2PX0A

Crystal structure of flhf complexed with gmppnp/mg(2+)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
258
Chain Sequence
b'PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
molecule tags Biosynthetic protein
source organism Bacillus subtilis
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
total genus 78
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px0A02
2A2ZA 4C0BA 2IF0A 4PPQA 4LJ9A 4D6PA 5FFMA 3GFTA 4MKIA 1MR3F 3DOEA 1M7GA 4JMPA 5EXTA 2OBMA 4KITB 4A36A 1DAEA 2P6UA 5G40A 1N6HA 2PH1A 2ZAMA 5KDDA 1GKYA 2Q21A 4EQ6A 2Z83A 4MDEA 5J40A 4ASUA 4G01B 3J81k 2WHXA 1KDRA 1CR0A 4PHTA 3TMKA 1T3LA 1L4YA 4PC7A 3T34A 2XITA 4FMCF 1N6RA 2P67A 3K9GA 2FH5B 3EA5A 4CEJB 4NCJA 1GL9B 4GOXA 4DDUA 4Z1MA 4POAA 3REFA 4F4IA 4EFMA 3F3YA 3ZZUA 4I4LA 1AGPA 4F7WA 1CF4A 1U9IC 1BYUA 1KI4A 3IO5A 3Q3JB 1EGAA 4JBYA 4QM6A 1DG3A 1IBRA 2GVZC 3SQXA 2HYDA 4LC1A 3EXAA 4IXNA 1ZBDA 3VR2A 2ZUCA 3K0FA 4JLNA 2ONJA 5LD2B 3KQUA 4LDJA 2C77A 2ZR0A 4IVQA 4PPFA 2EQBA 2EFDB 3UMSA 1R5OA 5GJCA 1GNRA 4NYIR 3UMFA 1UDWA 5FTLA 3N2EA 2YOGA 2ZRPA 3QEOA 1EXMA 1GFIA 5L3SA 2A78A 1M7HA 4JVMA 5DO9A 3GJ3A 4URXR 5BWMA 4LV5B 2QAGB 4NTZA 1JBKA 1ZNWA 1ZINA 5KUTA 4TMTA 1KY3A 2QL6A 2R6AA 4LHYA 3RRYA 3BORA 2ZJAA 4C7OA 1P60A 3AGPA 4ILEA 3QUSA 3K0SA 1GOTA 3U4QA 1SVLA 1JR6A 1Z28A 1VG1A 3F5FA 3KXKA 1W36C 1Z22A 1L2TA 4QBIA 2JIZD 5B64A 2RGNA 3ZVRA 4AK9A 2RHDA 1ZM4A 5EE9A 4OQLA 1R0XA 1G3IA 4MKGA 2WKQA 3B78A 5GVRA 1J8YF 4Q7JB 5G53C 5IDVA 3U5ZB 1ZMXA 4RJLA 1Z5ZA 2BMFA 4HUTA 3W3AA 4TMKA 5SZKB 4CEHA 1OXSC 2J46A 1JEDA 4ACBA 2RGBA 1G4UR 5TDHA 4KFUA 2C98A 3RC3A 3CNLA 3X2SA 4IDHA 1SKQA 1DAIA 1YVDA 2V7QD 1AGRA 2OUKA 3CNOA 4NCKA 4NCIA 1UADA 1Z0FA 4P4SB 1WB9A 4KSCA 4B3FX 1L4UA 3CX6A 1HH4A 1US8A 2V6IA 4HDCA 1HURA 3ADCA 3MWLA 4JJKA 1IJEA 3SBDA 4MRRA 4B32A 3KKPA 2REXB 3SHFA 4DSOA 1GL7A 1XPOA 1WF3A 1J2JA 4LYHA 4WOPA 3GEHA 2ZI6A 5JCPA 4H9GA 3WYAA 5F9HA 4BLPA 5UKDA 4NONA 4IOLA 4P33A 3IILA 4D4MA 3TR5A 4K46A 5DISB 1FPMA 3T06B 3LV8A 1X1SA 5G3YA 5J4KA 1OHHD 2J0UA 3PR1A 4Q1BA 2GF0A 2OILA 3NBZC 4QL3A 3OE7A 5JFGA 5GJVC 3FE2A 1V5WA 3AH8A 2IXEA 1ZU4A 3K70D 1E96A 2YWGA 5AUOB 1D2NA 1Z3IX 2QTFA 1JXOA 3VMFA 1CRQA 3CO5A 2QZ4A 3Q9LA 1AKYA 4RZ2A 3K0AA 1IAQA 1G17A 4WW0A 3ZS8A 1PUJA 2J0SA 2YJTD 1B23P 4DDTA 2F43A 3WBJA 1RPZA 2EFGA 2BEKA 2NO1A 1Z6XA 1XXHB 2J41A 2ORIA 5EXXA 1E2FA 4OHYA 1VHTA 2FNAA 3VX4A 4EFLA 1E2PA 4QM7A 2IUTA 1FZQA 2Q9CA 4OHWA 4XD7D 1VTKA 3BB3A 2QNRA 2ZJOA 1UBEA 4F91B 1T91A 2B8TA 4IXMA 4P31A 5L3RA 2HT1A 2YOFA 4G5SA 4DCTA 1NG9A 4NDZA 1T4GA 2KB0A 1NMYA 2PT5A 4AKGA 4AYXA 1OE0A 1ZNYA 4LHWA 3P4XA 1IQPA 1NBMA 4I99A 4ZV4A 3RNLA 4Q21A 1Q0UA 1G3MA 2F7SA 5DYIA 4BLOA 3TW4A 1E69A 1NMXA 3UG6A 3WXMA 2IC5A 3LW8A 2GCOB 4DLXA 2WPDA 4US2R 3P20A 2W6ID 1QVAA 2LKDA 4QGAA 1MV5A 1VIYA 1XCPA 4WAUA 3U3KA 3SBEA 5L8VA 4W5HA 3TBKA 2Q3MA 1E2GA 4FWIB 3QENA 5M04A 1U8ZA 2G9NA 4XTRA 2OAQ1 5HR5A 4A82A 2YHSA 4TT3D 1QHYA 2VF7A 4E09A 1N5KA 5KSZA 3KQNA 4ZCIA 3AVXA 1AS0A 4CT5A 2JLVA 1E2IA 1OT3A 1HEIA 4IVRA 2FX3A 3LBNA 2W58A 4S35A 3OFND 3KQHA 1CJUC 1HV8A 2QTHA 1X6VA 4HAUA 3ND9A 2D2EA 2GKSA 2J7PA 4Q7LA 1GRNA 2AWOA 2GTPA 1Z6AA 4JLMA 3Q85A 4YC7A 1KNQA 3L0SA 1XEFA 2DFKB 4CYMA 1BKDR 2JLRA 4LJ7A 2RGAA 5IRCD 2DPXA 1CTQA 2RKOA 1SXJA 3UG7A 1YR7A 3AUYA 3U7EB 1ZM7A 4BECA 1NRJB 3L0IB 4AWXA 2OV2A 2QA5A 3GEIA 4QG7A 1EFRA 4OQFA 2FSGA 2V54A 2GJSA 5EP4A 1KI8A 1ONBA 4OHZA 2D3WA 3GLFB 3BJIC 5FBLB 4PO9A 4OBEA 4PPNA 1XB2A 4MYHA 1AIPA 1CKEA 1RRFA 1W48A 4JT4A 2UZ3A 3RWOA 3M6AA 2HYIC 2J9RA 1XTIA 1I4LD 3K09C 2KE5A 4IW3B 1BIFA 4RSGA 2IHBA 5LB2A 4DVGA 4PZLA 3NDPA 3Q7PA 2WJHA 4D80A 1EFUA 1W4BA 2P6NA 2IK8A 1LF5A 4JL8A 3L0PA 1YQTA 1XMSA 4KYIB 2PCLA 1WBDA 3A6PC 2QTVB 2AD5A 3BH6A 3T5DA 2OZEA 1G8PA 4QC2A 1G16A 1YE8A 5L3QA 4NH0A 3Q7QA 4BZQA 1T3SA 3UK6A 1MRSA 1XRJA 4A6PA 4A0RA 4JVNA 4DJTA 3QSYA 2FF7A 4Q4AA 3K1JA 4F38A 2NO6A 1A2KC 2ZR9A 2RAPA 3BB1A 4HUQA 4B2IA 4C0HA 2QQEA 4B75A 1NBME 1LF0A 5CITA 3EZ2A 3FFAA 5FL7A 2JLYA 4WXPA 4MGIR 5AJXA 1DTSA 1WRBA 4KSBA 1E2LA 1FNMA 1FNNA 2GXUA 3VTKA 1TF5A 3C14C 5BQ5A 3BRWD 4MYCA 3N2IA 1SZPA 3L0OA 4QHTA 3PEWA 4M1KA 3AP2A 3QG1A 3RRMA 4B76A 2VP6A 5GVSA 2GXSA 2AWNA 1NVXQ 821PA 4Q47A 2QBYB 4AC9A 3PQCA 2ZRNA 4O2LA 1R0YA 5E95A 1ZUIA 1DEKA 1YRAA 3QF4B 1UAAA 1DAMA 4QBFA 1U81A 1P73A 1ZP6A 1PLKA 2ZRLA 5AJZA 4GI7A 2DCUA 4A4DA 1N5LA 1U0HC 2ZJYA 1BYIA 5EXSA 5EE1A 5IK2D 3I62A 5KTYA 3E5HA 1XDBA 3CLVA 3BK7A 2ZE6A 2PLFA 1XF9A 1Z08A 4GMXA 4ZDWA 4HAZA 3DL0A 1GSIA 4MQBA 1DPFA 2A5FA 3QG5A 1Z07A 3THYB 3IDQA 1G8HA 2NZJA 2G0TA 1KO1A 2O0JA 4ASUD 1N6LA 1GTVA 3A58B 4ZKDA 5JS8A 1EFTA 4L9WA 1WE2A 3TLXA 2NQ2C 2RGCA 4MGKR 5KOYA 3QE0A 4LZZA 4EKDA 2OO7A 1RRPA 5EZ5A 4LPSA 5KHOC 3AVQA 1CJMA 2GESA 4C4PA 3K9LA 3PIRA 3EWSA 1VYTA 2CK3D 4BZPA 2DFTA 3VNVA 1MOZA 4KFRA 4TLDA 4WZAE 2AXNA 3SNHA 3VR1A 2QAGA 3CRMA 3IBYA 1KK3A 1Z29A 2C9OA 2JIZA 2J7PD 2P5SA 1BMFA 2RB4A 2ZRCA 2CL0X 1EWRA 3WNDA 4M8NE 2JJ8A 4MH0R 5C1BA 3MJRA 2O8EB 1NSFA 3CNNA 2ZTSA 1HQCA 4Q9KA 1F48A 4TTRA 2N42A 4A8JC 4US1R 2QG6A 1IXSB 2ZRDA 3K9NA 4KBFA 2HLDD 2VQSA 3I4LA 4E07A 1XCMA 2F1RA 3T15A 4EFNA 4JSTA 1KSHA 4DLYA 2C5LA 1QG4A 2G88A 3RAPR 2IL1A 2OAP1 2KSQA 221PA 2D7CA 5CYOA 4LBVA 3N5CA 3C8UA 2O8DA 1IXRC 2JJ2A 4KVAA 1GNQA 1SVMA 5BYJA 1W4RA 1R7RA 3EX7C 4JT2A 1VPLA 1G9XA 2WVJA 3EAQA 1OJLA 2ERXA 1CRPA 1BH2A 1KIMA 4Q1CA 2FFAA 3SS8A 421PA 4EJSB 4C2UA 2X1VA 4RKFA 4I1VA 1XBTA 4RD6A 3O8DA 3H1TA 3A4LA 1G291 1R4AA 3SJCA 4E03A 4B74A 3HR7A 1KKLA 1G4AE 2V6JA 4M9SA 4QGHA 3KJGA 3GQBA 3PV0A 1JECA 1Y63A 5EUQB 4D2IA 1A82A 2WWYA 4C0QC 1DAFA 2ZJ2A 2QMOA 3L2OB 5AJWA 2AK2A 3KXLA 4LPKA 5DGXA 2ZSEA 5F3WB 1XFAA 4YXWA 4NYIQ 3NC1C 5D3QA 1YR9A 4O0MA 1LW7A 2AK3A 4O2RA 1NY6A 1E9BA 2W2TA 1E2NA 4PC3A 3U7FB 2XGJA 3VR4A 5B30A 2ZRKA 1JJVA 3WP1B 1OIXA 2OBNA 1ZU5A 2PZGA 3NHBA 3OFNA 1TEVA 3T61A 1FL9A 4FMCB 1MT0A 1YHNA 2R62A 3MG9A 4IDPA 2F3RA 2ODNA 4RFSB 3LVQE 1ZCAA 4NMMA 4RY2A 4KI0A 2JEOA 5E7IA 1E9RA 3KUDA 3M1IA 3U6KA 2JCSA 2BOVA 4ZCMA 3WMFA 2XJ4A 2C04A 5DYGA 1S96A 4HB0A 3NH9A 4C7OB 2IEZA 2W6IA 3I5YA 1Z0IA 2AKAB 4NYJR 3ZQ6A 2GK7A 4NL4H 2GAOA 4PANA 5AJYA 1DO0A 2YNMA 3DPUA 4LBWA 2FFBA 2Q0HA 2WWIA 3B6EA 4G1UC 4KO8A 4B35A 1SXJC 4UNSA 2FFHA 4V0ME 1KK1A 3QXJA 3PXGA 2VF8A 4Q4JB 2ZVQX 3RS5A 3DMNA 3MFYA 3Q5EA 1E2EA 4RD1A 1DVRA 1SHKA 1HYQA 1TF2A 1U94A 4DLWA 2YINC 1U8AA 2D4HA 2BC9A 1D8TA 3ZIAD 4M4SA 4UNPA 3AVOA 3PEUA 4RZXA 4RZ3A 4KLZA 3R9IA 3AKEA 5BXQC 2Z43A 3PUYA 1AN0A 2WWGA 3JZAA 3TUJC 5DNYB 1Q21A 1C9KA 1N6PA 1Q22A 2DWOA 4Y0VA 3QXHA 3OEHD 2CL6X 2KI5A 1XNJA 3FHOA 3SN6A 4A0GA 4Q9IA 5JWRA 4JZKA 4BQSA 3RVBA 4IDOA 1XMVA 5FBRB 3I32A 1YZTA 1K8RA 3NWJA 4V0LA 2MSEB 1WDTA 1H8EA 3EZ9A 1KZGB 2RMKA 2GCNA 4KBGA 3NHAA 3X1YA 1MO6A 3QOFA 3QKUA 1E0KA 3CUEF 1FTSA 1OXTA 2J5XA 1UBCA 5D3MA 5E4FA 3RANA 4YDHB 5K8IA 4TZ6A 2HUPA 3D31A 4KCGA 3ZDQA 1JEEA 1II0A 5C18A 3K70B 2BBSA 3GEEA 4RD3A 5AK0A 4W9MC 1DO2A 1NKTA 2QN6A 3HU3A 3QPVA 1XZQA 4GSYA 4J0QA 1OPXA 3IUYA 4GNKA 4RFVA 5EE3A 3V00A 2D7DA 1R6BX 2HJVA 3K0AB 3MLEA 4F4CA 5GJBA 1PZNA 3LFUA 1OH7A 4AIIA 2UVQA 4MRNA 4DLUA 1GRQA 3CM0A 2VO1A 1AK2A 1SULA 2QMUA 2P2LA 2ORWA 1E9EA 4ZI3A 5DSZA 3MWYW 4DT1B 3QXCA 5AR1A 2CHQA 1E9DA 2E1RA 1JR3D 4JJZA 1F5NA 2ZROA 5EP3A 3CRW1 5C4GB 1OFIA 4GL2A 1OB5A 5FR2A 1A1VA 4GZLA 1YZNA 4DLZA 1GM5A 3EZ6A 1T5LA 2F1JA 4MRPA 4LV8B 4G5GA 1S4QA 5CIWA 4DLRA 4AURA 3LQQA 2EYQA 4QNRA 2ZSAA 2O8FA 1Y3AA 5E7JA 4LJ6A 4HLCA 4LJYA 2IYUA 1Q1EA 2Q3HA 4PHFA 2W6JA 3SR0A 1Z06A 4TN1A 3SYNA 4QGFA 2C78A 2R6DA 3MJHA 1TQ2A 3TSOA 4LYJA 2ZSBA 4KVGA 2FSFA 4MRSA 1G3UA 4QNMA 1F2TB 3TVTA 4HUQB 4EPYA 2VP4A 3GP8A 2TMKA 3FPAA 2I3BA 3K8YA 3PUVA 4A2PA 1LVGA 1N5JA 3MWKA 2ZJ8A 5A5GA 5FR1A 2ZI3A 1S2MA 5DI9A 1ZNXA 3NC0C 5EP2A 3THXB 3AF3A 2NMVA 2QY9A 1ANKA 4JLAA 2ZRAA 2Z4RA 4JLVA 4C2TA 4W7SA 1MO5A 2AFHE 4B6FA 2WWFA 2NG1A 3CR7A 2BJWA 4R7ZA 2PLRA 4ZPXA 4OI0A 5K8LA 2J7KA 3BOSA 4F92B 3AKDA 1NVUQ 4W5WA 4URVR 1BO6A 1G6HA 1OLOA 1D5CA 3A1SA 3EIEA 4GBMA 2QRNA 1X3SA 1E9SA 2VSFA 3D3QA 5JHGB 1Z6GA 1Q57A 2PL3A 2WWHA 4JLBA 3GLFA 2OXCA 4TSFA 3B1ZA 2CE7A 1P62B 2XZPA 1SHZA 2REOA 4ABYA 5J4HA 1RRCA 3AKYA 3THYA 4KFTA 2JGNA 2K5UA 121PA 4Q01A 3VKHA 4OQMA 4HLUC 1KY2A 2F1HA 1US8B 3CRRA 1KMHA 2C99A 3B9QA 3HU2A 3WRYC 1LS6A 1F3OA 2OEPA 4XH9B 3DM9B 2QSZA 3PITA 4IDQA 3S1AA 1J70A 4ITRC 3OEHA 5JJLA 5DE3A 1XD9A 2FN4A 3AF4A 4PQYA 2JLXA 1TADA 1U8YA 1YJ5A 2B6HA 3SYLA 2O0KA 5JBQA 1TAGA 2G83A 1XTSA 1K5GA 4MUBA 3CRVA 4BEJA 2H18A 2BCGY 4E5UA 4L16A 2HXYA 3OZXA 2G77B 2UKDA 3RDPA 2EWVA 4Q1DA 1ODFA 1EX7A 2J0UB 3KB2A 1J99A 5IT5A 4XJXA 5DI3A 5L3SB 1XD2A 4DZZA 1KGDA 2ERYA 2CNWD 2CMKA 4PSVA 1XWIA 2RGDA 1G7RA 2DYKA 1Z63A 1CJVC 1Z0AA 1Q1ZA 2AL7A 2R2AA 2VRWA 1DS6A 4L4UA 2NO9A 3ADKA 3U4QB 1NN1A 2OT3B 1FMJA 3EPHA 3DEFA 2ZQ5A 2VH5R 3IQWA 1NN5A 4MITA 5FOWA 5FTKA 3VHXA 3T5GA 1YZLA 2OCBA 2AN9A 3CF2A 1S1MA 3QF4A 4S2EA 4D0GA 1O87A 2ZVPX 2G1KA 1YZQA 2IYZA 4NHOA 3VR6A 3CONA 5ELXA 4EJSC 1NY5A 4HAYA 2BVNA 4R98A 4CEHB 1EFHA 3KKQA 3PJRA 2GWHA 2V1XA 3OE7D 4A2QA 5JSZB 4M21A 2QP4A 2VPPA 1P5ZB 3P32A 2BV3A 1XJCA 1LFDB 3E2IA 4ZIRA 3QIAA 1JB1A 5CK4A 4CEIA 4HATA 1ZM9A 1RVDA 2PBRA 4RCZA 5F98A 2D2FA 2OXRA 2WJYA 3P26A 4D81A 4TLBA 2ZYTX 3BB4A 2GZDA 2XXAB 1KTVA 4A8JB 1P2UA 3CW2A 1YKSA 2NIPA 4EPVA 2R8RA 1VECA 2ZRFA 2I1QA 4DKXA 2XB2A 3M4YA 5FUYA 4Z8YA 3DDCA 2XTMA 1MABB 1T0JB 1NP6A 1UFQA 3LWNA 4B73A 5EJEA 1GILA 1NIPA 3AP1A 5C2JB 4L9SA 5AWFC 1GL6A 1N6IA 1PLJA 3SQWA 5B2ZA 3GLIE 2YWEA 4PFSA 1IY1A 4HLQB 2C9YA 4XD7A 1E9AA 1QHHB 4LGMA 2XNSA 1JPJA 3A1WA 2FSIA 3SOPA 3W6NA 2G6BA 2FDCA 4Q9JA 5P21A 1JAIA 3OIWA 4L8GA 4LY6A 3LX8A 2W0MA 3QQ5A 2FA9A 2H57A 1KI6B 2IXGA 2IYYA 4JLKA 2QU8A 1LV7A 4DBLC 2Q6TA 4FCVA 2C9CA 2VHCA 3EASA 1RIFA 4C30A 2O8DB 1TPZA 3L8YA 4PPGA 3PEYA 1TUIA 3OHMA 4B2PA 3SFZA 1S3GA 5CYPA 3K70C 1QZXA 3FMPB 3C41J 2P6RA 2ZI9A 3SI7A 3FWYA 4BGDA 4AKHA 1H8HA 3BAFA 3R8CA 1VYVA 2EU8A 2QMHA 3AVPA 5HE8A 1PUIA 4LHVA 2O5VA 2WWXA 5FUXA 4PC1A 4LC0A 2O0HA 2CVFA 3B1YA 4V02A 1NVVQ 4URYR 4HAWA 4A0FA 2BHRA 3C15C 1N3BA 3DZ8A 1KHTA 1XTJA 4XWKA 4OQXA 1LY1A 3GJXC 2XX3A 1XP8A 1ZJ6A 3E1SA 3QF7A 5FOSA 3GLFE 3ZD7A 4GP6A 1GRRA 4YQFA 3EIHA 4QJ5A 1N0UA 5JI3E 5KSPA 1OFUX 3TH5A 2DB3A 4M1OA 4WZBE 2EYUA 1J8MF 3MAAC 1KSGA 1N0WA 3BH0A 1AA9A 4KJZA 1LB1B 4DXAA 3QNUA 2OCAA 5TVKA 1QDEA 2DHRA 4UXJA 4BFWA 3KKOA 5FOTA 2ZRHA 3U6BA 4Q48A 5A0FA 5KPDA 2NZ8A 1M8PA 2FZ4A 3CX8A 4TQUS 4Q9LA 3VU9B 4ZCLA 4K81B 3CB4A 4JBXA 5IK2A 2GBLC 2A7QA 1E0SA 5FI1B 1KO5A 4Z1MD 5IHPA 1VHLA 3L82B 2ANCA 2B7BA 3V4FA 1D2MA 1F2UB 1NF3A 3QPUA 2MSCB 3THWB 2ZU0C 1DELA 3QXSA 1YR6A 2ODEA 1J90A 2G1JA 3OIVA 3W5IA 2KWIA 1KO8A 1JNYA 1W2HA 1CJKC 1IN6A 1QHXA 2REBA 4IKEA 4XIGS 2YKGA 4A92A 1CR4A 1GNPA 8OHMA 4HAVA 2YYZA 2X2EA 2F6RA 3CRQA 4JYCA 3FMFA 1NLFA 2GJKA 2PX3A 1E99A 2BBOA 5CDFE 4TMVA 3I8SA 1N6NA 3ICEA 4M9QA 2HCBA 3CWQA 4Q4JA 3NG1A 3GMTA 4NCHA 4QJ4A 5EE0A 5KU1A 2JLZA 3ADDA 1EESA 1VYUA 1SQ5A 2ZANA 3CIOA 2WKPA 3EARA 3W5JA 5CB6A 4NP6A 1COWD 3MSXA 3SE0A 4N1AA 4UXIA 2N46A 5J4YA 2J3EA 4IOMA 5FH9A 3R9WA 3HYTA 4M0LA 4C0JA 1W0JD 4FCWA 3H0KA 4HB4A 4WVFA 4C0LA 4U5XA 2ZXUA 4FINA 3Q72A 4DCNA 1NJGA 3LVRE 2F55A 3GJ8A 3K53A 4BFTA 4AG6A 1W2GA 4A1FA 2Q3FA 4GOJA 1L7VC 5LB4A 2V1UA 5AUPB 5EQTA 1FTNA 4BLSA 2FU5C 2W2VA 3OEED 3U3OA 2FEOA 4TQAA 4D82A 1Z0DA 2CVHA 1JAHA 2O8BA 2I1VB 2FJUA 3LXRA 2O8EA 4NCNA 3IPXA 2DBYA 4URZR 1E1QA 4II7A 1Z8FA 1P9RA 2FWRA 3MUFA 3VKWA 1COWA 2IWHA 4M2LA 4DEXA 4R71A 2XTZA 3D7MA 1TTTA 1AJEA 1IONA 1R0ZA 3EZFA 1U0JA 2GRJA 3VR5A 3IKJA 2HJGA 3DVLA 2ASEA 1XEXA 4A0HA 3DKVA 4XVQA 1A5TA 1UF9A 2GXAA 2VHJA 1KSJA 1E2QA 1R8QA 4NPHA 1Z2CA 1QHIA 2A5JA 4DEYA 1M1YE 3HWSA 1GITA 1NG1A 2EFEB 4PC2A 1NN3A 2FSHA 3MGCA 3WY9A 4G5QA 1CXZA 1ZIOA 2BBTA 2YV5A 1EX6A 1FW6A 1R0WA 2EFHB 3OAAD 1JALA 5EUMA 4GP7A 4M53A 4ZDJA 4IVPA 1G6OA 1KK0A 2V9PA 2RGNC 3KKMA 1G7CA 1OXVA 1G5TA 2BKUA 2RGXA 2C95A 3BIFA 4UJ3A 2EWWA 1QHGA 1Z47A 1NIJA 3M0EA 3U60B 5KYKA 4V0OA 1G7SA 1E79A 1SVSA 1G7TA 1SVOA 3KZ1E 1HY3A 3AVWA 1GKUB 3REGA 4KODA 1KO7A 2NGRA 3S1AB 4HI0E 2XB4A 1IJFA 2BJVA 5FL3A 2Q9AA 1ESMA 5FI0B 3VKGA 1XCGB 3KJHA 3BERA 4EIWA 4CVNA 4TL8A 1RRGA 1P72A 1VCNA 1TEXA 2R6FA 2FPKA 4RCYA 2WTUA 4TYPA 1OFHA 4QHSA 2X77A 3LY5A 3VX3A 1KNXA 1VKJA 3RYTC 3B13B 3TAUA 2VTKA 3W8RA 1CLUA 1Q3HA 5DI3B 3WNBA 1F2TA 2QENA 3AGQA 3R9XA 4PQRA 1C4OA 4I1UA 1NLYA 4AD8A 1KSFX 4M1TA 1JPNA 2IW3A 4YMWA 2PJRA 5FBVB 1QRAA 1P9WA 3B7GA 4C3ZA 4UNNA 1DAHA 3QBTA 2OLKA 1RYHA 4FMBB 1GVNB 2QT0A 1II8A 3GJ5A 2QGNA 4BFXA 4DCVA 4JLPA 4UJ5A 2JLSA 4A9AA 2ZS9A 1H8ED 2JLWA 4V0MA 3DM5A 3GLIA 1WBBA 3FKSA 4PAOA 2CLDX 4XSHA 4DC9A 2C2HA 2QSYA 3A8TA 4C0SA 5CJ2A 2ZRMA 3DOFA 2LCFA 4LCBA 1WXQA 1W49A 1AS2A 4IEIA 4A2WA 1Q20A 3BBPA 1XEWX 3PCRB 3FMOB 4U7DA 4HDQB 2C03A 1HUQA 4JL6A 4LJ4A 5CK5A 1Z0KA 4OJKA 2FFQA 4QOSA 4B3XA 4WZ6A 3LLUA 2FGKA 2WAYA 4HDOB 1W44A 4MRVA 1M2OB 2KBEA 5TY0A 3TSZA 3KTAB 1PLLA 4GMDA 3FMIA 2ZIAA 1FQJA 4OHXA 4DSTA 4P3YA 4LYFA 2IYXA 1KJWA 1IN4A 2FEMA 3QPWA 3QVUA 2GDJA 1R10A 4BFZA 4D4JA 3RHFA 2MMCA 3H4MA 1S9DA 2O52A 4B2LA 2QM7A 4Q03A 3VNUA 1KDTA 5KPJA 2F3TA 4JL5A 4A8JA 4PXAA 5K8TA 5HPYB 1W36B 1VG0B 4FWTA 3CPHA 3IO3A 4TQ9A 3G82C 1LS1A 5SZJA 3EWAA 1G8YA 4B48A 3O8CA 3A1UA 1OSNA 5DHFA 2PJZA 1E2MA 4JVLA 1UKZA 1OKKD 2VP0A 2DFNA 2MSDB 3LA6A 4PQFA 4ZDKA 2QAGC 1TL7C 1X1RA 3IIJA 2A9KA 4DSNA 1E6CA 1VG8A 2WBLC 5CLQA 2ZJ5A 4V0KA 3RRZA 5H8WA 4FN5A 5D3MB 4ZDIA 4MYTA 1E0AA 2QRZA 4TMZA 1GIAA 1XD2B 4HLUA 4TL7A 1M6NA 1AQUA 1XTKA 3FB4A 1HT1E 3OIUA 4V03A 3AB3A 3NEYA 1KI9A 4MKHA 1KI6A 5TARA 3KDSE 4G0NA 5LD2C 2JDID 2WMOB 5HCIA 1QG2A 4XWAA 1RJ9B 1JR3A 4BFSA 3FKQA 4O25A 2AXPA 3ND8A 1YZUA 2WJIA 3LH5A 3SU8A 4G5OA 4B43A 1KDOA 4WXRA 4PSAA 3IHWA 3EPLA 3ZIAA 2GF9A 2AKYA 2RGEA 1VDZA 4Q19A 2ZPTX 5JCZA 2X2FA 3IIMA 2WAXA 1F60A 5FPYA 2XJ9A 1WQ1R 5KDLA 3T1OA 3BFXA 3O8BA 5FPTA 4XOIA 5HE9A 2J0QA 1BOFA 1W0KD 2IT1A 4L5BA 4ZO4A 1E2DA 2PZFA 3X1WA 3MD0A 2OCYC 4NKRA 4EPXA 3RWMB 2J0VA 1F6BA 3KJIA 3X1DA 2ZEJA 6Q21A 1P75A 4N3NA 2EW1A 3CBQA 3IBGA 4PAQA 1SXJD 4TTQA 1AZSC 4UKDA 1MO3A 4DCSA 2CJWB 3EC1A 3EZ7A 1BMFD 5F9FA 3I92A 4D26A 4BLRA 4D25A 2JATA 2W2XA 5IF9A 3K0CA 3KQLA 3U7HB 4LK2A 2JDIA 1MRNA 1GUAA 4LJ5A 2BBWA 3U3JA 1W46A 3WRXC 2FZLA 4GZMA 4I1OA 4Q4HA 5E7MA 3QJYA 1YU9A 1ZM2A 3W3ZB 1TNDA 1JQLB 1F2UA 1ZIPA 5FTMA 1E9CA 4M9ZA 3WMEA 2A3RA 2PMKA 1P4SA 4WIAA 1Q3TA 2CLCX 4RD0A 2A5GA 4TL9A 3I1FA 2IYVA 2A5DA 4U00A 1JI0A 4BFVA 1G21E 1VCIA 4CIDA 2YC2C 3ZH9B 4URWR 2IS1A 5E3HA 2ZI7A 1YR8A 1KK2A 1MKYA 1G1MA 1G41A 3GLHE 2F1IA 3NH6A 2ONKA 3KB1A 1KO4A 1VIAA 3K0EA 3UIEA 1WCV1 3GLGA 2B21A 2HF8A 4TMXA 4HZUB 3SYKA 5JRJA 2H1LA 1U0LA 2FPLA 4OK6A 4P0TA 4PSKA 3AVUA 1KOFA 3EG5A 3ZVMA 2NOAA 4BWYA 3B60A 2XZOA 1E1QD 2AD1A 2Y8EA 4FW9A 5JEEA 1Z6TA 4AI6A 2VHTA 1II9A 1NL3A 4DT1A 4QHYA 2HT6A 2CXXA 1CIPA 1GAJA 1W0JA 4I1SA 4ON9A 4TLCA 2VP9A 2FV8A 1X8JA 2IYTA 1DARA 3GJ0A 4DRZA 5KSOA 4L15A 2AR7A 2W0SA 1MO4A 3LX5A 3U61B 2JJ2D 5JJIA 3ASYA 1W4CA 4TYQA 4JLDA 1FQKA 2JA1A 1HE8B 1UKVY 4F4JA 2CNWA 3ADBA 2E87A 1AS3A 4FMDB 4X8HA 1PV4A 2WSSA 2GNOA 3LNCA 3VFDA 3RS4A 4DLTA 4E22A 3CKLA 4C9BA 2O8FB 2ZRGA 3TRFA 1P3JA 2NTYC 2ZR7A 1CJTC 4MKFA 3TUIC 2B7CA 3C16C 2PX0A 2ZJBA 1RE0A 3R7WB 5KSYA 2QQ0A 1Q1BA 5KDOA 3EC2A 3D6TB 1OFTA 5EE5B 4B33A 3V4RA 5FBWB 5HZHA 2J45A 3TVDA 3JVUA 2FG5A 3RS0A 4RFSA 1G5PA 2VSOA 3KFXA 5ANRB 4Q9HA 4D0LB 4FXPA 1VCOA 2XNDD 1XEXB 3BFKA 2V3CC 1OV4A 3N70A 5FBQB 3T35A 3ZLJA 3A37A 2H8KA 4PHGA 2GJ8A 3BD9A 3QEJA 2WSMA 1NVWQ 3FOZA 4BZXA 5FOVA 4PR0A 3AUXA 4EQ6B 4LOAA 2GHIA 2XSZD 4PAMA 5H68A 4DUGD 4MDFA 2JLQA 2CL7X 2WICA 1XMJA 3SC3A 1FX0A 1UEJA 3FDIA 3HDTA 2H16A 4Q00A 1E3MA 3QVVA 5FOXA 1NJFA 2GEVA 3PG5A 1KYIA 4DLVA 2AHOA 3PEVA 4IFBA 1N6OA 2QT1A 3VR3A 3C5CA 1M74A 4OK3A 4M1MA 4OJQA 2RH5A 4ZIRB 2ORVA 2PZEA 621PA 4Q1FA 3B8HA 4CDGA 2GAAA 3CPEA 1S3SA 2XSZA 2H92A 5BN4A 3IPYA 2OE2A 4YONB 4BEBA 3K0FB 2ATXA 2CCKA 2BMEA 4HEJA 1U98A 4UNQA 1TU4A 3HPQA 1P7CA 2DWPA 5AUQA 5BN5A 4UXHA 1KMHB 2JLUA 2P65A 3KL4A 5EXPA 4EUNA 4Q1AA 1E2JA 2CHGA 1M34E 1NVVR 2XAUA 1VCMA 2ODBA 2ZS8A 1RC8A 3W6OA 4M1YA 4BRWA 1D6JA 2PT7A 2QEQA 3TQFA 4D4LA 2P0EA 1KI3A 1MABA 3EPJA 1E4YA 4QFMA 4BLQA 5EP1A 1G3RA 4TT3A 3UATA 3QBVA 3AVTA 3C7KA 4XSGA 2J87A 1IOZA 3FGNA 5JHHB 2ZI5A 5GJWC 3H2YA 5DLQC 3DMDA 4R9UC 3TIFA 3RABA 4ERNA 1E98A 4BLTA 4QKQA 1QHHA 2O8BB 2QPAA 2ZJZA 3QKSB 1LTQA 2OBLA 3Q5DA 4UNRA 4YMSA 5KO2A 3E70C 4RZUA 4KHZA 4R2IA 1FOEB 3CR8A 4LYAA 3ZS9A 3B1VA 1ZD8A 3U3MA 2V55B 4NYMQ 3C4JA 2F9MA 1CULC 1DBSA 4PTLA 4F93B 1DAGA 4H1UA 1ZAKA 1A7JA 3KQKA 2A5YB 4ARZA 1JR3E 2ZS7A 3JVVA 3ZZTA 2Z0MA 2F9LA 3SFVA 1ETUA 2ZSFA 1NBMD 5BN3A 1N6KA 2RCNA 5CB8A 4HLDA 1QHNA 2YZ2A 5J4VA 3CPJB 2WOJA 1WP9A 4MGZR 2ODWA 1T8UA 4OQNA 3SJBA 2IA5A 3GJ6A 4QBHA 3BXZA 3RC8A 4CEJA 4RVCA 1B0UA 2OSBA 3CZPA 3LRPA 3BWDD 3GLHA 3ASZA 3IGFA 4P4SA 1GKIA 4Q18A 4EAQA 5JSZA 1R5BA 2XNDA 3WP0A 3ETLA 2BWJA 4Z54A 1OH6A 1U90A 2JJ1D 1H65A 2H7VA 4IOJA 5DN6D 4DB4A 2NO0A 1Q1QA 2VSXA 4GPTA 2V8OA 5FL7D 4CEIB 1XEWY 1CEEA 3ICQB 4AYWA 2QM8A 2R44A 3GPLA 3TR0A 2DFLA 4PX9A 1P2SA 3TW8B 1PJRA 2WJGA 1DG1G 4KV9A 2XXAA 2IX3A 3AF0A 2ZAOA 2YWHA 3AM1A 2VHUA 3CF6R 3TAHA 1W36D 1KAGA 3VU9A 1K5DA 1OYWA 3BS4A 5FTJA 4C0AC 1YRBA 1KI7A 4JLJA 3I73A 3BGWA 2IEYA 2J1LA 2J59A 4ZKEA 2FMXA 2BMDA 3UPUA 4Q5IA 1DAKA 3UWKA 4HSEA 1HQYE 4KLNA 3FFBA 4ZI2A 3C5HA 2YC4C 2V7QA 4YMUA 1OIVA 1T8TA 2B8WA 1W47A 3BC1A 2CEAA 5CDFA 1U9IA 3U2QA 3KXIA 2QE7D 5JZVA 4WBSA 1G5RA 5FUWA 4BASA 1E2HA 2R65A 1N5IA 2D06A 4N0EA 5TV2A 3R8FA 4PZYA 1GDDA 2BIFA 3LBIA 1I4TD 5CIQA 4GT1A 4DLSA 4DB2A 5HCNA 3LDAA 2HDNB 1K6MA 2BMJA 3THOA 1E4VA 2FE4A 3GLGE 1EWQA 4YDSA 2WIBA 1P2TA 3RSOA 2WJVA 2BKEA 1C1YA 4AG5A 3UWOA 1JXMA 3QY0A 4FCTA 3B82A 4DDWA 1ZNZA 1CP2A 4OI1A 2GEDA 3AKCA 3A4MA 3ECCA 2WKRA 1IY2A 3LXXA 4I81A 3PUZA 3FKSD 2ZE5A 1W1WA 1Q12A 4AKEA 4AYTA 3LLMA 2DWQA 1RYFA 3I3SR 5B57C 1KI2A 2C8VA 3QKRB 3KKNA 3K0CC 2XOKD 4LWZA 1GZSA 3FTQA 1BS1A 521PA 3CWZA 4UQOA 1SVIA 3QKTA 4AKIA 2JJ1A 4AY2A 4ESVA 5CM9C 3NXSA 4IEEA 2R6GA 1KAOA 4OK5A 1G19A 2OFXA 4IRUB 4LBYA 1AQYA 1S9HA 2ZUDA 3B5JA 2GCPA 4RD4A 2OFWA 1OHHA 1SVWA 4B71A 5CM8B 2GVDC 3RLFA 5DHAA 1XD8A 4HYYA 1AKEA 4NYJQ 3W90A 3AVVA 3U44A 2KJQA 1T0HB 2EFCB 2IYQA 2O8CA 3CH5A 2HEIA 3HP1A 1JJ7A 3O8RA 1E1RA 4GRAA 1ZM3A 3EIQA 1CR1A 1P6XA 2DY1A 4Z51A 3HR8A 2ZITA 2BM0A 2GXQA 1KZ7B 1E79D 5FPHA 4PC6A 3B2EA 1TQDA 5B58C 3THWA 4DIDA 5FOUA 5J4LA 4TWZA 1RKBA 2OG2A 5HKKA 4HAXA 4OYHA 3GLGB 3G5UA 1OH5A 2OM2A 3W34A 4DUGA 2F43B 2A30A 3NTUA 3LW7A 1ZD1A 2ZYWX 4P4UA 4TMWA 1XXHA 2LKCA 3TUZC 1KKMA 5SZHB 4QRHA 1UPTA 3FYHA 4PO1A 4B47A 3NVAA 2BEJA 2CDNA 5FTNA 1TUEA 4FIDA 1KI1A 1TU3A 1KJYA 4HB3A 1N2CE 3L8ZA 2IS2A 3F0TA 1NSTA 3U3RA 3W8NA 2X8AA 2ZRJA 1EFCA 2FGJA 5GADl 3B1WA 2CK3A 4P32A 5CJPA 3UANA 4OI4A 1H8HD 1OYYA 4KYUA 3RS2A 5L3QB 1XJ0A 5JWHA 4DWJA 4MYUA 3BE4A 2GCOA 4QJ3A 2GZHA 1NKSA 2VEDA 1M7BA 4JYBA 1RFLA 3WBKA 1LNZA 4LV6A 3MCAA 3ZJYA 2IF2A 1IN7A 2XOKA 1XTQA 4Q4AB 3LD9A 2GETA 2VLIA 2ZI4A 4JKYA 2GJ9A 3OEEA 1W5SA 2RHMA 1E94E 2IYLD 5G41A 1FP6A 1KMQA 4KFSA 5J47A 1D9XA 4TYNA 3R20A 4NE2A 5JS7A 4Q4HB 3I72A 4Q4LA 3WHKA 1L8QA 4M22A 1I2MA 1II8B 3T1QA 1UKYA 2WPDD 2Z4SA 1FUUA 1OIWA 2HF9A 2QP3A 4RKEA 2PMDA 5JJKA 1FUKA 4US0R 3JZMA 2CCJA 2IYRA 2QGZA 1Z2AA 3LAWA 3QXXA 2QROA 2QBYA 5KNCA 3WYGA 3MWJA 3U7GA 5DH9A 4IHQA 2IUUA 1T9HA 3LO5A 4QXAA 5H1YA 4TYWA 1XTRA 3IEVA 4OHVA 3X1ZA 4EPRA 4YMVA 1CS4C 1IN5A 4Y0AA 1Z6YA 1QF9A 2X19A 3GCGA 4TYYA 4JKIA 4DHEA 5TB5A 3H84A 3WYFA 1SVKA 4EPTA 3OF5A 1JQJC 4HZUA 3CX7A 1SXJE 5FUVA 4PHHA 2HV8A 1ZRHA 3KTAA 1S0UA 3AF1A 5F2EA 3P4YA 3P1JA 2BCJQ 1TF7A 2ZSDA 3Q8XB 4D0NA 2IUSA 3TKLA 2G3YA 1I4DD 3W9YA 4Q7MB 4Q7KA 4JS0A 4EDHA 4JVSB 4WA7A 4BUJA 4M9XA 1E2KA 1R2QA 2IWRA 4X8LA 2ATVA 5EZ6B 4NU0A 4XTCS 3TQCA 1TQ6A 4JIMA 4TZ0A 4CRWB 4M1WA 1N25A 1XMIA 4BE7B 1TMKA 4TLEA 2GZAA 4ESHA 4JLOA 1CR2A 3OESA 2LWIA 3UXMA 3LBHA 5TXGA 2GEUA 3DKPA 3IIKA 3K9HA 4YXWD 4TSFD 1P2VA 5LPNA 2YWFA 2VBCA 1G20E 1Z0JA 2IXFA 1GWNA 4B6EA 5DN6A 3MRSA 1NNEA 2XZLA 1GP2A 1WA5A 2V4ZA 2QUZA 1NI3A 2GK6A 2VYFA 3A1VA 3K09A 3R7WA 4BFUA 4DSUA 4CT4B 5H70A 3HYRA 2ZETA 2QI9C 3NIBA 4CF7A 2D62A 4GDFA 3VQTA 3O47A 1HTWA 1ZUHA 5TMPA 1HE1C 2NPIA 1ELOA 3IQXA 2VP2A 1RJ9A 1N0VC 3SJAA 3HU1A 1Z83A 2OLJA 2QE7A 2VHQA 4LSGA 1ZC4A 3A36A 3PUWA 4R2HA 3GLIB 2PEZA 4FMDF 2H17A 2ECKA 3DHWC 1NLZA 3OIYA 4FI3C 4Z8XA 4ARZB 2D74A 2P3SA 4TLAA 5HTKA 3TK1A 2CBZA 4Q02A 4B34A 1R8SA 1A4RA 1QHSA 1IY0A 1VG9B 3EPKA 5FPKA 4XWOA 3HPRA 2ZRIA 1OB2A 4TL6A 4JSYA 2IS6A 4OL0A 3GFOA 3EA0A 3NBXX 4LJ8A 1FX0B 1G64A 3FHCB 3G0HA 3ZQJA 3RSLA 3TJZA 1KJZA 1I2DA 1RW4A 4MUAA 4OKSA 3GLHB 2R9VA 4MA4A 4B3BA 3KX2A 4LHXA 3LQRA 5JEDA 1D2EA 3L43A 1TQ4A 3A4NA 1KDPA 2IYSA 3QI2A 4H1VA 1G3QA 3WMGA 4B3DA 4CGZA 1S8FA 2OFOA 2WV9A 1PVOA 2MMGA 2CJWA 3MMPA 2QAJA 2FPMA 3KUCA 1OKKA 2CHVA 4B3CA 4KAXA 5JMTA 1O3YA 3IEUA 2OHFA 3ZGXA 5KNBA 4C0KA 1E0JA 1SKYB 4HZIA 5HKKD 4LBZA 3TE6A 4M1SA 4G3XA 1CU1A 3A1TA 2WM9B 4LUCA 3AQ4A 2ZUBA 4BFYA 3ZD6A 721PA 2ZRBA 1HT2E 2ZE8A 1SKYE 4G5RA 5DIFA 5JWOA 3I5XA 2IBMA 3CZQA 2QPTA 4LHZA 1OXXK 4OI2A 4NBSA 1HA3A 3UKDA 2OCPA 3TGPA 3WHLA 3GJ4A 4EPWA 4BRUA 3CH4B 3AV0B 3KJEA 5SZIA 3FHTA 3EW9A 3VAAA 2GILA 2ZYVX 2YOHA 1T5IA 1P9NA 2ZREA 4GOKA 2EVWX 5C4MA 3BH7A 2HXSA 2C96A 3PFIA 2WZQA 1X86B 2GA8A 4B44A 3SZRA 1FMLA 1UKEA 3AP3A 2QORA 1P61B 1R5NA 3GJ7A 4PO8A 3SJZA 3H86A 3OAAA 2R6CA 1UEIA 1ZUNB 3T12A 3B85A 2Z6VA 2W6JD 4V0NA 1YZGA 1AM4D 1IN8A 3ZZ0A 3ZVLA 4B3GA 2DR3A 2NPFA 4EJSA 2GBLA 5J5CA 1XXHE 2CE2X 2N1BA 3PVSA 3CF0A 4Q1EA 4PZZA 1U99A 2WIAA 3PUXA 4YLGA 1OH8A 1UBFA 1ZCBA 1X8LA 2XEXA 4RD2A 3TSWA 2FOLA 1ZC3A 4FD2A 5L3VA 2IHYA 4A6XA 3RS7A 4MGYR 2BDTA 4Q66C 5JECA 2CCGA 1XU4A 2B92A 2QPOA 3DO6A 5LBIA 2VL7A 1E1RD 1ZW6A 4X8MA 3VHLB 1E9FA 1OW3B 2L0XA 1QVRA 3D8BA 1RZ3A 2BM1A 4BPBA 1EK0A 1UBGA 1TX4B 1YZKA 3WNCA 1XZPA 4N0DA 4LRWA 3U44B 4GFDA 1GG2A 1G18A 3AF2A 2O8CB 4X8OA 2JASA 1ZD9A 1G8FA 3RS3A 4U02A 3GFPA 1NMZA 4KXFB 3SEAA 4YMTA 4TTPA 2ZM5A 2G0NA 1D9ZA 3SHWA 1WMSA 5BW8A 3P27A 1X8KA 2AFIE 1OF1A 2WWWA 1ESNA 3IHLA 4LX0A 4JBWA 4LI0A 4URUR 1XJQA 5KNDA 1FP7A 5JI2E 3X1XA 2H5EA 3KFVA 2WJJA 1SGWA 2PCJA 1IXZA 3SDZA 3NBFA 4DDVA 5AJVB 5FPSA 4A15A 4O3MA 1SXJB 3BFVA 1EFRD 2ZE7A 3ZVNA 2Q9BA 1XPRA 1UDXA 1QBKC 2QP9X 2W83A 1T3HA 4QGGA 4K8OA 4W5JA 3AVYA 4XVRA 3FVQA 5BYKA 3T1VA 3I61A 4ACAA 2WSSD 1U2RA 5A4JA 3T1TA 5K8UA 2ZU6A 4IJMA 1UM8A 3B9PA 1V43A 4HB2A 4NZYA 3B1XA 3NDBB 2VA8A 4IDNA 2ZYUX 1IM2A 3HJNA 4IFEA 3NEJA 1E32A 3ZYCA 1A2BA 1XX6A 5G3ZA 2IS4A 2VIIA 1J7KA 2HCJB 4DIEA 2SHKA 3NBYC 4IOKA 1ZYUA 2YVUA 4P4TA 2AX4A 1CBUA 1UJ2A 2CLSA 1FFHA 1AZTA 4D4KA 4KU4A 1S1CA 4DCUA 5JLJA 2XTNA 4CZ2A 5CLLA 1NN0A 2ANBA 3AEZA 2GJAA 2RGGA 2QMEA 1OXUA 1W0KA 3QKRA 3I8XA 3RRNA 2WOOA 3ONWA 3UMRA 3NKVA 5HZKA 1MH1A 2UZIR 3V9PA 1G8GA 2HLDA 2IYWA 1DE0A 1IHUA 4QBGB 5AUNB 5C46F 1DADA 2WMNB 2PEYA 1T6NA 1Q44A 1W4AA 2Z5FA 4LJAA 3QKSA 1EG7A 1XPUA 2VP5A 1DOAA 4XVUA 5JRZA 1W5TA 5LDDC 1W7AA 3DZDA 3W6PA 1ZVQA 2I4IA 2W00A 4CW7A 3THXA 4NYMR 2P5TB 3TNFA 2KBFA 3GD7A 1VMAA 2NO7A 2JAQA 3F8TA 2OESA 3PENA 2E9SA
chains in the Genus database with same CATH superfamily
1N0IA 3AUSA 4CS9C 1Z25A 5DVZA 1DB3A 3A9RA 4HNUA 4QJBA 4DR2B 1XAJA 1Z2DA 4TXHA 4JX8A 4MKIA 2FN3A 4Z1OA 1EUQA 1ENZA 2QUJA 4JMPA 4XW2A 5EXTA 5IC6A 1YRYE 1SOAA 1DAEA 2P6UA 4LZNA 1NULA 4FGKA 1EX9A 5YASA 4ND8B 4A03A 2VKQA 1VA5A 4EQ6A 4YX9A 3I83A 2Z83A 1WSBA 1YCGA 5JQGA 3AZOA 4G01B 1GQQA 1XLTA 1VE1A 2HU2A 2Q5CA 2C7BA 2G76A 2YW2A 1LD3A 3FUXA 1M1UA 3T34A 1PS8A 2HV7A 4H15A 4CDYA 4JXXA 4CM4B 2FRVA 4CEJB 4NCJA 1FRVA 2HU7A 4CS8C 5LIPA 4Z1MA 4POAA 4F4IA 1XTPA 3G2JA 4FR0A 4JI2B 2B1RA 3KQVA 2OR3A 4MAMA 4ZCIA 3ZZUA 3GGSA 1YMVA 4PXYA 5T3YA 2ISQA 1TKRA 2WABA 1U9IC 4LECA 1FU4A 1ZHXA 1OBHA 2JBAB 5ARCA 4A6DA 4MKRA 1KP2A 3B8EA 5DOZA 1DCFA 4YJGA 1ORYA 4IXNA 4IHAA 1EHCA 1ZBDA 5B2FA 1FNCA 1U28A 4DTCA 2OVBA 2PGIA 2C77A 2D0OB 1BWPA 3T6BA 2ZR0A 1KAQA 4IVQA 4NFLA 2EQBA 1JZSA 3AETB 4QT0A 4BU0A 3UMSA 2GUWA 2EZUA 5HF6A 1WETA 3CGWA 5GJCA 1GNRA 1ZPDA 2HI0A 1PL6A 2R4QA 4H7HA 4Y2SA 5JXHA 4R8MA 4B09A 5FTLA 3JTMA 2A14A 3N2EA 4QZVA 4MS4B 3AG1C 5L3SA 2F4VB 1M7HA 4LF8B 1E92A 1BRTA 2ZBEA 3GJ3A 3STUA 5IJXA 1VTMP 1Q7CA 2AC2A 3OY2A 4LV5B 3FCYA 1BXRB 1JBKA 3WK7A 3BMCA 3DVAB 1EUCB 1QRRA 5CX1B 2XD9A 1C3XA 2QL6A 4TMTA 2R6AA 1NSYA 2YMQA 4MWZA 1YRQA 4EF4A 1CUSA 5CGZA 3AGPA 1M6TA 5DYYA 2ZULA 1SH7A 4MQEA 1QIGA 3PNVA 1OXMA 3L7OA 5GINE 1XZDA 1JR6A 4ZYLA 3H05A 2V03A 3F5FA 4PRKA 1SHLA 3CZAA 2ATCA 1GUZA 3OWTA 3A6DA 3ANTA 1Z22A 2IGBA 1JG1A 1JLSA 1K86A 3CLRC 1E5VA 3HJCA 2HA5A 2RGNA 3ZVRA 2ZTLA 4CM5A 1EZ4A 2RHDA 4DNFA 1ZM4A 4EGSA 3R6WA 4OQLA 2QG9A 3ZHBA 4R0NA 2ZJFA 3VBCA 2YQZA 2XLOA 1DTWA 2W90A 3ZLUA 2BCEA 5K99A 1HRKA 4R0MA 3EVFA 4Q7JB 3TK0A 1NBWB 3JD3A 5G53C 4EMUA 2IOFK 4CKCB 3C5WP 2BHSA 3LA8A 4TS3A 5EERA 3U5ZB 2JZOA 2V45A 4H16A 4QO7A 3RBXA 4AF8A 4EG3A 3EVDA 3MNFA 4Q7EA 5BNFA 3QVTA 4ACBA 3T3MB 1LNSA 4AJ1A 4E17A 4DV6B 1G4UR 5TDHA 5FULA 1YRLA 3LC1O 4JNKA 3RC3A 1TTQB 1U8CB 1ZJ4A 3CNLA 3CZ4A 4JUAA 2EDAA 4H7FA 4EVQA 4UUQA 4IDHA 5DSTA 4J91A 1SKQA 4YV1A 3V48A 4DSZA 3CNOA 4NNOA 4D8UA 1Q7RA 1U4NA 1UADA 4HX2A 1HZZA 4FBMA 1IL0A 1WMFA 3FTDA 2WA2A 4KSCA 3ZV6A 4B3FX 1EUZA 1QLJA 1A8UA 4HH4A 1US8A 4MV7A 4AVYA 3M6LA 1DJMA 2I3DA 4UAGA 4OFWA 2GDCA 4Q3NA 4MHOA 1ZZPA 4MYDA 1KFEB 4IINA 4OXXA 4JJKA 1IJEA 5JYCA 4MRRA 2CYAA 1C8LA 1GL7A 4Q7CA 1J2JA 1MQAA 2O2JA 3ANSA 3EISA 1XPOA 2I4LA 1YDFA 2ZI6A 2IXPA 1SUEA 3OFJA 4H9GA 3RNOA 2Z6UA 3FG9A 2RHBA 4YRAA 5HBGA 4FZ3A 1Y7IA 3BWEA 2C5AA 2V58A 3IILA 3M2PA 4NONA 4P33A 2I2DA 5DISB 4D4MA 1STOA 3V1UA 3S2EA 1X1SA 5G3YA 2ZUUA 4HGYA 1WXFA 1M34B 3MSCA 1GCUA 1L4KA 3O73A 3PR1A 3NTOA 2OILA 4OQPA 2X5KO 4Q1BA 4XJSA 5AI4A 5JFGA 3FE2A 3FN4A 1WPRA 2WJZB 4CM9A 3AH8A 4ZHQA 2IXEA 2M64A 1GL3A 3ETGA 1E96A 5AUOB 4NZOA 1PV1A 1U1GA 2KYRA 3JVDA 1G4HA 3ZCTA 1JXOA 4ZI7B 3IULA 1KU6A 3EBPA 4FFMA 4RZ2A 4EA7A 1XP5A 3PLAE 4R05A 3JQ9A 4KX5A 1IAQA 1W93A 1T4CA 4HFJA 3K1IA 5D7BA 1PUJA 2RHJA 5AJUA 5BMVB 4G09A 4DDTA 2JS7A 2X5OA 3CB2A 5F2NA 3W5CA 1B23P 2F43A 2J3MA 4W8OA 4EYOA 2ZIWB 3DP9A 1AB5A 2G67A 4ER7A 3OQJA 2BEKA 1MJNA 1MQSA 2NO1A 3T9EA 5DEIA 4I6GA 5A1TA 5EXXA 4OHYA 1RC0A 4GX2A 4TVOA 1E2PA 2IUTA 1FZQA 2Q9CA 2PT6A 4BO8A 4CLDA 1SCAA 1NBIA 3QFSA 4XD7D 5H16A 2ZIGA 4GPEA 4S1VA 3ZDQA 3BB3A 2ZJOA 1L5RA 2P2YA 4KXQA 2OHHA 1P8AA 1XRSB 3QLJA 2WC1A 2Z30A 4P31A 1NG9A 1MC4A 3A28A 3HLYA 4UTRA 2WFZA 5IMSA 3EEIA 2PT5A 2VDJA 4N3GA 1OE0A 3WB9A 3ZCRA 1SRQA 1T5DX 1F38A 1NXPA 2DHDA 4I99A 4YP9A 1QRUA 5ALUA 5IM4F 1V3QE 4HDRA 5DYIA 1DXYA 3KOXA 4TTIA 1M57C 4D45A 4AQ7A 2GA0A 2YS6A 2DFPA 5FNVA 1C80A 3D0KA 1G0NA 4FN4A 4US2R 2NSGA 2QL9A 2VCAA 3PGA1 2LKDA 4ZT4A 3U3KA 4DV1B 3THXB 4X00A 1QIHA 4P35A 4W5HA 1I4WA 2KW5A 1E2GA 1ABBA 3AG3C 4FWIB 2J0XA 1U8ZA 3T5TA 1OZFA 4PGMA 1UJCA 3KCNA 4A82A 2YHSA 1KGSA 3DMTC 1SCNE 2VF7A 2XYPA 4YALA 4D9NA 4E09A 5KSZA 5B4UA 4HQLA 5FAKA 5DW3A 3IPLA 3L8CA 3VZRA 1NMSA 2BE7A 5HRUA 4IG9A 1KE1A 3NYMA 3KLOA 2W58A 3RU9A 1IZ7A 1IJKA 1I7NA 1RPTA 3OFND 4S35A 2RKBA 1QR6A 2QTHA 1V1JA 1X6VA 1M5RA 4LFBB 1GAQA 4Q7LA 1GRNA 2AWOA 3SAJA 2GTPA 1NQ5A 1ZOPA 4ZGGA 1SA0A 3L0SA 4RIFA 4XYEA 1ADBA 3R3YA 4LQLA 1EP2B 4O4JF 4II2A 2R85A 1KYXA 5K3OA 1OQCA 2RGAA 4CCYA 4NECA 5IRCD 1CTQA 3L6OO 3URMA 4QVIA 1YJ8A 3BL8A 4DA7A 3DR5A 3U7EB 1JUDA 3MYRA 3H7IA 3GEIA 1UEXC 3O91A 1E2XA 4IYJA 5IC4A 3V2UA 5HFAA 5EP4A 1X0XA 1KI8A 5TEWA 2R7RA 1C7JA 4P3NA 1J0EA 2ORYA 1ISHA 4E7ZA 3QYFA 3OEOA 3Q3CA 4YIKA 1HMPA 4N3CA 1QTRA 5F1YA 2W37A 3ORFA 3OZCA 4DVYP 2X1MA 3DYBA 5D1HA 3GCZA 3IAM1 3KSDO 3DV0A 4EIYA 3FPSA 4MYHA 1AIPA 3LZCA 3E4DA 1R5ID 3S2YA 1W48A 2FRDA 2PL1A 2QWXA 2XGOA 3K4QA 5GQSA 5MN4A 4J3NA 2C4HA 1AY0A 2W2LA 2HYIC 4NARA 4KQHA 4UQPA 2BKVA 3U7IA 2WJWA 5T1DB 3UC9A 2GZMA 4ZVQA 3ZE0B 3WYBA 4JLUA 4ONSA 2KE5A 2FX5A 1SURA 3RKSA 4EMSA 2IP1A 4DVGA 4CQJA 5A4MS 4G86A 1K63A 1OMOA 3RO7A 3BTVA 4IMIB 2GFQA 1PYDA 2I65A 4KYIB 3A6PC 1ZKMA 2O0MA 3RG8A 4WFQA 3JPYA 3P0EA 1WXEA 4PWYA 5DHTA 2NX2A 4ZREA 1G16A 1C7IA 3RKUA 3TTVA 3DZFA 3Q7QA 5KBYA 2FW0A 3H99A 3DMGA 1FTYA 1MRSA 1XRJA 4LXTA 1Y3FE 1XI2A 3KYJB 1JDBB 2EOAA 4MAAA 5E4TA 4AZWA 1KEEB 2H4ZA 3GJRA 3HXLA 2ZTMA 4CM8A 2GD0A 4I7EA 5LMNB 2XRFA 3AEUA 2OM6A 4TKZA 4F38A 1AMOA 4BO7A 5DFAA 2VT2A 5TGTA 4TVSA 1ECFA 4HUQA 1R27A 1FR0A 1NYRA 1OX4A 2V3VA 3PDCA 3UT0A 4B75A 1MMNA 3IDFA 3IOEA 4CI0B 3TB6A 2R7NA 3FFAA 4MS3B 5FO0A 2JLYA 5AJXA 3S4YA 3CUWA 4R40A 4OLAA 4KSBA 1FNNA 1KR2A 2GXUA 4J76A 4GE3A 1Y80A 2VLBA 3E9CA 1QVVA 3EE6A 1PN3A 3P5SA 2POCA 4LVUA 1JSZA 1KARA 3Q2KA 4CDVA 3QE3A 4KLAA 2L9JA 2AN4A 2QQ5A 2WIKA 3LNTA 2IV3A 3WG9A 1Y3DE 5IM5A 3S7ZA 5E33A 2FDXA 4RQTA 1H0HA 1MZVA 3ELBA 4Q47A 3UNGC 1X9IA 2Q0SA 1QYXA 5IBPA 2XWSA 2IUYA 4L22A 2R7VA 2ZRNA 4FW8A 4KO1S 4BKUA 1IHOA 4LJLA 3DBLA 4Z4IA 2DULA 3H5OA 1DAMA 2IZ6A 4HWPA 3W34A 3O83A 5IJ0A 1Z18A 1VMDA 5TVGA 3JQGB 4MVJM 3UC5A 4BTLA 4CV0A 1D1BA 2GBGA 5JD3A 3TZ6A 4CKWA 3BN3A 3AJ8A 2J67A 4C3UA 4JEAA 4O1MA 1U0HC 6CHYA 3EGIA 4P7KA 5D5QA 2H9IA 1N3YA 2EFJA 3E5HA 3CLVA 3PPWA 3W3AD 5C5CA 3O9ZA 2G04A 4LY0A 4U4AA 4RF4A 4C6SA 3W06A 1BQEA 4UEJA 1Z08A 2OD7A 4GMXA 4OAQA 4H17A 4ZDWA 2OJED 5FEUA 4PYNA 2QXUA 3QPAA 1BC5A 1GSIA 1DPFA 1MJGA 2C5SA 3QG5A 2EW2A 3LQ4A 5CNIA 5BPFA 1V7QA 3IKMB 2O14A 4F8EA 4EG6A 2R0QC 3OM1A 1Q11A 1J24A 1YD7A 2NZJA 3PNYA 1KO1A 1YI8A 4LK3A 4ASUD 1GTVA 3SXUB 2PV7A 4CLEA 1EFTA 1UZLA 3LDFA 3CEAA 2JAHA 2HSQA 3QE4A 4ZVNA 2OGUA 4BJHB 2RHGB 1JMWA 4WCDA 3ZXUB 4QXMA 4EGCB 1RRPA 1WHSA 2QTMA 1XFDA 1GSOA 2J3IA 3G8CA 4LPSA 1T36A 2I66A 1FSZA 1NW9B 4LGCA 4QATA 3PIRA 5ALKA 3EWSA 2CK3D 4BZPA 4CDMA 2DFTA 3VNVA 4ZT7A 1FE8A 3EGWA 2B0CA 1ZJJA 4TLDA 3ZBUA 1T2DA 3MJFA 4KAJA 3M4CA 4YHBA 4HEAJ 3QLVC 2C2OA 2CJXA 3CFYA 3EGXA 3QYAA 2JIZA 2J7PD 4CU2A 1G55A 3D5QA 2RB4A 4OOEA 4B4WA 4ALNA 3BXHA 3EH1A 1PT5A 4F9FA 4KXWA 2ZFUA 3JXEA 3DE7X 4M8NE 5HEKA 2VJNA 2O8EB 5BV2P 3KPJA 1HY5A 1HQCA 4Q9KA 1Z39A 1F48A 4TTRA 2N42A 3HXTA 4US1R 5B1IA 3TDMA 1N33B 3K9NA 4BNWA 1QH8A 3AWDA 3OA2A 2ZUSA 4K6HA 3I37X 5F77A 3GJTA 5COBA 1FEZA 3CG0A 3H5NA 3TYXA 4KLRA 4DLYA 1QG4A 4FFNA 4GGMX 2QYOA 4LBVA 5CYOA 4C3EA 5K3AA 3M4XA 3EHMA 2O8DA 1V7PC 4KVAA 3UJPA 1ZUNA 2JLCA 3ICCA 3RVQA 2OHIA 2CJYA 1YYXA 1C8VB 1G9XA 2XQJA 4RABA 4CN8A 1Y1LA 3DDWA 3JD2A 2BMVA 3EAQA 4KTVE 2ERXA 2WD7A 2GAJA 5CLHA 4HR7A 5KYYB 4JJ7A 1KIMA 2GO1A 4NK5A 4Q1CA 3S2ZA 1KTMA 1TB4A 4G0ZA 4I1VA 4O5AA 5BSUA 4O0LA 4LCEA 1WD7A 2XVAA 4O2BB 4K2HA 3THRA 5C32A 2ZBGA 2APJA 2C9DA 2GYWA 2NV0A 3O8LA 4QOJA 1RCFA 3BD8A 3L7KA 3DGFC 3PYMA 3OWOA 3N2ZB 3ZWAA 3F6SA 1UWVA 3GQBA 3CN7A 4CL0A 1Y63A 2ZIFA 2Y4OA 3QELA 4LXGA 1Y0BA 1V1RB 5KZMB 4QYIA 4RKWA 1A82A 4QUAA 1LV8A 4E70A 1DQYA 5JQGF 1F20A 1C1DB 1C2TA 1DAFA 1DBVO 1J0BA 1OI2A 2CCYA 1JDUA 3FCCA 4X94A 3SZUA 1AF4A 1C3EA 1K2VN 5EHZA 1IIRA 3HFJA 1JFRA 1GAWA 3FIUA 3L9XA 4MUJA 4YXWA 1JV2B 3ME5A 2PBLA 1VLSA 4CFSA 2NLOA 1GEGA 4O2RA 5FT9A 1NY6A 1NFOA 1TU0A 3S84A 2XGJA 1D1TA 1MC8A 4B5LA 3NGLA 1PDWA 1DKNA 3LT0A 3PWZA 1JJVA 2QTZA 1WV0A 4WABA 3F7MA 4QU5A 3RGGA 3W2WA 3MHPA 3NHBA 5BPHA 4BLVA 4MNTA 4D6PA 3O9MA 3GHYA 1F7VA 2ZJ4A 4FMCB 1BG6A 1YHNA 1QC5B 1KHHA 3CUUA 4GE0A 5DHQA 1KAHA 2PZBA 1SK8A 4KNWA 1D8AA 4RFSB 2OZPA 3LVQE 5E7IA 1E9RA 3EEQA 1W94A 4KO4S 3C18A 2JCSA 2VYVA 3LF2A 1YQ9A 3BMCB 4QFDA 1R0RE 2FHSA 1N5OX 3ESCA 2R6HA 1O9BA 4C7OB 4XRGA 5D00A 4F6RB 1TUBB 2BISA 2IEZA 5FI3A 1Z0IA 2AKAB 3MTBA 3CZ5A 3ZQ6A 1ECBA 1SCJA 1MRZA 4NL4H 4DLAA 4RAOA 4BY9E 4GL4A 3W4KA 1LBEA 3K0HA 3ZUGA 4EVRA 2DHQA 1R50A 5JLAA 3B6EA 2G1PA 4MJXA 3W4JA 2L18A 3N5KA 4QODA 4UNSA 1EVQA 1IBKB 1IZZA 3ROPA 4YIHA 2NUTB 2QVXX 2VF8A 2E2WA 2ZVQX 4HTFA 3I30X 2CMDA 3UTDA 4B4VA 4BNYA 4WXEA 3AB7A 4W9NC 4YDRA 1BFKA 1E2EA 1POWA 4RD1A 1DVRA 1U94A 1HYQA 2B5WA 3FXHA 3AG6A 1AKTA 3E7FA 1Z73A 2QN8A 4DLWA 3UMMA 4OHUA 5D2CA 3OFVA 1U5CA 2O9XA 4UNPA 5FNVF 3OLQA 1T4BA 3TGLA 3JSAA 4IKOA 3Q7RA 4RZXA 3GNLA 1XU7A 4GVPA 3AKEA 4H18A 4KLZA 3SM3A 1ZCZA 2P77A 2HFKA 2WWGA 2CUNA 4G5HA 2C9BA 4IMJB 5DYWA 1CK4A 2PXHA 4J2OA 3TUJC 1ND6A 3ZHRA 1Q21A 1WAMA 4C7XA 1N6PA 1U89A 1T2UA 2QY6A 2FSVA 1D1CA 2YW9A 1MN6A 3MM4A 3OZRA 5EZSA 5FORA 5C8YA 2CL6X 1JDJA 2KI5A 5JJBA 2AOWA 3FHOA 3MQ2A 1BW9B 4BQSA 2HK9A 2P35A 3TD6A 1ZQ9A 2RHWA 3F49S 3SR4A 3RAFC 3RVBA 1EFKA 1YS4A 1XMVA 5CVEA 4Z0PA 2EIKC 4FUTA 2FMTA 2CY0A 2VB6A 3KOZA 2RMKA 1X8XA 1UC4B 2OMKA 1MO6A 2ICAA 1RKVA 4E4TA 5I8PA 2X7XA 2ZYAA 4UHEA 3EXEA 2R6ZA 3NNDA 1GPKA 1S4MA 4DA6A 1K98A 5FPPA 3LLVA 2OQIA 3I9V6 3R23A 2FJPA 5E4FA 3M15A 2HMZA 3V4OA 4E5SA 1RCTE 1QLWA 4J0HA 5K8IA 1LVKA 1FYFA 4U2BA 1EWTA 2ZIZA 3K30A 1SMKA 2HB6A 2HUPA 4KCGA 1JEEA 1II0A 1L7XA 2LIPA 4L75A 1QQ6A 4QLAA 4RSRA 4WX2B 1KYYA 1V9SA 1DO2A 1NKTA 2WHEA 3DZIA 4B6RA 1OWOA 2AG5A 4WZAA 3IJEB 1OPXA 2IDMA 4PFKA 4MVJA 1A2OA 5DM0A 2D7JA 5GJBA 3RVZA 3K0AB 4Z9FA 4QXRA 1PZNA 2CKDA 2XUQA 3CH6A 1RT9A 1ZJWA 5EEHA 4XE5A 4BB5A 3EXIB 1B68A 1RYZA 1GRQA 4DLUA 4ENSA 1IEQA 2HDWA 3JAWB 3A06A 2H6EA 2GPSA 2BRUC 2QMUA 1SAYA 4Z3DA 3OU2A 1Z4QA 2AEMA 4HDMB 3P5BA 4JP5A 1GZ3A 4TX1A 3INRA 3KQYA 3UGOA 5AR1A 3W5AA 1B3BA 2E1RA 4IWXA 1ML4A 2XM4A 2QOEA 3HTXA 4JJZA 5E9WA 1KZ1A 3BSWA 2ZROA 3WMWA 4YPFA 1X9HA 2HKIA 2PG3A 4HDSA 4HO1X 5KTTA 1OB5A 1G4US 4MQ5A 4AMUA 1GM5A 1WY7A 3SQLA 3VH1A 3Q7GA 1Z2OX 2BM9A 1T5LA 4OO3A 4G5GA 3TCNA 3TI9A 4A5OA 1P1FA 2ZYIA 3B0UX 5HM6A 2NUBA 3MJCA 5LQRA 5AI8A 4HWOA 2HV9A 2C1XA 3G1UA 3QU2A 4MGEA 4YCNA 4LE1A 4PCUA 5COGA 4R8KA 2Q3HA 2XTJA 3CUVA 1T9DA 2M6RA 3HHPA 1KQNA 3W8DA 3RQFA 1HDOA 3GZNA 3SR0A 3DE0X 4CS9A 3CTPA 4BNDA 1I4ZA 3LNMB 2R6DA 3NANA 3TSOA 3TNLA 4JB2A 3RHSA 4KVGA 2B4YA 4YV2A 1WV1A 1DWUA 3DGEC 4QNMA 1I4YA 3OT5A 4HUQB 4G67A 5JC8A 3BM5A 4V3CA 5FUQA 2XS8A 1YWGO 2CNOA 2TMKA 2I3BA 3AESA 3PUVA 3PUHA 1OFUA 3C3JA 3P52A 3DVAA 3K9CA 1OZGA 1M6EX 5LXTA 2G63A 4HBGA 1FDIA 4KW7A 3RVYA 3U4HA 1T5SA 5A9TA 1R8YA 2PWBA 4N39A 4BRZA 3U5TA 4XDHA 3NC0C 1JEQA 3CAXA 3R2JA 4M76B 5EP2A 4RH0A 1ANKA 3JQ6A 3BTOA 3OWHA 4P5EA 2ZRAA 4E51A 3W0LB 2NSDA 3O4HA 2QDXA 5BQPA 4ZXPA 1SN7A 2UZ1A 2FE1A 2XKKA 2QW1A 3CBGA 1JFVA 4MAFA 5JQWA 3X1MA 3ITNA 2NG1A 1PS0A 4F5WA 3Q8LA 4FHZA 3T8YA 2WKSA 4YJ3F 1KP9A 2PLRA 4AF7A 1H69A 2OZLB 4OI0A 5LZ8A 5K8LA 1FS5A 2Q5QA 3FPEA 1ILEA 5EMMA 3BOSA 1SQSA 2B0JA 4YUYA 4W5WA 2IZOA 5FP0A 2FPIA 1ICEA 1EQUA 2D1QA 3OCUA 3HSKA 3A1SA 1YGPA 4CSAC 2QRNA 1MP0A 1Y9EA 2XKAA 3U7JA 5JOQA 3L02A 1Z6GA 2WWHA 3FLAA 4EO4A 3GLFA 4Z6KA 3B1ZA 3F5QA 1GUFA 2XZPA 4IJUA 2QT9A 4N8EA 1JJIA 1E1YA 1CZHA 1PR1A 3GGCA 3I5MA 4I4TF 4RZHA 3RV3A 1JA0A 3PNMA 4JLWA 4CM4A 3U16A 2H7BA 1XU9A 5KWEA 2IYFA 1B8OA 3NONA 4B4OA 1YDHA 2VH2A 4C4RA 4KI7A 3O3MB 4H6WA 4Q93A 3B9QA 2J0EA 2QL5A 3IEPA 5JNWA 3KSBC 1LBQA 2VDUE 3NP7A 3KHTA 2FPPB 4FBGA 4OIOF 1QK5A 2JPDA 3RSCA 2CV0A 3AIOA 3RPEA 3CSUA 3S1AA 1DRUA 3OEHA 4X85A 3PFKA 3WX0A 3KT8A 5IDYA 3AF4A 3VR5D 2B6NA 4FDAA 3VI4B 4YCSA 5JBQA 2V9CA 2P4EA 4CKZA 4F5DA 4CNBA 5FZTA 2G83A 5F3RA 5J58A 5DNAA 3CU5A 3SZLA 4XAQA 1Z4OA 4LQCA 1EE1A 5L51A 1U3DA 1ISSA 5CHEA 5DGHA 3V4VB 4EZEA 4Q1DA 5A6SA 2W2LD 2CFSA 3KB2A 4EVIA 5IT5A 1RQRA 1MFZA 3OE1A 3AUTA 3L5OA 1RLJA 3CKKA 3LC7O 3PQFA 5DI3A 1UIMA 1DKOA 4DZZA 2GPBA 1KGDA 1LPMA 1RWVA 4M0KA 3L8GA 4E12A 1E8DA 3E15A 5C8ZA 3ASUA 1XWIA 4XEKA 4BUCA 3NW9A 4X3OA 1PHRA 4YGXB 5BSKA 1IRIA 1ZMBA 4FJ0A 4L5YA 4L3VA 2WHPB 5FAXA 5E3AA 1YR2A 1B7GO 4JI1B 4AO8A 1DBQA 4RVSA 5AW0A 2YV3A 2R2AA 4L5IA 4EW2A 3WNQA 4L4UA 4D9FA 3KNZA 4XZ3A 1SBIA 5LYJA 1SG6A 4DTIA 3LX4A 5GAJA 1REQB 2BLLA 3DEFA 4WN9A 4ZOEA 2VH5R 1RM5A 1Z5PA 3RTDA 5C5IA 1NN5A 3RK4A 4C4SA 5A9RA 3TINA 2VJQA 1ZXBA 2BSQA 1CUCA 1YZLA 2OCBA 2AN9A 4KOAA 3CF2A 2RAUA 1D4FA 3BD6A 5I9NA 3FDZB 5HGJA 5C5EA 1Q91A 2WZFA 5CVDA 1FF9A 2XWJI 2F2TA 5COFA 4L08A 1NY5A 4Y6QA 4L4ZA 7MDHA 4G0UA 4I66A 4HV4A 2BVNA 2P9FA 1EFHA 4Z9XA 2IYNA 5A06A 1N7JA 2GWHA 4U5CE 1E2UA 2V1XA 3PGMA 5JSZB 2EZ8A 3CEJA 2VPPA 3QMMA 3BCRA 2HQRA 1C1DA 3P32A 2AW5A 1P4AA 2PX8A 1JHAA 3ZU4A 4ZIRA 5BR7A 5JFTA 2Y3IA 5CK4A 1EA7A 4HATA 3HDVA 3U3BA 1M2HA 1NUTA 1ZITA 5E8RA 3MRVA 2D2FA 4YJHA 3KWLA 1CQJB 3S0JA 5IDQA 3V6MA 2XBUA 1DFGA 2V65A 2ZAGA 4R2KA 2OXRA 4D3DA 3BB4A 4LJKA 5B7QA 2VUTA 1AHIA 1KTVA 3KOMA 1QCDA 1DEOA 2BFEA 3CW2A 1JHOA 3EUWA 5T4FA 1C8KA 3G2NA 4CCAA 2QLLA 1CUVA 3QY9A 4BO4A 2ZRFA 5A3QA 4F56A 5KHLB 3M4YA 5FUYA 5TNXA 4OFZA 4GYKA 1Q92A 5A9SB 3NRHA 4V0RA 5CXUA 4OA8A 5MFZA 2F8TA 1T01A 3NIDB 3LWNA 4DL9A 2D5IA 3VPSA 4B73A 5EJEA 2HUNA 1ZN8A 4WLFA 1DWOA 5C2JB 5AWFC 1GL6A 1PLJA 1XPJA 3BJEA 5B2ZA 3GLIE 2Q2OA 2XWQA 3AJDA 3C3BA 3CJTA 3EZNA 2AS0A 3JYOA 4HLQB 2C9YA 4XD7A 1TCVA 1XLUA 4OM8A 1TECE 1F8FA 1JPJA 1C4XA 1NV9A 3HCFA 2G6BA 3C3DA 3OIWA 4KYTA 5B1BC 3NIFB 3RODA 4D9HA 2FRDC 3TRIA 1Z5WA 3QQ5A 1LPOA 1KI6B 2ZDQA 2IYYA 2HDHA 2IZ0A 4KXUA 4TXMA 1FP1D 4QSMA 4BP9A 3TLMA 4FCVA 2HSWA 4E7OA 2C5FA 1DEHA 5LNK6 2X40A 3H2JA 2CSXA 3L1MA 3U7QB 1RIFA 1TPZA 3PWKA 1R3UA 2B8EA 4MMZB 3SJ7A 2EHJA 4MVJE 2C4UA 1T2NA 3ZV7A 2YMLA 3N0RA 3ZSUA 4N3AA 1TUIA 1A7UA 3DE3X 3OHMA 4B2PA 1QGOA 5DTQA 1QP8A 5JXWA 5CYPA 4ZVRA 3AM3A 4LSMA 3NPMA 3OPMA 2ZB7A 4MVCA 3MINB 3QNWA 4EHHA 1FDOA 2XLCA 4FZ5A 1SXQA 5HE8A 1QS0B 1S02A 1T9ZA 3AVPA 4G37A 5BNIA 3WJ7A 3P9IA 4PNZA 3GIWA 1PUIA 4FNOA 2O5VA 3WG7C 3BWYA 1K5PA 3ABSB 1BJRE 5FUXA 3O5AA 1QGAA 4MTGA 5K1ZA 2O3RA 1IBMB 2G40A 5E1OA 4QWMA 1LSOA 4BBZA 1KH3A 1K7FB 1Y98A 1KHTA 1Z5GA 2VS1A 2PSFA 2XMRA 3MMZA 1JVBA 4IO0A 5K2MA 4WESB 1JMYA 2P7VA 1IWPB 2WZBA 2P3OA 3G4ZA 3GJXC 1DQNA 3E7XA 3AHGA 1XK7A 2P0YA 2WE8A 3C63A 3FYUC 3PFHA 4GP6A 5AVKA 3NHUA 1V95A 4UUNA 1I1HA 5I7VA 4J29A 4BBPA 1UWKA 4B8ZA 2P1RA 2EYUA 13PKA 1KSGA 1N0WA 3BH0A 1AA9A 3P8ZA 3GY0A 1VMIA 1TEHA 2AR9A 4DQXA 4OQ4A 5FOTA 3SYRA 2HMUA 5KPDA 2E4ZA 2MINB 4NR0A 1M8PA 1KYZA 3B48A 1ACLA 4L8LA 4ZYTA 2NXWA 5EWMB 3CB4A 1QC5A 4JBXA 5ELLA 2GBLC 2F8SA 2RFLA 1E0SA 2W6OA 4Z1MD 5IHPA 3V5ZA 4X44A 3EBOA 1VMKA 1F2UB 4HDNB 1NUUA 3QPUA 3TRDA 4JUCA 2ZU0C 2CL5A 2BMAA 1J90A 3GRYA 4XJTA 1GTG1 4FYVA 4CQLB 3HKCB 2CDRA 4PO3X 4R1LA 3IUPA 2NVUA 4IKEA 2YKGA 4A92A 3LCUA 4X41A 5TF0A 3SF8A 4G8BA 4HAVA 4OATA 3VPGA 3KL2A 4K40A 3EXHA 1QQ5A 5BYBA 4N5DA 3M83A 3P2MA 2M98A 3ZWQA 3AI7A 2GJKA 1E99A 1RAFA 4TMVA 1PHPA 3I8SA 3M9XA 3ICEA 3WOVA 3S8EA 2HCBA 5DU2A 5REQB 1LA2A 3UZUA 1ZW1A 4Q4JA 4MVOA 3TD9A 5HJ7A 3DWEX 1ZN9A 2Z56A 3ADDA 2FWIA 1U4OA 2J9ZB 3CIOA 2KHZA 3BCHA 3OG9A 4OD5A 2VVTA 3E2PA 3IOYA 3UWMA 3H9GA 3T4UA 3ZHSA 3MSXA 3SE0A 1QYRA 3MFNA 2Y69C 1UMKA 2A1UB 4UXIA 5BN4B 5J4YA 4IOMA 1PWHA 4FOLA 1H9BA 3KXDA 3R9WA 4UTZA 5CA0B 2AJDA 2QVGA 3W5DA 2I91A 5ERYA 1A96A 4MULA 5C3UA 4I50A 1D6MA 3PS9A 2XUIA 3GVCA 1RTTA 3H6HA 4HB4A 4WVFA 3U5SA 2LBPA 3EW7A 4PIPA 3EHNA 4FINA 2HWUA 5I4IA 1HWYA 4L4SA 3GJ8A 2Y68A 1JHYA 3QWFA 3O0TA 4HX5A 4HXEB 3EQZA 4F96A 1SBZA 3G5AA 1SUCA 1VIVA 4YL1A 3ACBA 2O8VA 1EJ0A 3CCCA 1RKUA 3K2BA 4PGAA 4RHCA 3Q10A 3NWEA 3U3OA 3OJOA 2JFHA 2I8AA 4UBNA 3S9OA 3C3YA 3GUUA 1Z0DA 3FYUA 4MP8A 4EKYA 3OQPA 5FLKA 1VLJA 3L04A 1R1DA 3RFTA 3CLTC 1YZYA 2NUAA 3T9BA 4BEBA 2LXNA 4M7WA 2I1VB 5IAGA 2O8EA 1SUSA 1YB1A 4ZODA 5A5GA 1GAEO 2XL8A 4FX2A 5C1IA 5H3LA 3E5NA 1ZR4A 1P17A 1P9RA 2LUOA 5HILA 4JC4A 3C8MA 3EIWA 3GR6A 3UMIA 2ZSHA 4PLYA 2IWHA 4DCOA 1MO2A 1L5HB 1Y6ZA 3A31A 3CE9A 1KQGA 2YXBA 2Q7OE 3EZFA 1U0JA 2GRJA 2QG4A 1DC8A 1XWWA 3MA0A 4NATA 1YZ3A 4ZAFA 3WGJA 2WM8A 5JRDS 3GANA 1NNUA 3DKVA 2GYVA 5HQJA 4I8IA 1E2QA 2ZTUA 5EVJA 5LA6A 1ZK3A 4GOND 1Y33E 2A5JA 4RQAA 1UDRA 1DINA 1O5IA 2CVPA 3H13A 3TM4A 2WFLA 1G21B 4J1SA 3JQDA 4N5IX 3E9EA 5BN3B 4K9SA 3Q0TA 3OX2A 4DWVA 2PA0A 3UM9A 1DGQA 3O10A 1QIJA 1R0WA 2EFHB 3MUOA 4G4JA 1FW6A 4ZQIA 2UUPA 3INGA 4UZSA 1J49A 1HYGA 2O2DA 2V9PA 2RGNC 2XUKA 3UGJA 1QBGA 1T8WA 2HS5A 2Z1DA 1G5TA 1BZ4A 2BKUA 4QEZA 4JJGA 1IBCA 4XPIB 5AW4A 3F8WA 3UK2A 1M1NB 1DJNA 5IN4A 1OC2A 3QX8A 3X1JA 1YB4A 4GLFA 5AVJA 2UZAA 1ESDA 1SVSA 2EFYA 4R01A 4XQCA 5AKJA 1SVOA 3E53A 4RADA 5FUBA 4AJPA 3BQ9A 2WVHA 3O1LA 3OTOB 4LF7B 4KODA 1KO7A 3NORA 1UBRS 4JWKA 2E6UX 4LXUA 1SU8A 3O8QB 4WY2A 4Q5SF 3NIWA 2ZCJA 2R7LA 3LRTA 4REMA 4K3VA 4ZVPA 3N59A 3H16A 1J21A 4CVNA 4S1TA 2EILC 1QIMA 3CURA 1ITZA 1H1LA 3ERCA 4TYPA 1S7CA 4MR8B 5KB3A 3UW3A 3UY4A 1I9GA 1QAMA 3E18A 4IIUA 4OV6B 5ED0A 4G81A 2X9NA 1KH1A 3CEXA 4MPRA 2VAVA 2NQTA 1YKGA 2VTKA 4QYTA 3G50A 1CLUA 2YWAA 1PYOA 1NOKA 1Q3HA 4HPJB 4C89A 3IPCA 3WNBA 4WVLA 3R9XA 1U28C 2ZB4A 1X77A 2VXOA 4HWRA 2V3WA 2XMBA 4I1UA 1ODIA 4PQRA 7ABPA 1KSFX 3GPBA 2P78A 3RYFA 2Q3TA 1JPNA 4L74A 2WU0A 3L77A 3C5EA 2WHYA 3PLNA 2AFRA 4FMBB 2OLKA 1RYHA 5EWJB 3DZKA 3GJ5A 2H1WA 4DCVA 2VF5X 4P7GA 2XB6A 4OF4A 1CZRA 2JLWA 2ASVA 3PDIA 3FZGA 2VYND 4MW5A 3RYCA 3OX1A 3GLIA 1WBBA 2OQVA 2CLDX 1Z5NA 2C2HA 2RGYA 2XF8A 2DPHA 2R03A 3N6VA 5JSYA 2VDMB 2G7ZA 2Q6VA 2ZRMA 4MI9A 1Y8QA 1B8PA 3GZ4A 2WU4A 4XWWA 3OMXA 4LCBA 4ZYZA 2PANA 2OMEA 3KTOA 1Q20A 5HZGA 4J8PA 5T6BA 1V3VA 4U7DA 3FMOB 4WL0A 4CCSA 2B78A 1HUQA 2YWXA 4JL6A 4LJ4A 3FPFA 4RLHA 5CK5A 3ZWMA 3BXFA 5LSAA 2X6TA 5AHRA 5JSLA 3PQ2A 1T4DA 5ARBA 3LLUA 5GMOA 2WAYA 1NXXA 1CQZA 1W44A 2Q41A 3JR7A 1PGOA 3PYXA 4IIJB 1UC8A 3G79A 5B3JA 4DMGA 1NVGA 1HLFA 1PLLA 4M88A 1TZKA 3ICPA 3LOUA 5E1BA 3MYFA 1QF7A 2ADMA 2ZIAA 4AMBA 5DMXA 4ZJYA 1UAGA 2FEXA 2QI9F 1HE5A 3ACDA 2R47A 2R1UA 3PT5A 1DUSA 4OPMA 2QRMA 5KYXA 3JZIA 2YDXA 3GQBB 4BFZA 1K97A 4NCQA 1N1DA 1NNI1 3R3ZA 4NEN