1E86A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with co bound to distal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e86A00
2XM0A 5JT4A 2XL8A 4L6RA 4NC3A 1CPRA 3ZTMA 4IAQA 1RCPA 5JVEA 2YLIA 4CIPA 3M15A 3NMKA 5JSLA 4CDYA 3TOMA 1QQ3A 3NMJA 3U8PA 5JUAA 3C62A 1E83A 1CPQA 3M79A 3ZQVA 3FOPA 2XLHA 4U9DA 3TOLA 1APCA 3FOOA 4EIYA 2XLMA 3M4BA 5JLIA 1CGOA 2XLVA 3VRCA 256BA 3QW1A 3M4CA 2YL0A 2XLDA 2QLAA 4IARA 1EKYA 2XLOA 5AGFA 4CJGA 3QW0A 1QPUA 3DE8A 3HNJA 3QVZA 1E86A 4U9EA 3IQ6A 1A7VA 2XL6A 4CDAA 4CX9A 1E84A 2YKZA 2XM4A 1NBBA 1M6TA 3ZWIA 2YLDA 1LM3B 3L1MA 4JKVA 2J8WA 3HNIA 3HNKA 1CGNA 5JP7A 3QVYA 3IQ5A 4ULVA 4JE9A 2YL1A 3ZQYA 2YL7A 4IB4A 1S05A 2BC5A 4CJOA 1YZCA 1MQVA 2XLWA 3ZTZA 3NMIA 1YYXA 2J9BA 4JEBA 4JEAA 1E85A 2XLEA 4N6HA 1JAFA 2YLGA 1GQAA 1YZAA 4CDVA 5B3IA 4N4WA 5JRAA 4D4XA 3DE9A 2YL3A 3C63A 2CCYA 4WGYA 5JS5A 4WGZA 3HNLA 4ER9A 1BBHA 1YYJA 4D4NA
chains in the Genus database with same CATH superfamily
2PNOA 2R25A 4J32B 1SMYF 2AP3A 1MMAA 2KYHA 3CAXA 2LSEA 3PDMP 1CPRA 1E2XA 1Z63A 4O6NA 4QI0A 5A6BD 2A0UA 1T6IA 4XWJA 1MNDA 4JCZA 1KU2A 3RYLA 3ZG1A 5BQIA 3EH2A 2YEVA 2R7OA 5IY5C 3KMIA 3O55A 2DB4A 5A6BA 1ZW3A 3LEVA 5L0JA 2P7VA 4Q5SF 4E18A 3LJBA 2YQYA 2WVNA 3Q6MA 3ZDLA 2WVQA 5JUAA 2OEVA 1ZU5A 4CSAA 5F5FA 4F4BA 3DAFA 1D1BA 1G4WR 3M79A 1OR2A 2VH3A 3ITFA 1FMWA 1OR3A 4W8PA 1RJ9A 2A69F 5DS6A 4FWVA 1WWPA 2GAQA 2XLHA 1Q0DA 1R4TA 1RXQA 1TWAA 3ABMC 1LS4A 1QVXA 2VASA 3B0PA 3FOOA 2J9VA 3GODA 3JYHA 4PR9A 4ULWA 3V7OA 2GDCA 3L34A 1V54C 2FFHA 5E2QA 1FR0A 5L0GA 4C7OA 5HSWA 1UFBA 2ETSA 3SP1A 4A2NB 2BL2A 4J30B 4E7ZA 1ZHXA 4J7YA 3T6GB 3QTHA 2CDQA 1HE9A 4MVMA 1K40A 2ZXWC 4WABA 4N06A 4C3EA 1EKYA 5DVWA 3U2LA 2H8AA 5TJ5E 3W2WA 1V4AA 1HMDA 3IQTA 4MVUA 2Q00A 4Q7CA 1FNTc 4XEKA 4OIOF 4AL0A 3GWLA 2HJMA 3QW0A 3W4YA 5L0HA 4HEAJ 1YLMA 1E86A 4PJLA 2XL4A 2CNWD 1AUEA 1PCXA 4Z9HA 1Q0MA 3RF3A 5L3QA 3U0CA 3L8JA 1RJ9B 2YRFA 3IQ6A 1A7VA 1AVOB 1H9TA 2NUTA 2CNWA 2YKZA 4LLCA 1FMVA 5KYXB 3MYIA 3DKAA 3U8VA 3EFOB 5DQTA 3L1MA 1TWCA 1JPJA 1NSGB 4MQ9F 5KYYA 1ZHZA 2HZ8A 2EPNA 2Q4FA 1ZHTA 3GEHA 3BEHA 1EQ1A 3HNKA 3EH1A 3H2VA 4XPXA 1DOVA 3HTKC 1NFNA 3QVYA 3IQ5A 4LLEA 3ATPA 3HJCA 4MW8A 4YT2A 2YHSA 1NLXA 1Q0GA 4BJ6C 1XZPA 4IRUA 4ZLDA 4PJJA 4NTAA 4XEFA 3LS1A 4LDKA 4AL1A 3LAYA 5KYUA 3DD7A 2L6HA 1VB5A 2PBEA 3W8IA 4B6IA 3RVYA 3M1CB 1T9KA 4DJ9A 2J46A 3UR3C 3ZTZA 1TWGA 1J8MF 1NZEA 2WB7A 2DYRC 3DI5A 3ABLC 1YVIA 3EG9A 2VCBA 2Q9BA 4K1OA 1B68A 4BJ5A 4A4AA 5DS4A 2J9BA 1D1AA 3WHNA 2H7OA 4JEAA 3LNRA 3NKEA 1JAFA 5F5HA 4IWBA 4PJMA 1YZAA 1OCOC 4Q4ZF 1IZMA 2HUJA 1L3PA 1MMNA 3U5SA 2NG1A 4E0HA 2LIGA 2YL3A 1LKXA 2QTVA 3C63A 3C8ZA 2XSEA 4BPMA 2AU5A 3C8GB 4NY3A 3AGTA 5L0CA 5JS5A 4JCHA 1G8XA 1U6HA 4WGZA 2PFDA 2Q9AA 3ZSUA 4OIPF 2A6EF 1VK5A 4BJ5C 2DYSC 1OKKD 1JR8A 2R9RB 4MW3A 2R7UA 1ZZPA 5BUOA 2IXOA 3KH2A 1NG1A 4CS8A 1RKEA 1OKKA 1BBHA 4MTGA 1YYJA 4MNDA 4D4NA 1PD1A 5B3IA 1U0BB 3FMSA 1XWJA 2H7BA 4O7GA 5JT4A 2XL8A 3G4XA 3NG1A 3JSZA 4NC3A 1K05A 1H7IA 1VYKA 3B0VC 3POVA 3DJNB 3MLGA 2PP4A 1M57C 2YLIA 4CIPA 2R7TA 2JX0A 4CS9A 2R7RA 3NMKA 4AE4B 4G0HA 5JSLA 1SF8A 3BRJA 5L0DA 3NDBB 1T6UA 2WZLA 4JURI 4CS8C 4BG0A 1E83A 2MYSA 4XPWA 3JSEO 2VCCA 1Y4CA 3EGDB 4MVOA 3K33A 4JJGA 4H54A 2R05A 5EK0A 1TKNA 2LD6A 1APCA 3F47A 3SXZA 4EIYA 4I44A 3W2VA 1A41A 5JLIA 4IGGA 4O6MA 2I8BA 2JD3A 3ECSA 1WGWA 4HFKB 3VRCA 3PHF2 1RKEB 5E3CA 3DM5A 3WODF 4QDLA 3C7JA 3QW1A 4E17A 1O3UA 3AQBA 2YL0A 2GFHA 1YARO 2OJED 2VB6A 3AOUA 3GEEA 4CBEA 1D1CA 5COMA 1ZW2A 2YWAA 3S0XA 2Y69C 1FAPB 2F22A 5A69A 2J45A 3GM1A 1UG7A 1HW1A 1LVKA 2KK1A 2Q3TA 4PJNA 4BEJA 3HKKA 4IJJA 1K04A 2NSFA 1ORJA 3LESA 1A7DA 4OD4A 4OIQF 4JIOA 2KJGA 2EINC 2AVKA 3UNGC 5DQZA 4BJ1A 2J7PD 3I5PA 3QVZA 3JTLO 5F28E 3SXMA 4DBQA 2XXAB 3K6BA 5KYNA 4DXWA 4LACB 2J7PA 2ZD9A 1VLSA 3DWWA 3EZHA 3KYJA 2BE5F 3K1HA 3EHNA 4CDAA 5CI9A 5K0IA 3LLKA 3RH3A 3TJ5A 5CIVA 2YLDA 3L0IA 1G4US 2KGOA 3VM6A 1OW7A 2OQMA 3HNIA 1ZU4A 2A68F 3Q6NA 3SZRA 4CSAC 3CEXA 4PFOA 3U3FA 1QSPA 1Z23A 1WOLA 1OXBA 3OA1A 4N6CA 3U2MA 3U3BA 2G3VA 3IQCA 4ANJA 5B1BC 1A7EA 4BEMJ 4OD5A 3RW0A 1M56C 4U5GA 2E87A 3WAQA 4HE8D 5FCLA 1MMDA 1ZHWA 1S05A 5EHHA 2MHRA 3AGUA 4U5BE 2D4UA 4JZAA 4YN0B 5L0FA 4KC9A 2OOCA 2RD9A 5DLJA 2X51A 2IOQA 1I4YA 5B3SC 1BR2A 4P6IC 4JEBA 1FFHA 2R02A 2R7XA 1YA9A 3A9CA 3U9JA 5COFA 3GEIA 5BQGA 2X0CA 5EGYA 3FAJA 4P9TA 3VF0A 3UGOA 1HE1A 1ZYRF 3NYJA 4N4WA 4ONSA 4C7OB 2W4BA 4E0IA 4JW1A 2KNHA 1OCRC 4G78A 2B0HA 3K7DA 2R7WA 2Q9CA 4G7HF 1LE2A 4JC7A 1TR2A 2ASRA 2DGJA 2G62A 3HNLA 3JCUQ 1YAUO 4ER9A 3B0UX 4DVZA 2XS1A 3T4RA 1XZQA 5AC4A 3LNMB 3SNHA 2ICWG 3V5ZA 3NYMA 4BJTA 1J8YF 2P0NA 2DI3A 2QNLA 3E9VA 4YL1A 2O9XA 4HFFB 2WVOA 1WASA 1FTSA 5BQHA 4MS2A 4JRZA 2WL8A 3R2PA 3ZTMA 2C04A 2NUTB 3GM3A 2WZGA 4AX2A 3K1IA 1LI7A 3N2ZB 3I5QA 3NKDA 1GM5A 2EIKC 2IBFA 3JZ0A 1ORSC 3M15A 2PX0A 4O79A 5KYYB 1D0YA 4CDYA 1FFTC 3FHDA 1QQ3A 2KC3A 3NMJA 3TOMA 3EZIA 3EQLF 4DRIB 2ZXOA 1WN0A 3UMIA 1C17M 3C62A 4EUKB 4PFPA 5L0IA 3C18A 4RBNA 2CW0F 1H9GA 4XLPF 3H65A 1YDIA 4K0DA 3L8IA 4O6YA 1Z6AA 2LFFA 4R32A 3FOPA 2XS8A 5KYWA 2Z15A 3S29A 1OW6A 2AWCA 2KSFA 2NUPA 3ASNC 3M4BA 1CGOA 2XLVA 3TJ6A 1VYIA 2YVKA 5KYUB 3K1IC 4UDVA 2HFIA 2J0WA 3MFNA 2W4MA 1CGME 3N24A 2OJQA 1VTMP 4PACA 3MYFA 3EG9B 3M4CA 3EGXA 4U5HA 4C3DA 5B1AC 3NRHA 3GM2A 2R03A 1R5ID 4I3MA 3FDQA 2B0JA 2Y3HA 1Z7Qc 3JRTA 2Q7RA 3S28A 1NU7D 2QLAA 1A0BA 1O87A 2IXPA 2QE9A 2UUIA 4YJWA 3OEOA 3T9OA 3CZ6A 2VCAA 4W8KA 3B9QA 4KNVA 2XLOA 3RQGA 3F46A 3MX3A 3T6JA 3W8HA 3FVYA 4I1MA 3S84A 3JT1A 3DMDA 4LDQA 3LUTB 2QY9A 4Z9IA 3QZCA 3HNJA 4GYTA 2CYDA 3SXYA 1GGQA 3AG1C 4K7BA 4U9EA 5T3TA 1ST6A 1E84A 4CX9A 1OXKA 1OCCC 2J9UA 5KYWB 5T1DB 1TQGA 1JRAA 1BR4A 5FZTA 1LPEA 1M6TA 3AG4C 4JJFA 4MVRA 3ZVRA 1BZ4A 4CS9C 1WATA 3S27A 4YT8A 4M63A 3DM9B 4U5EE 2J8WA 5HV9A 3IEEA 2VC9A 1JOGA 3G4ZA 3V5XA 3UMHA 1CGNA 3MBGA 2M64A 3AQCA 5JP7A 1TFKB 3JYYA 2Y39A 4G7OF 4ULVA 3I4UA 4MTOA 4C3BA 2YL1A 4EWCA 3Q7LA 4H4KC 3ZQYA 2YL7A 3H2UA 1SR2A 3DJUB 4XTKA 1IW7F 1H6GA 3GWNA 3OWTA 4NTFA 5D92A 3QMKA 3LLIA 1Z5ZA 3TD7A 3NMIA 1LIHA 1U89A 3CSKA 3Q7GA 5T3WA 4DRHB 1YYXA 1QKRA 2OKUA 2WZFA 3EJNA 3JRMO 4JTAB 4NTBA 4QI2A 2I15A 4GQHA 3J06A 3EPVA 1Y6DA 2EPKX 2L6GA 3N0TA 2L6FA 2XLEA 4N6HA 3RQEA 1EA8A 2YLGA 4AK9A 4YK5A 1GQAA 2V3CC 2LCHA 2ZPAA 3G50A 4U5DE 3U9MA 5JRAA 2LK4A 1I4ZA 4D4XA 2QUPA 3B29A 3LEOA 1OW8A 2EPLX 3A11A 3IHUA 5D91A 4KNWA 4EBKA 4WGYA 2ZXPA 1RKCA 2Y3BA 2P61A 4J7TA 2Y3GA 2OCCC 4KBLA 4JTDB 4JVSA 3SYNA 3CQZA 3KKBA 3S90A 1NFOA 5KYXA 1L7CA 3PMRA 3FAPB 3GORA 1HY5A 3EFOA 3HLZA 1QLEC 4MTFA 2J9WA 4XPYA 2XM0A 2L81A 5E33A 4L6RA 2R7SA 3SEOA 2C03A 2L7AA 3TK0A 4YT5A 4IAQA 1RCPA 1F1MA 1T01A 4P9FA 2PF4E 4PK4A 3ZC4A 3RFYA 5JVEA 1SZIA 2EIMC 2TMVP 2GWWA 5GPGB 1WTYA 3GANA 3AJMA 5CI8A 4DBRA 1MMGA 4DOZA 3U8PA 2HMZA 3DAGA 2A6HF 3O10A 2IXNA 1BDJB 2LQGA 2R7VA 4DRJB 1LE4A 2GA0A 1CPQA 3ZQVA 5A6JA 4EHPA 2HS5A 2HV7A 4BJ6A 2KQ9A 1D0XA 1M2VA 2EILC 1Q0KA 2HKVA 2IXMA 4U9DA 3RIPA 3TOLA 3VAYA 2XLMA 3RVZA 3X2QC 4LERA 3UGPA 4CIHA 2P6VA 2MWQA 3ABKC 4EKWA 256BA 3NYLA 4NQFA 4XLNF 2AWYA 2A1DD 3C8GD 4MVZA 3ZIBA 3R7CA 4ZLCA 2XRHA 1N1CA 4KI2A 2XLDA 3C8GA 3RQFA 1D0ZA 4IARA 5COGA 1O5HA 4OINF 1V74B 4U5CE 2R7QA 3X1OA 2J0XA 1YJGA 5L3VA 5AGFA 1TFOB 2OG2A 4GEHA 1ZHYA 1KTMA 1QZXA 2NPUA 3E70C 2JPUA 2L9JA 4CJGA 2HJ3A 1QPUA 1SYQA 4FESA 1PV3A 4I1OB 1PD0A 2HV6A 3DE8A 3O6XA 4MVSA 1HMOA 1I5NA 3V5YA 4E7SA 2IM8A 3T6BA 4FAPB 1EI7A 4CS7A 3KPHA 1BR1A 3FXHA 1C03A 1M2VB 1AEPA 2M4EA 2XL6A 1M2OA 2EIJC 2UUHA 4LDRA 5AC5A 2XM4A 5DS5A 1RMVA 1NBBA 3ZWIA 2OEXA 3PCVA 3SXKA 4YWQA 1LM3B 1OCZC 2Y3DA 3UMKA 4AE4A 3ASOC 4JKVA 4EBJA 3US6A 1VMAA 2KW3C 2EPOA 2H7VC 3LS0A 1JPNA 4RD9A 1VOMA 3TULA 5E3AA 1MNEA 3EGDA 1ZVZA 4JE9A 1LS1A 4JTCB 1V55C 4YT4A 2NSGA 2P1AA 2RSEB 4EBBA 5A6AA 1LI5A 4IB4A 2LP4A 4U5FE 1ORYA 3S9OA 2BC5A 2HMQA 4CJOA 1HW2A 1YZCA 2D5RB 2HSQA 1MQVA 4OIRF 5A6KA 4NCQA 1Z3IX 4MVQA 2XLWA 1OQCA 4XEVA 4FX5A 1VLTA 2W9YA 2IYLD 2LFDA 3TQOA 2YZSA 3K66A 2NUPB 3WG7C 1E85A 2FGYA 4G7ZF 4XQ1A 3IPMO 4YL0A 1NU9C 1TWHA 1JMWA 1KNYA 2G3KA 4CDVA 3DZAA 1G5ZA 1Q0FA 3EGXB 1T6QA 3AG2C 2ZXRA 4DVYP 3DE9A 3KYIA 2CCYA 3DXJF 2CGEA 3EHMA 3AG3C 4X0RA 4Z9JA 2XXAA 1DOWA 1W2WA 1GS9A 2V26A 3KL4A 4WJ0A 3VYWA 2HSBA 2EPMX 3O39A 3B71A 4IAOA 1YA7O 4RDAA 2A0BA 2W45A 1T5OA 4YL3A 1S7ZA 2OU6A 1C02A 2PX3A 2FAPB 3RKOF
chains in the Genus database with same CATH topology
2XM0A 5JT4A 2XL8A 4L6RA 4NC3A 1CPRA 3ZTMA 4IAQA 1RCPA 5JVEA 2YLIA 4CIPA 3M15A 3NMKA 5JSLA 4CDYA 3TOMA 1QQ3A 3NMJA 3U8PA 5JUAA 3C62A 1E83A 1CPQA 3M79A 3ZQVA 3FOPA 2XLHA 4U9DA 3TOLA 1APCA 3FOOA 4EIYA 2XLMA 3M4BA 5JLIA 1CGOA 2XLVA 3VRCA 256BA 3QW1A 3M4CA 2YL0A 2XLDA 2QLAA 4IARA 1EKYA 2XLOA 5AGFA 4CJGA 3QW0A 1QPUA 3DE8A 3HNJA 3QVZA 1E86A 4U9EA 3IQ6A 1A7VA 2XL6A 4CDAA 4CX9A 1E84A 2YKZA 2XM4A 1NBBA 1M6TA 3ZWIA 2YLDA 1LM3B 3L1MA 4JKVA 2J8WA 3HNIA 3HNKA 1CGNA 5JP7A 3QVYA 3IQ5A 4ULVA 4JE9A 2YL1A 3ZQYA 2YL7A 4IB4A 1S05A 2BC5A 4CJOA 1YZCA 1MQVA 2XLWA 3ZTZA 3NMIA 1YYXA 2J9BA 4JEBA 4JEAA 1E85A 2XLEA 4N6HA 1JAFA 2YLGA 1GQAA 1YZAA 4CDVA 5B3IA 4N4WA 5JRAA 4D4XA 3DE9A 2YL3A 3C63A 2CCYA 4WGYA 5JS5A 4WGZA 3HNLA 4ER9A 1BBHA 1YYJA 4D4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM0 A;  5JT4 A;  2XL8 A;  4L6R A;  4NC3 A;  1CPR A;  3ZTM A;  4IAQ A;  1RCP A;  5JVE A;  2YLI A;  4CIP A;  3M15 A;  3NMK A;  5JSL A;  4CDY A;  3TOM A;  1QQ3 A;  3NMJ A;  3U8P A;  5JUA A;  3C62 A;  1E83 A;  1CPQ A;  3M79 A;  3ZQV A;  3FOP A;  2XLH A;  4U9D A;  3TOL A;  1APC A;  3FOO A;  4EIY A;  2XLM A;  3M4B A;  5JLI A;  1CGO A;  2XLV A;  3VRC A;  256B A;  3QW1 A;  3M4C A;  2YL0 A;  2XLD A;  2QLA A;  4IAR A;  1EKY A;  2XLO A;  5AGF A;  4CJG A;  3QW0 A;  1QPU A;  3DE8 A;  3HNJ A;  3QVZ A;  1E86 A;  4U9E A;  3IQ6 A;  1A7V A;  2XL6 A;  4CDA A;  4CX9 A;  1E84 A;  2YKZ A;  2XM4 A;  1NBB A;  1M6T A;  3ZWI A;  2YLD A;  1LM3 B;  3L1M A;  4JKV A;  2J8W A;  3HNI A;  3HNK A;  1CGN A;  5JP7 A;  3QVY A;  3IQ5 A;  4ULV A;  4JE9 A;  2YL1 A;  3ZQY A;  2YL7 A;  4IB4 A;  1S05 A;  2BC5 A;  4CJO A;  1YZC A;  1MQV A;  2XLW A;  3ZTZ A;  3NMI A;  1YYX A;  2J9B A;  4JEB A;  4JEA A;  1E85 A;  2XLE A;  4N6H A;  1JAF A;  2YLG A;  1GQA A;  1YZA A;  4CDV A;  5B3I A;  4N4W A;  5JRA A;  4D4X A;  3DE9 A;  2YL3 A;  3C63 A;  2CCY A;  4WGY A;  5JS5 A;  4WGZ A;  3HNL A;  4ER9 A;  1BBH A;  1YYJ A;  4D4N A; 
#chains in the Genus database with same CATH topology
 2PNO A;  2R25 A;  4J32 B;  1SMY F;  2AP3 A;  1MMA A;  2KYH A;  3CAX A;  2LSE A;  3PDM P;  1CPR A;  1E2X A;  1Z63 A;  4O6N A;  4QI0 A;  5A6B D;  2A0U A;  1T6I A;  4XWJ A;  1MND A;  4JCZ A;  1KU2 A;  3RYL A;  3ZG1 A;  5BQI A;  3EH2 A;  2YEV A;  2R7O A;  5IY5 C;  3KMI A;  3O55 A;  2DB4 A;  5A6B A;  1ZW3 A;  3LEV A;  5L0J A;  2P7V A;  4Q5S F;  4E18 A;  3LJB A;  2YQY A;  2WVN A;  3Q6M A;  3ZDL A;  2WVQ A;  5JUA A;  2OEV A;  1ZU5 A;  4CSA A;  5F5F A;  4F4B A;  3DAF A;  1D1B A;  1G4W R;  3M79 A;  1OR2 A;  2VH3 A;  3ITF A;  1FMW A;  1OR3 A;  4W8P A;  1RJ9 A;  2A69 F;  5DS6 A;  4FWV A;  1WWP A;  2GAQ A;  2XLH A;  1Q0D A;  1R4T A;  1RXQ A;  1TWA A;  3ABM C;  1LS4 A;  1QVX A;  2VAS A;  3B0P A;  3FOO A;  2J9V A;  3GOD A;  3JYH A;  4PR9 A;  4ULW A;  3V7O A;  2GDC A;  3L34 A;  1V54 C;  2FFH A;  5E2Q A;  1FR0 A;  5L0G A;  4C7O A;  5HSW A;  1UFB A;  2ETS A;  3SP1 A;  4A2N B;  2BL2 A;  4J30 B;  4E7Z A;  1ZHX A;  4J7Y A;  3T6G B;  3QTH A;  2CDQ A;  1HE9 A;  4MVM A;  1K40 A;  2ZXW C;  4WAB A;  4N06 A;  4C3E A;  1EKY A;  5DVW A;  3U2L A;  2H8A A;  5TJ5 E;  3W2W A;  1V4A A;  1HMD A;  3IQT A;  4MVU A;  2Q00 A;  4Q7C A;  1FNT c;  4XEK A;  4OIO F;  4AL0 A;  3GWL A;  2HJM A;  3QW0 A;  3W4Y A;  5L0H A;  4HEA J;  1YLM A;  1E86 A;  4PJL A;  2XL4 A;  2CNW D;  1AUE A;  1PCX A;  4Z9H A;  1Q0M A;  3RF3 A;  5L3Q A;  3U0C A;  3L8J A;  1RJ9 B;  2YRF A;  3IQ6 A;  1A7V A;  1AVO B;  1H9T A;  2NUT A;  2CNW A;  2YKZ A;  4LLC A;  1FMV A;  5KYX B;  3MYI A;  3DKA A;  3U8V A;  3EFO B;  5DQT A;  3L1M A;  1TWC A;  1JPJ A;  1NSG B;  4MQ9 F;  5KYY A;  1ZHZ A;  2HZ8 A;  2EPN A;  2Q4F A;  1ZHT A;  3GEH A;  3BEH A;  1EQ1 A;  3HNK A;  3EH1 A;  3H2V A;  4XPX A;  1DOV A;  3HTK C;  1NFN A;  3QVY A;  3IQ5 A;  4LLE A;  3ATP A;  3HJC A;  4MW8 A;  4YT2 A;  2YHS A;  1NLX A;  1Q0G A;  4BJ6 C;  1XZP A;  4IRU A;  4ZLD A;  4PJJ A;  4NTA A;  4XEF A;  3LS1 A;  4LDK A;  4AL1 A;  3LAY A;  5KYU A;  3DD7 A;  2L6H A;  1VB5 A;  2PBE A;  3W8I A;  4B6I A;  3RVY A;  3M1C B;  1T9K A;  4DJ9 A;  2J46 A;  3UR3 C;  3ZTZ A;  1TWG A;  1J8M F;  1NZE A;  2WB7 A;  2DYR C;  3DI5 A;  3ABL C;  1YVI A;  3EG9 A;  2VCB A;  2Q9B A;  4K1O A;  1B68 A;  4BJ5 A;  4A4A A;  5DS4 A;  2J9B A;  1D1A A;  3WHN A;  2H7O A;  4JEA A;  3LNR A;  3NKE A;  1JAF A;  5F5H A;  4IWB A;  4PJM A;  1YZA A;  1OCO C;  4Q4Z F;  1IZM A;  2HUJ A;  1L3P A;  1MMN A;  3U5S A;  2NG1 A;  4E0H A;  2LIG A;  2YL3 A;  1LKX A;  2QTV A;  3C63 A;  3C8Z A;  2XSE A;  4BPM A;  2AU5 A;  3C8G B;  4NY3 A;  3AGT A;  5L0C A;  5JS5 A;  4JCH A;  1G8X A;  1U6H A;  4WGZ A;  2PFD A;  2Q9A A;  3ZSU A;  4OIP F;  2A6E F;  1VK5 A;  4BJ5 C;  2DYS C;  1OKK D;  1JR8 A;  2R9R B;  4MW3 A;  2R7U A;  1ZZP A;  5BUO A;  2IXO A;  3KH2 A;  1NG1 A;  4CS8 A;  1RKE A;  1OKK A;  1BBH A;  4MTG A;  1YYJ A;  4MND A;  4D4N A;  1PD1 A;  5B3I A;  1U0B B;  3FMS A;  1XWJ A;  2H7B A;  4O7G A;  5JT4 A;  2XL8 A;  3G4X A;  3NG1 A;  3JSZ A;  4NC3 A;  1K05 A;  1H7I A;  1VYK A;  3B0V C;  3POV A;  3DJN B;  3MLG A;  2PP4 A;  1M57 C;  2YLI A;  4CIP A;  2R7T A;  2JX0 A;  4CS9 A;  2R7R A;  3NMK A;  4AE4 B;  4G0H A;  5JSL A;  1SF8 A;  3BRJ A;  5L0D A;  3NDB B;  1T6U A;  2WZL A;  4JUR I;  4CS8 C;  4BG0 A;  1E83 A;  2MYS A;  4XPW A;  3JSE O;  2VCC A;  1Y4C A;  3EGD B;  4MVO A;  3K33 A;  4JJG A;  4H54 A;  2R05 A;  5EK0 A;  1TKN A;  2LD6 A;  1APC A;  3F47 A;  3SXZ A;  4EIY A;  4I44 A;  3W2V A;  1A41 A;  5JLI A;  4IGG A;  4O6M A;  2I8B A;  2JD3 A;  3ECS A;  1WGW A;  4HFK B;  3VRC A;  3PHF 2;  1RKE B;  5E3C A;  3DM5 A;  3WOD F;  4QDL A;  3C7J A;  3QW1 A;  4E17 A;  1O3U A;  3AQB A;  2YL0 A;  2GFH A;  1YAR O;  2OJE D;  2VB6 A;  3AOU A;  3GEE A;  4CBE A;  1D1C A;  5COM A;  1ZW2 A;  2YWA A;  3S0X A;  2Y69 C;  1FAP B;  2F22 A;  5A69 A;  2J45 A;  3GM1 A;  1UG7 A;  1HW1 A;  1LVK A;  2KK1 A;  2Q3T A;  4PJN A;  4BEJ A;  3HKK A;  4IJJ A;  1K04 A;  2NSF A;  1ORJ A;  3LES A;  1A7D A;  4OD4 A;  4OIQ F;  4JIO A;  2KJG A;  2EIN C;  2AVK A;  3UNG C;  5DQZ A;  4BJ1 A;  2J7P D;  3I5P A;  3QVZ A;  3JTL O;  5F28 E;  3SXM A;  4DBQ A;  2XXA B;  3K6B A;  5KYN A;  4DXW A;  4LAC B;  2J7P A;  2ZD9 A;  1VLS A;  3DWW A;  3EZH A;  3KYJ A;  2BE5 F;  3K1H A;  3EHN A;  4CDA A;  5CI9 A;  5K0I A;  3LLK A;  3RH3 A;  3TJ5 A;  5CIV A;  2YLD A;  3L0I A;  1G4U S;  2KGO A;  3VM6 A;  1OW7 A;  2OQM A;  3HNI A;  1ZU4 A;  2A68 F;  3Q6N A;  3SZR A;  4CSA C;  3CEX A;  4PFO A;  3U3F A;  1QSP A;  1Z23 A;  1WOL A;  1OXB A;  3OA1 A;  4N6C A;  3U2M A;  3U3B A;  2G3V A;  3IQC A;  4ANJ A;  5B1B C;  1A7E A;  4BEM J;  4OD5 A;  3RW0 A;  1M56 C;  4U5G A;  2E87 A;  3WAQ A;  4HE8 D;  5FCL A;  1MMD A;  1ZHW A;  1S05 A;  5EHH A;  2MHR A;  3AGU A;  4U5B E;  2D4U A;  4JZA A;  4YN0 B;  5L0F A;  4KC9 A;  2OOC A;  2RD9 A;  5DLJ A;  2X51 A;  2IOQ A;  1I4Y A;  5B3S C;  1BR2 A;  4P6I C;  4JEB A;  1FFH A;  2R02 A;  2R7X A;  1YA9 A;  3A9C A;  3U9J A;  5COF A;  3GEI A;  5BQG A;  2X0C A;  5EGY A;  3FAJ A;  4P9T A;  3VF0 A;  3UGO A;  1HE1 A;  1ZYR F;  3NYJ A;  4N4W A;  4ONS A;  4C7O B;  2W4B A;  4E0I A;  4JW1 A;  2KNH A;  1OCR C;  4G78 A;  2B0H A;  3K7D A;  2R7W A;  2Q9C A;  4G7H F;  1LE2 A;  4JC7 A;  1TR2 A;  2ASR A;  2DGJ A;  2G62 A;  3HNL A;  3JCU Q;  1YAU O;  4ER9 A;  3B0U X;  4DVZ A;  2XS1 A;  3T4R A;  1XZQ A;  5AC4 A;  3LNM B;  3SNH A;  2ICW G;  3V5Z A;  3NYM A;  4BJT A;  1J8Y F;  2P0N A;  2DI3 A;  2QNL A;  3E9V A;  4YL1 A;  2O9X A;  4HFF B;  2WVO A;  1WAS A;  1FTS A;  5BQH A;  4MS2 A;  4JRZ A;  2WL8 A;  3R2P A;  3ZTM A;  2C04 A;  2NUT B;  3GM3 A;  2WZG A;  4AX2 A;  3K1I A;  1LI7 A;  3N2Z B;  3I5Q A;  3NKD A;  1GM5 A;  2EIK C;  2IBF A;  3JZ0 A;  1ORS C;  3M15 A;  2PX0 A;  4O79 A;  5KYY B;  1D0Y A;  4CDY A;  1FFT C;  3FHD A;  1QQ3 A;  2KC3 A;  3NMJ A;  3TOM A;  3EZI A;  3EQL F;  4DRI B;  2ZXO A;  1WN0 A;  3UMI A;  1C17 M;  3C62 A;  4EUK B;  4PFP A;  5L0I A;  3C18 A;  4RBN A;  2CW0 F;  1H9G A;  4XLP F;  3H65 A;  1YDI A;  4K0D A;  3L8I A;  4O6Y A;  1Z6A A;  2LFF A;  4R32 A;  3FOP A;  2XS8 A;  5KYW A;  2Z15 A;  3S29 A;  1OW6 A;  2AWC A;  2KSF A;  2NUP A;  3ASN C;  3M4B A;  1CGO A;  2XLV A;  3TJ6 A;  1VYI A;  2YVK A;  5KYU B;  3K1I C;  4UDV A;  2HFI A;  2J0W A;  3MFN A;  2W4M A;  1CGM E;  3N24 A;  2OJQ A;  1VTM P;  4PAC A;  3MYF A;  3EG9 B;  3M4C A;  3EGX A;  4U5H A;  4C3D A;  5B1A C;  3NRH A;  3GM2 A;  2R03 A;  1R5I D;  4I3M A;  3FDQ A;  2B0J A;  2Y3H A;  1Z7Q c;  3JRT A;  2Q7R A;  3S28 A;  1NU7 D;  2QLA A;  1A0B A;  1O87 A;  2IXP A;  2QE9 A;  2UUI A;  4YJW A;  3OEO A;  3T9O A;  3CZ6 A;  2VCA A;  4W8K A;  3B9Q A;  4KNV A;  2XLO A;  3RQG A;  3F46 A;  3MX3 A;  3T6J A;  3W8H A;  3FVY A;  4I1M A;  3S84 A;  3JT1 A;  3DMD A;  4LDQ A;  3LUT B;  2QY9 A;  4Z9I A;  3QZC A;  3HNJ A;  4GYT A;  2CYD A;  3SXY A;  1GGQ A;  3AG1 C;  4K7B A;  4U9E A;  5T3T A;  1ST6 A;  1E84 A;  4CX9 A;  1OXK A;  1OCC C;  2J9U A;  5KYW B;  5T1D B;  1TQG A;  1JRA A;  1BR4 A;  5FZT A;  1LPE A;  1M6T A;  3AG4 C;  4JJF A;  4MVR A;  3ZVR A;  1BZ4 A;  4CS9 C;  1WAT A;  3S27 A;  4YT8 A;  4M63 A;  3DM9 B;  4U5E E;  2J8W A;  5HV9 A;  3IEE A;  2VC9 A;  1JOG A;  3G4Z A;  3V5X A;  3UMH A;  1CGN A;  3MBG A;  2M64 A;  3AQC A;  5JP7 A;  1TFK B;  3JYY A;  2Y39 A;  4G7O F;  4ULV A;  3I4U A;  4MTO A;  4C3B A;  2YL1 A;  4EWC A;  3Q7L A;  4H4K C;  3ZQY A;  2YL7 A;  3H2U A;  1SR2 A;  3DJU B;  4XTK A;  1IW7 F;  1H6G A;  3GWN A;  3OWT A;  4NTF A;  5D92 A;  3QMK A;  3LLI A;  1Z5Z A;  3TD7 A;  3NMI A;  1LIH A;  1U89 A;  3CSK A;  3Q7G A;  5T3W A;  4DRH B;  1YYX A;  1QKR A;  2OKU A;  2WZF A;  3EJN A;  3JRM O;  4JTA B;  4NTB A;  4QI2 A;  2I15 A;  4GQH A;  3J06 A;  3EPV A;  1Y6D A;  2EPK X;  2L6G A;  3N0T A;  2L6F A;  2XLE A;  4N6H A;  3RQE A;  1EA8 A;  2YLG A;  4AK9 A;  4YK5 A;  1GQA A;  2V3C C;  2LCH A;  2ZPA A;  3G50 A;  4U5D E;  3U9M A;  5JRA A;  2LK4 A;  1I4Z A;  4D4X A;  2QUP A;  3B29 A;  3LEO A;  1OW8 A;  2EPL X;  3A11 A;  3IHU A;  5D91 A;  4KNW A;  4EBK A;  4WGY A;  2ZXP A;  1RKC A;  2Y3B A;  2P61 A;  4J7T A;  2Y3G A;  2OCC C;  4KBL A;  4JTD B;  4JVS A;  3SYN A;  3CQZ A;  3KKB A;  3S90 A;  1NFO A;  5KYX A;  1L7C A;  3PMR A;  3FAP B;  3GOR A;  1HY5 A;  3EFO A;  3HLZ A;  1QLE C;  4MTF A;  2J9W A;  4XPY A;  2XM0 A;  2L81 A;  5E33 A;  4L6R A;  2R7S A;  3SEO A;  2C03 A;  2L7A A;  3TK0 A;  4YT5 A;  4IAQ A;  1RCP A;  1F1M A;  1T01 A;  4P9F A;  2PF4 E;  4PK4 A;  3ZC4 A;  3RFY A;  5JVE A;  1SZI A;  2EIM C;  2TMV P;  2GWW A;  5GPG B;  1WTY A;  3GAN A;  3AJM A;  5CI8 A;  4DBR A;  1MMG A;  4DOZ A;  3U8P A;  2HMZ A;  3DAG A;  2A6H F;  3O10 A;  2IXN A;  1BDJ B;  2LQG A;  2R7V A;  4DRJ B;  1LE4 A;  2GA0 A;  1CPQ A;  3ZQV A;  5A6J A;  4EHP A;  2HS5 A;  2HV7 A;  4BJ6 A;  2KQ9 A;  1D0X A;  1M2V A;  2EIL C;  1Q0K A;  2HKV A;  2IXM A;  4U9D A;  3RIP A;  3TOL A;  3VAY A;  2XLM A;  3RVZ A;  3X2Q C;  4LER A;  3UGP A;  4CIH A;  2P6V A;  2MWQ A;  3ABK C;  4EKW A;  256B A;  3NYL A;  4NQF A;  4XLN F;  2AWY A;  2A1D D;  3C8G D;  4MVZ A;  3ZIB A;  3R7C A;  4ZLC A;  2XRH A;  1N1C A;  4KI2 A;  2XLD A;  3C8G A;  3RQF A;  1D0Z A;  4IAR A;  5COG A;  1O5H A;  4OIN F;  1V74 B;  4U5C E;  2R7Q A;  3X1O A;  2J0X A;  1YJG A;  5L3V A;  5AGF A;  1TFO B;  2OG2 A;  4GEH A;  1ZHY A;  1KTM A;  1QZX A;  2NPU A;  3E70 C;  2JPU A;  2L9J A;  4CJG A;  2HJ3 A;  1QPU A;  1SYQ A;  4FES A;  1PV3 A;  4I1O B;  1PD0 A;  2HV6 A;  3DE8 A;  3O6X A;  4MVS A;  1HMO A;  1I5N A;  3V5Y A;  4E7S A;  2IM8 A;  3T6B A;  4FAP B;  1EI7 A;  4CS7 A;  3KPH A;  1BR1 A;  3FXH A;  1C03 A;  1M2V B;  1AEP A;  2M4E A;  2XL6 A;  1M2O A;  2EIJ C;  2UUH A;  4LDR A;  5AC5 A;  2XM4 A;  5DS5 A;  1RMV A;  1NBB A;  3ZWI A;  2OEX A;  3PCV A;  3SXK A;  4YWQ A;  1LM3 B;  1OCZ C;  2Y3D A;  3UMK A;  4AE4 A;  3ASO C;  4JKV A;  4EBJ A;  3US6 A;  1VMA A;  2KW3 C;  2EPO A;  2H7V C;  3LS0 A;  1JPN A;  4RD9 A;  1VOM A;  3TUL A;  5E3A A;  1MNE A;  3EGD A;  1ZVZ A;  4JE9 A;  1LS1 A;  4JTC B;  1V55 C;  4YT4 A;  2NSG A;  2P1A A;  2RSE B;  4EBB A;  5A6A A;  1LI5 A;  4IB4 A;  2LP4 A;  4U5F E;  1ORY A;  3S9O A;  2BC5 A;  2HMQ A;  4CJO A;  1HW2 A;  1YZC A;  2D5R B;  2HSQ A;  1MQV A;  4OIR F;  5A6K A;  4NCQ A;  1Z3I X;  4MVQ A;  2XLW A;  1OQC A;  4XEV A;  4FX5 A;  1VLT A;  2W9Y A;  2IYL D;  2LFD A;  3TQO A;  2YZS A;  3K66 A;  2NUP B;  3WG7 C;  1E85 A;  2FGY A;  4G7Z F;  4XQ1 A;  3IPM O;  4YL0 A;  1NU9 C;  1TWH A;  1JMW A;  1KNY A;  2G3K A;  4CDV A;  3DZA A;  1G5Z A;  1Q0F A;  3EGX B;  1T6Q A;  3AG2 C;  2ZXR A;  4DVY P;  3DE9 A;  3KYI A;  2CCY A;  3DXJ F;  2CGE A;  3EHM A;  3AG3 C;  4X0R A;  4Z9J A;  2XXA A;  1DOW A;  1W2W A;  1GS9 A;  2V26 A;  3KL4 A;  4WJ0 A;  3VYW A;  2HSB A;  2EPM X;  3O39 A;  3B71 A;  4IAO A;  1YA7 O;  4RDA A;  2A0B A;  2W45 A;  1T5O A;  4YL3 A;  1S7Z A;  2OU6 A;  1C02 A;  2PX3 A;  2FAP B;  3RKO F; 
#chains in the Genus database with same CATH homology
 2XM0 A;  5JT4 A;  2XL8 A;  4L6R A;  4NC3 A;  1CPR A;  3ZTM A;  4IAQ A;  1RCP A;  5JVE A;  2YLI A;  4CIP A;  3M15 A;  3NMK A;  5JSL A;  4CDY A;  3TOM A;  1QQ3 A;  3NMJ A;  3U8P A;  5JUA A;  3C62 A;  1E83 A;  1CPQ A;  3M79 A;  3ZQV A;  3FOP A;  2XLH A;  4U9D A;  3TOL A;  1APC A;  3FOO A;  4EIY A;  2XLM A;  3M4B A;  5JLI A;  1CGO A;  2XLV A;  3VRC A;  256B A;  3QW1 A;  3M4C A;  2YL0 A;  2XLD A;  2QLA A;  4IAR A;  1EKY A;  2XLO A;  5AGF A;  4CJG A;  3QW0 A;  1QPU A;  3DE8 A;  3HNJ A;  3QVZ A;  1E86 A;  4U9E A;  3IQ6 A;  1A7V A;  2XL6 A;  4CDA A;  4CX9 A;  1E84 A;  2YKZ A;  2XM4 A;  1NBB A;  1M6T A;  3ZWI A;  2YLD A;  1LM3 B;  3L1M A;  4JKV A;  2J8W A;  3HNI A;  3HNK A;  1CGN A;  5JP7 A;  3QVY A;  3IQ5 A;  4ULV A;  4JE9 A;  2YL1 A;  3ZQY A;  2YL7 A;  4IB4 A;  1S05 A;  2BC5 A;  4CJO A;  1YZC A;  1MQV A;  2XLW A;  3ZTZ A;  3NMI A;  1YYX A;  2J9B A;  4JEB A;  4JEA A;  1E85 A;  2XLE A;  4N6H A;  1JAF A;  2YLG A;  1GQA A;  1YZA A;  4CDV A;  5B3I A;  4N4W A;  5JRA A;  4D4X A;  3DE9 A;  2YL3 A;  3C63 A;  2CCY A;  4WGY A;  5JS5 A;  4WGZ A;  3HNL A;  4ER9 A;  1BBH A;  1YYJ A;  4D4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...