5JRAA

Nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jraA00
256BA 3IQ5A 2XM4A 4N6HA 1JAFA 2YL7A 1A7VA 3QW0A 2XLMA 4EIYA 4D4XA 1E84A 4L6RA 2XLEA 3HNKA 4JKVA 4U9DA 1QPUA 3ZQVA 4ULVA 1E83A 3NMIA 2YL3A 3QVYA 3QVZA 4CJGA 1QQ3A 3U8PA 1YYJA 4JEAA 2J9BA 2QLAA 4CJOA 3DE9A 4JE9A 5B3IA 3DE8A 1NBBA 2XM0A 4WGYA 2J8WA 2XLDA 1LM3B 5JVEA 1RCPA 5JUAA 3ZQYA 3FOOA 5AGFA 3NMJA 3FOPA 1CPRA 3C63A 5JS5A 4IAQA 1S05A 3M4CA 3ZTZA 1YZCA 1BBHA 1CGNA 3QW1A 2CCYA 1APCA 3M79A 2XL8A 3TOLA 4CDAA 3HNIA 4CX9A 1EKYA 2YL0A 1MQVA 3TOMA 5JSLA 4ER9A 4CDVA 5JP7A 1E86A 1CGOA 1CPQA 2XLVA 3M4BA 3VRCA 3M15A 2YLIA 3HNLA 1YYXA 2XLHA 3L1MA 3HNJA 1YZAA 2XLOA 4IB4A 4CDYA 2YLDA 4U9EA 3ZTMA 5JT4A 4NC3A 4D4NA 2YL1A 5JRAA 2XL6A 4JEBA 2YLGA 3IQ6A 1M6TA 2XLWA 4N4WA 4IARA 3C62A 5JLIA 3ZWIA 4WGZA 1GQAA 2BC5A 1E85A 3NMKA 4CIPA 2YKZA
chains in the Genus database with same CATH superfamily
256BA 3W8IA 2XM4A 1M2VA 1Z5ZA 4LACB 4MVRA 4G0HA 1C03A 2WB7A 4OIQF 3S27A 2KC3A 2QTVA 1TKNA 3GM2A 3OA1A 2BE5F 4RD9A 5EGYA 3SNHA 4D4XA 4G7HF 4I1MA 3ASOC 3E9VA 4K1OA 2P6VA 4LLCA 3ZSUA 4L6RA 3OWTA 1VLSA 3AQBA 2DGJA 2W9YA 4WABA 3T6JA 3GEEA 3LS1A 5L0DA 1QQ3A 2KJGA 2R7QA 5K0IA 5KYUB 4XPXA 4EKWA 4O7GA 2J9WA 2Q00A 2VCAA 1YYJA 2XSEA 4EWCA 3TJ5A 2RD9A 2EPLX 2EIJC 3K33A 4ANJA 2EILC 4CJOA 1HE9A 4GEHA 3LJBA 3UR3C 2LP4A 4IJJA 4J30B 2KSFA 2CGEA 2J8WA 3I4UA 1KU2A 3KKBA 4XLNF 5AC4A 1GM5A 2GAQA 5DQTA 3LEOA 3B0VC 3ABLC 3LUTB 5JUAA 1HE1A 3RVYA 4BPMA 3CAXA 1XWJA 3V5YA 5B1AC 1Q0GA 3AOUA 3Q6MA 1NU9C 2LIGA 2DYRC 3EGDB 4KI2A 3ZTZA 1S05A 1MNDA 1LS1A 1K40A 4JZAA 1Z3IX 2Q4FA 3UGOA 4CS9C 2R03A 1FTSA 1ZHWA 3POVA 3Q6NA 3QW1A 3U8VA 1I5NA 4A4AA 4H54A 2VB6A 3M79A 1M56C 2MYSA 4LDKA 1LIHA 3Q7LA 1VMAA 3B0PA 1YJGA 4N06A 2W4MA 3S29A 4E17A 4GYTA 4I1OB 3EG9B 5F5FA 3JZ0A 4G78A 1EKYA 4OD5A 1A0BA 3TOMA 2R02A 4O6YA 3EQLF 2OQMA 2QE9A 3GEHA 4ER9A 4W8PA 3ZG1A 4I44A 3EH1A 1K04A 4J7YA 1ZHXA 4FESA 3RF3A 2VCCA 1CGOA 1CPQA 4KNVA 3M4BA 4YT8A 3V5ZA 1ZU4A 3M15A 2YLIA 1BR4A 3C8GD 1H9GA 3HNLA 3PDMP 2EPKX 2H7OA 4CSAA 1PD0A 3DWWA 2Q9BA 2WZGA 4O79A 1ZU5A 2LCHA 2NUTB 2HZ8A 1YZAA 2C04A 2KQ9A 3O55A 3PCVA 1W2WA 1FMWA 4EHPA 4E7ZA 4NTFA 4J32B 2UUIA 4U5BE 4U9EA 3KPHA 3SEOA 4MS2A 2ZXWC 4CBEA 3A11A 2YEVA 3DAGA 1TFOB 1Z6AA 1C02A 3L0IA 4D4NA 2YL1A 4YT4A 5L3VA 3B0UX 2VC9A 1O3UA 4IWBA 3US6A 4JC7A 5T3WA 4C3BA 4N4WA 2D4UA 2IOQA 3TQOA 3W4YA 3O39A 5JLIA 4DOZA 1YARO 2A6EF 2I8BA 1GQAA 1H7IA 3RYLA 1OR3A 4DJ9A 2IXMA 4YT5A 2YVKA 2YKZA 4QI0A 2G62A 3UMKA 1ORSC 2V26A 3EZHA 2MHRA 4W8KA 4A2NB 2NUPB 2AU5A 2A0BA 3I5PA 1D1CA 4N6HA 5COFA 4AL0A 3U3BA 2HSBA 4CIHA 2XLMA 2DYSC 4C3EA 3NRHA 4YT2A 3EG9A 4HEAJ 3AQCA 4XEKA 4BEJA 2ETSA 3DD7A 4XTKA 2J0WA 4Q4ZF 5GPGB 1JRAA 5T1DB 2Y69C 4ULWA 4U9DA 1QPUA 1TFKB 1A7EA 1RJ9A 3RQEA 2KGOA 3U2LA 3NMIA 4NCQA 2YL3A 5KYWA 3L34A 2XL4A 4M63A 4XWJA 3G4ZA 4MQ9F 4CJGA 5BQHA 5CI8A 3MBGA 2L7AA 3CEXA 3HJCA 1NU7D 3KYIA 3U8PA 3DXJF 1ZYRF 5BQIA 1MMNA 4DRJB 1ORJA 5TJ5E 1B68A 2HJ3A 5L0HA 1OXKA 3IHUA 3VF0A 4U5HA 2J0XA 3JSEO 3LLIA 4MNDA 4RDAA 3S84A 1GGQA 2XM0A 1WASA 2NSGA 2GDCA 3QZCA 5COMA 2GA0A 4X0RA 3S0XA 1JPNA 2YRFA 1D0ZA 1K05A 1Q0KA 4HFKB 2XLDA 2JX0A 4F4BA 2Y3GA 1RCPA 3NKEA 4LLEA 5KYNA 3W8HA 1HW2A 3ITFA 4WJ0A 3WODF 1L3PA 2HKVA 3L8IA 3ZQYA 2YHSA 3EGDA 1QKRA 3DMDA 3NMJA 5AGFA 2X0CA 1J8MF 1CPRA 3C63A 5IY5C 3SP1A 1WATA 2GFHA 2J46A 1YZCA 1JR8A 1G8XA 2JD3A 3ABMC 3L8JA 1CGNA 1MMDA 3ZIBA 2XS1A 3R7CA 1O87A 4JCHA 3IQTA 4CSAC 2CCYA 5F5HA 1SYQA 1APCA 2LD6A 1OR2A 4U5CE 3UNGC 1Z63A 2HFIA 3B71A 1H6GA 3BEHA 1UFBA 2WVQA 3UGPA 3O6XA 2KK1A 3FVYA 4YL0A 3SYNA 4JJGA 4QDLA 1ZVZA 1YA7O 4E0IA 3HKKA 4NTAA 5E33A 2PX0A 3B29A 3JTLO 3K66A 2OJQA 3AG2C 1Y4CA 1V4AA 1WGWA 5JP7A 5L0FA 1EQ1A 4IRUA 1FR0A 4DVZA 2OKUA 2G3VA 2OU6A 2XLVA 1OW8A 3K1HA 3RKOF 3VRCA 4Q7CA 2Q9AA 2LFFA 1RKCA 2F22A 2QNLA 2XLHA 1LPEA 5KYYB 2Q7RA 1LI7A 1V54C 5CIVA 4AE4A 3W2VA 2XLOA 3KH2A 1RJ9B 3A9CA 5KYYA 2AP3A 4IB4A 4CDYA 2Y3HA 2O9XA 1LI5A 3U9JA 4NC3A 4YK5A 3HTKC 3MX3A 2HV7A 5BUOA 5JT4A 3K7DA 1XZQA 1C17M 1D1AA 1I4ZA 2A69F 3IQCA 4GQHA 1F1MA 5A6AA 3DI5A 2P0NA 5JRAA 3PMRA 4MTGA 3NYMA 1T6IA 2PP4A 2XL6A 3IQ6A 2BL2A 3FXHA 4NTBA 4ZLCA 1TWAA 1M2OA 3RW0A 1A41A 3C62A 4U5EE 3WHNA 3ZWIA 4WGZA 3ABKC 4OD4A 1OCZC 2LK4A 5DS4A 2D5RB 2E87A 1E85A 4AX2A 1MMGA 2HUJA 1AVOB 3EHNA 1YLMA 3K1IC 4BJTA 5FCLA 1JOGA 1VOMA 4MVUA 3GEIA 4K7BA 4XPYA 3JT1A 3NYLA 3IQ5A 2R7TA 3F47A 2AVKA 4RBNA 2XRHA 4ZLDA 3QW0A 1Z23A 3EZIA 1NZEA 4Z9HA 1J8YF 1MNEA 1ZZPA 3CQZA 1HW1A 1PCXA 4BJ6C 4PJLA 1T6QA 2M64A 4FX5A 2XLEA 1YAUO 3NDBB 3C7JA 1IW7F 3FHDA 5CI9A 5DVWA 4DVYP 5L0GA 1BZ4A 3GWLA 3T4RA 3ZQVA 4ULVA 5HSWA 1ZHZA 4OIOF 3V7OA 3U2MA 2XS8A 2PFDA 2PNOA 2EINC 3N24A 3TULA 2EIMC 4YN0B 2Q9CA 4JEAA 3RQFA 4CS9A 1FAPB 3FAJA 1LE4A 2IXOA 2QLAA 1Z7Qc 5KYXA 3DE9A 2OEVA 4MVQA 4HE8D 2ICWG 2J7PA 5B3IA 4CS8C 1EA8A 3R2PA 1NBBA 4MTOA 4MVZA 3K1IA 2R05A 1RKEB 2HS5A 1S7ZA 3AG4C 3QTHA 4WGYA 4C7OA 5KYXB 3DZAA 1YVIA 2Y3DA 3FAPB 1T9KA 2G3KA 2WVNA 4B6IA 4G7ZF 1RMVA 3LESA 1LM3B 3NG1A 3T9OA 4XPWA 5JVEA 2DB4A 2NSFA 2QY9A 1ST6A 1H9TA 4LDQA 3FOOA 3E70C 4JTCB 4C7OB 2J7PD 1NFOA 1NSGB 3F46A 4PR9A 1VYKA 5JS5A 2WZFA 3EGXA 5AC5A 4KBLA 3I5QA 2A0UA 2L6GA 2FFHA 5D92A 2R7UA 2ZD9A 1FNTc 3LNRA 3N0TA 4FWVA 1L7CA 1ZHYA 3MYFA 1OCCC 1RXQA 1VK5A 1G5ZA 3TOLA 3LLKA 1M2VB 1IZMA 5L0JA 4JTDB 3ZVRA 1LVKA 2TMVP 4JRZA 3VAYA 2UUHA 5KYUA 3KMIA 2GWWA 4DBRA 3DAFA 1SMYF 2C03A 1AUEA 1T5OA 2YL0A 3C8GB 1MQVA 1RKEA 3U9MA 5JSLA 1LE2A 3AG1C 3VYWA 2OEXA 4AL1A 2ASRA 1E86A 1VYIA 3MFNA 3WG7C 1U89A 3EFOB 3MLGA 3S9OA 4EBBA 3GORA 3AJMA 4PFPA 4P9FA 4Q5SF 2Y3BA 5D91A 4KNWA 3SXYA 1M57C 3UMHA 3L1MA 5L0CA 1QZXA 4FAPB 3MYIA 3U3FA 3LEVA 4E7SA 3HNJA 2R7RA 1ZW2A 2OOCA 1T01A 1PV3A 2KNHA 3M1CB 1O5HA 2VCBA 3GWNA 2IBFA 1VB5A 1WWPA 2AWYA 2NUPA 4OIRF 2ZPAA 3RQGA 4BJ1A 1SF8A 1TR2A 2J9VA 3T6BA 2FGYA 3GM3A 2ZXOA 2HMZA 3DJUB 4BJ5C 1GS9A 4DBQA 2ZXPA 1HMDA 3PHF2 3C8ZA 5DLJA 4DXWA 1OW7A 1AEPA 2YLGA 4KC9A 4YJWA 5B1BC 4MW8A 2EIKC 4Z9JA 1LKXA 3ZDLA 2XXAB 1M6TA 3C8GA 4OIPF 2KW3C 3AG3C 4I3MA 4PK4A 3CSKA 2P1AA 1V55C 2CW0F 4YL3A 4MVOA 5B3SC 4YL1A 1V74B 2PF4E 3NYJA 1U0BB 1D1BA 1JPJA 1G4US 1Q0DA 2CDQA 2BC5A 2P7VA 3S28A 3WAQA 4BG0A 3Q7GA 4DRHB 2XXAA 2KYHA 5DS6A 2YZSA 4ONSA 4AE4B 4CIPA 2Y39A 4E18A 1R5ID 1MMAA 1WTYA 3FMSA 3H2VA 3T6GB 5F28E 4EUKB 1YDIA 1BR1A 2JPUA 3J06A 4MVSA 2CNWD 3KL4A 3EGXB 3AGUA 1VTMP 3JRMO 3RVZA 1QSPA 2L9JA 3SZRA 2EPNA 2QUPA 2IXPA 4NY3A 1JAFA 2YL7A 1A7VA 2R7WA 4YWQA 4U5DE 5L3QA 3HLZA 2YWAA 3JSZA 4XEFA 4MTFA 4EIYA 3C18A 3N2ZB 2R7SA 4HFFB 4XQ1A 2NG1A 1E84A 3EH2A 2CYDA 3ECSA 5DQZA 3HNKA 4JKVA 4JVSA 2A6HF 1NFNA 4PJNA 3RH3A 5FZTA 1TWCA 1E83A 2R7XA 3EFOA 3QVYA 3QVZA 4J7TA 3NKDA 4JCZA 3TK0A 2HMQA 3ZTMA 5COGA 3AGTA 4IGGA 2P61A 1SR2A 1U6HA 1PD1A 3EPVA 1T6UA 1Y6DA 2J9BA 5A6BD 1D0XA 1R4TA 2X51A 4O6MA 1YA9A 1FFTC 2MWQA 3QMKA 2NUTA 3ZC4A 4JE9A 1OKKD 1TWHA 2OJED 2PBEA 3DE8A 3DKAA 3JYHA 5EK0A 4LDRA 1D0YA 3K6BA 2HV6A 2H7BA 1HMOA 2VASA 4JTAB 2R9RB 5E2QA 4P9TA 3RIPA 4E0HA 4XLPF 4O6NA 4R32A 2Z15A 1JMWA 1OW6A 2L6FA 1OKKA 2A1DD 1VLTA 3FOPA 4PJMA 1DOWA 1QLEC 2EPMX 3TD7A 2B0JA 1N1CA 2LFDA 3JRTA 4BEMJ 4IAQA 3M4CA 4Z9IA 3H65A 5A6BA 1BBHA 3G4XA 2WZLA 3RFYA 4UDVA 3LAYA 1OCRC 4OINF 1OCOC 3DJNB 3G50A 2XL8A 3EJNA 1FFHA 2AWCA 3SXKA 4CS8A 1KTMA 1OQCA 2A68F 2ZXRA 1LS4A 4CDAA 1BDJB 4H4KC 2L6HA 3B9QA 4PFOA 5KYWB 3JCUQ 3HNIA 1G4WR 4EBJA 1UG7A 2FAPB 2WVOA 3DM9B 3KYJA 4CX9A 1KNYA 4NQFA 4BJ5A 5L0IA 5T3TA 1DOVA 2B0HA 2Q3TA 3IPMO 3S90A 3O10A 3OEOA 4K0DA 5DS5A 4P6IC 3IEEA 4CDVA 5A6JA 2J9UA 4JW1A 4N6CA 3X1OA 4PJJA 2VH3A 3GM1A 2CNWA 3JYYA 4AK9A 2R25A 2V3CC 1OXBA 2PX3A 2H7VC 2RSEB 2R7VA 2R7OA 4BJ6A 2IYLD 2J45A 2W45A 1HY5A 1QVXA 1YYXA 3ATPA 3EHMA 2M4EA 4PACA 2DI3A 1ZW3A 4G7OF 2NPUA 1WN0A 1TQGA 3W2WA 3VM6A 4DRIB 2OG2A 3LNMB 1EI7A 2LSEA 3U5SA 2YLDA 1A7DA 1TWGA 3GODA 1NLXA 5E3CA 2LQGA 1SZIA 3FDQA 4XEVA 4JJFA 2IM8A 3BRJA 3H2UA 3UMIA 3V5XA 1BR2A 5EHHA 2HSQA 4MVMA 2I15A 4JEBA 4MW3A 5A69A 1CGME 1ORYA 3LS0A 1NG1A 4JIOA 4JURI 2XLWA 1WOLA 2IXNA 3SXMA 2EPOA 4C3DA 4CS7A 4IARA 4U5FE 5A6KA 3X2QC 2W4BA 4LERA 4IAOA 3CZ6A 4EBKA 2WL8A 3ASNC 3GANA 5BQGA 1ZHTA 2OCCC 2YQYA 5HV9A 1I4YA 2L81A 5E3AA 2HJMA 3NMKA 4U5GA 1FMVA 3TJ6A 2H8AA 3U0CA 3DM5A 3SXZA 1XZPA 1E2XA 1Q0MA 4QI2A 1Q0FA
chains in the Genus database with same CATH topology
256BA 3IQ5A 2XM4A 4N6HA 1JAFA 2YL7A 1A7VA 3QW0A 2XLMA 4EIYA 4D4XA 1E84A 4L6RA 2XLEA 3HNKA 4JKVA 4U9DA 1QPUA 3ZQVA 4ULVA 1E83A 3NMIA 2YL3A 3QVYA 3QVZA 4CJGA 1QQ3A 3U8PA 1YYJA 4JEAA 2J9BA 2QLAA 4CJOA 3DE9A 4JE9A 5B3IA 3DE8A 1NBBA 2XM0A 4WGYA 2J8WA 2XLDA 1LM3B 5JVEA 1RCPA 5JUAA 3ZQYA 3FOOA 5AGFA 3NMJA 3FOPA 1CPRA 3C63A 5JS5A 4IAQA 1S05A 3M4CA 3ZTZA 1YZCA 1BBHA 1CGNA 3QW1A 2CCYA 1APCA 3M79A 2XL8A 3TOLA 4CDAA 3HNIA 4CX9A 1EKYA 2YL0A 1MQVA 3TOMA 5JSLA 4ER9A 4CDVA 5JP7A 1E86A 1CGOA 1CPQA 2XLVA 3M4BA 3VRCA 3M15A 2YLIA 3HNLA 1YYXA 2XLHA 3L1MA 3HNJA 1YZAA 2XLOA 4IB4A 4CDYA 2YLDA 4U9EA 3ZTMA 5JT4A 4NC3A 4D4NA 2YL1A 5JRAA 2XL6A 4JEBA 2YLGA 3IQ6A 1M6TA 2XLWA 4N4WA 4IARA 3C62A 5JLIA 3ZWIA 4WGZA 1GQAA 2BC5A 1E85A 3NMKA 4CIPA 2YKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 256B A;  3IQ5 A;  2XM4 A;  4N6H A;  1JAF A;  2YL7 A;  1A7V A;  3QW0 A;  2XLM A;  4EIY A;  4D4X A;  1E84 A;  4L6R A;  2XLE A;  3HNK A;  4JKV A;  4U9D A;  1QPU A;  3ZQV A;  4ULV A;  1E83 A;  3NMI A;  2YL3 A;  3QVY A;  3QVZ A;  4CJG A;  1QQ3 A;  3U8P A;  1YYJ A;  4JEA A;  2J9B A;  2QLA A;  4CJO A;  3DE9 A;  4JE9 A;  5B3I A;  3DE8 A;  1NBB A;  2XM0 A;  4WGY A;  2J8W A;  2XLD A;  1LM3 B;  5JVE A;  1RCP A;  5JUA A;  3ZQY A;  3FOO A;  5AGF A;  3NMJ A;  3FOP A;  1CPR A;  3C63 A;  5JS5 A;  4IAQ A;  1S05 A;  3M4C A;  3ZTZ A;  1YZC A;  1BBH A;  1CGN A;  3QW1 A;  2CCY A;  1APC A;  3M79 A;  2XL8 A;  3TOL A;  4CDA A;  3HNI A;  4CX9 A;  1EKY A;  2YL0 A;  1MQV A;  3TOM A;  5JSL A;  4ER9 A;  4CDV A;  5JP7 A;  1E86 A;  1CGO A;  1CPQ A;  2XLV A;  3M4B A;  3VRC A;  3M15 A;  2YLI A;  3HNL A;  1YYX A;  2XLH A;  3L1M A;  3HNJ A;  1YZA A;  2XLO A;  4IB4 A;  4CDY A;  2YLD A;  4U9E A;  3ZTM A;  5JT4 A;  4NC3 A;  4D4N A;  2YL1 A;  5JRA A;  2XL6 A;  4JEB A;  2YLG A;  3IQ6 A;  1M6T A;  2XLW A;  4N4W A;  4IAR A;  3C62 A;  5JLI A;  3ZWI A;  4WGZ A;  1GQA A;  2BC5 A;  1E85 A;  3NMK A;  4CIP A;  2YKZ A; 
#chains in the Genus database with same CATH topology
 256B A;  3W8I A;  2XM4 A;  1M2V A;  1Z5Z A;  4LAC B;  4MVR A;  4G0H A;  1C03 A;  2WB7 A;  4OIQ F;  3S27 A;  2KC3 A;  2QTV A;  1TKN A;  3GM2 A;  3OA1 A;  2BE5 F;  4RD9 A;  5EGY A;  3SNH A;  4D4X A;  4G7H F;  4I1M A;  3ASO C;  3E9V A;  4K1O A;  2P6V A;  4LLC A;  3ZSU A;  4L6R A;  3OWT A;  1VLS A;  3AQB A;  2DGJ A;  2W9Y A;  4WAB A;  3T6J A;  3GEE A;  3LS1 A;  5L0D A;  1QQ3 A;  2KJG A;  2R7Q A;  5K0I A;  5KYU B;  4XPX A;  4EKW A;  4O7G A;  2J9W A;  2Q00 A;  2VCA A;  1YYJ A;  2XSE A;  4EWC A;  3TJ5 A;  2RD9 A;  2EPL X;  2EIJ C;  3K33 A;  4ANJ A;  2EIL C;  4CJO A;  1HE9 A;  4GEH A;  3LJB A;  3UR3 C;  2LP4 A;  4IJJ A;  4J30 B;  2KSF A;  2CGE A;  2J8W A;  3I4U A;  1KU2 A;  3KKB A;  4XLN F;  5AC4 A;  1GM5 A;  2GAQ A;  5DQT A;  3LEO A;  3B0V C;  3ABL C;  3LUT B;  5JUA A;  1HE1 A;  3RVY A;  4BPM A;  3CAX A;  1XWJ A;  3V5Y A;  5B1A C;  1Q0G A;  3AOU A;  3Q6M A;  1NU9 C;  2LIG A;  2DYR C;  3EGD B;  4KI2 A;  3ZTZ A;  1S05 A;  1MND A;  1LS1 A;  1K40 A;  4JZA A;  1Z3I X;  2Q4F A;  3UGO A;  4CS9 C;  2R03 A;  1FTS A;  1ZHW A;  3POV A;  3Q6N A;  3QW1 A;  3U8V A;  1I5N A;  4A4A A;  4H54 A;  2VB6 A;  3M79 A;  1M56 C;  2MYS A;  4LDK A;  1LIH A;  3Q7L A;  1VMA A;  3B0P A;  1YJG A;  4N06 A;  2W4M A;  3S29 A;  4E17 A;  4GYT A;  4I1O B;  3EG9 B;  5F5F A;  3JZ0 A;  4G78 A;  1EKY A;  4OD5 A;  1A0B A;  3TOM A;  2R02 A;  4O6Y A;  3EQL F;  2OQM A;  2QE9 A;  3GEH A;  4ER9 A;  4W8P A;  3ZG1 A;  4I44 A;  3EH1 A;  1K04 A;  4J7Y A;  1ZHX A;  4FES A;  3RF3 A;  2VCC A;  1CGO A;  1CPQ A;  4KNV A;  3M4B A;  4YT8 A;  3V5Z A;  1ZU4 A;  3M15 A;  2YLI A;  1BR4 A;  3C8G D;  1H9G A;  3HNL A;  3PDM P;  2EPK X;  2H7O A;  4CSA A;  1PD0 A;  3DWW A;  2Q9B A;  2WZG A;  4O79 A;  1ZU5 A;  2LCH A;  2NUT B;  2HZ8 A;  1YZA A;  2C04 A;  2KQ9 A;  3O55 A;  3PCV A;  1W2W A;  1FMW A;  4EHP A;  4E7Z A;  4NTF A;  4J32 B;  2UUI A;  4U5B E;  4U9E A;  3KPH A;  3SEO A;  4MS2 A;  2ZXW C;  4CBE A;  3A11 A;  2YEV A;  3DAG A;  1TFO B;  1Z6A A;  1C02 A;  3L0I A;  4D4N A;  2YL1 A;  4YT4 A;  5L3V A;  3B0U X;  2VC9 A;  1O3U A;  4IWB A;  3US6 A;  4JC7 A;  5T3W A;  4C3B A;  4N4W A;  2D4U A;  2IOQ A;  3TQO A;  3W4Y A;  3O39 A;  5JLI A;  4DOZ A;  1YAR O;  2A6E F;  2I8B A;  1GQA A;  1H7I A;  3RYL A;  1OR3 A;  4DJ9 A;  2IXM A;  4YT5 A;  2YVK A;  2YKZ A;  4QI0 A;  2G62 A;  3UMK A;  1ORS C;  2V26 A;  3EZH A;  2MHR A;  4W8K A;  4A2N B;  2NUP B;  2AU5 A;  2A0B A;  3I5P A;  1D1C A;  4N6H A;  5COF A;  4AL0 A;  3U3B A;  2HSB A;  4CIH A;  2XLM A;  2DYS C;  4C3E A;  3NRH A;  4YT2 A;  3EG9 A;  4HEA J;  3AQC A;  4XEK A;  4BEJ A;  2ETS A;  3DD7 A;  4XTK A;  2J0W A;  4Q4Z F;  5GPG B;  1JRA A;  5T1D B;  2Y69 C;  4ULW A;  4U9D A;  1QPU A;  1TFK B;  1A7E A;  1RJ9 A;  3RQE A;  2KGO A;  3U2L A;  3NMI A;  4NCQ A;  2YL3 A;  5KYW A;  3L34 A;  2XL4 A;  4M63 A;  4XWJ A;  3G4Z A;  4MQ9 F;  4CJG A;  5BQH A;  5CI8 A;  3MBG A;  2L7A A;  3CEX A;  3HJC A;  1NU7 D;  3KYI A;  3U8P A;  3DXJ F;  1ZYR F;  5BQI A;  1MMN A;  4DRJ B;  1ORJ A;  5TJ5 E;  1B68 A;  2HJ3 A;  5L0H A;  1OXK A;  3IHU A;  3VF0 A;  4U5H A;  2J0X A;  3JSE O;  3LLI A;  4MND A;  4RDA A;  3S84 A;  1GGQ A;  2XM0 A;  1WAS A;  2NSG A;  2GDC A;  3QZC A;  5COM A;  2GA0 A;  4X0R A;  3S0X A;  1JPN A;  2YRF A;  1D0Z A;  1K05 A;  1Q0K A;  4HFK B;  2XLD A;  2JX0 A;  4F4B A;  2Y3G A;  1RCP A;  3NKE A;  4LLE A;  5KYN A;  3W8H A;  1HW2 A;  3ITF A;  4WJ0 A;  3WOD F;  1L3P A;  2HKV A;  3L8I A;  3ZQY A;  2YHS A;  3EGD A;  1QKR A;  3DMD A;  3NMJ A;  5AGF A;  2X0C A;  1J8M F;  1CPR A;  3C63 A;  5IY5 C;  3SP1 A;  1WAT A;  2GFH A;  2J46 A;  1YZC A;  1JR8 A;  1G8X A;  2JD3 A;  3ABM C;  3L8J A;  1CGN A;  1MMD A;  3ZIB A;  2XS1 A;  3R7C A;  1O87 A;  4JCH A;  3IQT A;  4CSA C;  2CCY A;  5F5H A;  1SYQ A;  1APC A;  2LD6 A;  1OR2 A;  4U5C E;  3UNG C;  1Z63 A;  2HFI A;  3B71 A;  1H6G A;  3BEH A;  1UFB A;  2WVQ A;  3UGP A;  3O6X A;  2KK1 A;  3FVY A;  4YL0 A;  3SYN A;  4JJG A;  4QDL A;  1ZVZ A;  1YA7 O;  4E0I A;  3HKK A;  4NTA A;  5E33 A;  2PX0 A;  3B29 A;  3JTL O;  3K66 A;  2OJQ A;  3AG2 C;  1Y4C A;  1V4A A;  1WGW A;  5JP7 A;  5L0F A;  1EQ1 A;  4IRU A;  1FR0 A;  4DVZ A;  2OKU A;  2G3V A;  2OU6 A;  2XLV A;  1OW8 A;  3K1H A;  3RKO F;  3VRC A;  4Q7C A;  2Q9A A;  2LFF A;  1RKC A;  2F22 A;  2QNL A;  2XLH A;  1LPE A;  5KYY B;  2Q7R A;  1LI7 A;  1V54 C;  5CIV A;  4AE4 A;  3W2V A;  2XLO A;  3KH2 A;  1RJ9 B;  3A9C A;  5KYY A;  2AP3 A;  4IB4 A;  4CDY A;  2Y3H A;  2O9X A;  1LI5 A;  3U9J A;  4NC3 A;  4YK5 A;  3HTK C;  3MX3 A;  2HV7 A;  5BUO A;  5JT4 A;  3K7D A;  1XZQ A;  1C17 M;  1D1A A;  1I4Z A;  2A69 F;  3IQC A;  4GQH A;  1F1M A;  5A6A A;  3DI5 A;  2P0N A;  5JRA A;  3PMR A;  4MTG A;  3NYM A;  1T6I A;  2PP4 A;  2XL6 A;  3IQ6 A;  2BL2 A;  3FXH A;  4NTB A;  4ZLC A;  1TWA A;  1M2O A;  3RW0 A;  1A41 A;  3C62 A;  4U5E E;  3WHN A;  3ZWI A;  4WGZ A;  3ABK C;  4OD4 A;  1OCZ C;  2LK4 A;  5DS4 A;  2D5R B;  2E87 A;  1E85 A;  4AX2 A;  1MMG A;  2HUJ A;  1AVO B;  3EHN A;  1YLM A;  3K1I C;  4BJT A;  5FCL A;  1JOG A;  1VOM A;  4MVU A;  3GEI A;  4K7B A;  4XPY A;  3JT1 A;  3NYL A;  3IQ5 A;  2R7T A;  3F47 A;  2AVK A;  4RBN A;  2XRH A;  4ZLD A;  3QW0 A;  1Z23 A;  3EZI A;  1NZE A;  4Z9H A;  1J8Y F;  1MNE A;  1ZZP A;  3CQZ A;  1HW1 A;  1PCX A;  4BJ6 C;  4PJL A;  1T6Q A;  2M64 A;  4FX5 A;  2XLE A;  1YAU O;  3NDB B;  3C7J A;  1IW7 F;  3FHD A;  5CI9 A;  5DVW A;  4DVY P;  5L0G A;  1BZ4 A;  3GWL A;  3T4R A;  3ZQV A;  4ULV A;  5HSW A;  1ZHZ A;  4OIO F;  3V7O A;  3U2M A;  2XS8 A;  2PFD A;  2PNO A;  2EIN C;  3N24 A;  3TUL A;  2EIM C;  4YN0 B;  2Q9C A;  4JEA A;  3RQF A;  4CS9 A;  1FAP B;  3FAJ A;  1LE4 A;  2IXO A;  2QLA A;  1Z7Q c;  5KYX A;  3DE9 A;  2OEV A;  4MVQ A;  4HE8 D;  2ICW G;  2J7P A;  5B3I A;  4CS8 C;  1EA8 A;  3R2P A;  1NBB A;  4MTO A;  4MVZ A;  3K1I A;  2R05 A;  1RKE B;  2HS5 A;  1S7Z A;  3AG4 C;  3QTH A;  4WGY A;  4C7O A;  5KYX B;  3DZA A;  1YVI A;  2Y3D A;  3FAP B;  1T9K A;  2G3K A;  2WVN A;  4B6I A;  4G7Z F;  1RMV A;  3LES A;  1LM3 B;  3NG1 A;  3T9O A;  4XPW A;  5JVE A;  2DB4 A;  2NSF A;  2QY9 A;  1ST6 A;  1H9T A;  4LDQ A;  3FOO A;  3E70 C;  4JTC B;  4C7O B;  2J7P D;  1NFO A;  1NSG B;  3F46 A;  4PR9 A;  1VYK A;  5JS5 A;  2WZF A;  3EGX A;  5AC5 A;  4KBL A;  3I5Q A;  2A0U A;  2L6G A;  2FFH A;  5D92 A;  2R7U A;  2ZD9 A;  1FNT c;  3LNR A;  3N0T A;  4FWV A;  1L7C A;  1ZHY A;  3MYF A;  1OCC C;  1RXQ A;  1VK5 A;  1G5Z A;  3TOL A;  3LLK A;  1M2V B;  1IZM A;  5L0J A;  4JTD B;  3ZVR A;  1LVK A;  2TMV P;  4JRZ A;  3VAY A;  2UUH A;  5KYU A;  3KMI A;  2GWW A;  4DBR A;  3DAF A;  1SMY F;  2C03 A;  1AUE A;  1T5O A;  2YL0 A;  3C8G B;  1MQV A;  1RKE A;  3U9M A;  5JSL A;  1LE2 A;  3AG1 C;  3VYW A;  2OEX A;  4AL1 A;  2ASR A;  1E86 A;  1VYI A;  3MFN A;  3WG7 C;  1U89 A;  3EFO B;  3MLG A;  3S9O A;  4EBB A;  3GOR A;  3AJM A;  4PFP A;  4P9F A;  4Q5S F;  2Y3B A;  5D91 A;  4KNW A;  3SXY A;  1M57 C;  3UMH A;  3L1M A;  5L0C A;  1QZX A;  4FAP B;  3MYI A;  3U3F A;  3LEV A;  4E7S A;  3HNJ A;  2R7R A;  1ZW2 A;  2OOC A;  1T01 A;  1PV3 A;  2KNH A;  3M1C B;  1O5H A;  2VCB A;  3GWN A;  2IBF A;  1VB5 A;  1WWP A;  2AWY A;  2NUP A;  4OIR F;  2ZPA A;  3RQG A;  4BJ1 A;  1SF8 A;  1TR2 A;  2J9V A;  3T6B A;  2FGY A;  3GM3 A;  2ZXO A;  2HMZ A;  3DJU B;  4BJ5 C;  1GS9 A;  4DBQ A;  2ZXP A;  1HMD A;  3PHF 2;  3C8Z A;  5DLJ A;  4DXW A;  1OW7 A;  1AEP A;  2YLG A;  4KC9 A;  4YJW A;  5B1B C;  4MW8 A;  2EIK C;  4Z9J A;  1LKX A;  3ZDL A;  2XXA B;  1M6T A;  3C8G A;  4OIP F;  2KW3 C;  3AG3 C;  4I3M A;  4PK4 A;  3CSK A;  2P1A A;  1V55 C;  2CW0 F;  4YL3 A;  4MVO A;  5B3S C;  4YL1 A;  1V74 B;  2PF4 E;  3NYJ A;  1U0B B;  1D1B A;  1JPJ A;  1G4U S;  1Q0D A;  2CDQ A;  2BC5 A;  2P7V A;  3S28 A;  3WAQ A;  4BG0 A;  3Q7G A;  4DRH B;  2XXA A;  2KYH A;  5DS6 A;  2YZS A;  4ONS A;  4AE4 B;  4CIP A;  2Y39 A;  4E18 A;  1R5I D;  1MMA A;  1WTY A;  3FMS A;  3H2V A;  3T6G B;  5F28 E;  4EUK B;  1YDI A;  1BR1 A;  2JPU A;  3J06 A;  4MVS A;  2CNW D;  3KL4 A;  3EGX B;  3AGU A;  1VTM P;  3JRM O;  3RVZ A;  1QSP A;  2L9J A;  3SZR A;  2EPN A;  2QUP A;  2IXP A;  4NY3 A;  1JAF A;  2YL7 A;  1A7V A;  2R7W A;  4YWQ A;  4U5D E;  5L3Q A;  3HLZ A;  2YWA A;  3JSZ A;  4XEF A;  4MTF A;  4EIY A;  3C18 A;  3N2Z B;  2R7S A;  4HFF B;  4XQ1 A;  2NG1 A;  1E84 A;  3EH2 A;  2CYD A;  3ECS A;  5DQZ A;  3HNK A;  4JKV A;  4JVS A;  2A6H F;  1NFN A;  4PJN A;  3RH3 A;  5FZT A;  1TWC A;  1E83 A;  2R7X A;  3EFO A;  3QVY A;  3QVZ A;  4J7T A;  3NKD A;  4JCZ A;  3TK0 A;  2HMQ A;  3ZTM A;  5COG A;  3AGT A;  4IGG A;  2P61 A;  1SR2 A;  1U6H A;  1PD1 A;  3EPV A;  1T6U A;  1Y6D A;  2J9B A;  5A6B D;  1D0X A;  1R4T A;  2X51 A;  4O6M A;  1YA9 A;  1FFT C;  2MWQ A;  3QMK A;  2NUT A;  3ZC4 A;  4JE9 A;  1OKK D;  1TWH A;  2OJE D;  2PBE A;  3DE8 A;  3DKA A;  3JYH A;  5EK0 A;  4LDR A;  1D0Y A;  3K6B A;  2HV6 A;  2H7B A;  1HMO A;  2VAS A;  4JTA B;  2R9R B;  5E2Q A;  4P9T A;  3RIP A;  4E0H A;  4XLP F;  4O6N A;  4R32 A;  2Z15 A;  1JMW A;  1OW6 A;  2L6F A;  1OKK A;  2A1D D;  1VLT A;  3FOP A;  4PJM A;  1DOW A;  1QLE C;  2EPM X;  3TD7 A;  2B0J A;  1N1C A;  2LFD A;  3JRT A;  4BEM J;  4IAQ A;  3M4C A;  4Z9I A;  3H65 A;  5A6B A;  1BBH A;  3G4X A;  2WZL A;  3RFY A;  4UDV A;  3LAY A;  1OCR C;  4OIN F;  1OCO C;  3DJN B;  3G50 A;  2XL8 A;  3EJN A;  1FFH A;  2AWC A;  3SXK A;  4CS8 A;  1KTM A;  1OQC A;  2A68 F;  2ZXR A;  1LS4 A;  4CDA A;  1BDJ B;  4H4K C;  2L6H A;  3B9Q A;  4PFO A;  5KYW B;  3JCU Q;  3HNI A;  1G4W R;  4EBJ A;  1UG7 A;  2FAP B;  2WVO A;  3DM9 B;  3KYJ A;  4CX9 A;  1KNY A;  4NQF A;  4BJ5 A;  5L0I A;  5T3T A;  1DOV A;  2B0H A;  2Q3T A;  3IPM O;  3S90 A;  3O10 A;  3OEO A;  4K0D A;  5DS5 A;  4P6I C;  3IEE A;  4CDV A;  5A6J A;  2J9U A;  4JW1 A;  4N6C A;  3X1O A;  4PJJ A;  2VH3 A;  3GM1 A;  2CNW A;  3JYY A;  4AK9 A;  2R25 A;  2V3C C;  1OXB A;  2PX3 A;  2H7V C;  2RSE B;  2R7V A;  2R7O A;  4BJ6 A;  2IYL D;  2J45 A;  2W45 A;  1HY5 A;  1QVX A;  1YYX A;  3ATP A;  3EHM A;  2M4E A;  4PAC A;  2DI3 A;  1ZW3 A;  4G7O F;  2NPU A;  1WN0 A;  1TQG A;  3W2W A;  3VM6 A;  4DRI B;  2OG2 A;  3LNM B;  1EI7 A;  2LSE A;  3U5S A;  2YLD A;  1A7D A;  1TWG A;  3GOD A;  1NLX A;  5E3C A;  2LQG A;  1SZI A;  3FDQ A;  4XEV A;  4JJF A;  2IM8 A;  3BRJ A;  3H2U A;  3UMI A;  3V5X A;  1BR2 A;  5EHH A;  2HSQ A;  4MVM A;  2I15 A;  4JEB A;  4MW3 A;  5A69 A;  1CGM E;  1ORY A;  3LS0 A;  1NG1 A;  4JIO A;  4JUR I;  2XLW A;  1WOL A;  2IXN A;  3SXM A;  2EPO A;  4C3D A;  4CS7 A;  4IAR A;  4U5F E;  5A6K A;  3X2Q C;  2W4B A;  4LER A;  4IAO A;  3CZ6 A;  4EBK A;  2WL8 A;  3ASN C;  3GAN A;  5BQG A;  1ZHT A;  2OCC C;  2YQY A;  5HV9 A;  1I4Y A;  2L81 A;  5E3A A;  2HJM A;  3NMK A;  4U5G A;  1FMV A;  3TJ6 A;  2H8A A;  3U0C A;  3DM5 A;  3SXZ A;  1XZP A;  1E2X A;  1Q0M A;  4QI2 A;  1Q0F A; 
#chains in the Genus database with same CATH homology
 256B A;  3IQ5 A;  2XM4 A;  4N6H A;  1JAF A;  2YL7 A;  1A7V A;  3QW0 A;  2XLM A;  4EIY A;  4D4X A;  1E84 A;  4L6R A;  2XLE A;  3HNK A;  4JKV A;  4U9D A;  1QPU A;  3ZQV A;  4ULV A;  1E83 A;  3NMI A;  2YL3 A;  3QVY A;  3QVZ A;  4CJG A;  1QQ3 A;  3U8P A;  1YYJ A;  4JEA A;  2J9B A;  2QLA A;  4CJO A;  3DE9 A;  4JE9 A;  5B3I A;  3DE8 A;  1NBB A;  2XM0 A;  4WGY A;  2J8W A;  2XLD A;  1LM3 B;  5JVE A;  1RCP A;  5JUA A;  3ZQY A;  3FOO A;  5AGF A;  3NMJ A;  3FOP A;  1CPR A;  3C63 A;  5JS5 A;  4IAQ A;  1S05 A;  3M4C A;  3ZTZ A;  1YZC A;  1BBH A;  1CGN A;  3QW1 A;  2CCY A;  1APC A;  3M79 A;  2XL8 A;  3TOL A;  4CDA A;  3HNI A;  4CX9 A;  1EKY A;  2YL0 A;  1MQV A;  3TOM A;  5JSL A;  4ER9 A;  4CDV A;  5JP7 A;  1E86 A;  1CGO A;  1CPQ A;  2XLV A;  3M4B A;  3VRC A;  3M15 A;  2YLI A;  3HNL A;  1YYX A;  2XLH A;  3L1M A;  3HNJ A;  1YZA A;  2XLO A;  4IB4 A;  4CDY A;  2YLD A;  4U9E A;  3ZTM A;  5JT4 A;  4NC3 A;  4D4N A;  2YL1 A;  5JRA A;  2XL6 A;  4JEB A;  2YLG A;  3IQ6 A;  1M6T A;  2XLW A;  4N4W A;  4IAR A;  3C62 A;  5JLI A;  3ZWI A;  4WGZ A;  1GQA A;  2BC5 A;  1E85 A;  3NMK A;  4CIP A;  2YKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...