5JRAA

Nitric oxide complex of the l16v mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jraA00
256BA 3HNJA 4D4NA 4N6HA 5JRAA 4CDVA 1E86A 2XLMA 1BBHA 3HNKA 4IAQA 2XLEA 1CPRA 3HNIA 4WGYA 4ER9A 2XLWA 4JEBA 1YZCA 3HNLA 1YZAA 1E84A 4EIYA 3NMKA 1YYXA 3FOOA 3L1MA 4IARA 3U8PA 1E83A 1E85A 2XLVA 5JP7A 1S05A 3FOPA 1RCPA 3TOMA 1NBBA 4U9EA 4NC3A 4IB4A 4CIPA 3TOLA 2XL6A 2XM0A 5JVEA 2BC5A 3ZQYA 1EKYA 3NMJA 4JKVA 3ZTZA 5B3IA 2XLHA 3M79A 1QPUA 2QLAA 4JE9A 1MQVA 3M15A 3QVZA 2XLOA 3C63A 5JLIA 3QW1A 2YL7A 2XL8A 3M4BA 1APCA 1JAFA 3QVYA 4CDAA 4WGZA 2XM4A 3M4CA 3ZWIA 4CJGA 1GQAA 4ULVA 3NMIA 5JUAA 3DE9A 5JSLA 3IQ6A 3IQ5A 2YL3A 3DE8A 3C62A 4D4XA 4L6RA 2YL0A 1QQ3A 3VRCA 4U9DA 5JT4A 4CJOA 2XLDA 1A7VA 4CX9A 2YLGA 3ZTMA 2YLIA 1LM3B 2CCYA 1YYJA 2J9BA 1M6TA 4N4WA 5JS5A 4CDYA 2J8WA 1CPQA 3ZQVA 5AGFA 1CGOA 2YLDA 1CGNA 2YL1A 3QW0A 2YKZA 4JEAA
chains in the Genus database with same CATH superfamily
3ASNC 1SR2A 2J46A 2YEVA 3C8GB 3SXYA 3G4ZA 1HW2A 1KTMA 2VCBA 2WZLA 4YT5A 3GM1A 2V26A 4CS7A 3MYIA 1H6GA 4LERA 1NFOA 2IXPA 2LFDA 3ABKC 4YJWA 4CDVA 5FCLA 1Z63A 3BEHA 3DWWA 3QTHA 3HNKA 1Y4CA 4IAQA 1CPRA 2UUIA 4O7GA 3IHUA 4PJMA 4Z9JA 2QUPA 1J8MF 3LAYA 4JW1A 4KNVA 2QTVA 3CZ6A 4PJLA 2P1AA 3B29A 1XWJA 1AEPA 4MVSA 4LLEA 2VCCA 3DM5A 1YA9A 1O5HA 1RKCA 3Q7GA 3LUTB 3FAPB 1VOMA 3HNLA 2A69F 3UMKA 3C18A 5E3AA 2Z15A 2NPUA 1E84A 1S7ZA 4YT4A 4U5GA 3L1MA 3U8PA 1RMVA 1MMAA 2XXAB 1H9GA 4QDLA 2CGEA 3K7DA 3FOPA 4MS2A 3RQEA 2R02A 1V54C 1RKEB 1JMWA 1G8XA 1RCPA 1NBBA 1Z3IX 4NC3A 4IB4A 2XXAA 1R5ID 3FMSA 1VLTA 3US6A 4RBNA 3EGDB 1IZMA 4NCQA 4NTFA 5B3SC 4XPYA 4XPXA 2HSBA 3ZQYA 2KJGA 4JVSA 1OR3A 3CEXA 1OQCA 4G7HF 4JCZA 4HEAJ 2LIGA 3ZTZA 4XPWA 2XLHA 3CAXA 5B3IA 1QPUA 1ZHTA 4MW3A 2QLAA 4R32A 3GANA 5A6AA 3DAFA 1MQVA 5KYNA 2NSGA 3M15A 1UFBA 4LDQA 1OW6A 1U6HA 2EPMX 4YN0B 3WG7C 2VASA 3GM3A 3B71A 3I4UA 5L0JA 1FR0A 2F22A 4N6CA 3K6BA 4JCHA 1PD0A 2YHSA 3QW1A 4W8KA 3J06A 1Q0GA 2OU6A 2Y3DA 2LD6A 1H9TA 2R7WA 1YARO 3ABMC 3PDMP 4K1OA 3ZG1A 5COGA 5KYXB 4YL0A 3SNHA 4LACB 1L3PA 3LNMB 2DB4A 3KMIA 3T6JA 3B9QA 4I1MA 3SZRA 3KYIA 5KYYA 2LFFA 3JRTA 4RD9A 2NUTA 2KYHA 1M2VB 3NG1A 2M4EA 4NTBA 1F1MA 3VM6A 4YT8A 3B0PA 2CW0F 5KYWB 1K40A 3B0UX 4G7OF 1YAUO 3U8VA 3IQ5A 1JPNA 2G62A 3F46A 5BQIA 2MYSA 3DE8A 3C62A 3UGOA 3A9CA 3PHF2 3EFOB 1C03A 4K0DA 1RJ9B 2LCHA 3DAGA 3UMIA 5L0CA 2R7VA 3K1IA 3JRMO 4U9DA 3MLGA 3U0CA 3N24A 1RJ9A 3I5QA 4XEVA 1TWGA 4U5CE 4E0HA 5CIVA 1ZW2A 4W8PA 5DVWA 3NYMA 1TFKB 1XZQA 4MTFA 4BG0A 1HW1A 4DRIB 2X51A 4XEFA 5GPGB 2CDQA 1LM3B 4CS9C 1OCOC 2ZPAA 3AOUA 5F28E 3MX3A 3U3FA 3GEEA 2VB6A 1M6TA 5HSWA 3S90A 2FGYA 3C8ZA 5L3VA 3AQCA 1SF8A 4H54A 3ZQVA 3X1OA 2CNWD 1V74B 2NSFA 3V5YA 3LLKA 1YJGA 4JJGA 2FAPB 3JSZA 1CGNA 3NYJA 3WAQA 3E9VA 4I44A 3RFYA 1OKKD 4NQFA 3LS1A 4EWCA 3C8GD 4JEAA 3KYJA 4C3EA 1JPJA 3O55A 3FHDA 1ORJA 3DZAA 2L6FA 1M56C 2YVKA 4BEJA 3S0XA 2H7VC 1SZIA 2WB7A 3AG3C 1TFOB 3HTKC 2ASRA 2D5RB 2OEXA 1TKNA 2XLMA 3NYLA 4DVYP 2HJMA 1BDJB 3LESA 1XZPA 3W2VA 1HE9A 3JYYA 2NUPA 4JC7A 2ETSA 4CS8C 4ZLCA 3LNRA 1HY5A 5COMA 1WGWA 5L3QA 4U5BE 2PNOA 1FMVA 2IOQA 2QNLA 3EGXB 5F5HA 2EPNA 4MVRA 1U89A 1NSGB 4BJ1A 1ZU4A 1ZU5A 2A6HF 2EPKX 1D0XA 3X2QC 4EIYA 3FOOA 2C03A 1E83A 2J0XA 2L6GA 4E0IA 3T6GB 2J45A 1Z7Qc 2A0UA 3JCUQ 4XWJA 1ZYRF 1OCCC 2WVQA 2H7BA 5D92A 4LLCA 1ORYA 3R2PA 3GM2A 2IYLD 4O6MA 4CIPA 3NKDA 4MVOA 4J7YA 3TOLA 4MTGA 2XM0A 3ZC4A 3SYNA 4AL0A 2WVNA 5A69A 5JVEA 2GDCA 2IXNA 1ZHWA 1VYIA 1Z5ZA 4JTAB 4PACA 3ZSUA 2ZD9A 5EK0A 1IW7F 3MBGA 3M79A 3BRJA 3RF3A 3EHMA 4FX5A 1V4AA 2G3VA 4WABA 4AX2A 2J7PD 2R7QA 3W8IA 5DQTA 2OEVA 3KL4A 4J32B 2B0JA 2ZXPA 3G4XA 1A7EA 1LI7A 2DYRC 2L9JA 2ZXRA 1PCXA 2EIJC 2XLOA 2ZXOA 3EQLF 1K04A 3MFNA 2PBEA 3MYFA 1N1CA 1FAPB 4KC9A 3V5XA 2HS5A 1AUEA 4JRZA 1FMWA 1D0YA 3M4BA 4C3DA 4BEMJ 3TK0A 3CSKA 5A6BA 5A6JA 1JAFA 1B68A 2G3KA 1T6QA 3QVYA 2EIKC 2EPLX 2HJ3A 3FXHA 4UDVA 4CDAA 2Q9AA 2W9YA 3RQFA 3U3BA 1T9KA 2XM4A 1GM5A 1Z23A 1LKXA 3ATPA 4DOZA 4E18A 1GQAA 4G0HA 4ULVA 1R4TA 4DVZA 3ABLC 2HFIA 3L34A 3S84A 5JSLA 1WWPA 1I5NA 2PFDA 1QLEC 2VC9A 4MW8A 1JR8A 2EILC 3EG9B 2W4BA 4BPMA 2OJQA 2J9WA 1MMDA 2XL4A 4PFOA 4EUKB 2BL2A 4L6RA 5DQZA 5F5FA 2LSEA 3HJCA 1YVIA 5T1DB 1QQ3A 1K05A 4KI2A 3EG9A 2QE9A 1LE4A 2O9XA 5B1BC 1TWAA 2B0HA 3F47A 1HE1A 2HSQA 4RDAA 2P6VA 1VB5A 4MVQA 4CS9A 5KYYB 4EBKA 2XLDA 1HMDA 4Q5SF 2NUTB 3RVYA 3G50A 3M1CB 3U5SA 4O6NA 3U9JA 1KU2A 3SEOA 4OIRF 3H65A 3S27A 2R7OA 2IBFA 5T3TA 4Q7CA 4MNDA 2Y69C 1U0BB 3S28A 5L0FA 2EIMC 2MHRA 4U5HA 4N4WA 4E17A 5JS5A 4CDYA 4JJFA 2D4UA 2KNHA 2R7RA 1CPQA 1PV3A 4JTDB 2R7TA 1SMYF 4EBBA 4PJNA 4P9FA 1LIHA 1T01A 1Z6AA 2LQGA 1SYQA 2YKZA 2HMQA 3AG2C 4E7ZA 2AWYA 4OIPF 2E87A 4WJ0A 2LK4A 2R05A 1QKRA 1H7IA 3NRHA 4D4NA 3JZ0A 3DKAA 3Q7LA 5L0DA 4N6HA 4CS8A 1E86A 3ECSA 3IPMO 1WASA 2HV7A 1D0ZA 3Q6MA 4CSAA 4OIQF 3KH2A 1BBHA 3FAJA 3DI5A 1OCZC 3HNIA 3O6XA 1NZEA 4ONSA 4WGYA 1O87A 2PF4E 2UUHA 4JEBA 1DOWA 2HV6A 4O6YA 5BQHA 4XLNF 3AGUA 5AC5A 5CI9A 3V7OA 4Q4ZF 4A2NB 1OCRC 2EINC 3EH1A 2L81A 5KYUA 3NMKA 1VMAA 3S29A 4XLPF 1AVOB 2WZGA 1BR1A 2KQ9A 4AE4A 2YQYA 4IARA 4BJ6C 1FFTC 4GEHA 4XTKA 5DS5A 2XLVA 2Y3BA 1GS9A 2KW3C 2MWQA 4JIOA 3KPHA 4MQ9F 2Q00A 4U5EE 3W8HA 1OW8A 1ST6A 5AC4A 3TOMA 3TJ5A 4U9EA 2AU5A 4C3BA 3RW0A 1DOVA 4MVZA 2XL6A 5E33A 4PJJA 1RXQA 4U5DE 3UNGC 2BC5A 2NUPB 4IRUA 3T6BA 4QI0A 3GWNA 3R7CA 5DS6A 5CI8A 2IXOA 1Q0FA 3NMJA 4JURI 5K0IA 4J30B 4A4AA 3ASOC 2H7OA 4JKVA 4HFKB 4IAOA 1OR2A 4OD5A 5HV9A 3UR3C 1LS1A 2A0BA 4YWQA 2J9VA 4FWVA 4CSAC 2OKUA 4DBQA 3EHNA 4N06A 3ZVRA 2Q7RA 4CIHA 1CGME 4I3MA 4DBRA 5JLIA 3C63A 5EGYA 1G4US 2Y3GA 3V5ZA 2YL7A 1E2XA 4JTCB 1NU7D 2XL8A 2ICWG 1VTMP 3FVYA 3NDBB 4GQHA 1UG7A 2PP4A 4J7TA 5L0IA 3OA1A 2XS1A 1MNDA 2WL8A 2DI3A 2BE5F 4ANJA 2GA0A 3IQTA 3SXKA 3M4CA 3ZWIA 2WVOA 4CJGA 3B0VC 1HMOA 1EI7A 1Y6DA 3JT1A 3LEOA 3NMIA 1BZ4A 1BR4A 3AJMA 5JUAA 3DE9A 4BJ5C 2NG1A 3IQ6A 2HMZA 3TJ6A 3KKBA 1D1CA 5IY5C 2YL3A 1ZHYA 3QMKA 4O79A 2VH3A 4D4XA 4XQ1A 3W2WA 4DRJB 4FAPB 4C7OA 3VRCA 1O3UA 1ZHZA 2CNWA 3GWLA 1PD1A 2XS8A 1M2OA 2DGJA 2OQMA 2RSEB 5KYUB 4YT2A 2JX0A 2R7SA 3DXJF 4YL1A 3K33A 1M57C 4G78A 1OKKA 2Q9BA 3L8JA 4DRHB 5JT4A 3C8GA 4CJOA 3HLZA 1VYKA 2CYDA 1A7VA 1TQGA 3H2VA 3GODA 1YA7O 4BJTA 3EJNA 3GEIA 2Q4FA 1GGQA 1LI5A 3WHNA 3AGTA 3RYLA 3E70C 2YLIA 3AG1C 3NKEA 4PR9A 1NU9C 4EBJA 5EHHA 2IM8A 1TR2A 2OG2A 2X0CA 4KBLA 4E7SA 4F4BA 1OXBA 4ULWA 4PFPA 2OJED 2YRFA 4H4KC 2H8AA 2IXMA 3EPVA 2YL1A 3JSEO 3POVA 2A68F 1MMNA 2ZXWC 1ZVZA 2GWWA 3K66A 3K1HA 4I1OB 256BA 4QI2A 3HNJA 2WZFA 2KK1A 4AK9A 5JRAA 3N2ZB 2I8BA 2EPOA 3A11A 1OW7A 1RKEA 4LDRA 1YDIA 3GEHA 3LLIA 4P9TA 3U9MA 2R7XA 2XLEA 3EGDA 1LPEA 3RIPA 2GFHA 4ER9A 2PX3A 1QZXA 4IJJA 2GAQA 2J0WA 2R03A 2JPUA 2XLWA 5L0GA 4M63A 4BJ6A 1EQ1A 1T5OA 3VYWA 1YZCA 1I4ZA 5BUOA 4G7ZF 1YZAA 1MMGA 2YWAA 4K7BA 4U5FE 1YYXA 5D91A 1VLSA 3HKKA 2J7PA 1E85A 5T3WA 1NG1A 4AL1A 3JTLO 3ITFA 2KSFA 1S05A 2W45A 5JP7A 3SXMA 1C17M 1L7CA 2HZ8A 2R7UA 4P6IC 5A6KA 3DM9B 2J9UA 3FDQA 2AWCA 3U2LA 3O39A 3WODF 4CBEA 3O10A 1C02A 3PMRA 2AVKA 4Z9HA 1ZHXA 1NLXA 1LVKA 2LP4A 4MVMA 3ZDLA 5KYXA 1OXKA 4ZLDA 3DMDA 5E2QA 5TJ5E 1EKYA 3W4YA 2A6EF 1WATA 3T4RA 1YLMA 1T6UA 4JZAA 5COFA 3SXZA 1M2VA 4X0RA 3QZCA 2HUJA 1EA8A 4DJ9A 5KYWA 2P0NA 1W2WA 3C7JA 2HKVA 3EZHA 2P7VA 3GORA 3DD7A 4JE9A 3OEOA 3QVZA 3LEVA 4AE4B 4DXWA 2PX0A 3Q6NA 3EH2A 3IEEA 2AP3A 4LDKA 5FZTA 2YZSA 4Z9IA 2Y3HA 1A41A 2Q3TA 3RH3A 2I15A 3EFOA 4OIOF 1Q0KA 4NTAA 4HE8D 1WN0A 3T9OA 2R9RB 3CQZA 4KNWA 5B1AC 5E3CA 5DLJA 1G4WR 1T6IA 2L6HA 1APCA 4YL3A 1J8YF 4IGGA 1ORSC 3RQGA 4GYTA 3RVZA 4BJ5A 3UMHA 1WOLA 4WGZA 1FFHA 1ZZPA 4NY3A 1BR2A 1G5ZA 2XSEA 1KNYA 1LS4A 3JYHA 3L0IA 3VF0A 3ZIBA 4MTOA 2L7AA 1D1BA 1MNEA 5BQGA 3IQCA 4YK5A 2W4MA 3TULA 1WTYA 2RD9A 4PK4A 2XRHA 3DJNB 3SP1A 4EHPA 2V3CC 4MVUA 1QVXA 1V55C 2KC3A 2YL0A 3AG4C 3LJBA 4FESA 3TD7A 1I4YA 2FFHA 2KGOA 3L8IA 2OCCC 4B6IA 2Q9CA 5A6BD 1JOGA 1D1AA 4XEKA 1Q0MA 3DJUB 2M64A 1VK5A 3I5PA 3LS0A 5DS4A 1FNTc 3UGPA 1Q0DA 3EZIA 2OOCA 3RKOF 2TMVP 1A0BA 2Y39A 3K1IC 2R25A 1LE2A 4CX9A 5L0HA 2QY9A 2YLGA 3ZTMA 4EKWA 1JRAA 1A7DA 1TWCA 2CCYA 1NFNA 1YYJA 3OWTA 1TWHA 3PCVA 2J9BA 4IWBA 3U2MA 4OD4A 1ZW3A 3S9OA 2DYSC 2J8WA 2C04A 2JD3A 2P61A 1FTSA 2VCAA 1CGOA 3H2UA 3N0TA 5AGFA 2YLDA 4C7OB 3VAYA 3TQOA 3EGXA 3AQBA 1QSPA 4OINF 4HFFB 3QW0A 2A1DD
chains in the Genus database with same CATH topology
256BA 3HNJA 4D4NA 4N6HA 5JRAA 4CDVA 1E86A 2XLMA 1BBHA 3HNKA 4IAQA 2XLEA 1CPRA 3HNIA 4WGYA 4ER9A 2XLWA 4JEBA 1YZCA 3HNLA 1YZAA 1E84A 4EIYA 3NMKA 1YYXA 3FOOA 3L1MA 4IARA 3U8PA 1E83A 1E85A 2XLVA 5JP7A 1S05A 3FOPA 1RCPA 3TOMA 1NBBA 4U9EA 4NC3A 4IB4A 4CIPA 3TOLA 2XL6A 2XM0A 5JVEA 2BC5A 3ZQYA 1EKYA 3NMJA 4JKVA 3ZTZA 5B3IA 2XLHA 3M79A 1QPUA 2QLAA 4JE9A 1MQVA 3M15A 3QVZA 2XLOA 3C63A 5JLIA 3QW1A 2YL7A 2XL8A 3M4BA 1APCA 1JAFA 3QVYA 4CDAA 4WGZA 2XM4A 3M4CA 3ZWIA 4CJGA 1GQAA 4ULVA 3NMIA 5JUAA 3DE9A 5JSLA 3IQ6A 3IQ5A 2YL3A 3DE8A 3C62A 4D4XA 4L6RA 2YL0A 1QQ3A 3VRCA 4U9DA 5JT4A 4CJOA 2XLDA 1A7VA 4CX9A 2YLGA 3ZTMA 2YLIA 1LM3B 2CCYA 1YYJA 2J9BA 1M6TA 4N4WA 5JS5A 4CDYA 2J8WA 1CPQA 3ZQVA 5AGFA 1CGOA 2YLDA 1CGNA 2YL1A 3QW0A 2YKZA 4JEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 256B A;  3HNJ A;  4D4N A;  4N6H A;  5JRA A;  4CDV A;  1E86 A;  2XLM A;  1BBH A;  3HNK A;  4IAQ A;  2XLE A;  1CPR A;  3HNI A;  4WGY A;  4ER9 A;  2XLW A;  4JEB A;  1YZC A;  3HNL A;  1YZA A;  1E84 A;  4EIY A;  3NMK A;  1YYX A;  3FOO A;  3L1M A;  4IAR A;  3U8P A;  1E83 A;  1E85 A;  2XLV A;  5JP7 A;  1S05 A;  3FOP A;  1RCP A;  3TOM A;  1NBB A;  4U9E A;  4NC3 A;  4IB4 A;  4CIP A;  3TOL A;  2XL6 A;  2XM0 A;  5JVE A;  2BC5 A;  3ZQY A;  1EKY A;  3NMJ A;  4JKV A;  3ZTZ A;  5B3I A;  2XLH A;  3M79 A;  1QPU A;  2QLA A;  4JE9 A;  1MQV A;  3M15 A;  3QVZ A;  2XLO A;  3C63 A;  5JLI A;  3QW1 A;  2YL7 A;  2XL8 A;  3M4B A;  1APC A;  1JAF A;  3QVY A;  4CDA A;  4WGZ A;  2XM4 A;  3M4C A;  3ZWI A;  4CJG A;  1GQA A;  4ULV A;  3NMI A;  5JUA A;  3DE9 A;  5JSL A;  3IQ6 A;  3IQ5 A;  2YL3 A;  3DE8 A;  3C62 A;  4D4X A;  4L6R A;  2YL0 A;  1QQ3 A;  3VRC A;  4U9D A;  5JT4 A;  4CJO A;  2XLD A;  1A7V A;  4CX9 A;  2YLG A;  3ZTM A;  2YLI A;  1LM3 B;  2CCY A;  1YYJ A;  2J9B A;  1M6T A;  4N4W A;  5JS5 A;  4CDY A;  2J8W A;  1CPQ A;  3ZQV A;  5AGF A;  1CGO A;  2YLD A;  1CGN A;  2YL1 A;  3QW0 A;  2YKZ A;  4JEA A; 
#chains in the Genus database with same CATH topology
 3ASN C;  1SR2 A;  2J46 A;  2YEV A;  3C8G B;  3SXY A;  3G4Z A;  1HW2 A;  1KTM A;  2VCB A;  2WZL A;  4YT5 A;  3GM1 A;  2V26 A;  4CS7 A;  3MYI A;  1H6G A;  4LER A;  1NFO A;  2IXP A;  2LFD A;  3ABK C;  4YJW A;  4CDV A;  5FCL A;  1Z63 A;  3BEH A;  3DWW A;  3QTH A;  3HNK A;  1Y4C A;  4IAQ A;  1CPR A;  2UUI A;  4O7G A;  3IHU A;  4PJM A;  4Z9J A;  2QUP A;  1J8M F;  3LAY A;  4JW1 A;  4KNV A;  2QTV A;  3CZ6 A;  4PJL A;  2P1A A;  3B29 A;  1XWJ A;  1AEP A;  4MVS A;  4LLE A;  2VCC A;  3DM5 A;  1YA9 A;  1O5H A;  1RKC A;  3Q7G A;  3LUT B;  3FAP B;  1VOM A;  3HNL A;  2A69 F;  3UMK A;  3C18 A;  5E3A A;  2Z15 A;  2NPU A;  1E84 A;  1S7Z A;  4YT4 A;  4U5G A;  3L1M A;  3U8P A;  1RMV A;  1MMA A;  2XXA B;  1H9G A;  4QDL A;  2CGE A;  3K7D A;  3FOP A;  4MS2 A;  3RQE A;  2R02 A;  1V54 C;  1RKE B;  1JMW A;  1G8X A;  1RCP A;  1NBB A;  1Z3I X;  4NC3 A;  4IB4 A;  2XXA A;  1R5I D;  3FMS A;  1VLT A;  3US6 A;  4RBN A;  3EGD B;  1IZM A;  4NCQ A;  4NTF A;  5B3S C;  4XPY A;  4XPX A;  2HSB A;  3ZQY A;  2KJG A;  4JVS A;  1OR3 A;  3CEX A;  1OQC A;  4G7H F;  4JCZ A;  4HEA J;  2LIG A;  3ZTZ A;  4XPW A;  2XLH A;  3CAX A;  5B3I A;  1QPU A;  1ZHT A;  4MW3 A;  2QLA A;  4R32 A;  3GAN A;  5A6A A;  3DAF A;  1MQV A;  5KYN A;  2NSG A;  3M15 A;  1UFB A;  4LDQ A;  1OW6 A;  1U6H A;  2EPM X;  4YN0 B;  3WG7 C;  2VAS A;  3GM3 A;  3B71 A;  3I4U A;  5L0J A;  1FR0 A;  2F22 A;  4N6C A;  3K6B A;  4JCH A;  1PD0 A;  2YHS A;  3QW1 A;  4W8K A;  3J06 A;  1Q0G A;  2OU6 A;  2Y3D A;  2LD6 A;  1H9T A;  2R7W A;  1YAR O;  3ABM C;  3PDM P;  4K1O A;  3ZG1 A;  5COG A;  5KYX B;  4YL0 A;  3SNH A;  4LAC B;  1L3P A;  3LNM B;  2DB4 A;  3KMI A;  3T6J A;  3B9Q A;  4I1M A;  3SZR A;  3KYI A;  5KYY A;  2LFF A;  3JRT A;  4RD9 A;  2NUT A;  2KYH A;  1M2V B;  3NG1 A;  2M4E A;  4NTB A;  1F1M A;  3VM6 A;  4YT8 A;  3B0P A;  2CW0 F;  5KYW B;  1K40 A;  3B0U X;  4G7O F;  1YAU O;  3U8V A;  3IQ5 A;  1JPN A;  2G62 A;  3F46 A;  5BQI A;  2MYS A;  3DE8 A;  3C62 A;  3UGO A;  3A9C A;  3PHF 2;  3EFO B;  1C03 A;  4K0D A;  1RJ9 B;  2LCH A;  3DAG A;  3UMI A;  5L0C A;  2R7V A;  3K1I A;  3JRM O;  4U9D A;  3MLG A;  3U0C A;  3N24 A;  1RJ9 A;  3I5Q A;  4XEV A;  1TWG A;  4U5C E;  4E0H A;  5CIV A;  1ZW2 A;  4W8P A;  5DVW A;  3NYM A;  1TFK B;  1XZQ A;  4MTF A;  4BG0 A;  1HW1 A;  4DRI B;  2X51 A;  4XEF A;  5GPG B;  2CDQ A;  1LM3 B;  4CS9 C;  1OCO C;  2ZPA A;  3AOU A;  5F28 E;  3MX3 A;  3U3F A;  3GEE A;  2VB6 A;  1M6T A;  5HSW A;  3S90 A;  2FGY A;  3C8Z A;  5L3V A;  3AQC A;  1SF8 A;  4H54 A;  3ZQV A;  3X1O A;  2CNW D;  1V74 B;  2NSF A;  3V5Y A;  3LLK A;  1YJG A;  4JJG A;  2FAP B;  3JSZ A;  1CGN A;  3NYJ A;  3WAQ A;  3E9V A;  4I44 A;  3RFY A;  1OKK D;  4NQF A;  3LS1 A;  4EWC A;  3C8G D;  4JEA A;  3KYJ A;  4C3E A;  1JPJ A;  3O55 A;  3FHD A;  1ORJ A;  3DZA A;  2L6F A;  1M56 C;  2YVK A;  4BEJ A;  3S0X A;  2H7V C;  1SZI A;  2WB7 A;  3AG3 C;  1TFO B;  3HTK C;  2ASR A;  2D5R B;  2OEX A;  1TKN A;  2XLM A;  3NYL A;  4DVY P;  2HJM A;  1BDJ B;  3LES A;  1XZP A;  3W2V A;  1HE9 A;  3JYY A;  2NUP A;  4JC7 A;  2ETS A;  4CS8 C;  4ZLC A;  3LNR A;  1HY5 A;  5COM A;  1WGW A;  5L3Q A;  4U5B E;  2PNO A;  1FMV A;  2IOQ A;  2QNL A;  3EGX B;  5F5H A;  2EPN A;  4MVR A;  1U89 A;  1NSG B;  4BJ1 A;  1ZU4 A;  1ZU5 A;  2A6H F;  2EPK X;  1D0X A;  3X2Q C;  4EIY A;  3FOO A;  2C03 A;  1E83 A;  2J0X A;  2L6G A;  4E0I A;  3T6G B;  2J45 A;  1Z7Q c;  2A0U A;  3JCU Q;  4XWJ A;  1ZYR F;  1OCC C;  2WVQ A;  2H7B A;  5D92 A;  4LLC A;  1ORY A;  3R2P A;  3GM2 A;  2IYL D;  4O6M A;  4CIP A;  3NKD A;  4MVO A;  4J7Y A;  3TOL A;  4MTG A;  2XM0 A;  3ZC4 A;  3SYN A;  4AL0 A;  2WVN A;  5A69 A;  5JVE A;  2GDC A;  2IXN A;  1ZHW A;  1VYI A;  1Z5Z A;  4JTA B;  4PAC A;  3ZSU A;  2ZD9 A;  5EK0 A;  1IW7 F;  3MBG A;  3M79 A;  3BRJ A;  3RF3 A;  3EHM A;  4FX5 A;  1V4A A;  2G3V A;  4WAB A;  4AX2 A;  2J7P D;  2R7Q A;  3W8I A;  5DQT A;  2OEV A;  3KL4 A;  4J32 B;  2B0J A;  2ZXP A;  3G4X A;  1A7E A;  1LI7 A;  2DYR C;  2L9J A;  2ZXR A;  1PCX A;  2EIJ C;  2XLO A;  2ZXO A;  3EQL F;  1K04 A;  3MFN A;  2PBE A;  3MYF A;  1N1C A;  1FAP B;  4KC9 A;  3V5X A;  2HS5 A;  1AUE A;  4JRZ A;  1FMW A;  1D0Y A;  3M4B A;  4C3D A;  4BEM J;  3TK0 A;  3CSK A;  5A6B A;  5A6J A;  1JAF A;  1B68 A;  2G3K A;  1T6Q A;  3QVY A;  2EIK C;  2EPL X;  2HJ3 A;  3FXH A;  4UDV A;  4CDA A;  2Q9A A;  2W9Y A;  3RQF A;  3U3B A;  1T9K A;  2XM4 A;  1GM5 A;  1Z23 A;  1LKX A;  3ATP A;  4DOZ A;  4E18 A;  1GQA A;  4G0H A;  4ULV A;  1R4T A;  4DVZ A;  3ABL C;  2HFI A;  3L34 A;  3S84 A;  5JSL A;  1WWP A;  1I5N A;  2PFD A;  1QLE C;  2VC9 A;  4MW8 A;  1JR8 A;  2EIL C;  3EG9 B;  2W4B A;  4BPM A;  2OJQ A;  2J9W A;  1MMD A;  2XL4 A;  4PFO A;  4EUK B;  2BL2 A;  4L6R A;  5DQZ A;  5F5F A;  2LSE A;  3HJC A;  1YVI A;  5T1D B;  1QQ3 A;  1K05 A;  4KI2 A;  3EG9 A;  2QE9 A;  1LE4 A;  2O9X A;  5B1B C;  1TWA A;  2B0H A;  3F47 A;  1HE1 A;  2HSQ A;  4RDA A;  2P6V A;  1VB5 A;  4MVQ A;  4CS9 A;  5KYY B;  4EBK A;  2XLD A;  1HMD A;  4Q5S F;  2NUT B;  3RVY A;  3G50 A;  3M1C B;  3U5S A;  4O6N A;  3U9J A;  1KU2 A;  3SEO A;  4OIR F;  3H65 A;  3S27 A;  2R7O A;  2IBF A;  5T3T A;  4Q7C A;  4MND A;  2Y69 C;  1U0B B;  3S28 A;  5L0F A;  2EIM C;  2MHR A;  4U5H A;  4N4W A;  4E17 A;  5JS5 A;  4CDY A;  4JJF A;  2D4U A;  2KNH A;  2R7R A;  1CPQ A;  1PV3 A;  4JTD B;  2R7T A;  1SMY F;  4EBB A;  4PJN A;  4P9F A;  1LIH A;  1T01 A;  1Z6A A;  2LQG A;  1SYQ A;  2YKZ A;  2HMQ A;  3AG2 C;  4E7Z A;  2AWY A;  4OIP F;  2E87 A;  4WJ0 A;  2LK4 A;  2R05 A;  1QKR A;  1H7I A;  3NRH A;  4D4N A;  3JZ0 A;  3DKA A;  3Q7L A;  5L0D A;  4N6H A;  4CS8 A;  1E86 A;  3ECS A;  3IPM O;  1WAS A;  2HV7 A;  1D0Z A;  3Q6M A;  4CSA A;  4OIQ F;  3KH2 A;  1BBH A;  3FAJ A;  3DI5 A;  1OCZ C;  3HNI A;  3O6X A;  1NZE A;  4ONS A;  4WGY A;  1O87 A;  2PF4 E;  2UUH A;  4JEB A;  1DOW A;  2HV6 A;  4O6Y A;  5BQH A;  4XLN F;  3AGU A;  5AC5 A;  5CI9 A;  3V7O A;  4Q4Z F;  4A2N B;  1OCR C;  2EIN C;  3EH1 A;  2L81 A;  5KYU A;  3NMK A;  1VMA A;  3S29 A;  4XLP F;  1AVO B;  2WZG A;  1BR1 A;  2KQ9 A;  4AE4 A;  2YQY A;  4IAR A;  4BJ6 C;  1FFT C;  4GEH A;  4XTK A;  5DS5 A;  2XLV A;  2Y3B A;  1GS9 A;  2KW3 C;  2MWQ A;  4JIO A;  3KPH A;  4MQ9 F;  2Q00 A;  4U5E E;  3W8H A;  1OW8 A;  1ST6 A;  5AC4 A;  3TOM A;  3TJ5 A;  4U9E A;  2AU5 A;  4C3B A;  3RW0 A;  1DOV A;  4MVZ A;  2XL6 A;  5E33 A;  4PJJ A;  1RXQ A;  4U5D E;  3UNG C;  2BC5 A;  2NUP B;  4IRU A;  3T6B A;  4QI0 A;  3GWN A;  3R7C A;  5DS6 A;  5CI8 A;  2IXO A;  1Q0F A;  3NMJ A;  4JUR I;  5K0I A;  4J30 B;  4A4A A;  3ASO C;  2H7O A;  4JKV A;  4HFK B;  4IAO A;  1OR2 A;  4OD5 A;  5HV9 A;  3UR3 C;  1LS1 A;  2A0B A;  4YWQ A;  2J9V A;  4FWV A;  4CSA C;  2OKU A;  4DBQ A;  3EHN A;  4N06 A;  3ZVR A;  2Q7R A;  4CIH A;  1CGM E;  4I3M A;  4DBR A;  5JLI A;  3C63 A;  5EGY A;  1G4U S;  2Y3G A;  3V5Z A;  2YL7 A;  1E2X A;  4JTC B;  1NU7 D;  2XL8 A;  2ICW G;  1VTM P;  3FVY A;  3NDB B;  4GQH A;  1UG7 A;  2PP4 A;  4J7T A;  5L0I A;  3OA1 A;  2XS1 A;  1MND A;  2WL8 A;  2DI3 A;  2BE5 F;  4ANJ A;  2GA0 A;  3IQT A;  3SXK A;  3M4C A;  3ZWI A;  2WVO A;  4CJG A;  3B0V C;  1HMO A;  1EI7 A;  1Y6D A;  3JT1 A;  3LEO A;  3NMI A;  1BZ4 A;  1BR4 A;  3AJM A;  5JUA A;  3DE9 A;  4BJ5 C;  2NG1 A;  3IQ6 A;  2HMZ A;  3TJ6 A;  3KKB A;  1D1C A;  5IY5 C;  2YL3 A;  1ZHY A;  3QMK A;  4O79 A;  2VH3 A;  4D4X A;  4XQ1 A;  3W2W A;  4DRJ B;  4FAP B;  4C7O A;  3VRC A;  1O3U A;  1ZHZ A;  2CNW A;  3GWL A;  1PD1 A;  2XS8 A;  1M2O A;  2DGJ A;  2OQM A;  2RSE B;  5KYU B;  4YT2 A;  2JX0 A;  2R7S A;  3DXJ F;  4YL1 A;  3K33 A;  1M57 C;  4G78 A;  1OKK A;  2Q9B A;  3L8J A;  4DRH B;  5JT4 A;  3C8G A;  4CJO A;  3HLZ A;  1VYK A;  2CYD A;  1A7V A;  1TQG A;  3H2V A;  3GOD A;  1YA7 O;  4BJT A;  3EJN A;  3GEI A;  2Q4F A;  1GGQ A;  1LI5 A;  3WHN A;  3AGT A;  3RYL A;  3E70 C;  2YLI A;  3AG1 C;  3NKE A;  4PR9 A;  1NU9 C;  4EBJ A;  5EHH A;  2IM8 A;  1TR2 A;  2OG2 A;  2X0C A;  4KBL A;  4E7S A;  4F4B A;  1OXB A;  4ULW A;  4PFP A;  2OJE D;  2YRF A;  4H4K C;  2H8A A;  2IXM A;  3EPV A;  2YL1 A;  3JSE O;  3POV A;  2A68 F;  1MMN A;  2ZXW C;  1ZVZ A;  2GWW A;  3K66 A;  3K1H A;  4I1O B;  256B A;  4QI2 A;  3HNJ A;  2WZF A;  2KK1 A;  4AK9 A;  5JRA A;  3N2Z B;  2I8B A;  2EPO A;  3A11 A;  1OW7 A;  1RKE A;  4LDR A;  1YDI A;  3GEH A;  3LLI A;  4P9T A;  3U9M A;  2R7X A;  2XLE A;  3EGD A;  1LPE A;  3RIP A;  2GFH A;  4ER9 A;  2PX3 A;  1QZX A;  4IJJ A;  2GAQ A;  2J0W A;  2R03 A;  2JPU A;  2XLW A;  5L0G A;  4M63 A;  4BJ6 A;  1EQ1 A;  1T5O A;  3VYW A;  1YZC A;  1I4Z A;  5BUO A;  4G7Z F;  1YZA A;  1MMG A;  2YWA A;  4K7B A;  4U5F E;  1YYX A;  5D91 A;  1VLS A;  3HKK A;  2J7P A;  1E85 A;  5T3W A;  1NG1 A;  4AL1 A;  3JTL O;  3ITF A;  2KSF A;  1S05 A;  2W45 A;  5JP7 A;  3SXM A;  1C17 M;  1L7C A;  2HZ8 A;  2R7U A;  4P6I C;  5A6K A;  3DM9 B;  2J9U A;  3FDQ A;  2AWC A;  3U2L A;  3O39 A;  3WOD F;  4CBE A;  3O10 A;  1C02 A;  3PMR A;  2AVK A;  4Z9H A;  1ZHX A;  1NLX A;  1LVK A;  2LP4 A;  4MVM A;  3ZDL A;  5KYX A;  1OXK A;  4ZLD A;  3DMD A;  5E2Q A;  5TJ5 E;  1EKY A;  3W4Y A;  2A6E F;  1WAT A;  3T4R A;  1YLM A;  1T6U A;  4JZA A;  5COF A;  3SXZ A;  1M2V A;  4X0R A;  3QZC A;  2HUJ A;  1EA8 A;  4DJ9 A;  5KYW A;  2P0N A;  1W2W A;  3C7J A;  2HKV A;  3EZH A;  2P7V A;  3GOR A;  3DD7 A;  4JE9 A;  3OEO A;  3QVZ A;  3LEV A;  4AE4 B;  4DXW A;  2PX0 A;  3Q6N A;  3EH2 A;  3IEE A;  2AP3 A;  4LDK A;  5FZT A;  2YZS A;  4Z9I A;  2Y3H A;  1A41 A;  2Q3T A;  3RH3 A;  2I15 A;  3EFO A;  4OIO F;  1Q0K A;  4NTA A;  4HE8 D;  1WN0 A;  3T9O A;  2R9R B;  3CQZ A;  4KNW A;  5B1A C;  5E3C A;  5DLJ A;  1G4W R;  1T6I A;  2L6H A;  1APC A;  4YL3 A;  1J8Y F;  4IGG A;  1ORS C;  3RQG A;  4GYT A;  3RVZ A;  4BJ5 A;  3UMH A;  1WOL A;  4WGZ A;  1FFH A;  1ZZP A;  4NY3 A;  1BR2 A;  1G5Z A;  2XSE A;  1KNY A;  1LS4 A;  3JYH A;  3L0I A;  3VF0 A;  3ZIB A;  4MTO A;  2L7A A;  1D1B A;  1MNE A;  5BQG A;  3IQC A;  4YK5 A;  2W4M A;  3TUL A;  1WTY A;  2RD9 A;  4PK4 A;  2XRH A;  3DJN B;  3SP1 A;  4EHP A;  2V3C C;  4MVU A;  1QVX A;  1V55 C;  2KC3 A;  2YL0 A;  3AG4 C;  3LJB A;  4FES A;  3TD7 A;  1I4Y A;  2FFH A;  2KGO A;  3L8I A;  2OCC C;  4B6I A;  2Q9C A;  5A6B D;  1JOG A;  1D1A A;  4XEK A;  1Q0M A;  3DJU B;  2M64 A;  1VK5 A;  3I5P A;  3LS0 A;  5DS4 A;  1FNT c;  3UGP A;  1Q0D A;  3EZI A;  2OOC A;  3RKO F;  2TMV P;  1A0B A;  2Y39 A;  3K1I C;  2R25 A;  1LE2 A;  4CX9 A;  5L0H A;  2QY9 A;  2YLG A;  3ZTM A;  4EKW A;  1JRA A;  1A7D A;  1TWC A;  2CCY A;  1NFN A;  1YYJ A;  3OWT A;  1TWH A;  3PCV A;  2J9B A;  4IWB A;  3U2M A;  4OD4 A;  1ZW3 A;  3S9O A;  2DYS C;  2J8W A;  2C04 A;  2JD3 A;  2P61 A;  1FTS A;  2VCA A;  1CGO A;  3H2U A;  3N0T A;  5AGF A;  2YLD A;  4C7O B;  3VAY A;  3TQO A;  3EGX A;  3AQB A;  1QSP A;  4OIN F;  4HFF B;  3QW0 A;  2A1D D; 
#chains in the Genus database with same CATH homology
 256B A;  3HNJ A;  4D4N A;  4N6H A;  5JRA A;  4CDV A;  1E86 A;  2XLM A;  1BBH A;  3HNK A;  4IAQ A;  2XLE A;  1CPR A;  3HNI A;  4WGY A;  4ER9 A;  2XLW A;  4JEB A;  1YZC A;  3HNL A;  1YZA A;  1E84 A;  4EIY A;  3NMK A;  1YYX A;  3FOO A;  3L1M A;  4IAR A;  3U8P A;  1E83 A;  1E85 A;  2XLV A;  5JP7 A;  1S05 A;  3FOP A;  1RCP A;  3TOM A;  1NBB A;  4U9E A;  4NC3 A;  4IB4 A;  4CIP A;  3TOL A;  2XL6 A;  2XM0 A;  5JVE A;  2BC5 A;  3ZQY A;  1EKY A;  3NMJ A;  4JKV A;  3ZTZ A;  5B3I A;  2XLH A;  3M79 A;  1QPU A;  2QLA A;  4JE9 A;  1MQV A;  3M15 A;  3QVZ A;  2XLO A;  3C63 A;  5JLI A;  3QW1 A;  2YL7 A;  2XL8 A;  3M4B A;  1APC A;  1JAF A;  3QVY A;  4CDA A;  4WGZ A;  2XM4 A;  3M4C A;  3ZWI A;  4CJG A;  1GQA A;  4ULV A;  3NMI A;  5JUA A;  3DE9 A;  5JSL A;  3IQ6 A;  3IQ5 A;  2YL3 A;  3DE8 A;  3C62 A;  4D4X A;  4L6R A;  2YL0 A;  1QQ3 A;  3VRC A;  4U9D A;  5JT4 A;  4CJO A;  2XLD A;  1A7V A;  4CX9 A;  2YLG A;  3ZTM A;  2YLI A;  1LM3 B;  2CCY A;  1YYJ A;  2J9B A;  1M6T A;  4N4W A;  5JS5 A;  4CDY A;  2J8W A;  1CPQ A;  3ZQV A;  5AGF A;  1CGO A;  2YLD A;  1CGN A;  2YL1 A;  3QW0 A;  2YKZ A;  4JEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...