1E86A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with co bound to distal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e86A00
2XL6A 4U9EA 2XM0A 2XLDA 2XLMA 4CDAA 3U8PA 3DE8A 3HNIA 3HNJA 2QLAA 4L6RA 4N6HA 1RCPA 2YLIA 2YKZA 5JP7A 4JEBA 3FOOA 2YLGA 3IQ5A 2YLDA 1CGNA 3QVYA 2J9BA 4JEAA 1YZAA 4CJOA 5JSLA 1NBBA 5JRAA 3QVZA 3ZWIA 5AGFA 2YL7A 3C63A 3NMIA 3IQ6A 2XLOA 4CDVA 1QQ3A 3M4BA 1E85A 3QW1A 3M15A 1MQVA 1QPUA 4JKVA 2J8WA 3M4CA 5JVEA 1YYXA 3NMKA 3DE9A 3ZQYA 1APCA 4WGZA 4IARA 5JLIA 1E84A 4U9DA 4N4WA 4CIPA 1BBHA 3FOPA 1E83A 1E86A 3TOLA 1CPQA 4CX9A 3QW0A 1CGOA 1GQAA 3C62A 3VRCA 1EKYA 2YL1A 3L1MA 1LM3B 4NC3A 2XM4A 1S05A 2XLEA 4IAQA 3ZTZA 1CPRA 4D4NA 2YL0A 1YYJA 3TOMA 2XLVA 2XL8A 4ER9A 2YL3A 2XLWA 1JAFA 4CJGA 4D4XA 5JS5A 4EIYA 2XLHA 3ZQVA 1YZCA 4ULVA 4WGYA 3NMJA 3HNLA 3HNKA 5JT4A 4JE9A 3ZTMA 5B3IA 3M79A 2CCYA 1M6TA 2BC5A 4CDYA 1A7VA 5JUAA 4IB4A 256BA
chains in the Genus database with same CATH superfamily
4MTFA 2HMZA 1WOLA 1J8MF 2KNHA 1D0ZA 4I3MA 4YT4A 2XM0A 4JC7A 2XLDA 2Q3TA 4DBQA 5F5HA 3FDQA 2NG1A 3DD7A 4YL0A 3EHMA 4P6IC 1A7EA 4ONSA 3RYLA 3U8PA 3HNIA 2KSFA 2Q9BA 4OINF 1CGME 4N6HA 2Q9CA 4NTAA 2RD9A 3E9VA 2YKZA 4E18A 5A6BA 2R7WA 4G0HA 2L6HA 5BQHA 3AOUA 3TJ6A 1BDJB 2J9UA 3F46A 2G62A 4J30B 4O7GA 5KYYA 3FOOA 2CGEA 2LQGA 2MHRA 2BL2A 2YLDA 3IQ5A 3RFYA 1R4TA 3ITFA 3QVYA 2KK1A 4JEAA 3LAYA 2AVKA 4MVUA 4Z9HA 4ZLDA 4CJOA 5A69A 5JSLA 4BJ1A 3C18A 1WTYA 3SEOA 1HW1A 3S84A 3HJCA 4CSAA 3X2QC 1BZ4A 3DM5A 4I44A 1T6QA 1U89A 1TWGA 2J0WA 2OEVA 3EJNA 2OCCC 2HV7A 3SP1A 3AG3C 2IXNA 5L0GA 3UMIA 4FX5A 2DYSC 4X0RA 4PFPA 5D92A 1TR2A 3ECSA 4CDVA 2WB7A 5DQTA 1Y4CA 3KH2A 4PJMA 1T01A 3GEHA 1TWAA 3V7OA 4Q5SF 3KYIA 3DAFA 4CS8C 3VYWA 1D1BA 2J7PD 1QPUA 4EUKB 2J8WA 3M4CA 3NMKA 2L6FA 3DM9B 2GWWA 2B0HA 1Y6DA 2IBFA 3NYJA 2A0UA 3S27A 3X1OA 2XXAA 5A6KA 1G4WR 1E84A 1YVIA 4OIOF 5KYUB 2J45A 3JYHA 1ZVZA 2MWQA 3GM1A 4DVYP 2ASRA 3U9MA 1KU2A 1FNTc 3FOPA 3TD7A 1T9KA 1VMAA 1ZHWA 2ETSA 5DQZA 1BR1A 4G7ZF 4CS7A 1GM5A 4BJ5A 5L0HA 1LE2A 4KI2A 3B0PA 2IXPA 3DI5A 1OCRC 1WN0A 3J06A 4LACB 1A0BA 3C62A 3GWNA 2ZPAA 2L9JA 2YL1A 3JT1A 1F1MA 3L1MA 2TMVP 5EK0A 4G78A 2P0NA 1TKNA 5CI8A 3N2ZB 4PACA 2WZGA 3AJMA 2DI3A 1JPNA 3LUTB 3LJBA 2HS5A 1K05A 1OCOC 3BRJA 2YZSA 1YARO 1Q0GA 1N1CA 2YL0A 2HSQA 4XLNF 4DRJB 4MTGA 4U5CE 3HKKA 3LLIA 2ICWG 1LVKA 2M64A 3S90A 1G4US 1RXQA 1OW6A 4XEVA 2IYLD 2XLWA 3WHNA 4CJGA 4IAOA 5JS5A 4YT8A 1MNEA 2NUPA 1I4YA 1E2XA 4C3BA 2DGJA 1M2VA 1AEPA 5JT4A 1R5ID 3HNKA 2Y3DA 4PJLA 3OEOA 4U5FE 3JTLO 3GEIA 1S7ZA 4LDRA 2Y3HA 5HSWA 1EI7A 2EPLX 3DWWA 3EGDB 1ZYRF 3K6BA 5AC5A 3E70C 2R7QA 2BE5F 3C8ZA 4IB4A 1RJ9A 5JUAA 4J7TA 256BA 2OQMA 5E3CA 3A11A 3JZ0A 1GGQA 1ZW2A 1NU7D 1ZU5A 3POVA 3I4UA 4LLEA 3ABKC 3RH3A 3KYJA 4CS9C 4NQFA 3S28A 1MNDA 2Q00A 1IZMA 4JCZA 1VLSA 2PFDA 2L6GA 3QTHA 1H9GA 2EPMX 2XLMA 1NFNA 1Q0DA 2R05A 3G4XA 1OXKA 3Q6NA 5A6BD 2IXMA 1DOVA 3AQCA 2NSGA 4YT2A 2QLAA 4MS2A 3T6BA 4CS8A 3SXKA 2Y69C 1A7DA 5K0IA 2A6EF 2QUPA 3EFOB 4MQ9F 3ZC4A 3MYIA 1FMVA 4JEBA 2P61A 4P9FA 3U3BA 3U0CA 3JSZA 2HV6A 1OXBA 5L0FA 3AGUA 4HFKB 3FAJA 1Z3IX 5B1BC 1RKEA 2J9BA 3DJUB 3Q6MA 2LSEA 4NTFA 5D91A 3FHDA 4OD4A 1JR8A 3SXZA 4E17A 4O6YA 3RVZA 4G7HF 3LNMB 4E0IA 4JTDB 4F4BA 5JRAA 1UFBA 4HE8D 2GFHA 2R7SA 4FAPB 1YA9A 2NUTB 1NU9C 1YAUO 2J46A 5AGFA 3ZWIA 1AVOB 3AG4C 4AE4B 2YL7A 3C63A 3EZHA 1VYIA 4ULWA 1MMDA 4NTBA 4XTKA 3NMIA 1Z23A 2J9WA 5L3QA 2R7RA 1QQ3A 1NFOA 3KKBA 3IQCA 3QW1A 4DRHB 4E7SA 4IGGA 2AWYA 3MYFA 4Z9JA 1ORJA 5DS4A 1M2OA 3WODF 4BJ6C 2W45A 3NDBB 4G7OF 3EH1A 3ATPA 1V54C 3QZCA 1YYXA 3IQTA 2IM8A 3DE9A 3EGXA 3U8VA 3IHUA 3ZQYA 1JOGA 1A41A 4IWBA 1JMWA 1HY5A 2ZXRA 4XWJA 3U5SA 3SXYA 1OCZC 4OIRF 1T6UA 4YL1A 2KJGA 4N4WA 4CIPA 1OR2A 1BBHA 3LEOA 3W2WA 4XLPF 3NYMA 1D0XA 1ZHYA 1VB5A 2DYRC 5CI9A 1CPQA 3ASNC 3TOLA 3ZDLA 3RIPA 4R32A 1UG7A 3L8IA 1CGOA 1OQCA 1WGWA 4NY3A 4OD5A 4DRIB 3PHF2 5L3VA 2OEXA 4ZLCA 3GODA 2WZFA 2XM4A 3IEEA 4MVMA 4CS9A 1T5OA 4J7YA 5L0CA 2CDQA 1U0BB 2KYHA 1S05A 2I8BA 2XSEA 4YN0B 4HEAJ 4JTCB 4IAQA 1ZHTA 4MVOA 3RQEA 2XXAB 3SNHA 1FFTC 4YK5A 2LCHA 2L81A 4ER9A 1VK5A 3NRHA 3FAPB 2PX0A 2MYSA 3T6JA 1OR3A 2H7BA 1C03A 1NZEA 4QI2A 2W4BA 2WVNA 1JAFA 2OG2A 2YRFA 3WG7C 4LDKA 5F5FA 2H7OA 3CZ6A 3ZQVA 1TQGA 3Q7LA 4QDLA 2YVKA 3CAXA 3F47A 1YZCA 1H9TA 3HNLA 1HMOA 2QNLA 3HLZA 1WWPA 4XPWA 5E3AA 5EGYA 1D1CA 1M6TA 2BC5A 3IPMO 3KL4A 2NPUA 5KYWA 1A7VA 1O5HA 3DKAA 4CIHA 4W8PA 1JPJA 2F22A 3VF0A 1V74B 2LD6A 3HTKC 5KYXA 4C7OA 5L0IA 2AP3A 4PFOA 5T3WA 1AUEA 3QMKA 3GANA 3O39A 5BQGA 3EHNA 2UUIA 5KYUA 3L8JA 3R2PA 4U9EA 1VLTA 2J9VA 5AC4A 4MVSA 2PF4E 1YA7O 1RMVA 3H2VA 2HJ3A 2FGYA 3CEXA 3NKEA 4LLCA 4AL0A 3FMSA 5TJ5E 2LFDA 4BEMJ 1XZPA 2JPUA 4DOZA 3CQZA 3B9QA 2VASA 3AG1C 4N6CA 4KC9A 4U5DE 4L6RA 1RCPA 4BJ6A 4Q4ZF 2A1DD 1I5NA 3C8GA 4IRUA 5T3TA 3VAYA 4OIQF 4JIOA 1M56C 1VYKA 2OJED 3ABLC 2YLGA 3DJNB 2WZLA 3NKDA 4K1OA 1SYQA 1B68A 1RJ9B 1U6HA 2H7VC 4MVRA 3AGTA 2QTVA 1HE9A 3V5YA 3W8IA 4AX2A 1TWCA 1YDIA 4B6IA 3L0IA 2D5RB 3LLKA 5CIVA 3EG9A 2HMQA 1NBBA 4XEFA 2C04A 3A9CA 1J8YF 4YL3A 5HV9A 2ZXWC 3PMRA 3H65A 1VTMP 2HSBA 2EIKC 1LS4A 3UGPA 1KNYA 2W4MA 1K40A 2G3KA 4PR9A 3UMKA 4WJ0A 1G8XA 2QE9A 2XRHA 3JRMO 1GS9A 4KNVA 3SYNA 3W2VA 5EHHA 5GPGB 1LPEA 3US6A 1Z63A 1Q0FA 3B0UX 3M15A 2OKUA 2JD3A 4FESA 4C3DA 3MX3A 2ZXPA 3W8HA 3B0VC 4OIPF 3C7JA 5FCLA 2R03A 4JKVA 1V4AA 2GAQA 4K0DA 3U3FA 1FAPB 3RW0A 4I1MA 2Y3BA 1PV3A 5COMA 1YLMA 2AU5A 3RVYA 1RKEB 2FFHA 2R9RB 2WVQA 3JCUQ 4EBBA 5BUOA 5E33A 4IARA 2Y3GA 5JLIA 1D0YA 3JRTA 4FWVA 2H8AA 3MBGA 3EH2A 1Z7Qc 4I1OB 2CNWA 3FXHA 2EINC 1SMYF 2QY9A 1E86A 2W9YA 3PCVA 1FR0A 2GDCA 4EBJA 4CX9A 1BR4A 3ZG1A 1MMGA 4MVZA 3U9JA 1GQAA 2C03A 2R7VA 2KQ9A 4JCHA 1EKYA 1LIHA 4DXWA 4U5BE 1LM3B 4NC3A 4HFFB 3T4RA 4U5GA 3U2MA 5KYYB 1NLXA 1ZW3A 4JW1A 2EIJC 3FVYA 5A6AA 3EGXB 2J0XA 4Z9IA 4N06A 3BEHA 4MW3A 4A2NB 2CW0F 3ZTZA 1NSGB 1CPRA 2Y39A 3RF3A 3H2UA 2EPKX 2WL8A 2A68F 3JSEO 1WATA 2HKVA 2XS1A 2XLVA 4MTOA 2NUTA 5KYNA 1KTMA 3LS0A 3ABMC 1L3PA 4YT5A 4AE4A 4E0HA 2YL3A 3M1CB 1ZHZA 4QI0A 1OKKA 3O6XA 4BEJA 2XL4A 5DS5A 3G50A 5JVEA 3DMDA 2PX3A 3NMJA 1FFHA 2VC9A 4BG0A 5B3IA 3GM3A 2YEVA 5E2QA 3M79A 2X51A 4CDYA 2A6HF 4M63A 2V3CC 4JJGA 3TK0A 1NG1A 2VB6A 2X0CA 1L7CA 4DBRA 2OU6A 2IOQA 3MLGA 2XL6A 2VH3A 3UMHA 1MMNA 3N24A 4XQ1A 2Q9AA 1ORSC 2D4UA 2Q4FA 1H6GA 1SF8A 4JRZA 4XEKA 1XWJA 1T6IA 2HZ8A 1TFOB 2KGOA 4GEHA 2R02A 1LE4A 3Q7GA 3DE8A 4H4KC 4CDAA 3B29A 3UR3C 2A0BA 1LS1A 1EA8A 2R7UA 2HFIA 1Q0MA 1SZIA 1WASA 3C8GD 3HNJA 4CBEA 5L0JA 2VCAA 2VCCA 1QSPA 3ASOC 4EWCA 3N0TA 3U2LA 2PNOA 2YLIA 4JJFA 3V5ZA 4O6MA 4XPYA 3GWLA 3AQBA 3DAGA 3EZIA 5JP7A 4J32B 3OWTA 4RD9A 1W2WA 2P7VA 1YJGA 4W8KA 1TWHA 4MW8A 4GYTA 3ZVRA 3AG2C 4GQHA 5KYWB 1BR2A 1MMAA 2HJMA 1QVXA 2LFFA 1I4ZA 5KYXB 1ZZPA 1CGNA 3K1IC 4JVSA 4MNDA 3V5XA 5L0DA 4C7OB 2Z15A 2EILC 1YZAA 3NYLA 2EPNA 1TFKB 4JZAA 3VM6A 2P6VA 3K33A 3K66A 1ZHXA 3TJ5A 1QZXA 2EPOA 2LP4A 3UGOA 1ZU4A 2R25A 1LI5A 2I15A 1VOMA 3QVZA 4K7BA 1FTSA 1FMWA 4E7ZA 2V26A 1C17M 3RQGA 4U5EE 1HMDA 3KMIA 4U5HA 1C02A 3S9OA 2UUHA 3IQ6A 4KBLA 2XLOA 3M4BA 5A6JA 3I5PA 2NUPB 1E85A 2PP4A 1M2VB 3KPHA 1G5ZA 3C8GB 1DOWA 2CYDA 3LNRA 1MQVA 3LS1A 4Q7CA 4AL1A 1Z5ZA 5F28E 4NCQA 1O3UA 4BPMA 2NSFA 3ZSUA 3S29A 3O55A 4PJJA 4EBKA 2M4EA 3R7CA 2O9XA 3GM2A 3GORA 2J7PA 3LESA 4XPXA 2RSEB 4O79A 2GA0A 1JRAA 1APCA 2B0JA 4ANJA 3S0XA 4EHPA 4WGZA 3L34A 5COFA 4O6NA 4EKWA 1H7IA 2OOCA 2XS8A 2YQYA 1M57C 4U9DA 4JURI 5T1DB 3EG9B 2CNWD 4BJTA 5FZTA 4LERA 3K1HA 1V55C 4KNWA 4AK9A 1RKCA 2WVOA 1Z6AA 1K04A 3MFNA 2R7OA 3K7DA 1E83A 4CSAC 3EPVA 2DB4A 5COGA 2JX0A 4MVQA 3OA1A 4PJNA 1OCCC 4YWQA 2A69F 5DS6A 1EQ1A 1PD1A 2ZXOA 3QW0A 1OW8A 3TQOA 3UNGC 2HUJA 3T9OA 4UDVA 3VRCA 4PK4A 1HE1A 1ORYA 2LK4A 2VCBA 3EGDA 3NG1A 4IJJA 4WABA 2Q7RA 3O10A 1QLEC 2FAPB 2YHSA 5DVWA 4DJ9A 2PBEA 3JYYA 3RQFA 3RKOF 4A4AA 3I5QA 2XLEA 5IY5C 1HW2A 2AWCA 5B1AC 4D4NA 3PDMP 1O87A 2G3VA 2R7XA 3CSKA 1YYJA 1QKRA 2L7AA 3TOMA 1PCXA 5DLJA 2P1AA 2XL8A 2OJQA 3DZAA 4C3EA 1OKKD 3WAQA 4RDAA 4LDQA 2ZD9A 3EQLF 3TULA 3DXJF 2R7TA 3GEEA 4YJWA 4D4XA 1PD0A 4EIYA 2XLHA 2IXOA 4DVZA 1OW7A 1LKXA 4ULVA 4WGYA 3EFOA 1Q0KA 2E87A 4JE9A 3T6GB 1IW7F 4JTAB 3W4YA 3B71A 3ZTMA 3K1IA 5BQIA 1LI7A 1XZQA 2CCYA 2YWAA 4BJ5C 1D1AA 4H54A 3G4ZA 2KW3C 4P9TA 3SXMA 2KC3A 5B3SC 3SZRA 1ST6A 3ZIBA 1SR2A 3LEVA 2EIMC 4RBNA 2LIGA
chains in the Genus database with same CATH topology
2XL6A 4U9EA 2XM0A 2XLDA 2XLMA 4CDAA 3U8PA 3DE8A 3HNIA 3HNJA 2QLAA 4L6RA 4N6HA 1RCPA 2YLIA 2YKZA 5JP7A 4JEBA 3FOOA 2YLGA 3IQ5A 2YLDA 1CGNA 3QVYA 2J9BA 4JEAA 1YZAA 4CJOA 5JSLA 1NBBA 5JRAA 3QVZA 3ZWIA 5AGFA 2YL7A 3C63A 3NMIA 3IQ6A 2XLOA 4CDVA 1QQ3A 3M4BA 1E85A 3QW1A 3M15A 1MQVA 1QPUA 4JKVA 2J8WA 3M4CA 5JVEA 1YYXA 3NMKA 3DE9A 3ZQYA 1APCA 4WGZA 4IARA 5JLIA 1E84A 4U9DA 4N4WA 4CIPA 1BBHA 3FOPA 1E83A 1E86A 3TOLA 1CPQA 4CX9A 3QW0A 1CGOA 1GQAA 3C62A 3VRCA 1EKYA 2YL1A 3L1MA 1LM3B 4NC3A 2XM4A 1S05A 2XLEA 4IAQA 3ZTZA 1CPRA 4D4NA 2YL0A 1YYJA 3TOMA 2XLVA 2XL8A 4ER9A 2YL3A 2XLWA 1JAFA 4CJGA 4D4XA 5JS5A 4EIYA 2XLHA 3ZQVA 1YZCA 4ULVA 4WGYA 3NMJA 3HNLA 3HNKA 5JT4A 4JE9A 3ZTMA 5B3IA 3M79A 2CCYA 1M6TA 2BC5A 4CDYA 1A7VA 5JUAA 4IB4A 256BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL6 A;  4U9E A;  2XM0 A;  2XLD A;  2XLM A;  4CDA A;  3U8P A;  3DE8 A;  3HNI A;  3HNJ A;  2QLA A;  4L6R A;  4N6H A;  1RCP A;  2YLI A;  2YKZ A;  5JP7 A;  4JEB A;  3FOO A;  2YLG A;  3IQ5 A;  2YLD A;  1CGN A;  3QVY A;  2J9B A;  4JEA A;  1YZA A;  4CJO A;  5JSL A;  1NBB A;  5JRA A;  3QVZ A;  3ZWI A;  5AGF A;  2YL7 A;  3C63 A;  3NMI A;  3IQ6 A;  2XLO A;  4CDV A;  1QQ3 A;  3M4B A;  1E85 A;  3QW1 A;  3M15 A;  1MQV A;  1QPU A;  4JKV A;  2J8W A;  3M4C A;  5JVE A;  1YYX A;  3NMK A;  3DE9 A;  3ZQY A;  1APC A;  4WGZ A;  4IAR A;  5JLI A;  1E84 A;  4U9D A;  4N4W A;  4CIP A;  1BBH A;  3FOP A;  1E83 A;  1E86 A;  3TOL A;  1CPQ A;  4CX9 A;  3QW0 A;  1CGO A;  1GQA A;  3C62 A;  3VRC A;  1EKY A;  2YL1 A;  3L1M A;  1LM3 B;  4NC3 A;  2XM4 A;  1S05 A;  2XLE A;  4IAQ A;  3ZTZ A;  1CPR A;  4D4N A;  2YL0 A;  1YYJ A;  3TOM A;  2XLV A;  2XL8 A;  4ER9 A;  2YL3 A;  2XLW A;  1JAF A;  4CJG A;  4D4X A;  5JS5 A;  4EIY A;  2XLH A;  3ZQV A;  1YZC A;  4ULV A;  4WGY A;  3NMJ A;  3HNL A;  3HNK A;  5JT4 A;  4JE9 A;  3ZTM A;  5B3I A;  3M79 A;  2CCY A;  1M6T A;  2BC5 A;  4CDY A;  1A7V A;  5JUA A;  4IB4 A;  256B A; 
#chains in the Genus database with same CATH topology
 4MTF A;  2HMZ A;  1WOL A;  1J8M F;  2KNH A;  1D0Z A;  4I3M A;  4YT4 A;  2XM0 A;  4JC7 A;  2XLD A;  2Q3T A;  4DBQ A;  5F5H A;  3FDQ A;  2NG1 A;  3DD7 A;  4YL0 A;  3EHM A;  4P6I C;  1A7E A;  4ONS A;  3RYL A;  3U8P A;  3HNI A;  2KSF A;  2Q9B A;  4OIN F;  1CGM E;  4N6H A;  2Q9C A;  4NTA A;  2RD9 A;  3E9V A;  2YKZ A;  4E18 A;  5A6B A;  2R7W A;  4G0H A;  2L6H A;  5BQH A;  3AOU A;  3TJ6 A;  1BDJ B;  2J9U A;  3F46 A;  2G62 A;  4J30 B;  4O7G A;  5KYY A;  3FOO A;  2CGE A;  2LQG A;  2MHR A;  2BL2 A;  2YLD A;  3IQ5 A;  3RFY A;  1R4T A;  3ITF A;  3QVY A;  2KK1 A;  4JEA A;  3LAY A;  2AVK A;  4MVU A;  4Z9H A;  4ZLD A;  4CJO A;  5A69 A;  5JSL A;  4BJ1 A;  3C18 A;  1WTY A;  3SEO A;  1HW1 A;  3S84 A;  3HJC A;  4CSA A;  3X2Q C;  1BZ4 A;  3DM5 A;  4I44 A;  1T6Q A;  1U89 A;  1TWG A;  2J0W A;  2OEV A;  3EJN A;  2OCC C;  2HV7 A;  3SP1 A;  3AG3 C;  2IXN A;  5L0G A;  3UMI A;  4FX5 A;  2DYS C;  4X0R A;  4PFP A;  5D92 A;  1TR2 A;  3ECS A;  4CDV A;  2WB7 A;  5DQT A;  1Y4C A;  3KH2 A;  4PJM A;  1T01 A;  3GEH A;  1TWA A;  3V7O A;  4Q5S F;  3KYI A;  3DAF A;  4CS8 C;  3VYW A;  1D1B A;  2J7P D;  1QPU A;  4EUK B;  2J8W A;  3M4C A;  3NMK A;  2L6F A;  3DM9 B;  2GWW A;  2B0H A;  1Y6D A;  2IBF A;  3NYJ A;  2A0U A;  3S27 A;  3X1O A;  2XXA A;  5A6K A;  1G4W R;  1E84 A;  1YVI A;  4OIO F;  5KYU B;  2J45 A;  3JYH A;  1ZVZ A;  2MWQ A;  3GM1 A;  4DVY P;  2ASR A;  3U9M A;  1KU2 A;  1FNT c;  3FOP A;  3TD7 A;  1T9K A;  1VMA A;  1ZHW A;  2ETS A;  5DQZ A;  1BR1 A;  4G7Z F;  4CS7 A;  1GM5 A;  4BJ5 A;  5L0H A;  1LE2 A;  4KI2 A;  3B0P A;  2IXP A;  3DI5 A;  1OCR C;  1WN0 A;  3J06 A;  4LAC B;  1A0B A;  3C62 A;  3GWN A;  2ZPA A;  2L9J A;  2YL1 A;  3JT1 A;  1F1M A;  3L1M A;  2TMV P;  5EK0 A;  4G78 A;  2P0N A;  1TKN A;  5CI8 A;  3N2Z B;  4PAC A;  2WZG A;  3AJM A;  2DI3 A;  1JPN A;  3LUT B;  3LJB A;  2HS5 A;  1K05 A;  1OCO C;  3BRJ A;  2YZS A;  1YAR O;  1Q0G A;  1N1C A;  2YL0 A;  2HSQ A;  4XLN F;  4DRJ B;  4MTG A;  4U5C E;  3HKK A;  3LLI A;  2ICW G;  1LVK A;  2M64 A;  3S90 A;  1G4U S;  1RXQ A;  1OW6 A;  4XEV A;  2IYL D;  2XLW A;  3WHN A;  4CJG A;  4IAO A;  5JS5 A;  4YT8 A;  1MNE A;  2NUP A;  1I4Y A;  1E2X A;  4C3B A;  2DGJ A;  1M2V A;  1AEP A;  5JT4 A;  1R5I D;  3HNK A;  2Y3D A;  4PJL A;  3OEO A;  4U5F E;  3JTL O;  3GEI A;  1S7Z A;  4LDR A;  2Y3H A;  5HSW A;  1EI7 A;  2EPL X;  3DWW A;  3EGD B;  1ZYR F;  3K6B A;  5AC5 A;  3E70 C;  2R7Q A;  2BE5 F;  3C8Z A;  4IB4 A;  1RJ9 A;  5JUA A;  4J7T A;  256B A;  2OQM A;  5E3C A;  3A11 A;  3JZ0 A;  1GGQ A;  1ZW2 A;  1NU7 D;  1ZU5 A;  3POV A;  3I4U A;  4LLE A;  3ABK C;  3RH3 A;  3KYJ A;  4CS9 C;  4NQF A;  3S28 A;  1MND A;  2Q00 A;  1IZM A;  4JCZ A;  1VLS A;  2PFD A;  2L6G A;  3QTH A;  1H9G A;  2EPM X;  2XLM A;  1NFN A;  1Q0D A;  2R05 A;  3G4X A;  1OXK A;  3Q6N A;  5A6B D;  2IXM A;  1DOV A;  3AQC A;  2NSG A;  4YT2 A;  2QLA A;  4MS2 A;  3T6B A;  4CS8 A;  3SXK A;  2Y69 C;  1A7D A;  5K0I A;  2A6E F;  2QUP A;  3EFO B;  4MQ9 F;  3ZC4 A;  3MYI A;  1FMV A;  4JEB A;  2P61 A;  4P9F A;  3U3B A;  3U0C A;  3JSZ A;  2HV6 A;  1OXB A;  5L0F A;  3AGU A;  4HFK B;  3FAJ A;  1Z3I X;  5B1B C;  1RKE A;  2J9B A;  3DJU B;  3Q6M A;  2LSE A;  4NTF A;  5D91 A;  3FHD A;  4OD4 A;  1JR8 A;  3SXZ A;  4E17 A;  4O6Y A;  3RVZ A;  4G7H F;  3LNM B;  4E0I A;  4JTD B;  4F4B A;  5JRA A;  1UFB A;  4HE8 D;  2GFH A;  2R7S A;  4FAP B;  1YA9 A;  2NUT B;  1NU9 C;  1YAU O;  2J46 A;  5AGF A;  3ZWI A;  1AVO B;  3AG4 C;  4AE4 B;  2YL7 A;  3C63 A;  3EZH A;  1VYI A;  4ULW A;  1MMD A;  4NTB A;  4XTK A;  3NMI A;  1Z23 A;  2J9W A;  5L3Q A;  2R7R A;  1QQ3 A;  1NFO A;  3KKB A;  3IQC A;  3QW1 A;  4DRH B;  4E7S A;  4IGG A;  2AWY A;  3MYF A;  4Z9J A;  1ORJ A;  5DS4 A;  1M2O A;  3WOD F;  4BJ6 C;  2W45 A;  3NDB B;  4G7O F;  3EH1 A;  3ATP A;  1V54 C;  3QZC A;  1YYX A;  3IQT A;  2IM8 A;  3DE9 A;  3EGX A;  3U8V A;  3IHU A;  3ZQY A;  1JOG A;  1A41 A;  4IWB A;  1JMW A;  1HY5 A;  2ZXR A;  4XWJ A;  3U5S A;  3SXY A;  1OCZ C;  4OIR F;  1T6U A;  4YL1 A;  2KJG A;  4N4W A;  4CIP A;  1OR2 A;  1BBH A;  3LEO A;  3W2W A;  4XLP F;  3NYM A;  1D0X A;  1ZHY A;  1VB5 A;  2DYR C;  5CI9 A;  1CPQ A;  3ASN C;  3TOL A;  3ZDL A;  3RIP A;  4R32 A;  1UG7 A;  3L8I A;  1CGO A;  1OQC A;  1WGW A;  4NY3 A;  4OD5 A;  4DRI B;  3PHF 2;  5L3V A;  2OEX A;  4ZLC A;  3GOD A;  2WZF A;  2XM4 A;  3IEE A;  4MVM A;  4CS9 A;  1T5O A;  4J7Y A;  5L0C A;  2CDQ A;  1U0B B;  2KYH A;  1S05 A;  2I8B A;  2XSE A;  4YN0 B;  4HEA J;  4JTC B;  4IAQ A;  1ZHT A;  4MVO A;  3RQE A;  2XXA B;  3SNH A;  1FFT C;  4YK5 A;  2LCH A;  2L81 A;  4ER9 A;  1VK5 A;  3NRH A;  3FAP B;  2PX0 A;  2MYS A;  3T6J A;  1OR3 A;  2H7B A;  1C03 A;  1NZE A;  4QI2 A;  2W4B A;  2WVN A;  1JAF A;  2OG2 A;  2YRF A;  3WG7 C;  4LDK A;  5F5F A;  2H7O A;  3CZ6 A;  3ZQV A;  1TQG A;  3Q7L A;  4QDL A;  2YVK A;  3CAX A;  3F47 A;  1YZC A;  1H9T A;  3HNL A;  1HMO A;  2QNL A;  3HLZ A;  1WWP A;  4XPW A;  5E3A A;  5EGY A;  1D1C A;  1M6T A;  2BC5 A;  3IPM O;  3KL4 A;  2NPU A;  5KYW A;  1A7V A;  1O5H A;  3DKA A;  4CIH A;  4W8P A;  1JPJ A;  2F22 A;  3VF0 A;  1V74 B;  2LD6 A;  3HTK C;  5KYX A;  4C7O A;  5L0I A;  2AP3 A;  4PFO A;  5T3W A;  1AUE A;  3QMK A;  3GAN A;  3O39 A;  5BQG A;  3EHN A;  2UUI A;  5KYU A;  3L8J A;  3R2P A;  4U9E A;  1VLT A;  2J9V A;  5AC4 A;  4MVS A;  2PF4 E;  1YA7 O;  1RMV A;  3H2V A;  2HJ3 A;  2FGY A;  3CEX A;  3NKE A;  4LLC A;  4AL0 A;  3FMS A;  5TJ5 E;  2LFD A;  4BEM J;  1XZP A;  2JPU A;  4DOZ A;  3CQZ A;  3B9Q A;  2VAS A;  3AG1 C;  4N6C A;  4KC9 A;  4U5D E;  4L6R A;  1RCP A;  4BJ6 A;  4Q4Z F;  2A1D D;  1I5N A;  3C8G A;  4IRU A;  5T3T A;  3VAY A;  4OIQ F;  4JIO A;  1M56 C;  1VYK A;  2OJE D;  3ABL C;  2YLG A;  3DJN B;  2WZL A;  3NKD A;  4K1O A;  1SYQ A;  1B68 A;  1RJ9 B;  1U6H A;  2H7V C;  4MVR A;  3AGT A;  2QTV A;  1HE9 A;  3V5Y A;  3W8I A;  4AX2 A;  1TWC A;  1YDI A;  4B6I A;  3L0I A;  2D5R B;  3LLK A;  5CIV A;  3EG9 A;  2HMQ A;  1NBB A;  4XEF A;  2C04 A;  3A9C A;  1J8Y F;  4YL3 A;  5HV9 A;  2ZXW C;  3PMR A;  3H65 A;  1VTM P;  2HSB A;  2EIK C;  1LS4 A;  3UGP A;  1KNY A;  2W4M A;  1K40 A;  2G3K A;  4PR9 A;  3UMK A;  4WJ0 A;  1G8X A;  2QE9 A;  2XRH A;  3JRM O;  1GS9 A;  4KNV A;  3SYN A;  3W2V A;  5EHH A;  5GPG B;  1LPE A;  3US6 A;  1Z63 A;  1Q0F A;  3B0U X;  3M15 A;  2OKU A;  2JD3 A;  4FES A;  4C3D A;  3MX3 A;  2ZXP A;  3W8H A;  3B0V C;  4OIP F;  3C7J A;  5FCL A;  2R03 A;  4JKV A;  1V4A A;  2GAQ A;  4K0D A;  3U3F A;  1FAP B;  3RW0 A;  4I1M A;  2Y3B A;  1PV3 A;  5COM A;  1YLM A;  2AU5 A;  3RVY A;  1RKE B;  2FFH A;  2R9R B;  2WVQ A;  3JCU Q;  4EBB A;  5BUO A;  5E33 A;  4IAR A;  2Y3G A;  5JLI A;  1D0Y A;  3JRT A;  4FWV A;  2H8A A;  3MBG A;  3EH2 A;  1Z7Q c;  4I1O B;  2CNW A;  3FXH A;  2EIN C;  1SMY F;  2QY9 A;  1E86 A;  2W9Y A;  3PCV A;  1FR0 A;  2GDC A;  4EBJ A;  4CX9 A;  1BR4 A;  3ZG1 A;  1MMG A;  4MVZ A;  3U9J A;  1GQA A;  2C03 A;  2R7V A;  2KQ9 A;  4JCH A;  1EKY A;  1LIH A;  4DXW A;  4U5B E;  1LM3 B;  4NC3 A;  4HFF B;  3T4R A;  4U5G A;  3U2M A;  5KYY B;  1NLX A;  1ZW3 A;  4JW1 A;  2EIJ C;  3FVY A;  5A6A A;  3EGX B;  2J0X A;  4Z9I A;  4N06 A;  3BEH A;  4MW3 A;  4A2N B;  2CW0 F;  3ZTZ A;  1NSG B;  1CPR A;  2Y39 A;  3RF3 A;  3H2U A;  2EPK X;  2WL8 A;  2A68 F;  3JSE O;  1WAT A;  2HKV A;  2XS1 A;  2XLV A;  4MTO A;  2NUT A;  5KYN A;  1KTM A;  3LS0 A;  3ABM C;  1L3P A;  4YT5 A;  4AE4 A;  4E0H A;  2YL3 A;  3M1C B;  1ZHZ A;  4QI0 A;  1OKK A;  3O6X A;  4BEJ A;  2XL4 A;  5DS5 A;  3G50 A;  5JVE A;  3DMD A;  2PX3 A;  3NMJ A;  1FFH A;  2VC9 A;  4BG0 A;  5B3I A;  3GM3 A;  2YEV A;  5E2Q A;  3M79 A;  2X51 A;  4CDY A;  2A6H F;  4M63 A;  2V3C C;  4JJG A;  3TK0 A;  1NG1 A;  2VB6 A;  2X0C A;  1L7C A;  4DBR A;  2OU6 A;  2IOQ A;  3MLG A;  2XL6 A;  2VH3 A;  3UMH A;  1MMN A;  3N24 A;  4XQ1 A;  2Q9A A;  1ORS C;  2D4U A;  2Q4F A;  1H6G A;  1SF8 A;  4JRZ A;  4XEK A;  1XWJ A;  1T6I A;  2HZ8 A;  1TFO B;  2KGO A;  4GEH A;  2R02 A;  1LE4 A;  3Q7G A;  3DE8 A;  4H4K C;  4CDA A;  3B29 A;  3UR3 C;  2A0B A;  1LS1 A;  1EA8 A;  2R7U A;  2HFI A;  1Q0M A;  1SZI A;  1WAS A;  3C8G D;  3HNJ A;  4CBE A;  5L0J A;  2VCA A;  2VCC A;  1QSP A;  3ASO C;  4EWC A;  3N0T A;  3U2L A;  2PNO A;  2YLI A;  4JJF A;  3V5Z A;  4O6M A;  4XPY A;  3GWL A;  3AQB A;  3DAG A;  3EZI A;  5JP7 A;  4J32 B;  3OWT A;  4RD9 A;  1W2W A;  2P7V A;  1YJG A;  4W8K A;  1TWH A;  4MW8 A;  4GYT A;  3ZVR A;  3AG2 C;  4GQH A;  5KYW B;  1BR2 A;  1MMA A;  2HJM A;  1QVX A;  2LFF A;  1I4Z A;  5KYX B;  1ZZP A;  1CGN A;  3K1I C;  4JVS A;  4MND A;  3V5X A;  5L0D A;  4C7O B;  2Z15 A;  2EIL C;  1YZA A;  3NYL A;  2EPN A;  1TFK B;  4JZA A;  3VM6 A;  2P6V A;  3K33 A;  3K66 A;  1ZHX A;  3TJ5 A;  1QZX A;  2EPO A;  2LP4 A;  3UGO A;  1ZU4 A;  2R25 A;  1LI5 A;  2I15 A;  1VOM A;  3QVZ A;  4K7B A;  1FTS A;  1FMW A;  4E7Z A;  2V26 A;  1C17 M;  3RQG A;  4U5E E;  1HMD A;  3KMI A;  4U5H A;  1C02 A;  3S9O A;  2UUH A;  3IQ6 A;  4KBL A;  2XLO A;  3M4B A;  5A6J A;  3I5P A;  2NUP B;  1E85 A;  2PP4 A;  1M2V B;  3KPH A;  1G5Z A;  3C8G B;  1DOW A;  2CYD A;  3LNR A;  1MQV A;  3LS1 A;  4Q7C A;  4AL1 A;  1Z5Z A;  5F28 E;  4NCQ A;  1O3U A;  4BPM A;  2NSF A;  3ZSU A;  3S29 A;  3O55 A;  4PJJ A;  4EBK A;  2M4E A;  3R7C A;  2O9X A;  3GM2 A;  3GOR A;  2J7P A;  3LES A;  4XPX A;  2RSE B;  4O79 A;  2GA0 A;  1JRA A;  1APC A;  2B0J A;  4ANJ A;  3S0X A;  4EHP A;  4WGZ A;  3L34 A;  5COF A;  4O6N A;  4EKW A;  1H7I A;  2OOC A;  2XS8 A;  2YQY A;  1M57 C;  4U9D A;  4JUR I;  5T1D B;  3EG9 B;  2CNW D;  4BJT A;  5FZT A;  4LER A;  3K1H A;  1V55 C;  4KNW A;  4AK9 A;  1RKC A;  2WVO A;  1Z6A A;  1K04 A;  3MFN A;  2R7O A;  3K7D A;  1E83 A;  4CSA C;  3EPV A;  2DB4 A;  5COG A;  2JX0 A;  4MVQ A;  3OA1 A;  4PJN A;  1OCC C;  4YWQ A;  2A69 F;  5DS6 A;  1EQ1 A;  1PD1 A;  2ZXO A;  3QW0 A;  1OW8 A;  3TQO A;  3UNG C;  2HUJ A;  3T9O A;  4UDV A;  3VRC A;  4PK4 A;  1HE1 A;  1ORY A;  2LK4 A;  2VCB A;  3EGD A;  3NG1 A;  4IJJ A;  4WAB A;  2Q7R A;  3O10 A;  1QLE C;  2FAP B;  2YHS A;  5DVW A;  4DJ9 A;  2PBE A;  3JYY A;  3RQF A;  3RKO F;  4A4A A;  3I5Q A;  2XLE A;  5IY5 C;  1HW2 A;  2AWC A;  5B1A C;  4D4N A;  3PDM P;  1O87 A;  2G3V A;  2R7X A;  3CSK A;  1YYJ A;  1QKR A;  2L7A A;  3TOM A;  1PCX A;  5DLJ A;  2P1A A;  2XL8 A;  2OJQ A;  3DZA A;  4C3E A;  1OKK D;  3WAQ A;  4RDA A;  4LDQ A;  2ZD9 A;  3EQL F;  3TUL A;  3DXJ F;  2R7T A;  3GEE A;  4YJW A;  4D4X A;  1PD0 A;  4EIY A;  2XLH A;  2IXO A;  4DVZ A;  1OW7 A;  1LKX A;  4ULV A;  4WGY A;  3EFO A;  1Q0K A;  2E87 A;  4JE9 A;  3T6G B;  1IW7 F;  4JTA B;  3W4Y A;  3B71 A;  3ZTM A;  3K1I A;  5BQI A;  1LI7 A;  1XZQ A;  2CCY A;  2YWA A;  4BJ5 C;  1D1A A;  4H54 A;  3G4Z A;  2KW3 C;  4P9T A;  3SXM A;  2KC3 A;  5B3S C;  3SZR A;  1ST6 A;  3ZIB A;  1SR2 A;  3LEV A;  2EIM C;  4RBN A;  2LIG A; 
#chains in the Genus database with same CATH homology
 2XL6 A;  4U9E A;  2XM0 A;  2XLD A;  2XLM A;  4CDA A;  3U8P A;  3DE8 A;  3HNI A;  3HNJ A;  2QLA A;  4L6R A;  4N6H A;  1RCP A;  2YLI A;  2YKZ A;  5JP7 A;  4JEB A;  3FOO A;  2YLG A;  3IQ5 A;  2YLD A;  1CGN A;  3QVY A;  2J9B A;  4JEA A;  1YZA A;  4CJO A;  5JSL A;  1NBB A;  5JRA A;  3QVZ A;  3ZWI A;  5AGF A;  2YL7 A;  3C63 A;  3NMI A;  3IQ6 A;  2XLO A;  4CDV A;  1QQ3 A;  3M4B A;  1E85 A;  3QW1 A;  3M15 A;  1MQV A;  1QPU A;  4JKV A;  2J8W A;  3M4C A;  5JVE A;  1YYX A;  3NMK A;  3DE9 A;  3ZQY A;  1APC A;  4WGZ A;  4IAR A;  5JLI A;  1E84 A;  4U9D A;  4N4W A;  4CIP A;  1BBH A;  3FOP A;  1E83 A;  1E86 A;  3TOL A;  1CPQ A;  4CX9 A;  3QW0 A;  1CGO A;  1GQA A;  3C62 A;  3VRC A;  1EKY A;  2YL1 A;  3L1M A;  1LM3 B;  4NC3 A;  2XM4 A;  1S05 A;  2XLE A;  4IAQ A;  3ZTZ A;  1CPR A;  4D4N A;  2YL0 A;  1YYJ A;  3TOM A;  2XLV A;  2XL8 A;  4ER9 A;  2YL3 A;  2XLW A;  1JAF A;  4CJG A;  4D4X A;  5JS5 A;  4EIY A;  2XLH A;  3ZQV A;  1YZC A;  4ULV A;  4WGY A;  3NMJ A;  3HNL A;  3HNK A;  5JT4 A;  4JE9 A;  3ZTM A;  5B3I A;  3M79 A;  2CCY A;  1M6T A;  2BC5 A;  4CDY A;  1A7V A;  5JUA A;  4IB4 A;  256B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...