5JRAA

Nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jraA00
2YL0A 1YYJA 1M6TA 5JLIA 4WGZA 3HNLA 2YL7A 5JVEA 2QLAA 3DE9A 4WGYA 1A7VA 1CGOA 1QQ3A 2XLEA 2XLWA 3NMKA 2YL1A 2YL3A 4N6HA 5JT4A 4D4XA 1E84A 4IARA 4CIPA 3ZQVA 3M4CA 3ZTZA 3QW1A 2J8WA 3M79A 3ZTMA 1RCPA 3QVZA 5JSLA 3TOLA 5JUAA 2XM4A 4CDAA 3C63A 5AGFA 3FOOA 5B3IA 1YZAA 3TOMA 3U8PA 1MQVA 3HNJA 1E85A 3C62A 2XM0A 5JS5A 2YLDA 1APCA 3FOPA 4ER9A 2CCYA 2YLIA 3M15A 3NMIA 3ZWIA 3NMJA 3IQ5A 1EKYA 3HNKA 1LM3B 2XL8A 1GQAA 2XLMA 2YLGA 3QW0A 4JKVA 3M4BA 4D4NA 4JEAA 1CPRA 2XLOA 4L6RA 3QVYA 4U9EA 1E83A 1S05A 2BC5A 3L1MA 4U9DA 256BA 5JP7A 3IQ6A 1CGNA 4CDYA 2XLDA 4CDVA 4NC3A 3VRCA 3ZQYA 1NBBA 4IAQA 1YYXA 3DE8A 4IB4A 1QPUA 2XLHA 2XLVA 4JE9A 5JRAA 1E86A 4EIYA 4N4WA 2YKZA 3HNIA 4JEBA 1BBHA 1YZCA 1JAFA 4CX9A 2XL6A 4CJOA 2J9BA 4ULVA 4CJGA 1CPQA
chains in the Genus database with same CATH superfamily
1Y6DA 1YYJA 3H2VA 4NTAA 4Q5SF 3DJUB 4FWVA 1G8XA 5IY5C 3HNLA 2JD3A 2YL7A 4O6YA 2HS5A 2IOQA 4FAPB 2QY9A 5DS5A 4FX5A 2XXAA 1FTSA 2XLWA 1QZXA 2NSGA 4N6CA 5KYUA 4DVZA 4NTBA 4N6HA 4I1OB 5L0CA 3B0VC 3AQCA 2HV6A 1QSPA 1Q0KA 2CDQA 3S27A 5F28E 5CI9A 5DQTA 4WJ0A 1FNTc 1LS4A 3JRTA 2LK4A 3S84A 2F22A 4KNVA 4AL0A 3Q7LA 1MMAA 3QTHA 4HFFB 1TWAA 2R02A 3X2QC 3K1IA 3ZTMA 3IPMO 1HE1A 2LP4A 3N2ZB 4CS8A 1A7EA 3W8HA 4JTDB 2Y3HA 5KYXA 2RSEB 4NTFA 3TOLA 1D1CA 2KSFA 2XM4A 4O79A 2XSEA 5E3AA 4JJGA 3S28A 1Q0DA 4BJTA 1SMYF 1DOWA 2WVNA 1OKKA 2NG1A 5E2QA 3NDBB 1RKEB 4GYTA 3UMHA 5B1BC 2ZD9A 3B29A 3WODF 2NUTB 1VYIA 1F1MA 1XZQA 2NUPA 2Q9CA 1D0XA 3CZ6A 3DXJF 3F46A 4HE8D 3NRHA 4XEVA 3RIPA 3G4ZA 4KI2A 4IGGA 3DD7A 2Y3DA 1YARO 1VB5A 4W8KA 5DQZA 3C8ZA 3HNJA 4CS7A 1VLSA 3GEEA 4MNDA 4N06A 3JSZA 1ST6A 1ZW3A 2JPUA 2XM0A 4CBEA 3F47A 3DKAA 5JS5A 1BDJB 2NPUA 1R4TA 3JCUQ 3DWWA 3EGDB 1TQGA 2PF4E 1M56C 5L0DA 3ZWIA 3L34A 3GWNA 3LEOA 4R32A 1T6QA 1LM3B 4BG0A 2XL8A 4DOZA 5B3SC 2QTVA 1D1BA 1GQAA 1NFNA 2EPLX 5L0IA 3AOUA 3Q6NA 1RKCA 3M4BA 3SXKA 1GS9A 3K1IC 4BEMJ 4CS8C 1YAUO 4JEAA 1CPRA 1WOLA 3H2UA 1HMDA 3PMRA 1TKNA 3NG1A 2BC5A 2L9JA 2QUPA 1T5OA 2J9VA 1RJ9B 1CGME 2VC9A 2OU6A 4QI2A 2FGYA 2XXAB 1BZ4A 1ZW2A 4PJNA 5KYWA 1ZU4A 2OCCC 3HJCA 3O10A 4CSAA 3EJNA 5KYUB 1OW6A 2ZXRA 2LQGA 3GODA 4NCQA 2HMQA 1EQ1A 2FFHA 2ETSA 5KYYB 3PCVA 4KBLA 4MTOA 4OD5A 3U5SA 2R7RA 3GM1A 3ZQYA 4JCHA 4EWCA 4DVYP 1NBBA 1TR2A 1VYKA 2OQMA 3K1HA 2XL4A 4IRUA 4P6IC 3NYJA 1EA8A 4OIQF 4LDQA 5COMA 3OWTA 1QPUA 3WHNA 3RYLA 2OG2A 2XLVA 1RXQA 2IXOA 4EIYA 1TWCA 5DS6A 4MVOA 3HNIA 4JEBA 2HJMA 3AGUA 1M2VA 1BBHA 1IW7F 4Q4ZF 3TD7A 1M57C 3VF0A 4CX9A 4EKWA 2XL6A 2KC3A 3IQCA 4CJOA 4E7ZA 2YVKA 4F4BA 2Q9AA 5FCLA 4ULVA 2AU5A 3Q6MA 3SXZA 3SZRA 4CJGA 2NUPB 1U0BB 1JPJA 5EGYA 3RVYA 1V55C 3MBGA 5JLIA 1RMVA 4I3MA 5HV9A 2W9YA 2Y3GA 2QLAA 5D92A 2PX3A 3DE9A 4C3EA 2B0HA 1T01A 3I5QA 1A7VA 1EI7A 1TWHA 1CGOA 4OINF 1SZIA 2EPOA 3RW0A 1ORSC 4DBRA 2GA0A 2YL1A 2C04A 2YL3A 2MWQA 3JRMO 2WZGA 2DYSC 3KMIA 3LESA 3V7OA 4EBBA 3NYMA 3FVYA 1NFOA 4YN0B 4BEJA 3W2VA 1K04A 2AP3A 1Y4CA 4LDKA 3RF3A 1E84A 1QLEC 3JZ0A 2NSFA 1S7ZA 3AG3C 1M2OA 4YT8A 4I1MA 4CIPA 2R7VA 2C03A 1H9GA 3EPVA 4AE4A 1WTYA 4XLNF 3ZTZA 2LFFA 1K05A 3QW1A 4B6IA 3LJBA 4HEAJ 5A6BA 2TMVP 1MMNA 3M79A 1LE4A 3ZSUA 4CS9C 4ZLCA 2LCHA 3RQGA 5KYNA 1YJGA 3K33A 2ZXOA 4LACB 3QVZA 2IXPA 1WWPA 5JSLA 1LPEA 5AC4A 5L3VA 2L6HA 3MFNA 4BJ1A 4P9TA 1LE2A 3EFOA 3LEVA 2HZ8A 2A0UA 3U0CA 3B0UX 2KW3C 4K0DA 4O7GA 4A2NB 3GM2A 3V5YA 3C63A 3GANA 5AGFA 3FOOA 4MVUA 4NQFA 4X0RA 4W8PA 4J32B 3RQEA 1YLMA 3UMIA 2WL8A 2EILC 1MMGA 3TOMA 5HSWA 1ZHZA 1OKKD 1FMWA 1SYQA 2M4EA 1JMWA 2L81A 4KC9A 4ONSA 5AC5A 2EPNA 2H7BA 4I44A 2ASRA 2ZXPA 4MTGA 1Q0FA 2DB4A 3DI5A 3EGXA 3G50A 3C62A 2V3CC 5FZTA 2YLDA 4A4AA 1SR2A 2JX0A 3ZG1A 2DI3A 2J46A 2PX0A 1PCXA 1W2WA 2HFIA 4PR9A 4XTKA 3US6A 3SXMA 4EHPA 4G78A 5BUOA 3S90A 1VTMP 3EHNA 3K66A 1EKYA 2OOCA 5CI8A 2HKVA 1C03A 1M2VB 3MYIA 3L8JA 2XLMA 1H6GA 1ZZPA 3O6XA 4JJFA 4JKVA 4PJMA 4D4NA 2IM8A 4Z9JA 4AX2A 2OKUA 3B71A 2HV7A 3MX3A 1OCCC 3ZDLA 4C3DA 3FDQA 3HTKC 1I5NA 2J9UA 2LSEA 3N0TA 2J9WA 3QVYA 3R2PA 4RD9A 2MYSA 3VYWA 1H9TA 1LVKA 4XPYA 1HW2A 4DXWA 1WN0A 2P61A 3ZC4A 3UNGC 2EPMX 3O39A 3L1MA 3LUTB 4U9DA 256BA 2YRFA 1NU9C 5JP7A 1V74B 3IQTA 3RVZA 2VB6A 3EZHA 3SYNA 3R7CA 3RFYA 3PHF2 2QE9A 2EIJC 2L7AA 3LLKA 4JZAA 4O6MA 3RKOF 1OW8A 3LAYA 4BPMA 5A6KA 1D1AA 3VAYA 2OEXA 4YL3A 4IJJA 4IAOA 1OR3A 3GWLA 2X0CA 3TQOA 4IAQA 4JRZA 2HUJA 2KJGA 3KL4A 1JPNA 2VCBA 3ABLC 2IXMA 2XRHA 3GEHA 1LI5A 4YWQA 3V5ZA 3ABMC 1ZHXA 2XS1A 3CAXA 3SEOA 1E86A 2KQ9A 4CIHA 2R7TA 4OD4A 4G7ZF 2CW0F 3IHUA 1OQCA 5A6JA 3BRJA 2PBEA 3EFOB 1C02A 3X1OA 3SXYA 4E7SA 3S29A 3T9OA 2IBFA 1A0BA 2D5RB 2J0XA 4G7HF 1U6HA 3E9VA 1D0ZA 3U9JA 2A6EF 2VASA 3ABKC 3EHMA 1BR4A 2J9BA 2WZFA 1NLXA 2LFDA 3AQBA 4UDVA 3BEHA 5BQIA 3PDMP 3NKEA 4RBNA 5EHHA 1B68A 2V26A 3T6JA 2M64A 2Y69C 1XWJA 5JVEA 3NYLA 4G7OF 3DM5A 2VCAA 3T4RA 3H65A 3O55A 2MHRA 2PNOA 3LNRA 3NMKA 4PACA 2O9XA 3S9OA 3LS0A 2G3KA 3LLIA 1V4AA 2A69F 3C8GA 5JT4A 4ULWA 5K0IA 4CS9A 5BQGA 5KYXB 2VCCA 4JCZA 2CYDA 3T6GB 3ASNC 1FAPB 2R25A 2Q7RA 4LDRA 3NKDA 4BJ5A 2GAQA 3M4CA 3T6BA 3EQLF 3DAFA 2R7WA 2W4BA 1ZHTA 1Q0GA 1U89A 2J45A 2J8WA 4MVZA 2WVOA 3SNHA 1KTMA 4MS2A 2A6HF 4YL0A 3FHDA 4U5CE 1RCPA 4EBJA 5F5FA 3W8IA 4MQ9F 4ZLDA 3VM6A 5A6BD 5JUAA 2BL2A 3G4XA 1FFHA 3OEOA 4CDAA 4GEHA 2HMZA 1OCOC 1ORJA 1FMVA 3U3BA 2OJED 2EPKX 3JTLO 3WG7C 1TFKB 3GM3A 1GM5A 3N24A 1Z5ZA 5B3IA 4JTCB 3HLZA 5BQHA 4IWBA 5D91A 3W2WA 3ZVRA 4JW1A 1AEPA 2P6VA 3ITFA 2EINC 4XPXA 1A7DA 4HFKB 5CIVA 2PP4A 2P7VA 3U2MA 4OIRF 1ZVZA 2Y39A 1E85A 2R7UA 3KKBA 4GQHA 4E18A 3S0XA 2UUIA 1RKEA 3KPHA 2GFHA 3ASOC 3UGOA 1APCA 3UGPA 2W45A 2YQYA 2NUTA 1HY5A 2CNWA 1JR8A 1VOMA 1OCRC 2YLIA 4OIPF 2VH3A 3NMIA 3ATPA 3FXHA 3NMJA 1E2XA 1G4WR 2WVQA 3GORA 2H7VC 4BJ5C 2YWAA 1WGWA 4U5GA 4RDAA 4H54A 2P1AA 2KK1A 3L0IA 1WASA 5KYWB 2XLOA 3L8IA 1Q0MA 2OJQA 4L6RA 4DRIB 4U9EA 1E83A 3CQZA 3A11A 1MMDA 4YT2A 2HSBA 2BE5F 1J8YF 2ICWG 2XS8A 4JC7A 4YJWA 2W4MA 4JIOA 4AK9A 5COFA 4LLEA 2QNLA 2ZXWC 3TJ5A 1MNEA 2A0BA 4Z9HA 3CSKA 3IQ6A 1T6IA 1CGNA 1JOGA 3KYJA 1LS1A 4XEFA 2R7OA 4CDYA 1O87A 1D0YA 3C8GB 2Q3TA 3AGTA 4MVQA 3I5PA 1RJ9A 2L6FA 3VRCA 5DLJA 3QZCA 1SF8A 2J7PA 2J0WA 3GEIA 1LIHA 2LIGA 5COGA 2I8BA 1YYXA 5T3TA 1XZPA 2CGEA 3DE8A 4LERA 3U8VA 2G62A 3SP1A 3WAQA 2R7SA 1OR2A 1AVOB 1O5HA 2XLHA 1UFBA 1ZHWA 3B0PA 1YDIA 4JE9A 5KYYA 1CPQA 3RH3A 1C17M 1VLTA 1Z23A 1MNDA 1VMAA 2G3VA 3K6BA 4KNWA 1ZHYA 1J8MF 2KYHA 4BJ6A 3DJNB 2Y3BA 1FFTC 2OEVA 1JAFA 3EH2A 5L0GA 1NSGB 3POVA 4MVRA 4E0IA 4WABA 2IXNA 3AJMA 4AL1A 3EH1A 1OXKA 1LI7A 2Q9BA 2YL0A 1T6UA 1VK5A 1M6TA 1ZYRF 4WGZA 4C3BA 2Z15A 3TJ6A 4YK5A 3W4YA 3EG9A 2I15A 1R5ID 2GDCA 1A41A 4PK4A 4XLPF 3QMKA 4WGYA 4QDLA 4PFOA 4AE4B 1UG7A 2R7QA 1OCZC 3TULA 1K40A 1QQ3A 2XLEA 4E0HA 3EZIA 1FR0A 1YA7O 2YEVA 3U2LA 3V5XA 2H8AA 1PD1A 3DAGA 1O3UA 4YL1A 2DYRC 2L6GA 4XQ1A 4PJLA 4MVMA 4D4XA 4DBQA 5EK0A 4O6NA 1HW1A 3Q7GA 4IARA 4XWJA 3LNMB 5T3WA 4U5DE 3DZAA 2IYLD 3ZIBA 4JTAB 3ZQVA 2HSQA 5A6AA 4J30B 2WB7A 2EIMC 3C8GD 3FMSA 2Q4FA 1NG1A 2HJ3A 2PFDA 1LKXA 1YVIA 4MW8A 5E3CA 4DRHB 5E33A 3JYYA 3E70C 3CEXA 3AG4C 2ZPAA 4BJ6C 1HMOA 5DS4A 1JRAA 1QKRA 1OW7A 3DM9B 4XPWA 1AUEA 3MYFA 4U5EE 5L0FA 1OXBA 3EGXB 4Z9IA 4MTFA 2E87A 4P9FA 4C7OA 5L0JA 4JVSA 1YA9A 3JYHA 1Z6AA 3U3FA 2WZLA 1YZAA 3U8PA 3C18A 3C7JA 1BR1A 4E17A 1MQVA 3FAPB 2R9RB 4DJ9A 3KH2A 4EBKA 2EIKC 4MW3A 3A9CA 2RD9A 1V54C 1NU7D 3FOPA 5F5HA 2CCYA 4ER9A 1BR2A 5L0HA 1TWGA 3M15A 1L3PA 1H7IA 3I4UA 3IQ5A 3JT1A 4K1OA 1G5ZA 5GPGB 1IZMA 3HNKA 3LS1A 4M63A 5A69A 1I4ZA 1QVXA 5DVWA 2CNWD 2R05A 4J7YA 2Q00A 2YLGA 3QW0A 2H7OA 4LLCA 3OA1A 4MVSA 4Q7CA 2D4UA 3ECSA 3U9MA 1GGQA 1HE9A 4QI0A 2YHSA 4J7TA 2KGOA 2DGJA 1S05A 3DMDA 1DOVA 3KYIA 3FAJA 4G0HA 3RQFA 4K7BA 3MLGA 3UMKA 3EG9B 4PFPA 1KNYA 2UUHA 4YT4A 1G4US 3AG2C 3JSEO 4JURI 4U5HA 4H4KC 2KNHA 5B1AC 1L7CA 5L3QA 2XLDA 1T9KA 4YT5A 4CDVA 4NC3A 1ORYA 1N1CA 2YZSA 5TJ5E 3UR3C 2R03A 4ANJA 4CSAC 3B9QA 3IEEA 1ZU5A 3M1CB 1KU2A 4PJJA 4IB4A 3TK0A 4DRJB 4OIOF 1I4YA 2FAPB 2J7PD 2AWYA 3EGDA 3HKKA 2P0NA 4U5FE 3J06A 2GWWA 5JRAA 4EUKB 2AVKA 4N4WA 2YKZA 4FESA 1TFOB 2X51A 2A68F 3AG1C 4NY3A 5T1DB 1PV3A 1Z3IX 4U5BE 1YZCA 1Z7Qc 2R7XA 1PD0A 2B0JA 2AWCA 4C7OB 1Z63A 2A1DD 2LD6A 3K7DA 4XEKA 1WATA 1NZEA
chains in the Genus database with same CATH topology
2YL0A 1YYJA 1M6TA 5JLIA 4WGZA 3HNLA 2YL7A 5JVEA 2QLAA 3DE9A 4WGYA 1A7VA 1CGOA 1QQ3A 2XLEA 2XLWA 3NMKA 2YL1A 2YL3A 4N6HA 5JT4A 4D4XA 1E84A 4IARA 4CIPA 3ZQVA 3M4CA 3ZTZA 3QW1A 2J8WA 3M79A 3ZTMA 1RCPA 3QVZA 5JSLA 3TOLA 5JUAA 2XM4A 4CDAA 3C63A 5AGFA 3FOOA 5B3IA 1YZAA 3TOMA 3U8PA 1MQVA 3HNJA 1E85A 3C62A 2XM0A 5JS5A 2YLDA 1APCA 3FOPA 4ER9A 2CCYA 2YLIA 3M15A 3NMIA 3ZWIA 3NMJA 3IQ5A 1EKYA 3HNKA 1LM3B 2XL8A 1GQAA 2XLMA 2YLGA 3QW0A 4JKVA 3M4BA 4D4NA 4JEAA 1CPRA 2XLOA 4L6RA 3QVYA 4U9EA 1E83A 1S05A 2BC5A 3L1MA 4U9DA 256BA 5JP7A 3IQ6A 1CGNA 4CDYA 2XLDA 4CDVA 4NC3A 3VRCA 3ZQYA 1NBBA 4IAQA 1YYXA 3DE8A 4IB4A 1QPUA 2XLHA 2XLVA 4JE9A 5JRAA 1E86A 4EIYA 4N4WA 2YKZA 3HNIA 4JEBA 1BBHA 1YZCA 1JAFA 4CX9A 2XL6A 4CJOA 2J9BA 4ULVA 4CJGA 1CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL0 A;  1YYJ A;  1M6T A;  5JLI A;  4WGZ A;  3HNL A;  2YL7 A;  5JVE A;  2QLA A;  3DE9 A;  4WGY A;  1A7V A;  1CGO A;  1QQ3 A;  2XLE A;  2XLW A;  3NMK A;  2YL1 A;  2YL3 A;  4N6H A;  5JT4 A;  4D4X A;  1E84 A;  4IAR A;  4CIP A;  3ZQV A;  3M4C A;  3ZTZ A;  3QW1 A;  2J8W A;  3M79 A;  3ZTM A;  1RCP A;  3QVZ A;  5JSL A;  3TOL A;  5JUA A;  2XM4 A;  4CDA A;  3C63 A;  5AGF A;  3FOO A;  5B3I A;  1YZA A;  3TOM A;  3U8P A;  1MQV A;  3HNJ A;  1E85 A;  3C62 A;  2XM0 A;  5JS5 A;  2YLD A;  1APC A;  3FOP A;  4ER9 A;  2CCY A;  2YLI A;  3M15 A;  3NMI A;  3ZWI A;  3NMJ A;  3IQ5 A;  1EKY A;  3HNK A;  1LM3 B;  2XL8 A;  1GQA A;  2XLM A;  2YLG A;  3QW0 A;  4JKV A;  3M4B A;  4D4N A;  4JEA A;  1CPR A;  2XLO A;  4L6R A;  3QVY A;  4U9E A;  1E83 A;  1S05 A;  2BC5 A;  3L1M A;  4U9D A;  256B A;  5JP7 A;  3IQ6 A;  1CGN A;  4CDY A;  2XLD A;  4CDV A;  4NC3 A;  3VRC A;  3ZQY A;  1NBB A;  4IAQ A;  1YYX A;  3DE8 A;  4IB4 A;  1QPU A;  2XLH A;  2XLV A;  4JE9 A;  5JRA A;  1E86 A;  4EIY A;  4N4W A;  2YKZ A;  3HNI A;  4JEB A;  1BBH A;  1YZC A;  1JAF A;  4CX9 A;  2XL6 A;  4CJO A;  2J9B A;  4ULV A;  4CJG A;  1CPQ A; 
#chains in the Genus database with same CATH topology
 1Y6D A;  1YYJ A;  3H2V A;  4NTA A;  4Q5S F;  3DJU B;  4FWV A;  1G8X A;  5IY5 C;  3HNL A;  2JD3 A;  2YL7 A;  4O6Y A;  2HS5 A;  2IOQ A;  4FAP B;  2QY9 A;  5DS5 A;  4FX5 A;  2XXA A;  1FTS A;  2XLW A;  1QZX A;  2NSG A;  4N6C A;  5KYU A;  4DVZ A;  4NTB A;  4N6H A;  4I1O B;  5L0C A;  3B0V C;  3AQC A;  2HV6 A;  1QSP A;  1Q0K A;  2CDQ A;  3S27 A;  5F28 E;  5CI9 A;  5DQT A;  4WJ0 A;  1FNT c;  1LS4 A;  3JRT A;  2LK4 A;  3S84 A;  2F22 A;  4KNV A;  4AL0 A;  3Q7L A;  1MMA A;  3QTH A;  4HFF B;  1TWA A;  2R02 A;  3X2Q C;  3K1I A;  3ZTM A;  3IPM O;  1HE1 A;  2LP4 A;  3N2Z B;  4CS8 A;  1A7E A;  3W8H A;  4JTD B;  2Y3H A;  5KYX A;  2RSE B;  4NTF A;  3TOL A;  1D1C A;  2KSF A;  2XM4 A;  4O79 A;  2XSE A;  5E3A A;  4JJG A;  3S28 A;  1Q0D A;  4BJT A;  1SMY F;  1DOW A;  2WVN A;  1OKK A;  2NG1 A;  5E2Q A;  3NDB B;  1RKE B;  4GYT A;  3UMH A;  5B1B C;  2ZD9 A;  3B29 A;  3WOD F;  2NUT B;  1VYI A;  1F1M A;  1XZQ A;  2NUP A;  2Q9C A;  1D0X A;  3CZ6 A;  3DXJ F;  3F46 A;  4HE8 D;  3NRH A;  4XEV A;  3RIP A;  3G4Z A;  4KI2 A;  4IGG A;  3DD7 A;  2Y3D A;  1YAR O;  1VB5 A;  4W8K A;  5DQZ A;  3C8Z A;  3HNJ A;  4CS7 A;  1VLS A;  3GEE A;  4MND A;  4N06 A;  3JSZ A;  1ST6 A;  1ZW3 A;  2JPU A;  2XM0 A;  4CBE A;  3F47 A;  3DKA A;  5JS5 A;  1BDJ B;  2NPU A;  1R4T A;  3JCU Q;  3DWW A;  3EGD B;  1TQG A;  2PF4 E;  1M56 C;  5L0D A;  3ZWI A;  3L34 A;  3GWN A;  3LEO A;  4R32 A;  1T6Q A;  1LM3 B;  4BG0 A;  2XL8 A;  4DOZ A;  5B3S C;  2QTV A;  1D1B A;  1GQA A;  1NFN A;  2EPL X;  5L0I A;  3AOU A;  3Q6N A;  1RKC A;  3M4B A;  3SXK A;  1GS9 A;  3K1I C;  4BEM J;  4CS8 C;  1YAU O;  4JEA A;  1CPR A;  1WOL A;  3H2U A;  1HMD A;  3PMR A;  1TKN A;  3NG1 A;  2BC5 A;  2L9J A;  2QUP A;  1T5O A;  2J9V A;  1RJ9 B;  1CGM E;  2VC9 A;  2OU6 A;  4QI2 A;  2FGY A;  2XXA B;  1BZ4 A;  1ZW2 A;  4PJN A;  5KYW A;  1ZU4 A;  2OCC C;  3HJC A;  3O10 A;  4CSA A;  3EJN A;  5KYU B;  1OW6 A;  2ZXR A;  2LQG A;  3GOD A;  4NCQ A;  2HMQ A;  1EQ1 A;  2FFH A;  2ETS A;  5KYY B;  3PCV A;  4KBL A;  4MTO A;  4OD5 A;  3U5S A;  2R7R A;  3GM1 A;  3ZQY A;  4JCH A;  4EWC A;  4DVY P;  1NBB A;  1TR2 A;  1VYK A;  2OQM A;  3K1H A;  2XL4 A;  4IRU A;  4P6I C;  3NYJ A;  1EA8 A;  4OIQ F;  4LDQ A;  5COM A;  3OWT A;  1QPU A;  3WHN A;  3RYL A;  2OG2 A;  2XLV A;  1RXQ A;  2IXO A;  4EIY A;  1TWC A;  5DS6 A;  4MVO A;  3HNI A;  4JEB A;  2HJM A;  3AGU A;  1M2V A;  1BBH A;  1IW7 F;  4Q4Z F;  3TD7 A;  1M57 C;  3VF0 A;  4CX9 A;  4EKW A;  2XL6 A;  2KC3 A;  3IQC A;  4CJO A;  4E7Z A;  2YVK A;  4F4B A;  2Q9A A;  5FCL A;  4ULV A;  2AU5 A;  3Q6M A;  3SXZ A;  3SZR A;  4CJG A;  2NUP B;  1U0B B;  1JPJ A;  5EGY A;  3RVY A;  1V55 C;  3MBG A;  5JLI A;  1RMV A;  4I3M A;  5HV9 A;  2W9Y A;  2Y3G A;  2QLA A;  5D92 A;  2PX3 A;  3DE9 A;  4C3E A;  2B0H A;  1T01 A;  3I5Q A;  1A7V A;  1EI7 A;  1TWH A;  1CGO A;  4OIN F;  1SZI A;  2EPO A;  3RW0 A;  1ORS C;  4DBR A;  2GA0 A;  2YL1 A;  2C04 A;  2YL3 A;  2MWQ A;  3JRM O;  2WZG A;  2DYS C;  3KMI A;  3LES A;  3V7O A;  4EBB A;  3NYM A;  3FVY A;  1NFO A;  4YN0 B;  4BEJ A;  3W2V A;  1K04 A;  2AP3 A;  1Y4C A;  4LDK A;  3RF3 A;  1E84 A;  1QLE C;  3JZ0 A;  2NSF A;  1S7Z A;  3AG3 C;  1M2O A;  4YT8 A;  4I1M A;  4CIP A;  2R7V A;  2C03 A;  1H9G A;  3EPV A;  4AE4 A;  1WTY A;  4XLN F;  3ZTZ A;  2LFF A;  1K05 A;  3QW1 A;  4B6I A;  3LJB A;  4HEA J;  5A6B A;  2TMV P;  1MMN A;  3M79 A;  1LE4 A;  3ZSU A;  4CS9 C;  4ZLC A;  2LCH A;  3RQG A;  5KYN A;  1YJG A;  3K33 A;  2ZXO A;  4LAC B;  3QVZ A;  2IXP A;  1WWP A;  5JSL A;  1LPE A;  5AC4 A;  5L3V A;  2L6H A;  3MFN A;  4BJ1 A;  4P9T A;  1LE2 A;  3EFO A;  3LEV A;  2HZ8 A;  2A0U A;  3U0C A;  3B0U X;  2KW3 C;  4K0D A;  4O7G A;  4A2N B;  3GM2 A;  3V5Y A;  3C63 A;  3GAN A;  5AGF A;  3FOO A;  4MVU A;  4NQF A;  4X0R A;  4W8P A;  4J32 B;  3RQE A;  1YLM A;  3UMI A;  2WL8 A;  2EIL C;  1MMG A;  3TOM A;  5HSW A;  1ZHZ A;  1OKK D;  1FMW A;  1SYQ A;  2M4E A;  1JMW A;  2L81 A;  4KC9 A;  4ONS A;  5AC5 A;  2EPN A;  2H7B A;  4I44 A;  2ASR A;  2ZXP A;  4MTG A;  1Q0F A;  2DB4 A;  3DI5 A;  3EGX A;  3G50 A;  3C62 A;  2V3C C;  5FZT A;  2YLD A;  4A4A A;  1SR2 A;  2JX0 A;  3ZG1 A;  2DI3 A;  2J46 A;  2PX0 A;  1PCX A;  1W2W A;  2HFI A;  4PR9 A;  4XTK A;  3US6 A;  3SXM A;  4EHP A;  4G78 A;  5BUO A;  3S90 A;  1VTM P;  3EHN A;  3K66 A;  1EKY A;  2OOC A;  5CI8 A;  2HKV A;  1C03 A;  1M2V B;  3MYI A;  3L8J A;  2XLM A;  1H6G A;  1ZZP A;  3O6X A;  4JJF A;  4JKV A;  4PJM A;  4D4N A;  2IM8 A;  4Z9J A;  4AX2 A;  2OKU A;  3B71 A;  2HV7 A;  3MX3 A;  1OCC C;  3ZDL A;  4C3D A;  3FDQ A;  3HTK C;  1I5N A;  2J9U A;  2LSE A;  3N0T A;  2J9W A;  3QVY A;  3R2P A;  4RD9 A;  2MYS A;  3VYW A;  1H9T A;  1LVK A;  4XPY A;  1HW2 A;  4DXW A;  1WN0 A;  2P61 A;  3ZC4 A;  3UNG C;  2EPM X;  3O39 A;  3L1M A;  3LUT B;  4U9D A;  256B A;  2YRF A;  1NU9 C;  5JP7 A;  1V74 B;  3IQT A;  3RVZ A;  2VB6 A;  3EZH A;  3SYN A;  3R7C A;  3RFY A;  3PHF 2;  2QE9 A;  2EIJ C;  2L7A A;  3LLK A;  4JZA A;  4O6M A;  3RKO F;  1OW8 A;  3LAY A;  4BPM A;  5A6K A;  1D1A A;  3VAY A;  2OEX A;  4YL3 A;  4IJJ A;  4IAO A;  1OR3 A;  3GWL A;  2X0C A;  3TQO A;  4IAQ A;  4JRZ A;  2HUJ A;  2KJG A;  3KL4 A;  1JPN A;  2VCB A;  3ABL C;  2IXM A;  2XRH A;  3GEH A;  1LI5 A;  4YWQ A;  3V5Z A;  3ABM C;  1ZHX A;  2XS1 A;  3CAX A;  3SEO A;  1E86 A;  2KQ9 A;  4CIH A;  2R7T A;  4OD4 A;  4G7Z F;  2CW0 F;  3IHU A;  1OQC A;  5A6J A;  3BRJ A;  2PBE A;  3EFO B;  1C02 A;  3X1O A;  3SXY A;  4E7S A;  3S29 A;  3T9O A;  2IBF A;  1A0B A;  2D5R B;  2J0X A;  4G7H F;  1U6H A;  3E9V A;  1D0Z A;  3U9J A;  2A6E F;  2VAS A;  3ABK C;  3EHM A;  1BR4 A;  2J9B A;  2WZF A;  1NLX A;  2LFD A;  3AQB A;  4UDV A;  3BEH A;  5BQI A;  3PDM P;  3NKE A;  4RBN A;  5EHH A;  1B68 A;  2V26 A;  3T6J A;  2M64 A;  2Y69 C;  1XWJ A;  5JVE A;  3NYL A;  4G7O F;  3DM5 A;  2VCA A;  3T4R A;  3H65 A;  3O55 A;  2MHR A;  2PNO A;  3LNR A;  3NMK A;  4PAC A;  2O9X A;  3S9O A;  3LS0 A;  2G3K A;  3LLI A;  1V4A A;  2A69 F;  3C8G A;  5JT4 A;  4ULW A;  5K0I A;  4CS9 A;  5BQG A;  5KYX B;  2VCC A;  4JCZ A;  2CYD A;  3T6G B;  3ASN C;  1FAP B;  2R25 A;  2Q7R A;  4LDR A;  3NKD A;  4BJ5 A;  2GAQ A;  3M4C A;  3T6B A;  3EQL F;  3DAF A;  2R7W A;  2W4B A;  1ZHT A;  1Q0G A;  1U89 A;  2J45 A;  2J8W A;  4MVZ A;  2WVO A;  3SNH A;  1KTM A;  4MS2 A;  2A6H F;  4YL0 A;  3FHD A;  4U5C E;  1RCP A;  4EBJ A;  5F5F A;  3W8I A;  4MQ9 F;  4ZLD A;  3VM6 A;  5A6B D;  5JUA A;  2BL2 A;  3G4X A;  1FFH A;  3OEO A;  4CDA A;  4GEH A;  2HMZ A;  1OCO C;  1ORJ A;  1FMV A;  3U3B A;  2OJE D;  2EPK X;  3JTL O;  3WG7 C;  1TFK B;  3GM3 A;  1GM5 A;  3N24 A;  1Z5Z A;  5B3I A;  4JTC B;  3HLZ A;  5BQH A;  4IWB A;  5D91 A;  3W2W A;  3ZVR A;  4JW1 A;  1AEP A;  2P6V A;  3ITF A;  2EIN C;  4XPX A;  1A7D A;  4HFK B;  5CIV A;  2PP4 A;  2P7V A;  3U2M A;  4OIR F;  1ZVZ A;  2Y39 A;  1E85 A;  2R7U A;  3KKB A;  4GQH A;  4E18 A;  3S0X A;  2UUI A;  1RKE A;  3KPH A;  2GFH A;  3ASO C;  3UGO A;  1APC A;  3UGP A;  2W45 A;  2YQY A;  2NUT A;  1HY5 A;  2CNW A;  1JR8 A;  1VOM A;  1OCR C;  2YLI A;  4OIP F;  2VH3 A;  3NMI A;  3ATP A;  3FXH A;  3NMJ A;  1E2X A;  1G4W R;  2WVQ A;  3GOR A;  2H7V C;  4BJ5 C;  2YWA A;  1WGW A;  4U5G A;  4RDA A;  4H54 A;  2P1A A;  2KK1 A;  3L0I A;  1WAS A;  5KYW B;  2XLO A;  3L8I A;  1Q0M A;  2OJQ A;  4L6R A;  4DRI B;  4U9E A;  1E83 A;  3CQZ A;  3A11 A;  1MMD A;  4YT2 A;  2HSB A;  2BE5 F;  1J8Y F;  2ICW G;  2XS8 A;  4JC7 A;  4YJW A;  2W4M A;  4JIO A;  4AK9 A;  5COF A;  4LLE A;  2QNL A;  2ZXW C;  3TJ5 A;  1MNE A;  2A0B A;  4Z9H A;  3CSK A;  3IQ6 A;  1T6I A;  1CGN A;  1JOG A;  3KYJ A;  1LS1 A;  4XEF A;  2R7O A;  4CDY A;  1O87 A;  1D0Y A;  3C8G B;  2Q3T A;  3AGT A;  4MVQ A;  3I5P A;  1RJ9 A;  2L6F A;  3VRC A;  5DLJ A;  3QZC A;  1SF8 A;  2J7P A;  2J0W A;  3GEI A;  1LIH A;  2LIG A;  5COG A;  2I8B A;  1YYX A;  5T3T A;  1XZP A;  2CGE A;  3DE8 A;  4LER A;  3U8V A;  2G62 A;  3SP1 A;  3WAQ A;  2R7S A;  1OR2 A;  1AVO B;  1O5H A;  2XLH A;  1UFB A;  1ZHW A;  3B0P A;  1YDI A;  4JE9 A;  5KYY A;  1CPQ A;  3RH3 A;  1C17 M;  1VLT A;  1Z23 A;  1MND A;  1VMA A;  2G3V A;  3K6B A;  4KNW A;  1ZHY A;  1J8M F;  2KYH A;  4BJ6 A;  3DJN B;  2Y3B A;  1FFT C;  2OEV A;  1JAF A;  3EH2 A;  5L0G A;  1NSG B;  3POV A;  4MVR A;  4E0I A;  4WAB A;  2IXN A;  3AJM A;  4AL1 A;  3EH1 A;  1OXK A;  1LI7 A;  2Q9B A;  2YL0 A;  1T6U A;  1VK5 A;  1M6T A;  1ZYR F;  4WGZ A;  4C3B A;  2Z15 A;  3TJ6 A;  4YK5 A;  3W4Y A;  3EG9 A;  2I15 A;  1R5I D;  2GDC A;  1A41 A;  4PK4 A;  4XLP F;  3QMK A;  4WGY A;  4QDL A;  4PFO A;  4AE4 B;  1UG7 A;  2R7Q A;  1OCZ C;  3TUL A;  1K40 A;  1QQ3 A;  2XLE A;  4E0H A;  3EZI A;  1FR0 A;  1YA7 O;  2YEV A;  3U2L A;  3V5X A;  2H8A A;  1PD1 A;  3DAG A;  1O3U A;  4YL1 A;  2DYR C;  2L6G A;  4XQ1 A;  4PJL A;  4MVM A;  4D4X A;  4DBQ A;  5EK0 A;  4O6N A;  1HW1 A;  3Q7G A;  4IAR A;  4XWJ A;  3LNM B;  5T3W A;  4U5D E;  3DZA A;  2IYL D;  3ZIB A;  4JTA B;  3ZQV A;  2HSQ A;  5A6A A;  4J30 B;  2WB7 A;  2EIM C;  3C8G D;  3FMS A;  2Q4F A;  1NG1 A;  2HJ3 A;  2PFD A;  1LKX A;  1YVI A;  4MW8 A;  5E3C A;  4DRH B;  5E33 A;  3JYY A;  3E70 C;  3CEX A;  3AG4 C;  2ZPA A;  4BJ6 C;  1HMO A;  5DS4 A;  1JRA A;  1QKR A;  1OW7 A;  3DM9 B;  4XPW A;  1AUE A;  3MYF A;  4U5E E;  5L0F A;  1OXB A;  3EGX B;  4Z9I A;  4MTF A;  2E87 A;  4P9F A;  4C7O A;  5L0J A;  4JVS A;  1YA9 A;  3JYH A;  1Z6A A;  3U3F A;  2WZL A;  1YZA A;  3U8P A;  3C18 A;  3C7J A;  1BR1 A;  4E17 A;  1MQV A;  3FAP B;  2R9R B;  4DJ9 A;  3KH2 A;  4EBK A;  2EIK C;  4MW3 A;  3A9C A;  2RD9 A;  1V54 C;  1NU7 D;  3FOP A;  5F5H A;  2CCY A;  4ER9 A;  1BR2 A;  5L0H A;  1TWG A;  3M15 A;  1L3P A;  1H7I A;  3I4U A;  3IQ5 A;  3JT1 A;  4K1O A;  1G5Z A;  5GPG B;  1IZM A;  3HNK A;  3LS1 A;  4M63 A;  5A69 A;  1I4Z A;  1QVX A;  5DVW A;  2CNW D;  2R05 A;  4J7Y A;  2Q00 A;  2YLG A;  3QW0 A;  2H7O A;  4LLC A;  3OA1 A;  4MVS A;  4Q7C A;  2D4U A;  3ECS A;  3U9M A;  1GGQ A;  1HE9 A;  4QI0 A;  2YHS A;  4J7T A;  2KGO A;  2DGJ A;  1S05 A;  3DMD A;  1DOV A;  3KYI A;  3FAJ A;  4G0H A;  3RQF A;  4K7B A;  3MLG A;  3UMK A;  3EG9 B;  4PFP A;  1KNY A;  2UUH A;  4YT4 A;  1G4U S;  3AG2 C;  3JSE O;  4JUR I;  4U5H A;  4H4K C;  2KNH A;  5B1A C;  1L7C A;  5L3Q A;  2XLD A;  1T9K A;  4YT5 A;  4CDV A;  4NC3 A;  1ORY A;  1N1C A;  2YZS A;  5TJ5 E;  3UR3 C;  2R03 A;  4ANJ A;  4CSA C;  3B9Q A;  3IEE A;  1ZU5 A;  3M1C B;  1KU2 A;  4PJJ A;  4IB4 A;  3TK0 A;  4DRJ B;  4OIO F;  1I4Y A;  2FAP B;  2J7P D;  2AWY A;  3EGD A;  3HKK A;  2P0N A;  4U5F E;  3J06 A;  2GWW A;  5JRA A;  4EUK B;  2AVK A;  4N4W A;  2YKZ A;  4FES A;  1TFO B;  2X51 A;  2A68 F;  3AG1 C;  4NY3 A;  5T1D B;  1PV3 A;  1Z3I X;  4U5B E;  1YZC A;  1Z7Q c;  2R7X A;  1PD0 A;  2B0J A;  2AWC A;  4C7O B;  1Z63 A;  2A1D D;  2LD6 A;  3K7D A;  4XEK A;  1WAT A;  1NZE A; 
#chains in the Genus database with same CATH homology
 2YL0 A;  1YYJ A;  1M6T A;  5JLI A;  4WGZ A;  3HNL A;  2YL7 A;  5JVE A;  2QLA A;  3DE9 A;  4WGY A;  1A7V A;  1CGO A;  1QQ3 A;  2XLE A;  2XLW A;  3NMK A;  2YL1 A;  2YL3 A;  4N6H A;  5JT4 A;  4D4X A;  1E84 A;  4IAR A;  4CIP A;  3ZQV A;  3M4C A;  3ZTZ A;  3QW1 A;  2J8W A;  3M79 A;  3ZTM A;  1RCP A;  3QVZ A;  5JSL A;  3TOL A;  5JUA A;  2XM4 A;  4CDA A;  3C63 A;  5AGF A;  3FOO A;  5B3I A;  1YZA A;  3TOM A;  3U8P A;  1MQV A;  3HNJ A;  1E85 A;  3C62 A;  2XM0 A;  5JS5 A;  2YLD A;  1APC A;  3FOP A;  4ER9 A;  2CCY A;  2YLI A;  3M15 A;  3NMI A;  3ZWI A;  3NMJ A;  3IQ5 A;  1EKY A;  3HNK A;  1LM3 B;  2XL8 A;  1GQA A;  2XLM A;  2YLG A;  3QW0 A;  4JKV A;  3M4B A;  4D4N A;  4JEA A;  1CPR A;  2XLO A;  4L6R A;  3QVY A;  4U9E A;  1E83 A;  1S05 A;  2BC5 A;  3L1M A;  4U9D A;  256B A;  5JP7 A;  3IQ6 A;  1CGN A;  4CDY A;  2XLD A;  4CDV A;  4NC3 A;  3VRC A;  3ZQY A;  1NBB A;  4IAQ A;  1YYX A;  3DE8 A;  4IB4 A;  1QPU A;  2XLH A;  2XLV A;  4JE9 A;  5JRA A;  1E86 A;  4EIY A;  4N4W A;  2YKZ A;  3HNI A;  4JEB A;  1BBH A;  1YZC A;  1JAF A;  4CX9 A;  2XL6 A;  4CJO A;  2J9B A;  4ULV A;  4CJG A;  1CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...