1E86A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with co bound to distal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e86A00
2YL0A 4ER9A 3U8PA 2XLEA 3C62A 4JEBA 3HNJA 2XL6A 3HNLA 3M15A 1APCA 4EIYA 4IB4A 5JS5A 4D4NA 4JKVA 1YZAA 2BC5A 2YL3A 5JP7A 4L6RA 3TOMA 2J8WA 1CGOA 1QPUA 2QLAA 4CDVA 3NMJA 5JVEA 2YL1A 3QW1A 1NBBA 4JE9A 5JRAA 1EKYA 1A7VA 1E86A 4D4XA 4JEAA 5B3IA 3TOLA 5AGFA 4CDYA 3ZQYA 4N6HA 1E84A 4WGZA 3NMKA 256BA 2YL7A 3NMIA 1YZCA 1E83A 3L1MA 3ZWIA 3HNKA 2XM4A 2J9BA 3DE9A 1GQAA 1M6TA 1CPRA 2YLGA 2YLIA 3C63A 3VRCA 2XLDA 4IAQA 1MQVA 2XL8A 4CIPA 4IARA 4CJOA 3M4CA 1BBHA 2XLWA 3QVYA 2YLDA 4N4WA 2CCYA 3FOOA 4ULVA 4CX9A 5JUAA 4CJGA 4NC3A 3ZTMA 1CGNA 3DE8A 3QVZA 3HNIA 3M4BA 2XM0A 3FOPA 1YYJA 4U9DA 5JT4A 3QW0A 2XLMA 3M79A 1RCPA 3ZQVA 3IQ6A 5JSLA 3IQ5A 1S05A 1YYXA 2XLVA 4CDAA 1CPQA 1JAFA 1QQ3A 2XLHA 4WGYA 1E85A 2XLOA 3ZTZA 4U9EA 2YKZA 5JLIA 1LM3B
chains in the Genus database with same CATH superfamily
3RVYA 1PCXA 1ZVZA 3ZG1A 3JCUQ 3C8ZA 3IHUA 1OKKA 2XLEA 3C62A 3DAGA 2KW3C 3CZ6A 4JEBA 3LS0A 2P6VA 3HNLA 4AK9A 4PFOA 3S28A 3EGDA 2CYDA 3RKOF 1BR2A 3Q6NA 4IB4A 4D4NA 5F5FA 2YL3A 1NFNA 3TOMA 3V7OA 3ZDLA 3LLIA 3K1IA 4CS9A 1HW1A 1U89A 1CGOA 3E9VA 1YARO 3FHDA 2H7OA 2QY9A 2AU5A 2G3VA 3H65A 1RMVA 2RD9A 1TFKB 1BDJB 3C8GA 3KH2A 2YL1A 4O6NA 5JVEA 1ZW3A 2Y39A 3CEXA 5L0GA 2KJGA 3NYMA 2J9VA 5JRAA 1PV3A 5KYYA 2R05A 3FVYA 3AQCA 3EFOB 1LI5A 4JEAA 4MNDA 1SMYF 3BRJA 2YZSA 3TOLA 2Q7RA 1ZU5A 5AGFA 4BJ5A 2W4BA 4CDYA 3LEOA 1XZPA 2UUIA 1ORSC 3PCVA 2IXMA 2CNWD 1SF8A 2L6HA 3R7CA 4G7HF 4C7OB 1F1MA 4WGZA 1QKRA 1OCRC 1KU2A 2LD6A 3HLZA 1IW7F 1Q0GA 4I44A 3DKAA 4R32A 5KYXA 4AX2A 2L6GA 1K40A 2OEXA 2PFDA 3JYHA 1OW8A 2CNWA 2XS8A 4K0DA 4U5BE 4YL1A 1WATA 2GWWA 3SEOA 3W8HA 5F28E 4A2NB 1FNTc 1L3PA 4XWJA 4MVUA 1HE1A 3ZSUA 2ASRA 3EFOA 3I4UA 4PJJA 2F22A 1YZCA 2EPMX 4IJJA 4MVQA 3G4ZA 1JRAA 3TD7A 4E7SA 2X0CA 2VASA 1NG1A 3RYLA 3NG1A 1LE4A 4PFPA 4YL3A 4QI0A 4JVSA 1T6IA 3ZC4A 2FGYA 2YEVA 3TK0A 1UG7A 5L3QA 1FTSA 1DOWA 1M6TA 2P7VA 3GEHA 4LACB 3T6GB 3U8VA 1CPRA 2PF4E 5E3AA 1RJ9B 4EWCA 4AE4B 3AGUA 4KBLA 4W8PA 3I5QA 2Q00A 1S7ZA 4J30B 3UMKA 1OQCA 1LPEA 3O6XA 3VRCA 4QI2A 4O7GA 2J9UA 1W2WA 5KYWB 1MQVA 1ZW2A 2A1DD 3GM3A 2HJ3A 3JTLO 4RBNA 5GPGB 3RQEA 3SP1A 4CIPA 1PD0A 4IARA 4LDQA 2HMQA 1E2XA 3H2VA 1LKXA 1OKKD 1MNEA 4W8KA 2LIGA 1LS1A 2DI3A 4MVMA 2KQ9A 4ULVA 1LIHA 5COGA 3S9OA 4E0HA 2V3CC 4YN0B 3LNRA 1CGNA 3AG4C 3PDMP 3HNIA 1AVOB 3M4BA 3MX3A 5TJ5E 2XM0A 3I5PA 1JPNA 1FMVA 4IAOA 4E7ZA 2J45A 2L7AA 1Z3IX 4FAPB 2DGJA 2V26A 1QZXA 3DJUB 3IQ6A 4EHPA 3KMIA 3AOUA 3FAJA 1Q0KA 4YWQA 2JD3A 4WJ0A 2LCHA 3OA1A 1Q0FA 4JW1A 4Z9HA 2XLHA 3EG9A 4CBEA 3CQZA 2Y3HA 1I4YA 1T9KA 2IYLD 4NTFA 4P9TA 1A7DA 3FAPB 4OD4A 2JPUA 5D91A 3SXYA 3Q6MA 2W9YA 3KYIA 4LDRA 1GM5A 2EPOA 2BE5F 2BL2A 4C3EA 5EK0A 4CS9C 3DI5A 3US6A 2HZ8A 2J0XA 4C3BA 2WVQA 2L6FA 4IRUA 4BPMA 2J7PD 1MMDA 3T9OA 2D4UA 3EHNA 1D0XA 3MLGA 1Q0MA 2ZXRA 4I1MA 2LP4A 4JCHA 3WG7C 4ER9A 4WABA 5HV9A 1QLEC 1NU7D 4GYTA 4JZAA 5KYWA 2KNHA 3HNJA 5KYUB 1APCA 4LLEA 3U3BA 2R02A 2CW0F 2ZXPA 3CAXA 5KYNA 1VLTA 2OJED 4P9FA 1WASA 3RH3A 3UR3C 1SZIA 2L81A 2NUTB 2R7UA 3DAFA 2PX3A 2VCAA 4XQ1A 2VH3A 5BQIA 2R7WA 1FR0A 2NG1A 2XS1A 2J8WA 3PHF2 1QPUA 2A0BA 4MTOA 1D0ZA 2IBFA 3HKKA 3UGOA 4KNVA 2QLAA 4NTBA 1YDIA 2XXAA 4EBJA 2R7VA 4G7OF 3L34A 3FMSA 1OXBA 1A7VA 1V55C 5DQZA 3E70C 2DB4A 4C7OA 2VCBA 4Q5SF 1MMAA 1OR3A 3HJCA 1A7EA 2IM8A 2YVKA 1V54C 3FXHA 4KC9A 4GEHA 1Z7Qc 3RW0A 3LUTB 3A11A 1R5ID 3EH1A 4N6HA 1ZYRF 3SXKA 2HKVA 1OW7A 4PJLA 3T6BA 4YT4A 1ZHWA 5L0IA 1XZQA 2GDCA 4MTFA 3VYWA 4J32B 2GFHA 2Y69C 3W2VA 1QSPA 1OCZC 2YL7A 3T6JA 4DBRA 4Q4ZF 4HFKB 2HJMA 2QTVA 3EZIA 1BR4A 5BQHA 2PNOA 1ZZPA 3L1MA 2WVOA 4JIOA 3JSEO 1D1AA 2HUJA 1SYQA 4NY3A 3ZWIA 5DQTA 4Q7CA 4BJ6C 3L8JA 4BJ1A 1FMWA 1QVXA 1GGQA 2XL4A 5KYUA 2FAPB 2R7RA 1IZMA 2Z15A 2A68F 2M4EA 4BEJA 1GQAA 2NPUA 1OW6A 2A6EF 3K33A 4YT5A 4OD5A 4YT2A 4KI2A 3QZCA 1KTMA 2XRHA 2ZD9A 2NSGA 5A6AA 3GORA 2HV7A 2HSBA 3G50A 3B0VC 2A69F 3C63A 4BEMJ 3MFNA 1H7IA 2CGEA 1ORJA 4DOZA 4DXWA 1WOLA 5BUOA 1RJ9A 3ITFA 2H8AA 2HS5A 1H6GA 5EGYA 4CJOA 3EGXB 1BBHA 3EPVA 1M2VA 2XLWA 4ONSA 3EQLF 3VAYA 3S0XA 4RD9A 2WZGA 4CX9A 1MNDA 1TR2A 1Q0DA 4Z9JA 2EPLX 3UMIA 4Z9IA 1ORYA 4XTKA 2X51A 3DE8A 3N0TA 3QVZA 4K7BA 2OJQA 1UFBA 5E33A 3GODA 2J46A 5L0CA 3FOPA 4KNWA 3QW0A 4JRZA 4PK4A 5JT4A 2OG2A 2DYSC 2XLMA 2AWCA 1RCPA 3DD7A 2R03A 3M79A 3U2MA 4OIQF 1RKEB 3M1CB 3HTKC 2AP3A 1ZU4A 4FX5A 4U5EE 3GM2A 3TJ5A 3EJNA 2Y3DA 3B0PA 2D5RB 1QQ3A 5A6BA 1JMWA 3K1IC 4DJ9A 3U0CA 2W45A 3F47A 3JYYA 2MYSA 2C04A 4CS7A 1LI7A 4U9EA 1T6UA 4BJTA 2PBEA 4EUKB 3U9JA 5F5HA 2HV6A 2YKZA 2KK1A 4LERA 4E17A 1Z63A 1JR8A 4NTAA 2KC3A 2R7QA 4JJGA 3AGTA 1VB5A 4JJFA 3ECSA 1D1CA 2IXOA 3KYJA 4X0RA 4QDLA 4MVSA 2YL0A 2E87A 2HSQA 2O9XA 3LEVA 2R7XA 5AC5A 1O5HA 2LQGA 2R7OA 3QTHA 4XLPF 4I1OB 4BJ6A 2OEVA 2ZXWC 4YL0A 4E18A 5DS4A 1EI7A 5JS5A 4YJWA 1YZAA 3BEHA 3T4RA 1VYKA 2WZLA 3GEIA 2JX0A 4L6RA 5JP7A 4O6YA 4ANJA 5HSWA 4RDAA 2ICWG 2Y3BA 1WGWA 2KGOA 4CDVA 4OIOF 5IY5C 5L0DA 1V4AA 3U3FA 3B9QA 4A4AA 1M57C 5E2QA 2J0WA 4H4KC 3NKEA 5B1AC 2G3KA 3ASOC 2LFDA 1T5OA 3K6BA 5B1BC 1R4TA 5B3IA 1VTMP 4P6IC 2EIMC 2LK4A 4JCZA 1HW2A 2R9RB 1G5ZA 1Z23A 2AVKA 3C8GD 4JTDB 4N06A 4XEVA 3ZQYA 5AC4A 5EHHA 3C18A 1J8YF 5DVWA 4B6IA 4IGGA 3L8IA 1ZHYA 2EIKC 3EH2A 2ZXOA 3TULA 2HFIA 4FWVA 3N24A 5COMA 3NMKA 4EBKA 1N1CA 2H7VC 3JSZA 3FDQA 2IXNA 5KYXB 1M2VB 2J9WA 4G78A 1T01A 3LAYA 4GQHA 4MQ9F 1D0YA 2WZFA 2P61A 3UGPA 2KYHA 2C03A 1L7CA 4IWBA 4MVZA 4NQFA 4JTCB 1XWJA 3NYJA 1Y6DA 3HNKA 1NU9C 2VB6A 3MYIA 2XM4A 4HFFB 1C02A 2MHRA 3DZAA 3KL4A 4LLCA 5KYYB 3LESA 1O87A 1MMNA 1YJGA 2YLIA 3EZHA 4MW3A 1LVKA 2Q3TA 2Y3GA 1LE2A 1O3UA 4AE4A 4EKWA 1TQGA 4IAQA 3GM1A 3AG1C 3ATPA 2PX0A 4O6MA 4N6CA 3U2LA 3M4CA 3GWNA 2A0UA 4K1OA 3QVYA 5L3VA 2YLDA 4JTAB 2R7SA 1HY5A 1VK5A 3GEEA 4N4WA 1WTYA 2R25A 3JZ0A 1BR1A 2H7BA 4H54A 3ABKC 3EGDB 4XPXA 2OCCC 4XLNF 4U5CE 3U5SA 2QUPA 5JUAA 2EPKX 1J8MF 3ZTMA 3ABMC 5L0JA 4BJ5C 4UDVA 3W8IA 2P0NA 3J06A 2P1AA 2IOQA 1EA8A 4XPWA 3S27A 3DM9B 3A9CA 4U9DA 2RSEB 1H9GA 1Y4CA 2LFFA 1RKCA 4NCQA 3ZQVA 3B29A 5JSLA 4JC7A 5A6BD 2QNLA 3NRHA 3LS1A 2FFHA 3LJBA 2Q9BA 3R2PA 4CS8A 1CPQA 3Q7GA 3ZVRA 4WGYA 1E85A 2XLOA 1H9TA 5A6KA 1OR2A 2GAQA 2VCCA 3RVZA 1HMDA 3EG9B 3PMRA 1GS9A 3IPMO 5FCLA 3K7DA 5E3CA 2EIJC 4CIHA 3QMKA 1SR2A 4F4BA 4J7TA 4PACA 4CS8C 2VC9A 4PJMA 3MBGA 1NZEA 3VM6A 3WAQA 1EQ1A 5JLIA 1G4WR 1KNYA 3V5YA 2M64A 1LM3B 1TWAA 2W4MA 4CSAC 3SZRA 3UMHA 1TKNA 1YLMA 3O55A 3SNHA 2WB7A 4XPYA 1FAPB 4OIRF 3U8PA 1G8XA 3EGXA 1D1BA 3X2QC 1K04A 5L0HA 5BQGA 2XL6A 3ZIBA 2B0HA 3M15A 4MS2A 1AUEA 4EIYA 3B71A 4ZLCA 2MWQA 1YA9A 3H2UA 4DVZA 4JKVA 1ZHTA 3C7JA 2BC5A 5COFA 4G7ZF 3KKBA 3NKDA 4I3MA 1JPJA 3NYLA 2A6HF 2B0JA 2LSEA 2OQMA 1B68A 3KPHA 1AEPA 2I15A 3AG2C 1YAUO 3N2ZB 1Z6AA 5T3TA 3NMJA 2NUPB 3SXMA 5CIVA 1YA7O 1LS4A 3QW1A 4C3DA 4JURI 5DLJA 3B0UX 3K66A 1NBBA 4JE9A 4LDKA 4M63A 5DS5A 1EKYA 1RKEA 1NSGB 5FZTA 1E86A 4D4XA 3RQFA 1TFOB 4PR9A 1WN0A 4U5DE 3JT1A 4MTGA 4XEKA 2XSEA 3NDBB 1NLXA 2IXPA 2YHSA 1VLSA 1A41A 1PD1A 3F46A 4FESA 5D92A 4HE8D 1A0BA 4O79A 3VF0A 4DVYP 1E84A 4OIPF 4MVRA 4MVOA 3IEEA 3ASNC 1VMAA 3RIPA 2EILC 2QE9A 1I5NA 1V74B 3AG3C 3V5XA 1T6QA 1FFHA 256BA 4PJNA 1JOGA 4U5FE 3S90A 4XEFA 3TJ6A 4YT8A 2J7PA 3DM5A 3RF3A 2Q9CA 4E0IA 1I4ZA 3LLKA 3NMIA 1E83A 1YVIA 3MYFA 3POVA 3UNGC 1WWPA 1MMGA 3OEOA 3AJMA 4BG0A 2UUHA 1VYIA 3Q7LA 3IQCA 5DS6A 1U0BB 1TWGA 2J9BA 3DE9A 3DXJF 2NUTA 1C17M 4DBQA 2AWYA 4MW8A 3U9MA 2YLGA 2WL8A 2OKUA 2WVNA 1ZHXA 3DMDA 3GWLA 3JRTA 3JRMO 3L0IA 2XLDA 3LNMB 3G4XA 1VOMA 3OWTA 4HEAJ 3TQOA 2XL8A 5T3WA 1K05A 2NSFA 1DOVA 1OCCC 1Z5ZA 2KSFA 2YRFA 1M2OA 1ST6A 4DRIB 3W2WA 2ZPAA 3CSKA 2I8BA 5K0IA 5T1DB 2CCYA 4G0HA 3S29A 1HE9A 3FOOA 4ULWA 5B3SC 3DJNB 2GA0A 4ZLDA 5A6JA 4J7YA 1TWHA 1BZ4A 4CJGA 2PP4A 4NC3A 3SYNA 1G4US 5CI9A 3S84A 1OCOC 3O39A 4YK5A 2YWAA 2CDQA 1TWCA 3GANA 1YYJA 3IQTA 2EINC 2HMZA 3K1HA 1RXQA 1FFTC 2Q4FA 3RFYA 3W4YA 2ETSA 2OU6A 3O10A 5CI8A 3ABLC 3WODF 3X1OA 4DRJB 3IQ5A 2YQYA 1S05A 1YYXA 2XLVA 3RQGA 4CDAA 3EHMA 1C03A 4AL1A 3SXZA 4U5GA 1JAFA 2EPNA 3C8GB 4EBBA 1U6HA 2OOCA 2Q9AA 3ZTZA 3WHNA 4DRHB 4U5HA 1NFOA 3V5ZA 2G62A 2L9JA 5L0FA 4AL0A 2TMVP 5A69A 4CSAA 4OINF 1HMOA 2NUPA 1CGME 2R7TA 1M56C 3DWWA 1OXKA 1ZHZA 3AQBA 2XXAB 2DYRC
chains in the Genus database with same CATH topology
2YL0A 4ER9A 3U8PA 2XLEA 3C62A 4JEBA 3HNJA 2XL6A 3HNLA 3M15A 1APCA 4EIYA 4IB4A 5JS5A 4D4NA 4JKVA 1YZAA 2BC5A 2YL3A 5JP7A 4L6RA 3TOMA 2J8WA 1CGOA 1QPUA 2QLAA 4CDVA 3NMJA 5JVEA 2YL1A 3QW1A 1NBBA 4JE9A 5JRAA 1EKYA 1A7VA 1E86A 4D4XA 4JEAA 5B3IA 3TOLA 5AGFA 4CDYA 3ZQYA 4N6HA 1E84A 4WGZA 3NMKA 256BA 2YL7A 3NMIA 1YZCA 1E83A 3L1MA 3ZWIA 3HNKA 2XM4A 2J9BA 3DE9A 1GQAA 1M6TA 1CPRA 2YLGA 2YLIA 3C63A 3VRCA 2XLDA 4IAQA 1MQVA 2XL8A 4CIPA 4IARA 4CJOA 3M4CA 1BBHA 2XLWA 3QVYA 2YLDA 4N4WA 2CCYA 3FOOA 4ULVA 4CX9A 5JUAA 4CJGA 4NC3A 3ZTMA 1CGNA 3DE8A 3QVZA 3HNIA 3M4BA 2XM0A 3FOPA 1YYJA 4U9DA 5JT4A 3QW0A 2XLMA 3M79A 1RCPA 3ZQVA 3IQ6A 5JSLA 3IQ5A 1S05A 1YYXA 2XLVA 4CDAA 1CPQA 1JAFA 1QQ3A 2XLHA 4WGYA 1E85A 2XLOA 3ZTZA 4U9EA 2YKZA 5JLIA 1LM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL0 A;  4ER9 A;  3U8P A;  2XLE A;  3C62 A;  4JEB A;  3HNJ A;  2XL6 A;  3HNL A;  3M15 A;  1APC A;  4EIY A;  4IB4 A;  5JS5 A;  4D4N A;  4JKV A;  1YZA A;  2BC5 A;  2YL3 A;  5JP7 A;  4L6R A;  3TOM A;  2J8W A;  1CGO A;  1QPU A;  2QLA A;  4CDV A;  3NMJ A;  5JVE A;  2YL1 A;  3QW1 A;  1NBB A;  4JE9 A;  5JRA A;  1EKY A;  1A7V A;  1E86 A;  4D4X A;  4JEA A;  5B3I A;  3TOL A;  5AGF A;  4CDY A;  3ZQY A;  4N6H A;  1E84 A;  4WGZ A;  3NMK A;  256B A;  2YL7 A;  3NMI A;  1YZC A;  1E83 A;  3L1M A;  3ZWI A;  3HNK A;  2XM4 A;  2J9B A;  3DE9 A;  1GQA A;  1M6T A;  1CPR A;  2YLG A;  2YLI A;  3C63 A;  3VRC A;  2XLD A;  4IAQ A;  1MQV A;  2XL8 A;  4CIP A;  4IAR A;  4CJO A;  3M4C A;  1BBH A;  2XLW A;  3QVY A;  2YLD A;  4N4W A;  2CCY A;  3FOO A;  4ULV A;  4CX9 A;  5JUA A;  4CJG A;  4NC3 A;  3ZTM A;  1CGN A;  3DE8 A;  3QVZ A;  3HNI A;  3M4B A;  2XM0 A;  3FOP A;  1YYJ A;  4U9D A;  5JT4 A;  3QW0 A;  2XLM A;  3M79 A;  1RCP A;  3ZQV A;  3IQ6 A;  5JSL A;  3IQ5 A;  1S05 A;  1YYX A;  2XLV A;  4CDA A;  1CPQ A;  1JAF A;  1QQ3 A;  2XLH A;  4WGY A;  1E85 A;  2XLO A;  3ZTZ A;  4U9E A;  2YKZ A;  5JLI A;  1LM3 B; 
#chains in the Genus database with same CATH topology
 3RVY A;  1PCX A;  1ZVZ A;  3ZG1 A;  3JCU Q;  3C8Z A;  3IHU A;  1OKK A;  2XLE A;  3C62 A;  3DAG A;  2KW3 C;  3CZ6 A;  4JEB A;  3LS0 A;  2P6V A;  3HNL A;  4AK9 A;  4PFO A;  3S28 A;  3EGD A;  2CYD A;  3RKO F;  1BR2 A;  3Q6N A;  4IB4 A;  4D4N A;  5F5F A;  2YL3 A;  1NFN A;  3TOM A;  3V7O A;  3ZDL A;  3LLI A;  3K1I A;  4CS9 A;  1HW1 A;  1U89 A;  1CGO A;  3E9V A;  1YAR O;  3FHD A;  2H7O A;  2QY9 A;  2AU5 A;  2G3V A;  3H65 A;  1RMV A;  2RD9 A;  1TFK B;  1BDJ B;  3C8G A;  3KH2 A;  2YL1 A;  4O6N A;  5JVE A;  1ZW3 A;  2Y39 A;  3CEX A;  5L0G A;  2KJG A;  3NYM A;  2J9V A;  5JRA A;  1PV3 A;  5KYY A;  2R05 A;  3FVY A;  3AQC A;  3EFO B;  1LI5 A;  4JEA A;  4MND A;  1SMY F;  3BRJ A;  2YZS A;  3TOL A;  2Q7R A;  1ZU5 A;  5AGF A;  4BJ5 A;  2W4B A;  4CDY A;  3LEO A;  1XZP A;  2UUI A;  1ORS C;  3PCV A;  2IXM A;  2CNW D;  1SF8 A;  2L6H A;  3R7C A;  4G7H F;  4C7O B;  1F1M A;  4WGZ A;  1QKR A;  1OCR C;  1KU2 A;  2LD6 A;  3HLZ A;  1IW7 F;  1Q0G A;  4I44 A;  3DKA A;  4R32 A;  5KYX A;  4AX2 A;  2L6G A;  1K40 A;  2OEX A;  2PFD A;  3JYH A;  1OW8 A;  2CNW A;  2XS8 A;  4K0D A;  4U5B E;  4YL1 A;  1WAT A;  2GWW A;  3SEO A;  3W8H A;  5F28 E;  4A2N B;  1FNT c;  1L3P A;  4XWJ A;  4MVU A;  1HE1 A;  3ZSU A;  2ASR A;  3EFO A;  3I4U A;  4PJJ A;  2F22 A;  1YZC A;  2EPM X;  4IJJ A;  4MVQ A;  3G4Z A;  1JRA A;  3TD7 A;  4E7S A;  2X0C A;  2VAS A;  1NG1 A;  3RYL A;  3NG1 A;  1LE4 A;  4PFP A;  4YL3 A;  4QI0 A;  4JVS A;  1T6I A;  3ZC4 A;  2FGY A;  2YEV A;  3TK0 A;  1UG7 A;  5L3Q A;  1FTS A;  1DOW A;  1M6T A;  2P7V A;  3GEH A;  4LAC B;  3T6G B;  3U8V A;  1CPR A;  2PF4 E;  5E3A A;  1RJ9 B;  4EWC A;  4AE4 B;  3AGU A;  4KBL A;  4W8P A;  3I5Q A;  2Q00 A;  1S7Z A;  4J30 B;  3UMK A;  1OQC A;  1LPE A;  3O6X A;  3VRC A;  4QI2 A;  4O7G A;  2J9U A;  1W2W A;  5KYW B;  1MQV A;  1ZW2 A;  2A1D D;  3GM3 A;  2HJ3 A;  3JTL O;  4RBN A;  5GPG B;  3RQE A;  3SP1 A;  4CIP A;  1PD0 A;  4IAR A;  4LDQ A;  2HMQ A;  1E2X A;  3H2V A;  1LKX A;  1OKK D;  1MNE A;  4W8K A;  2LIG A;  1LS1 A;  2DI3 A;  4MVM A;  2KQ9 A;  4ULV A;  1LIH A;  5COG A;  3S9O A;  4E0H A;  2V3C C;  4YN0 B;  3LNR A;  1CGN A;  3AG4 C;  3PDM P;  3HNI A;  1AVO B;  3M4B A;  3MX3 A;  5TJ5 E;  2XM0 A;  3I5P A;  1JPN A;  1FMV A;  4IAO A;  4E7Z A;  2J45 A;  2L7A A;  1Z3I X;  4FAP B;  2DGJ A;  2V26 A;  1QZX A;  3DJU B;  3IQ6 A;  4EHP A;  3KMI A;  3AOU A;  3FAJ A;  1Q0K A;  4YWQ A;  2JD3 A;  4WJ0 A;  2LCH A;  3OA1 A;  1Q0F A;  4JW1 A;  4Z9H A;  2XLH A;  3EG9 A;  4CBE A;  3CQZ A;  2Y3H A;  1I4Y A;  1T9K A;  2IYL D;  4NTF A;  4P9T A;  1A7D A;  3FAP B;  4OD4 A;  2JPU A;  5D91 A;  3SXY A;  3Q6M A;  2W9Y A;  3KYI A;  4LDR A;  1GM5 A;  2EPO A;  2BE5 F;  2BL2 A;  4C3E A;  5EK0 A;  4CS9 C;  3DI5 A;  3US6 A;  2HZ8 A;  2J0X A;  4C3B A;  2WVQ A;  2L6F A;  4IRU A;  4BPM A;  2J7P D;  1MMD A;  3T9O A;  2D4U A;  3EHN A;  1D0X A;  3MLG A;  1Q0M A;  2ZXR A;  4I1M A;  2LP4 A;  4JCH A;  3WG7 C;  4ER9 A;  4WAB A;  5HV9 A;  1QLE C;  1NU7 D;  4GYT A;  4JZA A;  5KYW A;  2KNH A;  3HNJ A;  5KYU B;  1APC A;  4LLE A;  3U3B A;  2R02 A;  2CW0 F;  2ZXP A;  3CAX A;  5KYN A;  1VLT A;  2OJE D;  4P9F A;  1WAS A;  3RH3 A;  3UR3 C;  1SZI A;  2L81 A;  2NUT B;  2R7U A;  3DAF A;  2PX3 A;  2VCA A;  4XQ1 A;  2VH3 A;  5BQI A;  2R7W A;  1FR0 A;  2NG1 A;  2XS1 A;  2J8W A;  3PHF 2;  1QPU A;  2A0B A;  4MTO A;  1D0Z A;  2IBF A;  3HKK A;  3UGO A;  4KNV A;  2QLA A;  4NTB A;  1YDI A;  2XXA A;  4EBJ A;  2R7V A;  4G7O F;  3L34 A;  3FMS A;  1OXB A;  1A7V A;  1V55 C;  5DQZ A;  3E70 C;  2DB4 A;  4C7O A;  2VCB A;  4Q5S F;  1MMA A;  1OR3 A;  3HJC A;  1A7E A;  2IM8 A;  2YVK A;  1V54 C;  3FXH A;  4KC9 A;  4GEH A;  1Z7Q c;  3RW0 A;  3LUT B;  3A11 A;  1R5I D;  3EH1 A;  4N6H A;  1ZYR F;  3SXK A;  2HKV A;  1OW7 A;  4PJL A;  3T6B A;  4YT4 A;  1ZHW A;  5L0I A;  1XZQ A;  2GDC A;  4MTF A;  3VYW A;  4J32 B;  2GFH A;  2Y69 C;  3W2V A;  1QSP A;  1OCZ C;  2YL7 A;  3T6J A;  4DBR A;  4Q4Z F;  4HFK B;  2HJM A;  2QTV A;  3EZI A;  1BR4 A;  5BQH A;  2PNO A;  1ZZP A;  3L1M A;  2WVO A;  4JIO A;  3JSE O;  1D1A A;  2HUJ A;  1SYQ A;  4NY3 A;  3ZWI A;  5DQT A;  4Q7C A;  4BJ6 C;  3L8J A;  4BJ1 A;  1FMW A;  1QVX A;  1GGQ A;  2XL4 A;  5KYU A;  2FAP B;  2R7R A;  1IZM A;  2Z15 A;  2A68 F;  2M4E A;  4BEJ A;  1GQA A;  2NPU A;  1OW6 A;  2A6E F;  3K33 A;  4YT5 A;  4OD5 A;  4YT2 A;  4KI2 A;  3QZC A;  1KTM A;  2XRH A;  2ZD9 A;  2NSG A;  5A6A A;  3GOR A;  2HV7 A;  2HSB A;  3G50 A;  3B0V C;  2A69 F;  3C63 A;  4BEM J;  3MFN A;  1H7I A;  2CGE A;  1ORJ A;  4DOZ A;  4DXW A;  1WOL A;  5BUO A;  1RJ9 A;  3ITF A;  2H8A A;  2HS5 A;  1H6G A;  5EGY A;  4CJO A;  3EGX B;  1BBH A;  3EPV A;  1M2V A;  2XLW A;  4ONS A;  3EQL F;  3VAY A;  3S0X A;  4RD9 A;  2WZG A;  4CX9 A;  1MND A;  1TR2 A;  1Q0D A;  4Z9J A;  2EPL X;  3UMI A;  4Z9I A;  1ORY A;  4XTK A;  2X51 A;  3DE8 A;  3N0T A;  3QVZ A;  4K7B A;  2OJQ A;  1UFB A;  5E33 A;  3GOD A;  2J46 A;  5L0C A;  3FOP A;  4KNW A;  3QW0 A;  4JRZ A;  4PK4 A;  5JT4 A;  2OG2 A;  2DYS C;  2XLM A;  2AWC A;  1RCP A;  3DD7 A;  2R03 A;  3M79 A;  3U2M A;  4OIQ F;  1RKE B;  3M1C B;  3HTK C;  2AP3 A;  1ZU4 A;  4FX5 A;  4U5E E;  3GM2 A;  3TJ5 A;  3EJN A;  2Y3D A;  3B0P A;  2D5R B;  1QQ3 A;  5A6B A;  1JMW A;  3K1I C;  4DJ9 A;  3U0C A;  2W45 A;  3F47 A;  3JYY A;  2MYS A;  2C04 A;  4CS7 A;  1LI7 A;  4U9E A;  1T6U A;  4BJT A;  2PBE A;  4EUK B;  3U9J A;  5F5H A;  2HV6 A;  2YKZ A;  2KK1 A;  4LER A;  4E17 A;  1Z63 A;  1JR8 A;  4NTA A;  2KC3 A;  2R7Q A;  4JJG A;  3AGT A;  1VB5 A;  4JJF A;  3ECS A;  1D1C A;  2IXO A;  3KYJ A;  4X0R A;  4QDL A;  4MVS A;  2YL0 A;  2E87 A;  2HSQ A;  2O9X A;  3LEV A;  2R7X A;  5AC5 A;  1O5H A;  2LQG A;  2R7O A;  3QTH A;  4XLP F;  4I1O B;  4BJ6 A;  2OEV A;  2ZXW C;  4YL0 A;  4E18 A;  5DS4 A;  1EI7 A;  5JS5 A;  4YJW A;  1YZA A;  3BEH A;  3T4R A;  1VYK A;  2WZL A;  3GEI A;  2JX0 A;  4L6R A;  5JP7 A;  4O6Y A;  4ANJ A;  5HSW A;  4RDA A;  2ICW G;  2Y3B A;  1WGW A;  2KGO A;  4CDV A;  4OIO F;  5IY5 C;  5L0D A;  1V4A A;  3U3F A;  3B9Q A;  4A4A A;  1M57 C;  5E2Q A;  2J0W A;  4H4K C;  3NKE A;  5B1A C;  2G3K A;  3ASO C;  2LFD A;  1T5O A;  3K6B A;  5B1B C;  1R4T A;  5B3I A;  1VTM P;  4P6I C;  2EIM C;  2LK4 A;  4JCZ A;  1HW2 A;  2R9R B;  1G5Z A;  1Z23 A;  2AVK A;  3C8G D;  4JTD B;  4N06 A;  4XEV A;  3ZQY A;  5AC4 A;  5EHH A;  3C18 A;  1J8Y F;  5DVW A;  4B6I A;  4IGG A;  3L8I A;  1ZHY A;  2EIK C;  3EH2 A;  2ZXO A;  3TUL A;  2HFI A;  4FWV A;  3N24 A;  5COM A;  3NMK A;  4EBK A;  1N1C A;  2H7V C;  3JSZ A;  3FDQ A;  2IXN A;  5KYX B;  1M2V B;  2J9W A;  4G78 A;  1T01 A;  3LAY A;  4GQH A;  4MQ9 F;  1D0Y A;  2WZF A;  2P61 A;  3UGP A;  2KYH A;  2C03 A;  1L7C A;  4IWB A;  4MVZ A;  4NQF A;  4JTC B;  1XWJ A;  3NYJ A;  1Y6D A;  3HNK A;  1NU9 C;  2VB6 A;  3MYI A;  2XM4 A;  4HFF B;  1C02 A;  2MHR A;  3DZA A;  3KL4 A;  4LLC A;  5KYY B;  3LES A;  1O87 A;  1MMN A;  1YJG A;  2YLI A;  3EZH A;  4MW3 A;  1LVK A;  2Q3T A;  2Y3G A;  1LE2 A;  1O3U A;  4AE4 A;  4EKW A;  1TQG A;  4IAQ A;  3GM1 A;  3AG1 C;  3ATP A;  2PX0 A;  4O6M A;  4N6C A;  3U2L A;  3M4C A;  3GWN A;  2A0U A;  4K1O A;  3QVY A;  5L3V A;  2YLD A;  4JTA B;  2R7S A;  1HY5 A;  1VK5 A;  3GEE A;  4N4W A;  1WTY A;  2R25 A;  3JZ0 A;  1BR1 A;  2H7B A;  4H54 A;  3ABK C;  3EGD B;  4XPX A;  2OCC C;  4XLN F;  4U5C E;  3U5S A;  2QUP A;  5JUA A;  2EPK X;  1J8M F;  3ZTM A;  3ABM C;  5L0J A;  4BJ5 C;  4UDV A;  3W8I A;  2P0N A;  3J06 A;  2P1A A;  2IOQ A;  1EA8 A;  4XPW A;  3S27 A;  3DM9 B;  3A9C A;  4U9D A;  2RSE B;  1H9G A;  1Y4C A;  2LFF A;  1RKC A;  4NCQ A;  3ZQV A;  3B29 A;  5JSL A;  4JC7 A;  5A6B D;  2QNL A;  3NRH A;  3LS1 A;  2FFH A;  3LJB A;  2Q9B A;  3R2P A;  4CS8 A;  1CPQ A;  3Q7G A;  3ZVR A;  4WGY A;  1E85 A;  2XLO A;  1H9T A;  5A6K A;  1OR2 A;  2GAQ A;  2VCC A;  3RVZ A;  1HMD A;  3EG9 B;  3PMR A;  1GS9 A;  3IPM O;  5FCL A;  3K7D A;  5E3C A;  2EIJ C;  4CIH A;  3QMK A;  1SR2 A;  4F4B A;  4J7T A;  4PAC A;  4CS8 C;  2VC9 A;  4PJM A;  3MBG A;  1NZE A;  3VM6 A;  3WAQ A;  1EQ1 A;  5JLI A;  1G4W R;  1KNY A;  3V5Y A;  2M64 A;  1LM3 B;  1TWA A;  2W4M A;  4CSA C;  3SZR A;  3UMH A;  1TKN A;  1YLM A;  3O55 A;  3SNH A;  2WB7 A;  4XPY A;  1FAP B;  4OIR F;  3U8P A;  1G8X A;  3EGX A;  1D1B A;  3X2Q C;  1K04 A;  5L0H A;  5BQG A;  2XL6 A;  3ZIB A;  2B0H A;  3M15 A;  4MS2 A;  1AUE A;  4EIY A;  3B71 A;  4ZLC A;  2MWQ A;  1YA9 A;  3H2U A;  4DVZ A;  4JKV A;  1ZHT A;  3C7J A;  2BC5 A;  5COF A;  4G7Z F;  3KKB A;  3NKD A;  4I3M A;  1JPJ A;  3NYL A;  2A6H F;  2B0J A;  2LSE A;  2OQM A;  1B68 A;  3KPH A;  1AEP A;  2I15 A;  3AG2 C;  1YAU O;  3N2Z B;  1Z6A A;  5T3T A;  3NMJ A;  2NUP B;  3SXM A;  5CIV A;  1YA7 O;  1LS4 A;  3QW1 A;  4C3D A;  4JUR I;  5DLJ A;  3B0U X;  3K66 A;  1NBB A;  4JE9 A;  4LDK A;  4M63 A;  5DS5 A;  1EKY A;  1RKE A;  1NSG B;  5FZT A;  1E86 A;  4D4X A;  3RQF A;  1TFO B;  4PR9 A;  1WN0 A;  4U5D E;  3JT1 A;  4MTG A;  4XEK A;  2XSE A;  3NDB B;  1NLX A;  2IXP A;  2YHS A;  1VLS A;  1A41 A;  1PD1 A;  3F46 A;  4FES A;  5D92 A;  4HE8 D;  1A0B A;  4O79 A;  3VF0 A;  4DVY P;  1E84 A;  4OIP F;  4MVR A;  4MVO A;  3IEE A;  3ASN C;  1VMA A;  3RIP A;  2EIL C;  2QE9 A;  1I5N A;  1V74 B;  3AG3 C;  3V5X A;  1T6Q A;  1FFH A;  256B A;  4PJN A;  1JOG A;  4U5F E;  3S90 A;  4XEF A;  3TJ6 A;  4YT8 A;  2J7P A;  3DM5 A;  3RF3 A;  2Q9C A;  4E0I A;  1I4Z A;  3LLK A;  3NMI A;  1E83 A;  1YVI A;  3MYF A;  3POV A;  3UNG C;  1WWP A;  1MMG A;  3OEO A;  3AJM A;  4BG0 A;  2UUH A;  1VYI A;  3Q7L A;  3IQC A;  5DS6 A;  1U0B B;  1TWG A;  2J9B A;  3DE9 A;  3DXJ F;  2NUT A;  1C17 M;  4DBQ A;  2AWY A;  4MW8 A;  3U9M A;  2YLG A;  2WL8 A;  2OKU A;  2WVN A;  1ZHX A;  3DMD A;  3GWL A;  3JRT A;  3JRM O;  3L0I A;  2XLD A;  3LNM B;  3G4X A;  1VOM A;  3OWT A;  4HEA J;  3TQO A;  2XL8 A;  5T3W A;  1K05 A;  2NSF A;  1DOV A;  1OCC C;  1Z5Z A;  2KSF A;  2YRF A;  1M2O A;  1ST6 A;  4DRI B;  3W2W A;  2ZPA A;  3CSK A;  2I8B A;  5K0I A;  5T1D B;  2CCY A;  4G0H A;  3S29 A;  1HE9 A;  3FOO A;  4ULW A;  5B3S C;  3DJN B;  2GA0 A;  4ZLD A;  5A6J A;  4J7Y A;  1TWH A;  1BZ4 A;  4CJG A;  2PP4 A;  4NC3 A;  3SYN A;  1G4U S;  5CI9 A;  3S84 A;  1OCO C;  3O39 A;  4YK5 A;  2YWA A;  2CDQ A;  1TWC A;  3GAN A;  1YYJ A;  3IQT A;  2EIN C;  2HMZ A;  3K1H A;  1RXQ A;  1FFT C;  2Q4F A;  3RFY A;  3W4Y A;  2ETS A;  2OU6 A;  3O10 A;  5CI8 A;  3ABL C;  3WOD F;  3X1O A;  4DRJ B;  3IQ5 A;  2YQY A;  1S05 A;  1YYX A;  2XLV A;  3RQG A;  4CDA A;  3EHM A;  1C03 A;  4AL1 A;  3SXZ A;  4U5G A;  1JAF A;  2EPN A;  3C8G B;  4EBB A;  1U6H A;  2OOC A;  2Q9A A;  3ZTZ A;  3WHN A;  4DRH B;  4U5H A;  1NFO A;  3V5Z A;  2G62 A;  2L9J A;  5L0F A;  4AL0 A;  2TMV P;  5A69 A;  4CSA A;  4OIN F;  1HMO A;  2NUP A;  1CGM E;  2R7T A;  1M56 C;  3DWW A;  1OXK A;  1ZHZ A;  3AQB A;  2XXA B;  2DYR C; 
#chains in the Genus database with same CATH homology
 2YL0 A;  4ER9 A;  3U8P A;  2XLE A;  3C62 A;  4JEB A;  3HNJ A;  2XL6 A;  3HNL A;  3M15 A;  1APC A;  4EIY A;  4IB4 A;  5JS5 A;  4D4N A;  4JKV A;  1YZA A;  2BC5 A;  2YL3 A;  5JP7 A;  4L6R A;  3TOM A;  2J8W A;  1CGO A;  1QPU A;  2QLA A;  4CDV A;  3NMJ A;  5JVE A;  2YL1 A;  3QW1 A;  1NBB A;  4JE9 A;  5JRA A;  1EKY A;  1A7V A;  1E86 A;  4D4X A;  4JEA A;  5B3I A;  3TOL A;  5AGF A;  4CDY A;  3ZQY A;  4N6H A;  1E84 A;  4WGZ A;  3NMK A;  256B A;  2YL7 A;  3NMI A;  1YZC A;  1E83 A;  3L1M A;  3ZWI A;  3HNK A;  2XM4 A;  2J9B A;  3DE9 A;  1GQA A;  1M6T A;  1CPR A;  2YLG A;  2YLI A;  3C63 A;  3VRC A;  2XLD A;  4IAQ A;  1MQV A;  2XL8 A;  4CIP A;  4IAR A;  4CJO A;  3M4C A;  1BBH A;  2XLW A;  3QVY A;  2YLD A;  4N4W A;  2CCY A;  3FOO A;  4ULV A;  4CX9 A;  5JUA A;  4CJG A;  4NC3 A;  3ZTM A;  1CGN A;  3DE8 A;  3QVZ A;  3HNI A;  3M4B A;  2XM0 A;  3FOP A;  1YYJ A;  4U9D A;  5JT4 A;  3QW0 A;  2XLM A;  3M79 A;  1RCP A;  3ZQV A;  3IQ6 A;  5JSL A;  3IQ5 A;  1S05 A;  1YYX A;  2XLV A;  4CDA A;  1CPQ A;  1JAF A;  1QQ3 A;  2XLH A;  4WGY A;  1E85 A;  2XLO A;  3ZTZ A;  4U9E A;  2YKZ A;  5JLI A;  1LM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...