5JRAA

Nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jraA00
3DE9A 3DE8A 4IARA 2XL6A 1JAFA 4EIYA 2YKZA 4U9EA 2XLHA 2XLWA 5JS5A 4WGZA 2CCYA 1CPQA 3HNIA 3NMJA 3HNJA 3QW1A 5JVEA 1YYXA 1APCA 3HNKA 1E84A 1E85A 3TOMA 2XL8A 1S05A 4ULVA 4N4WA 3HNLA 3ZTMA 1YZCA 3ZQYA 5JUAA 2YL7A 5B3IA 1RCPA 3IQ5A 3FOOA 4JKVA 3FOPA 2XLOA 1CPRA 1MQVA 1EKYA 1QQ3A 3NMIA 4CIPA 4CDYA 4JE9A 1E86A 3U8PA 4CDAA 2YL1A 1YYJA 4CDVA 5JLIA 1YZAA 2BC5A 3ZWIA 4CJOA 2XLDA 3IQ6A 5JT4A 1NBBA 1E83A 1QPUA 2YLIA 3QW0A 2XLEA 2YL0A 3VRCA 4D4XA 4WGYA 3M15A 2YLGA 3NMKA 5JSLA 5JP7A 4IAQA 1A7VA 3L1MA 4NC3A 1M6TA 2YL3A 1GQAA 3TOLA 4CX9A 3QVZA 2J9BA 4L6RA 2XM4A 1CGOA 3M79A 4JEBA 2YLDA 3ZTZA 3C63A 1BBHA 4N6HA 5AGFA 3M4CA 1LM3B 2XLMA 1CGNA 4D4NA 3QVYA 4CJGA 3C62A 2XM0A 4ER9A 2J8WA 5JRAA 3M4BA 3ZQVA 4JEAA 4IB4A 256BA 2XLVA 2QLAA 4U9DA
chains in the Genus database with same CATH superfamily
4DRHB 2H7OA 3DE8A 2ZXPA 3FXHA 4I3MA 2P1AA 3FVYA 1ORSC 3RVZA 3AG1C 2XL6A 3DXJF 4EIYA 1N1CA 3MLGA 2WZFA 3KYJA 4U9EA 2KC3A 1ORJA 3AJMA 3S27A 4A2NB 1D1AA 2L6FA 3H2VA 5A6AA 4JVSA 4U5HA 2CNWD 3U8VA 4XPXA 2MWQA 4A4AA 4YL0A 3EJNA 2JX0A 2R7VA 4OIQF 1WASA 2AWCA 5JVEA 3DAGA 3O39A 4FWVA 5D91A 3Q7GA 1XWJA 1VYIA 4DVZA 4WABA 3SZRA 2J9WA 3EHMA 1C03A 2J7PD 2PP4A 1PD0A 3JT1A 5FCLA 2HKVA 2VASA 4NY3A 4U5DE 3EHNA 5GPGB 4ULVA 1QVXA 2X51A 2P61A 4N4WA 3DJUB 1A7EA 4MVOA 2KNHA 3N2ZB 3GM3A 2ETSA 4XEFA 4J30B 3ZQYA 4EKWA 4BJ6C 1WTYA 4DBRA 5KYXA 3FAJA 1MNDA 2J45A 5B1BC 4XTKA 4KI2A 2X0CA 5DVWA 1HMOA 4BPMA 3S90A 3UGOA 3FOPA 2IBFA 1EQ1A 2LCHA 4CSAA 1TWGA 1F1MA 3B0PA 1TWCA 2HJMA 3B9QA 4P9FA 3U2LA 4EHPA 3JSZA 4JE9A 2LK4A 2HV6A 2R7XA 3POVA 2P6VA 4OIPF 5F28E 3UMIA 2CNWA 4MS2A 2Y3BA 1BR1A 2KK1A 1EA8A 2BC5A 4ULWA 4CJOA 1T6IA 3EFOB 2VCCA 4PK4A 5L0HA 4P6IC 3EG9A 3IQ6A 3OWTA 2IM8A 1GM5A 1NBBA 1FFTC 2IXOA 3SXMA 2YQYA 1T6QA 2EIKC 4G7HF 3KH2A 2J0WA 1LKXA 3HJCA 1YAUO 2CYDA 2A0UA 3T9OA 3W4YA 3VAYA 2L6GA 4OD4A 1OW7A 2Q9CA 1V54C 1C17M 1HE1A 1O5HA 3QW0A 3VF0A 3U9MA 2J0XA 3VRCA 4BEJA 1ORYA 2L6HA 2A6HF 4WGYA 4YK5A 2I15A 3EZIA 1TWAA 4IGGA 4E0HA 4OIOF 4IAQA 1M56C 3RW0A 2A6EF 3G50A 2PBEA 2Z15A 5KYUB 3DJNB 4N6CA 3TOLA 2PF4E 4CIHA 4KC9A 3DAFA 3RYLA 5A6JA 3DZAA 2XM4A 4YJWA 4CSAC 2GWWA 3GWLA 5B1AC 3S84A 1PV3A 2W4MA 1RKCA 3MBGA 5BQGA 1TFKB 3AG4C 2WZGA 4H4KC 4RBNA 2EIJC 5E3AA 4CS9C 2XXAB 1OR3A 2JD3A 3R7CA 2KW3C 3C63A 3EZHA 2JPUA 4G0HA 1LM3B 4JJGA 3JTLO 1CGNA 3WHNA 1OCRC 1ZHZA 2EPMX 2IXMA 1T9KA 5T1DB 4CS7A 4KNVA 4Z9JA 1ST6A 4NQFA 1YJGA 1NG1A 3QMKA 3EGXA 5B3SC 3LS0A 4IB4A 1U0BB 2M4EA 2XLVA 3NYJA 5COGA 3G4ZA 4U9DA 1I4ZA 2P0NA 4MQ9F 5DQZA 1E2XA 1XZQA 1Q0MA 2IXNA 4EBBA 3SYNA 4B6IA 4E7SA 4AX2A 1OKKA 2A1DD 2R7SA 2R7UA 1V55C 5FZTA 1OCZC 1JPJA 2XLWA 1FAPB 2A69F 3FAPB 3LJBA 5EK0A 1Z3IX 2XSEA 3U9JA 3MYFA 1PD1A 4JRZA 4PJLA 4NTFA 4X0RA 5KYXB 2CCYA 1YLMA 1R4TA 2YVKA 3AOUA 4LACB 4PACA 2OOCA 3ABMC 3JYYA 2ASRA 4BJ6A 3MYIA 1KTMA 3ABLC 3S0XA 3TK0A 3HNJA 5KYUA 2BL2A 2YZSA 3AG2C 1FMWA 1YYXA 3C8GA 1T01A 4GQHA 4NTBA 1Z23A 3BEHA 2I8BA 2XRHA 3JCUQ 1JR8A 2EPKX 3LEVA 3NKDA 2J9UA 1VMAA 1ZHYA 3ASNC 1S05A 3AQCA 3O55A 3HNLA 3U0CA 3ZTMA 3L8JA 3V7OA 1YZCA 5L0GA 1YA7O 2V3CC 1LE2A 2D4UA 3EG9B 4JTAB 4RD9A 5B3IA 1G4WR 1HW1A 4C7OB 4EWCA 3JRMO 3FMSA 4MW3A 1TQGA 1D0XA 1JMWA 4DBQA 1MMAA 2D5RB 4XLNF 4JJFA 1XZPA 1E86A 1BR4A 1O87A 2BE5F 2L81A 4R32A 3L0IA 5DS6A 5JLIA 1KNYA 1L7CA 5COMA 1FNTc 1OW8A 5JT4A 3GEEA 3WG7C 2HMQA 1B68A 1D1CA 2XL4A 1AUEA 4OINF 3NDBB 5T3TA 2XS8A 1CGME 4GEHA 1V74B 2OEVA 1OXKA 5L0DA 4O6NA 1VTMP 4MW8A 2R7TA 1LS4A 2PNOA 1GGQA 3E70C 2WVOA 3GEHA 2L7AA 3ZIBA 5T3WA 5HV9A 1NSGB 2HMZA 4E0IA 2YLIA 2DYSC 3NKEA 3LLIA 4LDRA 2XLEA 4BJTA 1QZXA 2YL0A 4YT5A 1HE9A 3ZSUA 2OEXA 3SP1A 2R02A 4BJ5C 4EBJA 1TWHA 2E87A 2RD9A 3M15A 4KBLA 4O79A 4CS9A 2GAQA 1K05A 3LLKA 1SYQA 4Q5SF 5E2QA 4LLCA 5JP7A 2QTVA 1ZHXA 2Q4FA 5K0IA 3NRHA 1D0YA 1NU9C 4LERA 3DM9B 3J06A 4NC3A 1M6TA 2YL3A 3MX3A 1OCCC 1Z6AA 4L6RA 1J8YF 3IHUA 2VB6A 3QTHA 3W8HA 4CBEA 4C7OA 1FFHA 3L34A 3C18A 3EGXB 4QI0A 4I1OB 1TKNA 3MFNA 4RDAA 2YLDA 2GA0A 2UUIA 3HTKC 3IQTA 3V5YA 4Q4ZF 1NFNA 1SZIA 2ZD9A 3M4CA 4HE8D 4Z9IA 1NZEA 3DKAA 3S28A 3TJ6A 3ATPA 3LNMB 3RQGA 3CSKA 2KSFA 2PFDA 3TQOA 2HJ3A 1QKRA 4AK9A 2EPOA 5DQTA 2KGOA 3C8ZA 4DJ9A 1WGWA 2Q3TA 3T6BA 3AGUA 3C62A 4U5BE 4P9TA 3KL4A 2CGEA 2Q7RA 4AE4A 4ER9A 1T5OA 2GDCA 2NSGA 3AQBA 3M4BA 2VCAA 3F47A 5L3VA 2QLAA 4WJ0A 5EGYA 3CQZA 4N06A 3C8GB 3DE9A 2WB7A 2EIMC 1OKKD 2HV7A 3SNHA 1LVKA 1M57C 3K1HA 4IJJA 1HW2A 2XLHA 5A6BA 4QDLA 3B0UX 4W8KA 3K1IC 4DOZA 2QNLA 4YN0B 1K40A 3E9VA 2R05A 3FHDA 4XEVA 5E33A 3VM6A 5JS5A 3RKOF 1FTSA 2Y3GA 4MVRA 4NCQA 1CPQA 3HNIA 3SXYA 3C8GD 4J7TA 3O6XA 3LEOA 2OCCC 2ZXOA 1APCA 3DI5A 2G62A 2HS5A 3ZDLA 4U5GA 5COFA 1UG7A 1S7ZA 2KYHA 5KYYB 3R2PA 1E85A 4J32B 3TOMA 4BJ1A 3TULA 2XL8A 1Q0GA 1ZHTA 4BG0A 4LLEA 3IPMO 4ZLDA 1IZMA 2B0HA 2W4BA 5A6BD 1UFBA 1QSPA 3US6A 1ZW3A 2YL7A 3I5PA 4G7OF 3ITFA 4MTGA 5AC5A 4FAPB 3W2VA 1SMYF 1RCPA 1ZU5A 5F5FA 3FOOA 2R9RB 1RJ9B 4JKVA 2XLOA 1CPRA 4CS8C 3EPVA 3LS1A 1MQVA 5IY5C 1QQ3A 4JURI 3QZCA 4LDQA 2AVKA 4CIPA 1EKYA 4CDYA 2XS1A 4DXWA 4F4BA 2J9VA 3Q6NA 4JCZA 3RIPA 3U8PA 4DVYP 1W2WA 4CDAA 1WN0A 2YL1A 4CDVA 5AC4A 3LESA 4K7BA 1H7IA 4MVMA 1YZAA 5BUOA 5A69A 1ZU4A 4IRUA 3ZWIA 4DRIB 3LNRA 1H9TA 2DYRC 1OXBA 2XLDA 3JYHA 4NTAA 3LAYA 1Z7Qc 4BJ5A 1GS9A 2DGJA 2HFIA 2LIGA 2OU6A 2RSEB 2YEVA 4IAOA 3EQLF 1YDIA 4MNDA 2KJGA 3DWWA 4XEKA 3X1OA 4E18A 4EBKA 1G8XA 3BRJA 3GANA 4JC7A 1G4US 1BDJB 4PJMA 1SF8A 3Q6MA 1ZZPA 2EPLX 2P7VA 5D92A 3TJ5A 2DI3A 3ZC4A 5L3QA 3TD7A 4C3BA 5E3CA 2H7VC 2NUTA 4D4XA 1TR2A 3EH2A 3RQFA 2QY9A 4YT8A 2A0BA 4YL3A 3K33A 3U3BA 3RH3A 5KYYA 1JPNA 1VOMA 3HKKA 3WAQA 3NG1A 3U2MA 1QLEC 3IEEA 1D0ZA 3RFYA 1NU7D 1L3PA 2EILC 2EINC 2KQ9A 3GM1A 3GODA 3K6BA 3L1MA 3V5XA 2FGYA 5L0FA 1RKEB 4U5EE 2L9JA 3JSEO 1Y4CA 2YRFA 2DB4A 1DOVA 2LFFA 4HFKB 3O10A 4KNWA 4JTDB 3QVZA 4CX9A 3H65A 3JRTA 1AVOB 1CGOA 1OW6A 2LFDA 1RJ9A 2CW0F 3M79A 3PMRA 2AWYA 2NUPA 4MTFA 4AE4B 4PFPA 5DLJA 5L0JA 3HLZA 3PDMP 1RMVA 2HUJA 2A68F 4G78A 2YHSA 5KYWB 3PHF2 1I5NA 3U5SA 3ZTZA 4N6HA 1EI7A 1ZHWA 4J7YA 3RVYA 3S9OA 4AL0A 4UDVA 3ABKC 2WZLA 4C3EA 1Q0FA 1HMDA 3OEOA 2PX3A 2WVQA 2VCBA 3AG3C 2G3VA 4Z9HA 5HSWA 5L0IA 2V26A 1U89A 2NG1A 3W8IA 4CJGA 1Y6DA 3K1IA 2IYLD 2H7BA 3B29A 1LE4A 2XM0A 3N24A 3ZG1A 5EHHA 2Y3DA 3CAXA 3L8IA 1NLXA 2UUHA 3ZQVA 4JEAA 5KYNA 1ZVZA 4MVSA 256BA 1OCOC 4JW1A 5DS5A 4AL1A 1YARO 1J8MF 4YL1A 1LS1A 1HY5A 3DM5A 3AGTA 1KU2A 1M2OA 3CZ6A 1NFOA 1VLSA 3N0TA 4IARA 1U6HA 3KPHA 3A9CA 1JAFA 2FFHA 1PCXA 3LUTB 3NYLA 2O9XA 4XPWA 3ZVRA 4DRJB 2ICWG 2NPUA 2YKZA 3SXKA 1K04A 3SXZA 4K0DA 2C03A 3FDQA 2R7RA 2TMVP 4HFFB 2R7OA 3M1CB 2VC9A 3ASOC 4WGZA 3KKBA 3B71A 2OQMA 1H6GA 3NMJA 4O6MA 2HSBA 2OJED 4I1MA 4LDKA 1A41A 1RKEA 2QUPA 2AU5A 3ECSA 1Z5ZA 4GYTA 4HEAJ 3X2QC 3QW1A 1WWPA 4CS8A 3F46A 1WATA 1I4YA 1O3UA 3HNKA 3UNGC 5F5HA 2W9YA 4FX5A 1E84A 1LI7A 3GM2A 3Q7LA 4XWJA 3UMHA 2J7PA 1JOGA 1OQCA 2C04A 3G4XA 2AP3A 2PX0A 1LIHA 3WODF 5KYWA 1Z63A 4JCHA 3V5ZA 4MVZA 5JUAA 1M2VB 4MVQA 1A7DA 5TJ5E 4I44A 1A0BA 3I4UA 2LSEA 3CEXA 3IQ5A 3EGDB 3KYIA 3RQEA 4OIRF 1BR2A 1MMNA 4U5FE 2WVNA 3NMIA 4BEMJ 4YWQA 3K66A 4JTCB 3C7JA 3IQCA 2WL8A 4XQ1A 4QI2A 5BQHA 2ZXWC 3U3FA 3UR3C 5BQIA 2MHRA 2VH3A 1YYJA 1H9GA 2NSFA 2B0JA 1VK5A 3OA1A 1Q0DA 1VB5A 2F22A 2NUTB 3H2UA 2EPNA 4O6YA 2YWAA 4PJNA 2FAPB 4JIOA 5CI9A 1MMGA 3T6JA 1ZYRF 2HZ8A 2GFHA 2R7WA 3DMDA 3UGPA 4E17A 4M63A 3T6GB 1LI5A 5A6KA 2R03A 1IW7F 3GORA 3RF3A 2W45A 1E83A 1QPUA 2ZXRA 4XLPF 2OJQA 4YT4A 3K7DA 4XPYA 1DOWA 2OKUA 1RXQA 3DD7A 4Q7CA 3GWNA 4EUKB 1VLTA 5DS4A 2NUPB 3UMKA 2CDQA 3I5QA 3EFOA 4O7GA 4ANJA 4IWBA 1Q0KA 4U5CE 1OR2A 4JZAA 2YLGA 2R7QA 3NMKA 4ONSA 1FR0A 2Y69C 1C02A 5JSLA 4OD5A 1AEPA 3W2WA 1A7VA 1V4AA 1M2VA 3VYWA 3SEOA 1GQAA 2Q9BA 2HSQA 2J9BA 1YA9A 1YVIA 1R5ID 3PCVA 2Y39A 2Y3HA 3S29A 2Q00A 3EGDA 3JZ0A 5L0CA 4JEBA 1D1BA 1FMVA 3KMIA 3NYMA 5CIVA 2H8AA 2LD6A 3A11A 1MNEA 2R25A 2J46A 1SR2A 1BBHA 3EH1A 5AGFA 4G7ZF 4W8PA 4PJJA 4ZLCA 4MTOA 2XLMA 4YT2A 1MMDA 4PR9A 4D4NA 4H54A 1BZ4A 1VYKA 2Q9AA 4E7ZA 2IOQA 2QE9A 1JRAA 3GEIA 2IXPA 1ZW2A 3QVYA 3T4RA 3B0VC 2ZPAA 1WOLA 2OG2A 4FESA 4PFOA 4MVUA 2J8WA 5CI8A 4K1OA 2M64A 4C3DA 5JRAA 2LP4A 2MYSA 1LPEA 1TFOB 1T6UA 2XXAA 1G5ZA 2G3KA 2LQGA
chains in the Genus database with same CATH topology
3DE9A 3DE8A 4IARA 2XL6A 1JAFA 4EIYA 2YKZA 4U9EA 2XLHA 2XLWA 5JS5A 4WGZA 2CCYA 1CPQA 3HNIA 3NMJA 3HNJA 3QW1A 5JVEA 1YYXA 1APCA 3HNKA 1E84A 1E85A 3TOMA 2XL8A 1S05A 4ULVA 4N4WA 3HNLA 3ZTMA 1YZCA 3ZQYA 5JUAA 2YL7A 5B3IA 1RCPA 3IQ5A 3FOOA 4JKVA 3FOPA 2XLOA 1CPRA 1MQVA 1EKYA 1QQ3A 3NMIA 4CIPA 4CDYA 4JE9A 1E86A 3U8PA 4CDAA 2YL1A 1YYJA 4CDVA 5JLIA 1YZAA 2BC5A 3ZWIA 4CJOA 2XLDA 3IQ6A 5JT4A 1NBBA 1E83A 1QPUA 2YLIA 3QW0A 2XLEA 2YL0A 3VRCA 4D4XA 4WGYA 3M15A 2YLGA 3NMKA 5JSLA 5JP7A 4IAQA 1A7VA 3L1MA 4NC3A 1M6TA 2YL3A 1GQAA 3TOLA 4CX9A 3QVZA 2J9BA 4L6RA 2XM4A 1CGOA 3M79A 4JEBA 2YLDA 3ZTZA 3C63A 1BBHA 4N6HA 5AGFA 3M4CA 1LM3B 2XLMA 1CGNA 4D4NA 3QVYA 4CJGA 3C62A 2XM0A 4ER9A 2J8WA 5JRAA 3M4BA 3ZQVA 4JEAA 4IB4A 256BA 2XLVA 2QLAA 4U9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE9 A;  3DE8 A;  4IAR A;  2XL6 A;  1JAF A;  4EIY A;  2YKZ A;  4U9E A;  2XLH A;  2XLW A;  5JS5 A;  4WGZ A;  2CCY A;  1CPQ A;  3HNI A;  3NMJ A;  3HNJ A;  3QW1 A;  5JVE A;  1YYX A;  1APC A;  3HNK A;  1E84 A;  1E85 A;  3TOM A;  2XL8 A;  1S05 A;  4ULV A;  4N4W A;  3HNL A;  3ZTM A;  1YZC A;  3ZQY A;  5JUA A;  2YL7 A;  5B3I A;  1RCP A;  3IQ5 A;  3FOO A;  4JKV A;  3FOP A;  2XLO A;  1CPR A;  1MQV A;  1EKY A;  1QQ3 A;  3NMI A;  4CIP A;  4CDY A;  4JE9 A;  1E86 A;  3U8P A;  4CDA A;  2YL1 A;  1YYJ A;  4CDV A;  5JLI A;  1YZA A;  2BC5 A;  3ZWI A;  4CJO A;  2XLD A;  3IQ6 A;  5JT4 A;  1NBB A;  1E83 A;  1QPU A;  2YLI A;  3QW0 A;  2XLE A;  2YL0 A;  3VRC A;  4D4X A;  4WGY A;  3M15 A;  2YLG A;  3NMK A;  5JSL A;  5JP7 A;  4IAQ A;  1A7V A;  3L1M A;  4NC3 A;  1M6T A;  2YL3 A;  1GQA A;  3TOL A;  4CX9 A;  3QVZ A;  2J9B A;  4L6R A;  2XM4 A;  1CGO A;  3M79 A;  4JEB A;  2YLD A;  3ZTZ A;  3C63 A;  1BBH A;  4N6H A;  5AGF A;  3M4C A;  1LM3 B;  2XLM A;  1CGN A;  4D4N A;  3QVY A;  4CJG A;  3C62 A;  2XM0 A;  4ER9 A;  2J8W A;  5JRA A;  3M4B A;  3ZQV A;  4JEA A;  4IB4 A;  256B A;  2XLV A;  2QLA A;  4U9D A; 
#chains in the Genus database with same CATH topology
 4DRH B;  2H7O A;  3DE8 A;  2ZXP A;  3FXH A;  4I3M A;  2P1A A;  3FVY A;  1ORS C;  3RVZ A;  3AG1 C;  2XL6 A;  3DXJ F;  4EIY A;  1N1C A;  3MLG A;  2WZF A;  3KYJ A;  4U9E A;  2KC3 A;  1ORJ A;  3AJM A;  3S27 A;  4A2N B;  1D1A A;  2L6F A;  3H2V A;  5A6A A;  4JVS A;  4U5H A;  2CNW D;  3U8V A;  4XPX A;  2MWQ A;  4A4A A;  4YL0 A;  3EJN A;  2JX0 A;  2R7V A;  4OIQ F;  1WAS A;  2AWC A;  5JVE A;  3DAG A;  3O39 A;  4FWV A;  5D91 A;  3Q7G A;  1XWJ A;  1VYI A;  4DVZ A;  4WAB A;  3SZR A;  2J9W A;  3EHM A;  1C03 A;  2J7P D;  2PP4 A;  1PD0 A;  3JT1 A;  5FCL A;  2HKV A;  2VAS A;  4NY3 A;  4U5D E;  3EHN A;  5GPG B;  4ULV A;  1QVX A;  2X51 A;  2P61 A;  4N4W A;  3DJU B;  1A7E A;  4MVO A;  2KNH A;  3N2Z B;  3GM3 A;  2ETS A;  4XEF A;  4J30 B;  3ZQY A;  4EKW A;  4BJ6 C;  1WTY A;  4DBR A;  5KYX A;  3FAJ A;  1MND A;  2J45 A;  5B1B C;  4XTK A;  4KI2 A;  2X0C A;  5DVW A;  1HMO A;  4BPM A;  3S90 A;  3UGO A;  3FOP A;  2IBF A;  1EQ1 A;  2LCH A;  4CSA A;  1TWG A;  1F1M A;  3B0P A;  1TWC A;  2HJM A;  3B9Q A;  4P9F A;  3U2L A;  4EHP A;  3JSZ A;  4JE9 A;  2LK4 A;  2HV6 A;  2R7X A;  3POV A;  2P6V A;  4OIP F;  5F28 E;  3UMI A;  2CNW A;  4MS2 A;  2Y3B A;  1BR1 A;  2KK1 A;  1EA8 A;  2BC5 A;  4ULW A;  4CJO A;  1T6I A;  3EFO B;  2VCC A;  4PK4 A;  5L0H A;  4P6I C;  3EG9 A;  3IQ6 A;  3OWT A;  2IM8 A;  1GM5 A;  1NBB A;  1FFT C;  2IXO A;  3SXM A;  2YQY A;  1T6Q A;  2EIK C;  4G7H F;  3KH2 A;  2J0W A;  1LKX A;  3HJC A;  1YAU O;  2CYD A;  2A0U A;  3T9O A;  3W4Y A;  3VAY A;  2L6G A;  4OD4 A;  1OW7 A;  2Q9C A;  1V54 C;  1C17 M;  1HE1 A;  1O5H A;  3QW0 A;  3VF0 A;  3U9M A;  2J0X A;  3VRC A;  4BEJ A;  1ORY A;  2L6H A;  2A6H F;  4WGY A;  4YK5 A;  2I15 A;  3EZI A;  1TWA A;  4IGG A;  4E0H A;  4OIO F;  4IAQ A;  1M56 C;  3RW0 A;  2A6E F;  3G50 A;  2PBE A;  2Z15 A;  5KYU B;  3DJN B;  4N6C A;  3TOL A;  2PF4 E;  4CIH A;  4KC9 A;  3DAF A;  3RYL A;  5A6J A;  3DZA A;  2XM4 A;  4YJW A;  4CSA C;  2GWW A;  3GWL A;  5B1A C;  3S84 A;  1PV3 A;  2W4M A;  1RKC A;  3MBG A;  5BQG A;  1TFK B;  3AG4 C;  2WZG A;  4H4K C;  4RBN A;  2EIJ C;  5E3A A;  4CS9 C;  2XXA B;  1OR3 A;  2JD3 A;  3R7C A;  2KW3 C;  3C63 A;  3EZH A;  2JPU A;  4G0H A;  1LM3 B;  4JJG A;  3JTL O;  1CGN A;  3WHN A;  1OCR C;  1ZHZ A;  2EPM X;  2IXM A;  1T9K A;  5T1D B;  4CS7 A;  4KNV A;  4Z9J A;  1ST6 A;  4NQF A;  1YJG A;  1NG1 A;  3QMK A;  3EGX A;  5B3S C;  3LS0 A;  4IB4 A;  1U0B B;  2M4E A;  2XLV A;  3NYJ A;  5COG A;  3G4Z A;  4U9D A;  1I4Z A;  2P0N A;  4MQ9 F;  5DQZ A;  1E2X A;  1XZQ A;  1Q0M A;  2IXN A;  4EBB A;  3SYN A;  4B6I A;  4E7S A;  4AX2 A;  1OKK A;  2A1D D;  2R7S A;  2R7U A;  1V55 C;  5FZT A;  1OCZ C;  1JPJ A;  2XLW A;  1FAP B;  2A69 F;  3FAP B;  3LJB A;  5EK0 A;  1Z3I X;  2XSE A;  3U9J A;  3MYF A;  1PD1 A;  4JRZ A;  4PJL A;  4NTF A;  4X0R A;  5KYX B;  2CCY A;  1YLM A;  1R4T A;  2YVK A;  3AOU A;  4LAC B;  4PAC A;  2OOC A;  3ABM C;  3JYY A;  2ASR A;  4BJ6 A;  3MYI A;  1KTM A;  3ABL C;  3S0X A;  3TK0 A;  3HNJ A;  5KYU A;  2BL2 A;  2YZS A;  3AG2 C;  1FMW A;  1YYX A;  3C8G A;  1T01 A;  4GQH A;  4NTB A;  1Z23 A;  3BEH A;  2I8B A;  2XRH A;  3JCU Q;  1JR8 A;  2EPK X;  3LEV A;  3NKD A;  2J9U A;  1VMA A;  1ZHY A;  3ASN C;  1S05 A;  3AQC A;  3O55 A;  3HNL A;  3U0C A;  3ZTM A;  3L8J A;  3V7O A;  1YZC A;  5L0G A;  1YA7 O;  2V3C C;  1LE2 A;  2D4U A;  3EG9 B;  4JTA B;  4RD9 A;  5B3I A;  1G4W R;  1HW1 A;  4C7O B;  4EWC A;  3JRM O;  3FMS A;  4MW3 A;  1TQG A;  1D0X A;  1JMW A;  4DBQ A;  1MMA A;  2D5R B;  4XLN F;  4JJF A;  1XZP A;  1E86 A;  1BR4 A;  1O87 A;  2BE5 F;  2L81 A;  4R32 A;  3L0I A;  5DS6 A;  5JLI A;  1KNY A;  1L7C A;  5COM A;  1FNT c;  1OW8 A;  5JT4 A;  3GEE A;  3WG7 C;  2HMQ A;  1B68 A;  1D1C A;  2XL4 A;  1AUE A;  4OIN F;  3NDB B;  5T3T A;  2XS8 A;  1CGM E;  4GEH A;  1V74 B;  2OEV A;  1OXK A;  5L0D A;  4O6N A;  1VTM P;  4MW8 A;  2R7T A;  1LS4 A;  2PNO A;  1GGQ A;  3E70 C;  2WVO A;  3GEH A;  2L7A A;  3ZIB A;  5T3W A;  5HV9 A;  1NSG B;  2HMZ A;  4E0I A;  2YLI A;  2DYS C;  3NKE A;  3LLI A;  4LDR A;  2XLE A;  4BJT A;  1QZX A;  2YL0 A;  4YT5 A;  1HE9 A;  3ZSU A;  2OEX A;  3SP1 A;  2R02 A;  4BJ5 C;  4EBJ A;  1TWH A;  2E87 A;  2RD9 A;  3M15 A;  4KBL A;  4O79 A;  4CS9 A;  2GAQ A;  1K05 A;  3LLK A;  1SYQ A;  4Q5S F;  5E2Q A;  4LLC A;  5JP7 A;  2QTV A;  1ZHX A;  2Q4F A;  5K0I A;  3NRH A;  1D0Y A;  1NU9 C;  4LER A;  3DM9 B;  3J06 A;  4NC3 A;  1M6T A;  2YL3 A;  3MX3 A;  1OCC C;  1Z6A A;  4L6R A;  1J8Y F;  3IHU A;  2VB6 A;  3QTH A;  3W8H A;  4CBE A;  4C7O A;  1FFH A;  3L34 A;  3C18 A;  3EGX B;  4QI0 A;  4I1O B;  1TKN A;  3MFN A;  4RDA A;  2YLD A;  2GA0 A;  2UUI A;  3HTK C;  3IQT A;  3V5Y A;  4Q4Z F;  1NFN A;  1SZI A;  2ZD9 A;  3M4C A;  4HE8 D;  4Z9I A;  1NZE A;  3DKA A;  3S28 A;  3TJ6 A;  3ATP A;  3LNM B;  3RQG A;  3CSK A;  2KSF A;  2PFD A;  3TQO A;  2HJ3 A;  1QKR A;  4AK9 A;  2EPO A;  5DQT A;  2KGO A;  3C8Z A;  4DJ9 A;  1WGW A;  2Q3T A;  3T6B A;  3AGU A;  3C62 A;  4U5B E;  4P9T A;  3KL4 A;  2CGE A;  2Q7R A;  4AE4 A;  4ER9 A;  1T5O A;  2GDC A;  2NSG A;  3AQB A;  3M4B A;  2VCA A;  3F47 A;  5L3V A;  2QLA A;  4WJ0 A;  5EGY A;  3CQZ A;  4N06 A;  3C8G B;  3DE9 A;  2WB7 A;  2EIM C;  1OKK D;  2HV7 A;  3SNH A;  1LVK A;  1M57 C;  3K1H A;  4IJJ A;  1HW2 A;  2XLH A;  5A6B A;  4QDL A;  3B0U X;  4W8K A;  3K1I C;  4DOZ A;  2QNL A;  4YN0 B;  1K40 A;  3E9V A;  2R05 A;  3FHD A;  4XEV A;  5E33 A;  3VM6 A;  5JS5 A;  3RKO F;  1FTS A;  2Y3G A;  4MVR A;  4NCQ A;  1CPQ A;  3HNI A;  3SXY A;  3C8G D;  4J7T A;  3O6X A;  3LEO A;  2OCC C;  2ZXO A;  1APC A;  3DI5 A;  2G62 A;  2HS5 A;  3ZDL A;  4U5G A;  5COF A;  1UG7 A;  1S7Z A;  2KYH A;  5KYY B;  3R2P A;  1E85 A;  4J32 B;  3TOM A;  4BJ1 A;  3TUL A;  2XL8 A;  1Q0G A;  1ZHT A;  4BG0 A;  4LLE A;  3IPM O;  4ZLD A;  1IZM A;  2B0H A;  2W4B A;  5A6B D;  1UFB A;  1QSP A;  3US6 A;  1ZW3 A;  2YL7 A;  3I5P A;  4G7O F;  3ITF A;  4MTG A;  5AC5 A;  4FAP B;  3W2V A;  1SMY F;  1RCP A;  1ZU5 A;  5F5F A;  3FOO A;  2R9R B;  1RJ9 B;  4JKV A;  2XLO A;  1CPR A;  4CS8 C;  3EPV A;  3LS1 A;  1MQV A;  5IY5 C;  1QQ3 A;  4JUR I;  3QZC A;  4LDQ A;  2AVK A;  4CIP A;  1EKY A;  4CDY A;  2XS1 A;  4DXW A;  4F4B A;  2J9V A;  3Q6N A;  4JCZ A;  3RIP A;  3U8P A;  4DVY P;  1W2W A;  4CDA A;  1WN0 A;  2YL1 A;  4CDV A;  5AC4 A;  3LES A;  4K7B A;  1H7I A;  4MVM A;  1YZA A;  5BUO A;  5A69 A;  1ZU4 A;  4IRU A;  3ZWI A;  4DRI B;  3LNR A;  1H9T A;  2DYR C;  1OXB A;  2XLD A;  3JYH A;  4NTA A;  3LAY A;  1Z7Q c;  4BJ5 A;  1GS9 A;  2DGJ A;  2HFI A;  2LIG A;  2OU6 A;  2RSE B;  2YEV A;  4IAO A;  3EQL F;  1YDI A;  4MND A;  2KJG A;  3DWW A;  4XEK A;  3X1O A;  4E18 A;  4EBK A;  1G8X A;  3BRJ A;  3GAN A;  4JC7 A;  1G4U S;  1BDJ B;  4PJM A;  1SF8 A;  3Q6M A;  1ZZP A;  2EPL X;  2P7V A;  5D92 A;  3TJ5 A;  2DI3 A;  3ZC4 A;  5L3Q A;  3TD7 A;  4C3B A;  5E3C A;  2H7V C;  2NUT A;  4D4X A;  1TR2 A;  3EH2 A;  3RQF A;  2QY9 A;  4YT8 A;  2A0B A;  4YL3 A;  3K33 A;  3U3B A;  3RH3 A;  5KYY A;  1JPN A;  1VOM A;  3HKK A;  3WAQ A;  3NG1 A;  3U2M A;  1QLE C;  3IEE A;  1D0Z A;  3RFY A;  1NU7 D;  1L3P A;  2EIL C;  2EIN C;  2KQ9 A;  3GM1 A;  3GOD A;  3K6B A;  3L1M A;  3V5X A;  2FGY A;  5L0F A;  1RKE B;  4U5E E;  2L9J A;  3JSE O;  1Y4C A;  2YRF A;  2DB4 A;  1DOV A;  2LFF A;  4HFK B;  3O10 A;  4KNW A;  4JTD B;  3QVZ A;  4CX9 A;  3H65 A;  3JRT A;  1AVO B;  1CGO A;  1OW6 A;  2LFD A;  1RJ9 A;  2CW0 F;  3M79 A;  3PMR A;  2AWY A;  2NUP A;  4MTF A;  4AE4 B;  4PFP A;  5DLJ A;  5L0J A;  3HLZ A;  3PDM P;  1RMV A;  2HUJ A;  2A68 F;  4G78 A;  2YHS A;  5KYW B;  3PHF 2;  1I5N A;  3U5S A;  3ZTZ A;  4N6H A;  1EI7 A;  1ZHW A;  4J7Y A;  3RVY A;  3S9O A;  4AL0 A;  4UDV A;  3ABK C;  2WZL A;  4C3E A;  1Q0F A;  1HMD A;  3OEO A;  2PX3 A;  2WVQ A;  2VCB A;  3AG3 C;  2G3V A;  4Z9H A;  5HSW A;  5L0I A;  2V26 A;  1U89 A;  2NG1 A;  3W8I A;  4CJG A;  1Y6D A;  3K1I A;  2IYL D;  2H7B A;  3B29 A;  1LE4 A;  2XM0 A;  3N24 A;  3ZG1 A;  5EHH A;  2Y3D A;  3CAX A;  3L8I A;  1NLX A;  2UUH A;  3ZQV A;  4JEA A;  5KYN A;  1ZVZ A;  4MVS A;  256B A;  1OCO C;  4JW1 A;  5DS5 A;  4AL1 A;  1YAR O;  1J8M F;  4YL1 A;  1LS1 A;  1HY5 A;  3DM5 A;  3AGT A;  1KU2 A;  1M2O A;  3CZ6 A;  1NFO A;  1VLS A;  3N0T A;  4IAR A;  1U6H A;  3KPH A;  3A9C A;  1JAF A;  2FFH A;  1PCX A;  3LUT B;  3NYL A;  2O9X A;  4XPW A;  3ZVR A;  4DRJ B;  2ICW G;  2NPU A;  2YKZ A;  3SXK A;  1K04 A;  3SXZ A;  4K0D A;  2C03 A;  3FDQ A;  2R7R A;  2TMV P;  4HFF B;  2R7O A;  3M1C B;  2VC9 A;  3ASO C;  4WGZ A;  3KKB A;  3B71 A;  2OQM A;  1H6G A;  3NMJ A;  4O6M A;  2HSB A;  2OJE D;  4I1M A;  4LDK A;  1A41 A;  1RKE A;  2QUP A;  2AU5 A;  3ECS A;  1Z5Z A;  4GYT A;  4HEA J;  3X2Q C;  3QW1 A;  1WWP A;  4CS8 A;  3F46 A;  1WAT A;  1I4Y A;  1O3U A;  3HNK A;  3UNG C;  5F5H A;  2W9Y A;  4FX5 A;  1E84 A;  1LI7 A;  3GM2 A;  3Q7L A;  4XWJ A;  3UMH A;  2J7P A;  1JOG A;  1OQC A;  2C04 A;  3G4X A;  2AP3 A;  2PX0 A;  1LIH A;  3WOD F;  5KYW A;  1Z63 A;  4JCH A;  3V5Z A;  4MVZ A;  5JUA A;  1M2V B;  4MVQ A;  1A7D A;  5TJ5 E;  4I44 A;  1A0B A;  3I4U A;  2LSE A;  3CEX A;  3IQ5 A;  3EGD B;  3KYI A;  3RQE A;  4OIR F;  1BR2 A;  1MMN A;  4U5F E;  2WVN A;  3NMI A;  4BEM J;  4YWQ A;  3K66 A;  4JTC B;  3C7J A;  3IQC A;  2WL8 A;  4XQ1 A;  4QI2 A;  5BQH A;  2ZXW C;  3U3F A;  3UR3 C;  5BQI A;  2MHR A;  2VH3 A;  1YYJ A;  1H9G A;  2NSF A;  2B0J A;  1VK5 A;  3OA1 A;  1Q0D A;  1VB5 A;  2F22 A;  2NUT B;  3H2U A;  2EPN A;  4O6Y A;  2YWA A;  4PJN A;  2FAP B;  4JIO A;  5CI9 A;  1MMG A;  3T6J A;  1ZYR F;  2HZ8 A;  2GFH A;  2R7W A;  3DMD A;  3UGP A;  4E17 A;  4M63 A;  3T6G B;  1LI5 A;  5A6K A;  2R03 A;  1IW7 F;  3GOR A;  3RF3 A;  2W45 A;  1E83 A;  1QPU A;  2ZXR A;  4XLP F;  2OJQ A;  4YT4 A;  3K7D A;  4XPY A;  1DOW A;  2OKU A;  1RXQ A;  3DD7 A;  4Q7C A;  3GWN A;  4EUK B;  1VLT A;  5DS4 A;  2NUP B;  3UMK A;  2CDQ A;  3I5Q A;  3EFO A;  4O7G A;  4ANJ A;  4IWB A;  1Q0K A;  4U5C E;  1OR2 A;  4JZA A;  2YLG A;  2R7Q A;  3NMK A;  4ONS A;  1FR0 A;  2Y69 C;  1C02 A;  5JSL A;  4OD5 A;  1AEP A;  3W2W A;  1A7V A;  1V4A A;  1M2V A;  3VYW A;  3SEO A;  1GQA A;  2Q9B A;  2HSQ A;  2J9B A;  1YA9 A;  1YVI A;  1R5I D;  3PCV A;  2Y39 A;  2Y3H A;  3S29 A;  2Q00 A;  3EGD A;  3JZ0 A;  5L0C A;  4JEB A;  1D1B A;  1FMV A;  3KMI A;  3NYM A;  5CIV A;  2H8A A;  2LD6 A;  3A11 A;  1MNE A;  2R25 A;  2J46 A;  1SR2 A;  1BBH A;  3EH1 A;  5AGF A;  4G7Z F;  4W8P A;  4PJJ A;  4ZLC A;  4MTO A;  2XLM A;  4YT2 A;  1MMD A;  4PR9 A;  4D4N A;  4H54 A;  1BZ4 A;  1VYK A;  2Q9A A;  4E7Z A;  2IOQ A;  2QE9 A;  1JRA A;  3GEI A;  2IXP A;  1ZW2 A;  3QVY A;  3T4R A;  3B0V C;  2ZPA A;  1WOL A;  2OG2 A;  4FES A;  4PFO A;  4MVU A;  2J8W A;  5CI8 A;  4K1O A;  2M64 A;  4C3D A;  5JRA A;  2LP4 A;  2MYS A;  1LPE A;  1TFO B;  1T6U A;  2XXA A;  1G5Z A;  2G3K A;  2LQG A; 
#chains in the Genus database with same CATH homology
 3DE9 A;  3DE8 A;  4IAR A;  2XL6 A;  1JAF A;  4EIY A;  2YKZ A;  4U9E A;  2XLH A;  2XLW A;  5JS5 A;  4WGZ A;  2CCY A;  1CPQ A;  3HNI A;  3NMJ A;  3HNJ A;  3QW1 A;  5JVE A;  1YYX A;  1APC A;  3HNK A;  1E84 A;  1E85 A;  3TOM A;  2XL8 A;  1S05 A;  4ULV A;  4N4W A;  3HNL A;  3ZTM A;  1YZC A;  3ZQY A;  5JUA A;  2YL7 A;  5B3I A;  1RCP A;  3IQ5 A;  3FOO A;  4JKV A;  3FOP A;  2XLO A;  1CPR A;  1MQV A;  1EKY A;  1QQ3 A;  3NMI A;  4CIP A;  4CDY A;  4JE9 A;  1E86 A;  3U8P A;  4CDA A;  2YL1 A;  1YYJ A;  4CDV A;  5JLI A;  1YZA A;  2BC5 A;  3ZWI A;  4CJO A;  2XLD A;  3IQ6 A;  5JT4 A;  1NBB A;  1E83 A;  1QPU A;  2YLI A;  3QW0 A;  2XLE A;  2YL0 A;  3VRC A;  4D4X A;  4WGY A;  3M15 A;  2YLG A;  3NMK A;  5JSL A;  5JP7 A;  4IAQ A;  1A7V A;  3L1M A;  4NC3 A;  1M6T A;  2YL3 A;  1GQA A;  3TOL A;  4CX9 A;  3QVZ A;  2J9B A;  4L6R A;  2XM4 A;  1CGO A;  3M79 A;  4JEB A;  2YLD A;  3ZTZ A;  3C63 A;  1BBH A;  4N6H A;  5AGF A;  3M4C A;  1LM3 B;  2XLM A;  1CGN A;  4D4N A;  3QVY A;  4CJG A;  3C62 A;  2XM0 A;  4ER9 A;  2J8W A;  5JRA A;  3M4B A;  3ZQV A;  4JEA A;  4IB4 A;  256B A;  2XLV A;  2QLA A;  4U9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...