A;  3M1C B;  1XZQ A;  2GDC A;  1E2X A;  3HNL A;  1JOG A;  3QVY A;  3HTK C;  1NU9 C;  3UNG C;  5L3Q A;  2XL8 A;  2L7A A;  1CGM E;  2EPO A;  2YEV A;  2HSB A;  2PF4 E;  3L34 A;  2HJ3 A;  3CAX A;  2FFH A;  4B6I A;  1Q0K A;  1JPJ A;  4MND A;  4J30 B;  2D5R B;  3B9Q A;  3KYI A;  3X2Q C;  3AGU A;  1FFT C;  2Q9B A;  4NQF A;  1AEP A;  4QDL A;  2LK4 A;  3DM9 B;  4H54 A;  4WAB A;  4JC7 A;  2J9U A;  1F1M A;  2E87 A;  2YKZ A;  4YL0 A;  3SP1 A;  4IAO A;  1NFN A;  3CQZ A;  4XEF A;  4Z9J A;  4JRZ A;  4DBR A;  4C7O B;  3LLI A;  3GWL A;  1NSG B;  2Y69 C;  4Z9I A;  4XEV A;  3W8I A;  2XLD A;  1D0Z A;  3NYJ A;  3JRM O;  4BPM A;  1IZM A;  3EGX B;  3L0I A;  4JKV A;  4K7B A;  4I1M A;  5BQH A;  3EJN A;  1YZC A;  1S05 A;  4I44 A;  3R2P A;  3U3F A;  4C7O A;  2GAQ A;  3DE8 A;  1A7E A;  4QI0 A;  5L0J A;  2JPU A;  1BZ4 A;  3HNJ A;  4PJJ A;  5E2Q A;  2YZS A;  4LLE A;  2PBE A;  3E70 C;  4KC9 A;  1OCO C;  1GM5 A;  2R02 A;  1HMD A;  3AQC A;  2R7R A;  2EIM C;  3EG9 B;  1T6I A;  2A0U A;  2OJQ A;  4NY3 A;  4A4A A;  2EIL C;  4L6R A;  1FNT c;  3S0X A;  3B0U X;  3R7C A;  1D1A A;  1OXB A;  2YL1 A;  1LM3 B;  4AL0 A;  4AE4 B;  2EPL X;  3B71 A;  2A6H F;  4H4K C;  1HY5 A;  3TOM A;  4WGZ A;  3AG2 C;  3VF0 A;  3ZDL A;  1ZW3 A;  2QLA A;  1J8M F;  2W4B A;  1T01 A;  2X0C A;  4EIY A;  2OQM A;  2WVO A;  4G78 A;  2GWW A;  4CIH A;  2CNW A;  2J8W A;  2LFD A;  2ZXO A;  4HE8 D;  3NG1 A;  4MTG A;  1OW8 A;  4AE4 A;  3HJC A;  4YT5 A;  3RVY A;  5L3V A;  1TQG A;  5DVW A;  5JT4 A;  5E3A A;  1Z6A A;  3FXH A;  4R32 A;  2WVN A;  3W2V A;  3EQL F;  3C18 A;  1G5Z A;  4IAQ A;  4LER A;  3FAP B;  3POV A;  2DB4 A;  3NMI A;  4FAP B;  2XRH A;  3TJ5 A;  2DI3 A;  1ZHT A;  2HV6 A;  2J45 A;  5B3S C;  1H6G A;  1OR2 A;  1YDI A;  2KQ9 A;  2XLM A;  4NTF A;  4BG0 A;  4DBQ A;  1S7Z A;  2UUI A;  1U6H A;  1WTY A;  4ER9 A;  2A69 F;  1AVO B;  5L0D A;  2JX0 A;  4JEA A;  4LDQ A;  1M2O A;  1TFO B;  3I5Q A;  3KPH A;  3NMJ A;  1SF8 A;  2WZG A;  3Q7G A;  4JZA A;  3US6 A;  4CS8 C;  3EGD A;  2R7V A;  3F46 A;  5JS5 A;  1ZVZ A;  2XLW A;  1JPN A;  3AJM A;  4E7S A;  2A6E F;  2XLE A;  3LES A;  1DOW A;  4FX5 A;  1TFK B;  3K66 A;  3RVZ A;  5A69 A;  1RMV A;  3J06 A;  3DE9 A;  1MNE A;  4N6C A;  4OIQ F;  3DMD A;  3DZA A;  4JVS A;  3RYL A;  2CYD A;  4IJJ A;  2EIN C;  2CDQ A;  3S29 A;  4DVZ A;  1YJG A;  2AWY A;  3I5P A;  4E7Z A;  1OW7 A;  3G4X A;  3MBG A;  4MVR A;  5CIV A;  1C17 M;  1SYQ A;  3Q7L A;  1Z63 A;  4DRH B;  4YN0 B;  3L8I A;  4C3D A;  2J9V A;  3EFO B;  2CCY A;  4PJL A;  1R5I D;  1ZHY A;  3FDQ A;  3GWN A;  3ZTM A;  4YT2 A;  2QUP A;  1LE4 A;  1U89 A;  2YQY A;  5BUO A;  3MLG A;  1WOL A;  5E3C A;  2KYH A;  2F22 A;  4XQ1 A;  1I4Y A;  2DYS C;  2EIJ C;  2A1D D;  2ZXR A;  4OIO F;  2EIK C;  2OKU A;  3HNI A;  2XLO A;  2XS8 A;  4U5E E;  1Q0D A;  3NKE A;  3S28 A;  1PD1 A;  4MW8 A;  4RDA A;  3TK0 A;  1WAT A;  5T3T A;  2R7Q A;  4QI2 A;  1NG1 A;  1TWA A;  1ZHX A;  2BL2 A;  1QSP A;  2M64 A;  1BR2 A;  1CGO A;  2TMV P;  3ABL C;  4Q4Z F;  1U0B B;  5A6B A;  4EUK B;  1C03 A;  1AUE A;  2AVK A;  2PX3 A;  1M57 C;  3K33 A;  2VC9 A;  1YA9 A;  3WHN A;  3GAN A;  4FES A;  1WN0 A;  3BRJ A;  2XLH A;  3G50 A;  2QY9 A;  4JE9 A;  4I3M A;  4IAR A;  4IB4 A;  4JCZ A;  3IHU A;  2YRF A;  4KI2 A;  3ASO C;  2HV7 A;  2R7X A;  3K1H A;  1SR2 A;  1VMA A;  1RKE B;  3QW0 A;  3PHF 2;  1A7V A;  1D0Y A;  2GFH A;  4O6M A;  1LVK A;  4YT4 A;  1RXQ A;  3DXJ F;  3C8G D;  1E85 A;  3I4U A;  3N0T A;  4YT8 A;  3DAF A;  4J7T A;  3UMH A;  3UGO A;  4G7Z F;  2L6H A;  2J0W A;  1IW7 F;  2HJM A;  3T6J A;  4XPW A;  4HFF B;  1RKE A;  4IWB A;  1NLX A;  1ST6 A;  1T9K A;  3G4Z A;  2P7V A;  3EZI A;  1ZHW A;  3JYH A;  1K04 A;  1RKC A;  4D4N A;  4U9E A;  2XLV A;  256B A;  1LI7 A;  1EKY A;  3NRH A;  4CS8 A;  2NSG A;  4IGG A;  4E18 A;  1HW1 A;  2J0X A;  4PFO A;  5A6K A;  5JLI A;  5COM A;  4F4B A;  2FGY A;  4EWC A;  1V4A A;  1VYI A;  4NC3 A;  1LPE A;  4GYT A;  1TR2 A;  4RBN A;  1A7D A;  2R05 A;  3U9J A;  4E17 A;  3U2M A;  4OIP F;  3LAY A;  2IXN A;  3NDB B;  1L7C A;  1A0B A;  2IXM A;  1FR0 A;  3DWW A;  4NTB A;  2EPN A;  4P9T A;  1DOV A;  3IQC A;  3TUL A;  2YVK A;  3QTH A;  2PNO A;  4EBK A;  5BQI A;  4D4X A;  3A9C A;  4XWJ A;  3VAY A;  4EBJ A;  2XL4 A;  4YWQ A;  1NZE A;  5L0G A;  4JW1 A;  3DJU B;  1WGW A;  3DD7 A;  2ZXW C;  2HUJ A;  4ZLD A;  2QTV A;  2H7O A;  5B1A C;  2PFD A;  2Y3G A;  4MW3 A;  4W8P A;  2XL6 A;  2W4M A;  3SXK A;  3VYW A;  1E83 A;  1VK5 A;  3NMK A;  4KBL A;  3EZH A;  4OD5 A;  1RJ9 B;  1L3P A;  2R9R B;  1QKR A;  4FWV A;  2OEX A;  4MVQ A;  4X0R A;  5L0I A;  2L81 A;  2AU5 A;  2I8B A;  2V26 A;  2QNL A;  4JUR I;  2ZXP A;  2IM8 A;  4OIN F;  2Y3B A;  2RD9 A;  4GEH A;  3VRC A;  2P61 A;  3DKA A;  4N06 A;  4GQH A;  3SEO A;  3MYI A;  4DRJ B;  1PV3 A;  5F28 E;  1OCZ C;  2R7S A;  2ZD9 A;  1MQV A;  4ANJ A;  3DAG A;  4CDA A;  1RJ9 A;  1Q0F A;  4ONS A;  1APC A;  5HV9 A;  1BDJ B;  1Q0M A;  4BEM J;  2HZ8 A;  3KL4 A;  3E9V A;  5AC4 A;  5KYW B;  5KYU B;  1TKN A;  2YWA A;  2IXO A;  2R7O A;  1EA8 A;  3BEH A;  3EGD B;  5DQZ A;  2KNH A;  1A41 A;  2P1A A;  4DVY P;  2XXA B;  2VCA A;  1HE1 A;  1CGN A;  1G8X A;  1ZU5 A;  3GEI A;  4U5B E;  5JRA A;  1QZX A;  1V55 C;  3O6X A;  5KYW A;  2HMZ A;  5KYU A;  1T5O A;  1VOM A;  2H7V C;  3CEX A;  5JSL A;  1Z5Z A;  2R7W A;  3K6B A;  1VLT A;  4IRU A;  1MMD A;  4MVU A;  3GM3 A;  2XXA A;  4WJ0 A;  4MVM A;  4CS7 A;  3TD7 A;  3U9M A;  4PJN A;  3V5X A;  5DQT A;  3DJN B;  3Q6N A;  2NPU A;  2XM0 A;  1K05 A;  3WG7 C;  2WB7 A;  1OKK D;  5GPG B;  2J7P A;  4CS9 C;  3S9O A;  1O5H A;  3PCV A;  2NG1 A;  2PP4 A;  1JMW A;  4I1O B;  3L1M A;  3L8J A;  3WAQ A;  4BJ1 A;  3GOD A;  4XLP F;  4Q5S F;  3T9O A;  5KYX B;  2V3C C;  3ZC4 A;  3N2Z B;  2A68 F;  3M79 A;  2YLD A;  1O3U A;  1SMY F;  4NTA A;  5FZT A;  1VB5 A;  1ZW2 A;  5COF A;  2YL7 A;  3K1I A;  3V5Z A;  3SZR A;  3ZQV A;  1BR1 A;  4U5H A;  3RH3 A;  1KTM A;  1Z23 A;  1ZYR F;  2VCC A;  5JVE A;  1HMO A;  5AGF A;  1O87 A;  2YLG A;  3JT1 A;  4E0I A;  3RW0 A;  2C04 A;  4RD9 A;  5KYX A;  2W45 A;  1Q0G A;  5DLJ A;  1OXK A;  4AX2 A;  3NYL A;  5F5H A;  5DS4 A;  1QVX A;  3H2V A;  1Z7Q c;  3EPV A;  1LE2 A;  3EH2 A;  3GM2 A;  3AQB A;  2JD3 A;  3JCU Q;  4JJG A;  2R7T A;  1NBB A;  1FMV A;  1CPR A;  2DGJ A;  2NSF A;  2M4E A;  3FVY A;  3O55 A;  3RIP A;  3U2L A;  3V5Y A;  4CDY A;  1TWC A;  3U8V A;  3O10 A;  4BEJ A;  3SYN A;  5EHH A;  2LP4 A;  3ZTZ A;  1TWG A;  2CNW D;  2Y3H A;  4U5C E;  2OG2 A;  2WVQ A;  3ATP A;  2OCC C;  2LCH A;  5EK0 A;  1OCR C;  4K1O A;  4AK9 A;  1LKX A;  1HE9 A;  3HKK A;  3QVZ A;  1JRA A;  2RSE B;  1Y4C A;  3AG1 C;  3NYM A;  3F47 A;  3UR3 C;  4ZLC A;  2MWQ A;  4JTD B;  1MMN A;  1EI7 A;  1YVI A;  2BC5 A;  2O9X A;  1I4Z A;  4LAC B;  4PJM A;  4MQ9 F;  2ICW G;  5BQG A;  4EKW A;  2AWC A;  2Q3T A;  2VH3 A;  1I5N A;  2KK1 A;  3EH1 A;  5KYN A;  4MVS A;  2B0H A;  2OU6 A;  4CX9 A;  1T6Q A;  1ORJ A;  5DS6 A;  4C3B A;  2LQG A;  2MYS A;  5FCL A;  4JEB A;  4BJ5 A;  4HFK B;  3UGP A;  2R25 A;  1LIH A;  2J46 A;  4MVO A;  3VM6 A;  3W8H A;  1T6U A;  2Z15 A;  4PR9 A;  2HS5 A;  2KC3 A;  1RCP A;  2Q9C A;  3KKB A;  1V74 B;  2CGE A;  2VCB A;  3H2U A;  4JIO A;  2VAS A;  4XPX A;  3ZG1 A;  2HMQ A;  1D1C A;  4Q7C A;  5CI8 A;  1R4T A;  2LIG A;  3JTL O;  1GGQ A;  3KMI A;  4P9F A;  1D1B A;  3M15 A;  3B0V C;  3GEH A;  3MX3 A;  3IQ6 A;  3Q6M A;  4A2N B;  5JUA A;  5L0F A;  3LEV A;  1FTS A;  3JYY A;  3K1I C;  3TQO A;  3SNH A;  2OOC A;  3U3B A;  1SZI A;  3EHM A;  4BJ6 A;  4CS9 A;  4UDV A;  3RFY A;  4U5F E;  3OWT A;  1FFH A;  3N24 A;  2R03 A;  4CIP A;  2I15 A;  3GM1 A;  1QLE C;  3IQ5 A;  1LS4 A;  2Q7R A;  2GA0 A;  2LFF A;  4MTF A;  4CBE A;  4DXW A;  3IQT A;  3S90 A;  3W2W A;  2XM4 A;  4CSA A;  2NUT B;  3S84 A;  3DM5 A;  2WZF A;  4YJW A;  1J8Y F;  1G4W R;  3QW1 A;  5B1B C;  4PK4 A;  2H7B A;  3ZIB A;  3FOP A;  3U8P A;  1PCX A;  2L6G A;  3RQG A;  2H8A A;  1N1C A;  1WAS A;  1Y6D A;  3JSZ A;  4LDK A;  4O6N A;  2WZL A;  4YK5 A;  2G3K A;  5A6B D;  2VB6 A;  1H9G A;  4XEK A;  3PDM P;  4XTK A;  1FMW A;  4JJF A;  5KYY B;  3JZ0 A;  2NUT A;  3AG4 C;  3O39 A;  3OEO A;  4JCH A;  3LUT B;  3OA1 A;  4MS2 A;  3B0P A;  3V7O A;  4KNW A;  2YL0 A;  1OKK A;  2YL3 A;  3LNM B;  4O7G A;  4U5G A;  3ZVR A;  3ABK C;  4G7H F;  1NFO A;  2BE5 F;  4AL1 A;  4ULW A;  3LLK A;  1HW2 A;  5T1D B;  3ZWI A;  1GQA A;  2G62 A;  2CW0 F;  4EBB A;  4OD4 A;  4EHP A;  2HSQ A;  2OEV A;  3EGX A;  4LDR A;  5KYY A;  2KW3 C;  1E86 A;  2XSE A;  3PMR A;  4U9D A;  5E33 A;  5IY5 C;  1K40 A;  1XWJ A;  1OCC C;  1V54 C;  3MYF A;  5AC5 A;  1UG7 A;  2PX0 A;  4J32 B;  4DOZ A;  3TOL A;  4ULV A;  3GEE A;  1TWH A;  2IYL D;  3JRT A;  4NCQ A;  4BJ5 C;  4BJT A;  1VTM P;  5D91 A;  5L0C A;  1ZU4 A;  3FMS A;  2C03 A;  1W2W A;  4O6Y A;  3ZSU A;  5B3I A;  3U0C A;  1CPQ A;  2D4U A;  2DYR C;  1H7I A;  3EG9 A;  4CDV A;  3AOU A;  5EGY A;  1MMA A;  1VLS A;  2FAP B;  3FAJ A;  3RQE A;  3UMK A;  4M63 A;  1C02 A;  3C8Z A;  1MND A;  5DS5 A;  5JP7 A;  3IPM O;  3WOD F;  5COG A;  1YAR O;  3DI5 A;  3M4C A;  3T4R A;  2NUP B;  5L0H A;  3CZ6 A;  1OW6 A;  2KJG A;  4J7Y A;  1GS9 A;  2Y39 A;  1LS1 A;  2KGO A;  3C63 A;  3KH2 A;  3C8G B;  3KYJ A;  3ITF A;  3LNR A;  4E0H A;  4LLC A;  1E84 A;  4WGY A;  2L6F A;  4MTO A;  1M2V B;  1WWP A;  3SXM A;  4OIR F;  4BJ6 C;  2R7U A;  1BR4 A;  3FOO A;  1YLM A;  1OQC A;  1YZA A;  4JTC B;  1ZZP A;  3UMI A;  4DRI B;  5F5F A;  4N6H A;  3ZQY A;  2NUP A;  3RKO F;  2L9J A;  1EQ1 A;  2B0J A;  4CSA C;  1FAP B;  1UFB A;  4N4W A;  1YYJ A;  2IOQ A;  3C8G A;  1VYK A;  2UUH A;  2P0N A;  4MVZ A;  1KNY A;  1M2V A;  2AP3 A;  2EPK X;  2KSF A;  2Q00 A;  4YL1 A;  4PAC A;  2EPM X;  3NKD A;  3C62 A;  3ECS A;  1YAU O;  2LSE A;  3C7J A;  1D0X A;  3TJ6 A;  4XLN F;  2G3V A;  3HLZ A;  3AG3 C;  1M56 C;  1QPU A;  3QZC A;  3SXZ A;  4HEA J;  4K0D A;  4O79 A;  1QQ3 A;  4W8K A;  2IBF A;  1YYX A;  3RQF A;  3B29 A;  1G4U S;  3A11 A;  4Z9H A;  2OJE D;  2WL8 A;  2Q4F A;  3M4B A;  2W9Y A;  4U5D E;  4G0H A;  3EHN A;  1MMG A;  1NU7 D;  3LS1 A;  1YA7 O;  3MFN A;  5K0I A;  3GOR A;  3K7D A;  2HKV A;  4G7O F;  3HNK A;  1ORY A;  2A0B A;  2ETS A;  3X1O A;  1OR3 A;  3LS0 A;  5TJ5 E;  2MHR A;  2ASR A;  3S27 A;  2HFI A;  1XZP A;  2LD6 A;  2P6V A;  4CJG A;  4DJ9 A;  3AGT A;  5D92 A;  2QE9 A;  1BBH A;  1B68 A;  2YLI A;  2IXP A;  3SXY A;  3W4Y A;  4C3E A;  3CSK A;  4XPY A;  5CI9 A;  3T6G B;  3EFO A;  2ZPA A;  3JSE O;  1JAF A;  4P6I C;  4PFP A;  4YL3 A;  3RF3 A;  1H9T A;  5A6J A;  1M6T A;  3T6B A;  1Z3I X;  3ABM C;  1KU2 A;  5A6A A; 
#chains in the Genus database with same CATH homology
 2XM4 A;  4CJO A;  3QW1 A;  3FOP A;  1CGN A;  2CCY A;  5JRA A;  3ZTM A;  2J9B A;  3HNL A;  3QVY A;  5JSL A;  2YL0 A;  2YL3 A;  2XL8 A;  3HNI A;  2XLO A;  3ZWI A;  1GQA A;  1E86 A;  2XM0 A;  4U9D A;  1CGO A;  3L1M A;  3TOL A;  4ULV A;  2YKZ A;  3M79 A;  2YLD A;  2XLH A;  2YL7 A;  4JE9 A;  4IAR A;  3ZQV A;  4IB4 A;  2XLD A;  5B3I A;  1CPQ A;  4CDV A;  5AGF A;  5JVE A;  2YLG A;  3QW0 A;  4JKV A;  1A7V A;  1YZC A;  1S05 A;  5JP7 A;  1E85 A;  3DE8 A;  3M4C A;  1NBB A;  1CPR A;  4CDY A;  3HNJ A;  3C63 A;  1E84 A;  4WGY A;  3ZTZ A;  3FOO A;  4D4N A;  4L6R A;  4U9E A;  2XLV A;  1YZA A;  256B A;  1EKY A;  4N6H A;  3ZQY A;  2YL1 A;  1LM3 B;  3QVZ A;  4N4W A;  5JLI A;  1YYJ A;  3U8P A;  2BC5 A;  3TOM A;  4WGZ A;  4NC3 A;  2QLA A;  4EIY A;  3C62 A;  4CX9 A;  2J8W A;  1QPU A;  4D4X A;  4JEB A;  5JT4 A;  1QQ3 A;  1YYX A;  4IAQ A;  3NMI A;  3M4B A;  1RCP A;  2XL6 A;  2XLM A;  1E83 A;  3NMK A;  4ER9 A;  3HNK A;  4JEA A;  3NMJ A;  3M15 A;  4CJG A;  3IQ6 A;  5JUA A;  1BBH A;  3VRC A;  2XLW A;  5JS5 A;  2YLI A;  2XLE A;  1JAF A;  1MQV A;  4CDA A;  4CIP A;  3DE9 A;  1M6T A;  1APC A;  3IQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...