2PX0A

Crystal structure of flhf complexed with gmppnp/mg(2+)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
258
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar biosynthesis protein flhF
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 78
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px0A02
2AN9A 1QHHA 3Q7QA 4ZO4A 2JLWA 4AC9A 4LBVA 1AN0A 1XFAA 3RHFA 1E9AA 3BB4A 4EDHA 1KO7A 3LVRE 2V7QA 4NONA 2XSZD 3C7KA 1F2TA 4ZCMA 4B3FX 3RC3A 1D8TA 4F93B 3TRFA 1E69A 2ZRAA 2IYZA 1KSGA 3VKWA 2ZSFA 3DPUA 3NC1C 3GJ8A 1RKBA 3KQLA 3CRVA 3WBKA 2RHDA 2WKPA 4C0AC 1SVLA 2PMKA 1RJ9B 4LJ7A 1K5DA 4WXRA 2G0TA 1LFDB 1PLKA 4NCNA 5JMTA 1E2KA 1E1RA 2G83A 1OIVA 2BBWA 1S4QA 2WJJA 2GK7A 1Q21A 1VCIA 2J7PA 3SJBA 4BFVA 1QHXA 5HPYB 4NBSA 1Z06A 2QE7D 2VH5R 3CF6R 3QF4A 4EFMA 1N5KA 3UG6A 2OXCA 4RKEA 4DDUA 2ANCA 4A0FA 3A1TA 4MYUA 4RZ3A 2XOKD 4OL0A 2DFLA 2C9OA 4X8HA 1W4AA 1SVIA 3N5CA 3IKJA 5SZJA 4HLUA 2VHTA 3TVDA 1GNPA 3U3RA 4TQUS 4JVMA 4URVR 1ZMXA 3L8YA 5F9FA 4XD7D 3K8YA 3U60B 2AD5A 2QQEA 3P32A 1JQJC 2X1VA 1W5TA 4PPNA 1E2DA 4NYJQ 4PHHA 2NIPA 4MRSA 1VCMA 2WVJA 4QNRA 3IHWA 3CX7A 4URZR 3R7WB 4A6PA 4EJSA 2A78A 1AKYA 1G3IA 5EXPA 3KTAB 4C4PA 3B5JA 3NTUA 4P0TA 2QENA 3MMPA 1ESNA 1FPMA 4YMVA 5JHHB 3IGFA 2PX3A 1GDDA 1CTQA 2ZM5A 3FMFA 3UATA 3R7WA 1BMFA 2JIZA 2O8BA 4Q03A 5KNCA 4MGYR 4N3NA 2P6UA 1FP7A 2IHYA 3IHLA 2ZRKA 1NVXQ 3CF0A 4NTZA 2D74A 3BXZA 5FFMA 2FFQA 4A6XA 3NEJA 3AF4A 3TUIC 1W36C 2RGCA 1XTSA 2FSHA 1HYQA 1II8A 1RIFA 1E9SA 2GJSA 5FR2A 2IWRA 2O8DA 3CRQA 4XWOA 3C5HA 3IIMA 1KAGA 1SHKA 1GKYA 2R6GA 2X77A 2XZPA 2ZE7A 3QY0A 1G5RA 2WJHA 4MRRA 2HCJB 1D6JA 3GCGA 2BHRA 4PAQA 5D3MB 1NJGA 3X1XA 1JQLB 1CBUA 1OSNA 3HYRA 4FI3C 5TB5A 2JJ1D 4QOSA 3RWOA 3WP0A 4ZV4A 1XEXB 4TMZA 5LB4A 3SJCA 2RGEA 1ZNYA 1EFHA 2QM7A 4K8OA 2IYRA 4GMXA 2OE2A 4A2QA 2WJIA 4IOLA 2XZOA 1G4UR 5B2ZA 3BFVA 2QAGB 3D8BA 1IAQA 1L4YA 2Q6TA 2WWFA 4PZZA 4EQ6B 2XTNA 4US2R 4Q1FA 2V1UA 4BZXA 3U6KA 1FL9A 1CJKC 4KLNA 4HATA 5EE1A 2F6RA 4ZDKA 1G20E 3DVLA 2W6ID 4CEHB 1KMHB 3C16C 4LBZA 3CH4B 2FU5C 5DLQC 4CIDA 1UEJA 2IUTA 1CIPA 1E96A 2VP2A 1L7VC 4JLJA 3QG5A 4JLMA 1T4GA 1I2MA 2IXEA 4CEHA 1MR3F 3EARA 421PA 4GMDA 4M1KA 5KDOA 1P5ZB 3OEHA 1ZM9A 2CCGA 4YXWD 4D81A 5FTLA 4LSGA 3TGPA 3VR3A 4D4JA 1K5GA 1X1RA 4D4KA 4LYAA 5DHFA 2LKCA 1FFHA 4LHXA 4OQLA 1YQTA 2P2LA 4DCVA 3NWJA 1A5TA 3QKSA 1G41A 3GP8A 5DHAA 2MSEB 4CDGA 4PSVA 4V0MA 1UJ2A 4W5HA 2XB4A 3M0EA 3T1OA 4Q18A 4ACAA 1U81A 3VR6A 3RRNA 4O2LA 5JHGB 3I62A 3TAUA 4IDHA 1AZSC 2D4HA 3EC2A 2IL1A 3LBIA 1JEEA 1NKSA 2EQBA 5FOTA 1T0HB 4NCJA 3CRMA 2GJKA 5AUNB 2W00A 3BH6A 3HR8A 4YMSA 4V0OA 2ZRBA 4CVNA 3MD0A 4Q9KA 3X1YA 3DO6A 1DAFA 4LDJA 4TYYA 4F4JA 2NZ8A 5E4FA 4NYJR 1TL7C 4Q4HB 4QG7A 3I61A 3RAPR 1N5JA 3TBKA 1D9XA 2B7CA 2F1IA 1W5SA 4LYFA 1Z0FA 2BCJQ 2ZI9A 5L3QB 2XTZA 3FKSD 2ZRNA 3LQQA 4CGZA 1C9KA 3QEOA 4GFDA 1GRQA 2FWRA 4FW9A 4IOKA 4WBSA 1JI0A 5KNDA 4I4LA 1UEIA 4HYYA 3AKYA 4Q4HA 4DB2A 1U8YA 3BFKA 4TYPA 5JSZB 1OHHD 1A4RA 1NN5A 3GJ7A 1WBBA 2A3RA 4B33A 1SZPA 3ZLJA 2KI5A 1LW7A 4TLCA 2R8RA 1SXJB 1Q3TA 3X1DA 2DR3A 3QENA 4IEEA 2YZ2A 2P67A 1DPFA 2X19A 3M1IA 4OI2A 4RD4A 1IONA 1UF9A 5EZ5A 1OXVA 1BOFA 1XX6A 1OXXK 2Q9CA 1VIYA 5AUQA 2H5EA 1Q1QA 3W8NA 3NIBA 1HQYE 2X2FA 1Z6TA 3KJHA 1E2NA 4FMDF 4TMKA 1KJYA 1Z07A 2IYLD 5FBWB 4JSTA 3A58B 2G3YA 2YOFA 3JZAA 2H18A 4LOAA 4XTRA 5H68A 2BDTA 2ZREA 4M9QA 3GEIA 3EZ2A 1CXZA 3MWKA 5FUYA 5CIQA 1ZM7A 5KPJA 5E7JA 5J4KA 4POAA 4OBEA 1J90A 4OHZA 4ESVA 1ESMA 1SXJD 2J1LA 3TH5A 2BCGY 4AI6A 4LZZA 3PEUA 1G17A 1KYIA 1NMYA 1TQ6A 2ATXA 2CJWB 5G3YA 3T12A 1HT2E 2AK3A 2B7BA 1ZCAA 4ZKEA 1E94E 3B13B 1TQ4A 1XEWY 1XMVA 2FFBA 2O52A 1LB1B 2W0SA 3KXLA 4B47A 4LHYA 1XXHA 2BJVA 3GFPA 5FBRB 3ZS9A 2CJWA 2VHJA 2ZIAA 2ZVPX 3A8TA 4QXAA 5JFGA 5FL7D 4URXR 3NXSA 3RRMA 1E9CA 2H7VA 2EWWA 2QPTA 2WAXA 3GJXC 2WV9A 1KK1A 1N6KA 3GJ6A 2FG5A 3OZXA 4KO8A 4NH0A 3X2SA 1C1YA 4GP7A 3AGPA 3CPEA 2YOHA 2QG6A 4XWAA 2ZI6A 4WOPA 1IN8A 5DE3A 3U3MA 1XCGB 4Q4JA 1X6VA 2ODBA 1AIPA 1JJ7A 4F91B 2D62A 3K0CC 3AVUA 1QZXA 4BFSA 1AS2A 2VP9A 1NN0A 1TMKA 3LDAA 4L5BA 1OPXA 3CM0A 1H8HD 4C0KA 1QRAA 5BYJA 1NSTA 1P4SA 3FFBA 4FMCF 3VR1A 3IEUA 3P27A 4WA7A 3U7HB 3LW8A 1WXQA 3A37A 2J46A 4Q1BA 3U7GA 1D2NA 1W7AA 2F43A 3A6PC 5FPYA 5C18A 2GHIA 2FA9A 2BM1A 2GTPA 2H8KA 4LBWA 3LAWA 1RRCA 4B74A 1NIJA 4M22A 1JBKA 2PEZA 3HPQA 1KSHA 4G5GA 4QFMA 3ZQ6A 3QVVA 3PEWA 3VX3A 4GP6A 3NKVA 5FTMA 4NL4H 4QGGA 5K8UA 1OFIA 2HF8A 3PIRA 3A4MA 4HB2A 4IHQA 3W5JA 4HUTA 1ZINA 1OYYA 2ZVQX 3QBVA 1X86B 5EE9A 3T15A 2C9CA 4QC2A 4AKIA 1E4YA 1N6NA 1X8JA 1GNQA 2AKYA 3CWZA 4LC0A 3QKRA 4IRUB 2QN6A 2ZYVX 4IOMA 2C2HA 5F98A 1T5IA 1B23P 5DO9A 5EE0A 4MKFA 3TUZC 1D5CA 1KNQA 4ACBA 1HH4A 4M1MA 1GUAA 1WMSA 1IY0A 1EFUA 4DCSA 1U9IA 1EFCA 1ZUNB 1A7JA 1SGWA 1OH6A 2JASA 3NHAA 5JCZA 3UANA 4PQRA 1OKKA 4XH9B 4QBHA 3SNHA 4CEJA 2F7SA 2QSZA 4MUBA 4RCYA 1U94A 2QMEA 1KI6A 4C30A 3RRZA 1Z6AA 2CK3D 3I1FA 2RB4A 2OUKA 3AUXA 3GFTA 4DLZA 1UM8A 1A82A 1TADA 1Z5ZA 3CWQA 4PSKA 1XMJA 1X1SA 3CW2A 2QU8A 4Z8YA 3PQCA 3AP1A 4G5SA 3WBJA 4TSFD 4LHVA 4A8JB 4YMUA 5FPKA 1NNEA 1ZAKA 1QBKC 3ZVRA 1JB1A 2OEPA 5HZKA 2ZPTX 4TL8A 4B3CA 3GFOA 4M9SA 4EPTA 1E0KA 5F3WB 2G1JA 1N6IA 3KKPA 3REGA 2CBZA 2WSMA 1Z29A 5LDDC 3IQXA 1R0YA 2DYKA 4KBFA 4TTRA 5LBIA 5G3ZA 1F5NA 1FX0B 3RVBA 3V00A 5L3SB 1V5WA 4PPQA 4Z8XA 1KY3A 1NMXA 3CKLA 4FWIB 4JS0A 5BYKA 3HU3A 4TLEA 5KSPA 2O8EB 3A1SA 2OCBA 4WW0A 3KZ1E 1G4AE 3T61A 1U0JA 1NLFA 4Q66C 5F2EA 2ORIA 4AK9A 5FL3A 3E70C 4WAUA 5AUOB 2XXAB 3R20A 2O8EA 4BRUA 3KQUA 1KJZA 1A2KC 4D4LA 2ZJAA 4IKEA 3ZVMA 2QAGC 4D80A 2Q3HA 1Z83A 3B2EA 4OQFA 4OI0A 4IDNA 4DLWA 4TTPA 3AVOA 3K0EA 5DN6A 2HJGA 3RS0A 5DNYB 4QGFA 3QXXA 2Z6VA 3ADDA 4Q4AB 3FTQA 1JAHA 3GLIA 4B3XA 3GEEA 2HT6A 4TQ9A 4ITRC 4KSCA 2WJGA 5HKKD 4LBYA 2AWNA 1XD2A 5CK4A 1CR4A 5DSZA 1GNRA 4DSNA 3C14C 4Q19A 2IYTA 4HLDA 2GCOA 2J0VA 2W58A 1R6BX 4B44A 1NVVQ 821PA 3C4JA 1E2EA 3ZQJA 1UDWA 1ZBDA 4GNKA 4C0LA 4NZYA 3WRYC 4DB4A 3QI2A 1MO3A 2CLDX 4WZ6A 2V3CC 2I4IA 5CM8B 1Z0JA 4PO1A 3IIJA 3WYAA 1ZVQA 4D25A 4Q48A 1OIWA 4Q7KA 5FPSA 3BBPA 4DJTA 4ZIRB 3T06B 2AX4A 2GETA 4R2IA 4D0LB 1IN4A 1P72A 2EFHB 3BH7A 2J0UA 1YKSA 4AD8A 1BYIA 4FCTA 4PHFA 5JEDA 1XB2A 3QXCA 3LA6A 5CDFA 1Z2AA 4M21A 4ILEA 1ETUA 5FUXA 3WMFA 3WHKA 4JVLA 1E9BA 1U2RA 1ZCBA 1ZW6A 4L9WA 1ZM2A 2Z43A 4QBIA 4Z1MA 4BFXA 3SQWA 1YR7A 3ZZTA 3E1SA 5LB2A 1KHTA 2AK2A 3SR0A 4KLZA 3X1WA 1GTVA 1X8KA 1XEFA 4LCBA 1NVUQ 5FTJA 3DZ8A 3D3QA 1ZUIA 3OE7A 2GDJA 4NP6A 2V9PA 2WPDA 3QUSA 5JBQA 2ZJ5A 4DCTA 1R8SA 1M7BA 3R9WA 1XP8A 5FTKA 4M8NE 4TT3A 2GF9A 1KK3A 2MMGA 5TARA 2IWHA 1TAGA 5EP2A 1JXMA 4W5JA 4F92B 5EE5B 5D3QA 3BD9A 2NO1A 4AYXA 4US1R 4XSHA 3N70A 4EPYA 5C2JB 4I1UA 1RFLA 1FNNA 3SBEA 2FFAA 1RW4A 2ZSDA 4DIEA 3GLFB 5HE8A 1UKEA 2DBYA 2VF7A 4IXNA 5L3RA 1UBFA 1KI2A 1SXJC 2REXB 3TLXA 3W34A 4R71A 3AVXA 3SI7A 4Q5IA 2HXYA 4AWXA 4FINA 4HEJA 4FD2A 3PR1A 4KFTA 1R5NA 2O8FB 1YJ5A 1SVOA 1P61B 4LUCA 1Z6GA 2QTFA 1CR0A 2O5VA 4GOKA 5IK2A 1E79A 1T9HA 2BEKA 3HJNA 3OAAA 1QHSA 1LY1A 5EQTA 4D0NA 5BN3A 4GZMA 1IN7A 3MWLA 2BIFA 4Q4LA 1CJVC 1WRBA 4IEIA 2H17A 4F4IA 5BXQC 4TLBA 3PG5A 1OT3A 3DMDA 3M6AA 1F60A 2I1VB 3TJZA 2C5LA 3ICEA 2R65A 5H70A 1NY6A 4Q1DA 1US8A 4E09A 2W6JA 1XXHE 4TTQA 3KB1A 2DCUA 2FSIA 2J87A 5B30A 5FH9A 1UKVY 1UAAA 3OESA 4LPKA 1GWNA 1FOEB 3RS2A 1W4CA 5FR1A 2WSSD 3RS4A 3BWDD 2BC9A 1QHIA 1XBTA 4V02A 5P21A 3ADKA 3KXKA 4G0NA 2PH1A 3U4QA 5CYPA 4DIDA 4ZI2A 2REOA 1YRBA 3U61B 1K8RA 5FBQB 4CW7A 4M9XA 3EXAA 4RD6A 1ZNXA 4MKHA 2MSDB 5J4HA 3TE6A 5A0FA 2QRZA 2XSZA 5EXTA 1FMLA 4U5XA 4F7WA 3I72A 1P3JA 3EIHA 3W6OA 2GZDA 4LK2A 4OYHA 2V54A 1AQUA 3THXB 2FJUA 1YHNA 1G8GA 3K0AB 5AJXA 2D7DA 2BMJA 2OBMA 2ZS8A 3VR5A 2YOGA 3QOFA 1Q44A 2JJ2D 1ZU5A 4TYQA 3R8CA 1FMJA 3NBXX 3EZ9A 4Z51A 1E99A 2GEUA 3BERA 3VQTA 4PO8A 3WHLA 4W7SA 4CF7A 2P65A 3JZMA 3L0SA 1I4LD 3P26A 2JJ8A 4QJ5A 4MGIR 2N1BA 5JS8A 3B85A 1P9RA 4AURA 1W0JD 1T3LA 3ZZ0A 3HDTA 1G7SA 1X3SA 2QORA 2V6IA 2ERXA 4PAMA 3PUXA 1RPZA 2CCKA 2QE7A 2SHKA 1MOZA 2D7CA 2KBEA 3I8XA 3K0CA 3EPJA 5AJVB 5EXSA 4KFSA 2GJ8A 4S35A 1TEVA 2CVHA 3GJ4A 1G9XA 1RRPA 4TL7A 1LF5A 3BORA 4A36A 3THWB 4AYTA 1AK2A 4YMTA 2DB3A 2IS4A 2ODEA 4G5RA 3BRWD 2XOKA 3KXIA 3WY9A 2Z4SA 4QJ4A 2B8TA 2NGRA 5E7MA 4LYHA 4D4MA 4MUAA 4DC9A 1RJ9A 1U9IC 2GAAA 1M6NA 1G8HA 2IC5A 3RANA 3L43A 2IXGA 2TMKA 2YC2C 3EA0A 3QPWA 4IDOA 4U02A 4B71A 4XD7A 1VKJA 1YR8A 2ZU0C 4IDQA 4QRHA 2JA1A 2UZIR 2OXRA 3T34A 3U3KA 2RKOA 2XB2A 4KJZA 5JCPA 4B2LA 1H8ED 2I3BA 4EAQA 1XTQA 2F3RA 5KTYA 3KQHA 4LJ8A 1EFRA 3THYB 5KSYA 3CO5A 1KO4A 2PBRA 4BZPA 5IRCD 3BFXA 3DOEA 2JLXA 221PA 1O87A 3NC0C 4NYIR 2ZSBA 1T3SA 4U7DA 2H16A 1CRQA 4E07A 2ZUBA 3QSYA 3B1ZA 1TTTA 3THYA 1W1WA 3CIOA 2F1JA 5GVRA 1E1RD 2Y8EA 2GXAA 3EASA 4C3ZA 4LV8B 4D26A 1XCMA 4A8JC 5FI1B 2A5GA 3QVUA 3LO5A 5J4LA 3H0KA 2ZTSA 4B48A 4LWZA 2HLDA 3WNCA 5TXGA 1BKDR 4EPVA 1OXUA 2ZYUX 3KQKA 1VDZA 1GG2A 5SZIA 2GJ9A 2CCJA 2JLYA 3L8ZA 4P4TA 4ABYA 3BB3A 2RGAA 1J8YF 3KFXA 5J4YA 3KTAA 4JLPA 1U8AA 3GLGB 3FHCB 1QHNA 3NEYA 2JJ1A 3C41J 2H57A 3NBYC 4RJLA 3ZGXA 2EYUA 1Z47A 5M04A 1OE0A 4BWYA 3JVUA 1DBSA 2ZETA 5DI3B 4KFUA 1G6OA 3AVTA 2W2XA 2BM0A 1P62B 1OH7A 3AF3A 1EFTA 3GLIE 2ONKA 2ZRDA 1CRPA 2MMCA 3O8RA 1JR3E 1TF7A 4KITB 4PANA 5L3QA 1AS3A 3B1VA 4NPHA 1BYUA 2XNDD 3H2YA 4FN5A 5JECA 4HUQA 5EJEA 4PPGA 3U5ZB 2DWQA 2W6IA 3O8BA 2FGKA 3I8SA 4LPSA 3PUVA 4L16A 4L15A 4UNQA 2UZ3A 1NLYA 5D3MA 1Q1ZA 4HAUA 2OHFA 2RGNC 4DCNA 1NG1A 4YDSA 3ZYCA 3E2IA 1Z3IX 4QKQA 1KNXA 2WMNB 4L4UA 4AKEA 1W49A 3PUWA 1XEXA 3RLFA 3RRYA 2CL7X 1R0ZA 3BGWA 5FOXA 3L82B 3VU9B 5KHOC 4CEIB 5EUQB 4RZUA 2A2ZA 1VYUA 3AVPA 5FOSA 3CRRA 3BIFA 3T5GA 4QHYA 3ECCA 2GAOA 1VECA 1NBMD 2W2TA 2QAGA 4QHSA 1S1MA 1KMQA 5EUMA 2OCPA 1CJMA 3NBZC 3SC3A 4EQ6A 4RD2A 4YMWA 3AVYA 1NJFA 1AKEA 5CDFE 3GLHE 4HLQB 2IUSA 1ZUHA 2BMFA 2W0MA 1KMHA 3U2QA 5FI0B 4M0LA 1P60A 1W0KD 1FUUA 4NYMQ 2G77B 4PQFA 2PT5A 3I32A 5EZ6B 2R6DA 1N5IA 5AUPB 2YJTD 2QI9C 4YLGA 1GILA 4IOJA 4W5WA 2V4ZA 2JEOA 4ZCIA 2GXQA 2EU8A 3QKUA 5J5CA 3VX4A 4B43A 2X2EA 1MT0A 1CR1A 1N6HA 2V6JA 1E9FA 3T1TA 4Q1EA 1E0JA 5DGXA 1XPRA 4Q47A 3LLUA 1HTWA 1JPNA 4BQSA 3LLMA 1XD9A 1KZGB 4KU4A 3LVQE 1O3YA 2ZYWX 2NO7A 1IXSB 1TUIA 2WJVA 4OQMA 1XD8A 2FPKA 1VIAA 2GVDC 4DSOA 1Z2CA 3GMTA 2VHUA 4B3GA 4BEJA 1MABB 1SKYE 2V8OA 1KGDA 2IYWA 1OHHA 2ORVA 2ZUCA 3B7GA 2IYYA 3VHXA 4M1TA 4RZ2A 2C95A 521PA 1DAKA 4G5QA 2NO0A 4XIGS 3CRW1 4F38A 2F9MA 1GRNA 5CYOA 1U0HC 2F9LA 1RYHA 4N0EA 2RHMA 3SBDA 4RD3A 3U3OA 4C0HA 4LHWA 1G18A 1GKUB 2ZSEA 3FVQA 4ZDWA 4PHTA 2VP0A 1NIPA 3ONWA 3KDSE 3CNLA 4C9BA 2J45A 4OK6A 3CF2A 4IDPA 5CIWA 1F3OA 2RCNA 4B2IA 4BFYA 4DT1B 5CJ2A 4HZUB 1KZ7B 1J8MF 4P4SB 2ECKA 3AP2A 2ZR7A 5JSZA 4MDEA 4B35A 1E6CA 2OFOA 2OLJA 4XVQA 3AF2A 2NMVA 2G9NA 4AKGA 1P75A 4TL6A 2DPXA 2J7KA 1XCPA 5KYKA 1SXJA 4CT4B 5JWRA 3TMKA 3ZIAD 2JDID 4JZKA 3AVQA 2IHBA 2ZAOA 2ZROA 2VF8A 5HE9A 4BFZA 5HZHA 4HI0E 1P73A 3I5XA 3TUJC 3OIWA 1FUKA 3UMRA 3SFZA 3ICQB 1X8LA 2BMDA 2IW3A 3W9YA 1GIAA 4FXPA 5JLJA 4PXAA 2QEQA 5JRJA 1XTIA 3QQ5A 1CJUC 5FL7A 4QJ3A 2VYFA 2P6RA 2RAPA 1YZNA 5K8TA 1FP6A 4WVFA 3QE0A 3ASYA 2GZHA 2LWIA 1G5PA 1QHGA 3EA5A 4YONB 3REFA 4DZZA 1A1VA 2FN4A 4M1SA 2ZS9A 5ANRB 3KUCA 4KYIB 1XDBA 2WWGA 5J40A 3EWAA 1TEXA 4Q21A 4R9UC 3QEJA 2C04A 1FTSA 2VSXA 1DOAA 1E2MA 2ONJA 5DYGA 3NDBB 3WXMA 1EX7A 1H8HA 1SVWA 1YVDA 1BIFA 1TQDA 3K0FB 1G3RA 4KXFB 5BN4A 4PQYA 3T1VA 2EWVA 4URWR 3NBFA 5CITA 2CMKA 3EZFA 4GI7A 2D3WA 1NLZA 4JVNA 4NYMR 1S9HA 1XRJA 1DADA 1D9ZA 3QXHA 4L9SA 3U7EB 4B6FA 4ASUD 3K0FA 3BK7A 3KQNA 3DM9B 4H9GA 4U00A 3BC1A 2J0QA 2WBLC 4E5UA 1E2HA 4NCIA 1UADA 2QSYA 4FMDB 4PC2A 1L8QA 3CONA 3HP1A 3K53A 1YR9A 1P9WA 1G3MA 2JATA 2VL7A 4H1UA 1PLJA 3Q72A 4WXPA 2PJRA 4A2PA 1KI1A 1XMIA 4PC3A 1QHYA 1ANKA 2FE4A 3BH0A 5E95A 3T1QA 5BW8A 4MYHA 4OHVA 5KNBA 2ATVA 1RVDA 2XX3A 3GEHA 3F3YA 2DWOA 2GZAA 2JCSA 3WMGA 3IILA 3RS5A 2VBCA 1EX6A 3BAFA 4YDHB 2JAQA 1LTQA 1MO6A 1IM2A 2WM9B 3FOZA 2YV5A 1QDEA 4LJ4A 3RWMB 3I92A 1DEKA 5K8IA 1DO2A 3I4LA 2ODWA 1R7RA 4OHYA 1HT1E 1Z8FA 2QP3A 2QTHA 3LX5A 1TNDA 3PV0A 1NKTA 2OM2A 3O47A 4MRNA 2ORWA 1LS6A 4HSEA 4JLDA 3VR4A 1GAJA 1OIXA 1FQKA 4LC1A 2BBSA 2QY9A 2A5YB 1FZQA 2PLRA 3IIKA 4PHGA 2QPAA 2FSFA 4A82A 1KI4A 3I73A 4TLAA 1I2DA 2NO6A 2R62A 2CK3A 2WWXA 4TYNA 5G41A 1N5LA 3W8RA 4ZDIA 2VP6A 4LGMA 5FBVB 3SE0A 5FBLB 2ZJZA 1OV4A 1EESA 2ZQ5A 4RKFA 1E9EA 4TSFA 1OXSC 1AGRA 3KKNA 2O0KA 1XZQA 4AIIA 5LD2B 2HF9A 3FB4A 4JYCA 1GKIA 4ARZB 4QM7A 1DS6A 1I4TD 1WDTA 2OCAA 4OQNA 4PC7A 4JLAA 3FHTA 2J3EA 2OT3B 1WB9A 3CNOA 3I5YA 2VP5A 1P2TA 4FMCB 2WZQA 3UMFA 1DVRA 1XTRA 2HDNB 2X8AA 4LJ6A 1G8FA 1ZM4A 1E2PA 4Q7JB 4F4CA 2QP9X 1NY5A 2ZRFA 1G1MA 1YZKA 1SVKA 3O8DA 4V03A 1Z08A 1Z6YA 1CR2A 1Q1EA 1DAIA 3K70B 1OYWA 3A1VA 3FE2A 2C78A 3NH6A 3PVSA 5SZHB 4DLVA 3V9PA 3PUYA 3DZDA 4NKRA 4BPBA 3MFYA 3AVVA 2CVFA 1W2HA 4A8JA 1W47A 1W4RA 2VSOA 1G6HA 1CKEA 4BGDA 2EFEB 2HV8A 2N46A 1OFTA 5JZVA 3QIAA 1NP6A 1DAMA 2W2VA 3B1YA 4QNMA 2F3TA 1LS1A 1FX0A 5L3SA 3P1JA 2ZE8A 1G5TA 5HKKA 3PITA 4RFSB 5H1YA 4HB0A 1PJRA 3K70D 4QGHA 1KO8A 3CUEF 3M4YA 2QL6A 4II7A 2C96A 2XXAA 4KI0A 1P7CA 1QVAA 2P5TB 1EWRA 2VP4A 3B9QA 4JT2A 5FPHA 4RY2A 4JLBA 3IEVA 2VIIA 1VHTA 2BOVA 3SEAA 2XEXA 4B76A 2IBMA 2LKDA 2VEDA 1R5OA 4PC6A 2GXSA 4IJMA 1HE8B 5EP3A 1ELOA 5TMPA 1M74A 3ADBA 2RGNA 4Q4AA 1AM4D 3VHLB 1E2LA 1ONBA 4HAZA 4LV6A 4AYWA 1KK2A 3OIVA 3S1AB 5JJLA 4OK5A 3PCRB 2Q3MA 3BS4A 1LVGA 1DARA 1ZNZA 2CDNA 2WWHA 3H84A 4CYMA 1GSIA 4XWKA 2CL0X 4KFRA 4V0ME 3IBGA 3IQWA 4YC7A 4E03A 1Q12A 1T6NA 1GL6A 4KV9A 2R9VA 1R10A 4JL6A 2JLUA 1W36D 3RNLA 3TR5A 3ZZUA 2QGZA 2F55A 4MDFA 1E3MA 1ZU4A 3KJIA 5AJWA 4D82A 1E9RA 2FFHA 4TMWA 5FUWA 1IJFA 1BO6A 2Q0HA 3W6NA 5C1BA 4C2UA 2UKDA 1N0VC 1JXOA 3A4NA 2C77A 4D6PA 3Q3JB 2I1QA 4UXHA 3UKDA 1PV4A 2PLFA 4J0QA 4B6EA 4ZIRA 2XTMA 1J7KA 1T0JB 1TU4A 4UJ5A 3HU1A 5GVSA 2IX3A 1IQPA 5GJVC 2FMXA 3CX8A 3QG1A 2WIAA 3CZQA 1IBRA 2FOLA 1JR3D 1W46A 1SVMA 1ZC4A 2WAYA 1FW6A 3GLHB 3RYTC 4ZI3A 1VHLA 2O8CB 1Q3HA 2IYUA 3AP3A 4OK3A 1W44A 4UXIA 1ODFA 3MJHA 5DISB 1YE8A 1Z63A 3VNVA 1OH5A 3LWNA 3AEZA 1G16A 4BE7B 4KSBA 5CK5A 4JSYA 2ZJBA 4DDTA 2O8CA 4DLTA 2CHQA 3W6PA 1KI7A 1MKYA 1ZC3A 4OI4A 2QMHA 5AWFC 5B58C 4YQFA 3GJ0A 1RE0A 3GPLA 4JLNA 4A0RA 2WOOA 2WTUA 3MLEA 3EWSA 3DL0A 4H1VA 1NN1A 1TU3A 3CR8A 2PZGA 1GOTA 1SXJE 3G82C 4CT5A 4D0GA 1E0SA 2FX3A 1HE1C 2OCYC 2QBYB 1DAHA 2H1LA 1U0LA 2YVUA 4DVGA 4EUNA 1HQCA 4PZYA 1FTNA 4Q1AA 1G64A 5JWHA 1AS0A 2VQSA 2Z4RA 2Z83A 3L0IB 1MO5A 4MQBA 4MITA 4Q9IA 4QGAA 3CB4A 4B34A 4TL9A 3DKPA 4L8GA 3GLFA 2JLRA 4NYIQ 4A92A 2YYZA 4MYTA 4UNRA 2VSFA 1RRFA 4CRWB 2EVWX 1J2JA 1ZD8A 3OEEA 2O8FA 1P2VA 721PA 1G8PA 1G7TA 2EW1A 3OE7D 3SOPA 5J4VA 1II0A 3OIUA 4R98A 2CNWD 2WSSA 3FFAA 2HYDA 2NG1A 3WRXC 3FPAA 1W2GA 3A1UA 1WE2A 4Q01A 1Y3AA 4I1SA 2XGJA 3OFNA 3WYFA 4DKXA 3U44B 5AK0A 4CZ2A 4RCZA 3WYGA 1JAIA 2HYIC 2P0EA 4XVRA 2VHQA 4UNNA 1Z0IA 1PLLA 3NHBA 3RSOA 4GDFA 4MKIA 4HAYA 1II9A 4XTCS 3DOFA 4KBGA 2NQ2C 3U44A 4TQAA 5GJBA 1E1QD 3GJ3A 2GBLC 2K5UA 2QMOA 5JWOA 4LJYA 3SS8A 1K6MA 1QG4A 4DLXA 2B21A 3PXGA 4BECA 2JLVA 2R2AA 4KVAA 4M1WA 1E32A 3W3AA 4C7OB 2JJ2A 4LJ5A 3RSLA 4BLSA 3EPKA 1HV8A 4K81B 4C0JA 8OHMA 2ZS7A 4UKDA 4TYWA 3AKEA 1XPUA 4JLKA 1E4VA 2ZI3A 4DUGD 1DTSA 1EGAA 1G3QA 2IF0A 3CZPA 3HPRA 2E87A 1JPJA 4QBFA 4NMMA 2RGDA 3L2OB 1F48A 2RMKA 1W0JA 2OESA 1H65A 1LNZA 2QM8A 4B75A 5GJCA 2KBFA 3LNCA 4Q7MB 3SHWA 4ZKDA 3SHFA 4BFUA 4JKYA 3HR7A 1QHHB 5B64A 4TMXA 2DHRA 3THXA 3K0AA 3R8FA 2AFIE 3X1ZA 1TF2A 2EYQA 4X8OA 1GITA 5JI3E 1C4OA 1CJTC 1YZTA 4M2LA 5FOVA 1YR6A 2BBOA 2MSCB 4MRPA 4Q02A 1EK0A 4GZLA 4N1AA 5SZKB 5E3HA 1U99A 1VG1A 2QNRA 3GJ5A 4KAXA 4DLRA 3IO5A 4R7ZA 4LX0A 3VMFA 1F2TB 1TF5A 4ZPXA 4DHEA 3PFIA 1MRSA 2J9RA 3LQRA 5K8LA 3EIEA 2B6HA 1VCOA 4LYJA 3KKMA 1MO4A 1M7HA 3RC8A 4JVSB 5JS7A 2HUPA 2ZSAA 4GPTA 1COWD 1KSFX 2GEDA 3K9NA 1H8EA 121PA 4C0SA 4DLUA 5KU1A 3VR2A 5KUTA 2QTVB 2FEOA 4JLVA 3B82A 4DSUA 3VTKA 1JALA 3RABA 2ZU6A 3THWA 1UKYA 5G53C 3W90A 1YRAA 4JMPA 1PUJA 1RC8A 3LXRA 3Q85A 3EW9A 1OH8A 2RH5A 2V7QD 1SKQA 2R6CA 4A0GA 3ZH9B 2N42A 3QF4B 5HCIA 1JECA 3TW4A 2QRNA 2JLSA 2GESA 1SVSA 5LD2C 3LY5A 5UKDA 3GQBA 5JRZA 3LRPA 1I4DD 4URUR 1F6BA 5A4JA 3AGQA 1IN5A 4DRZA 2PCLA 1MV5A 1DG3A 2IXFA 1KDPA 2AXPA 1T91A 3EPLA 2HJVA 4HAWA 2B8WA 2FZ4A 3K9HA 1IJEA 4C2TA 1KIMA 2OBLA 2IK8A 4G5OA 2OSBA 1GL9B 4JBXA 2AHOA 4GT1A 3TK1A 4ZCLA 2C99A 3TSZA 3K70C 4R2HA 2J7PD 2OZEA 2DWPA 2ZRCA 1HUQA 3CLVA 5AJYA 2Q9AA 4XOIA 5FUVA 3QF7A 4EJSB 2D2EA 1CP2A 2ODNA 4RD1A 1EWQA 2AWOA 3C15C 1MRNA 4DLSA 2FDCA 3DHWC 1CS4C 2XNDA 1YU9A 4I1VA 2R6FA 3ETLA 4Z54A 3DDCA 3OIYA 3ZJYA 2O8BB 1D2EA 3FKQA 1SQ5A 4G1UC 1T8UA 3KKOA 3LV8A 4JJZA 4PFSA 3T35A 2XITA 4NE2A 3PEVA 4RVCA 2QPOA 3GLGA 2FH5B 3UK6A 1EFRD 5CM9C 1G291 3CR7A 3A36A 2QT1A 3QXJA 4HDOB 1ZJ6A 1YZQA 1II8B 3U6BA 2GCPA 3B9PA 3EIQA 5DI3A 2HEIA 3D31A 2O8DB 2C8VA 3ND8A 3EC1A 1DO0A 1NBMA 4Q7LA 2GCNA 2PZFA 1J99A 4G01B 1ZIPA 5L3VA 4O3MA 4Q9JA 2HLDD 1VG0B 3IO3A 4JKIA 5TVKA 2BEJA 3Q9LA 2A7QA 1Z0AA 5JEEA 1BH2A 3AM1A 5FTNA 3K9GA 1BMFD 3AH8A 2JIZD 2Z0MA 2GNOA 1NRJB 4TN1A 1W0KA 1KAOA 4YXWA 2REBA 1N6OA 3DM5A 2GKSA 1W4BA 2IEYA 2WWIA 3Q5DA 3PJRA 2O0HA 3VU9A 4D2IA 3AKDA 4CEIA 2BV3A 2RGGA 2WMOB 3IPYA 2ZANA 4I99A 2G0NA 1XJ0A 4IW3B 1OB2A 1TQ2A 1D2MA 2VRWA 3A1WA 1J70A 1Z22A 4TMTA 4X8MA 4TZ6A 3NVAA 4I1OA 1LV7A 1CF4A 5IT5A 3UMSA 4DXAA 1RRGA 5FPTA 4QM6A 1XTJA 1Q57A 2XJ9A 3LX8A 3MAAC 2LCFA 4X8LA 2RGBA 3F0TA 5B57C 4OQXA 2NPFA 4O0MA 1KI8A 2WIBA 3AB3A 4WIAA 2FPMA 1OFHA 2CL6X 3FMIA 4JJKA 5HR5A 1XPOA 5CB6A 3E5HA 3MGCA 3H86A 3TKLA 1AA9A 5TDHA 1DE0A 2PL3A 4OI1A 5J47A 4Q00A 3R9IA 3MJRA 3QPUA 4BUJA 5IHPA 3DMNA 3QKSB 2JGNA 4Q1CA 4OJQA 2ZJOA 3FKSA 1VPLA 3UWOA 2JLZA 2ZRGA 4UQOA 5DYIA 1IN6A 2OFXA 5H8WA 5JJIA 2OO7A 1NG9A 2RGXA 3K09C 1WCV1 3ZVNA 3OHMA 2PCJA 4BLQA 3KUDA 5CB8A 1VG9B 3BOSA 1MH1A 4GOJA 1QVRA 1P2SA 4P31A 5JJKA 2KSQA 3GLFE 3OEHD 1R8QA 3VNUA 1E2QA 4N0DA 1OXTA 3WMEA 3ZD6A 1MABA 4B3BA 1B0UA 2QROA 3IDQA 1N6RA 5CLLA 3HWSA 2CE7A 1UDXA 2CE2X 2DFTA 1ZNWA 3EZ6A 4HB3A 1YZLA 5ELXA 1Q1BA 2D06A 4OHWA 2ZI4A 3WP1B 3ZIAA 4M1YA 1XMSA 1S3SA 2JDIA 2VTKA 5EP1A 2L0XA 2OLKA 4GRAA 4O2RA 3UIEA 4HB4A 3SJAA 2E9SA 4HDQB 1VMAA 1R4AA 1F2UB 2PX0A 2H92A 4FCVA 4A9AA 1M8PA 1YZGA 1R0WA 3LXXA 1KO5A 3AF1A 5A5GA 2G88A 5CJPA 2GWHA 2CLSA 1F2UA 4DT1A 1T5LA 1GM5A 4HZUA 1UBEA 4IVRA 4BRWA 1RZ3A 3AF0A 4P4SA 3FYHA 5KOYA 1U90A 1OW3B 3QPVA 3R9XA 2IA5A 1G19A 3KFVA 4PX9A 5C46F 4AG5A 1DAEA 3TVTA 1RYFA 3QXSA 2B92A 4P3YA 3IUYA 4RFVA 3SJZA 3SYLA 1Z0KA 2ZR0A 2ERYA 3O8CA 1Y63A 5TV2A 2BKUA 4OKSA 2EFDB 3H1TA 3AV0B 4O25A 2ZE6A 2XZLA 1XNJA 3P4XA 1AGPA 1E2GA 3D6TB 4HDCA 2YNMA 2GJAA 1WF3A 2DY1A 4B73A 2ZI7A 3VFDA 4TWZA 4IVQA 2ZEJA 4NCKA 3MWYW 2AKAB 2F1HA 2HT1A 2GK6A 4TLDA 2P5SA 4G3XA 4Q9LA 3B78A 3SU8A 3KX2A 5FOUA 4K46A 4ASUA 3TIFA 1T8TA 1NMZA 3NDPA 1P2UA 5JI2E 2J5XA 2GBLA 2ZI5A 4JL5A 3V4RA 1YZUA 2IYXA 1XXHB 4JBWA 1VCNA 4PC1A 4B2PA 1XJCA 2DFNA 3ZVLA 2GRJA 1N6LA 1NSFA 2FZLA 3C8UA 2GA8A 4HUQB 3PENA 1VG8A 4JLOA 3B60A 2ZXUA 3EPHA 1M34E 2P3SA 1A2BA 1KDRA 2A5JA 2OFWA 4DCUA 1ZYUA 4BLRA 4BEBA 1PUIA 2PJZA 4MKGA 3B1XA 3SFVA 2JLQA 1N0UA 4Q4JB 2A5DA 4MGKR 2IT1A 4RD0A 4A0HA 4HAVA 1S9DA 4P32A 2GXUA 1KO1A 3CX6A 1NL3A 2CLCX 3U7FB 1GVNB 2WWWA 2OG2A 2AFHE 1EG7A 2V1XA 5EXXA 3MRSA 3J81k 2C9YA 4KVGA 4XSGA 4M53A 4WZBE 6Q21A 4IFEA 3CBQA 4US0R 2F43B 1IY2A 2FEMA 4IVPA 2KJQA 4P33A 2QQ0A 1XZPA 3KJEA 3TQCA 4RZXA 2OAP1 2YWHA 2ZUDA 2V55B 3A4LA 3UPUA 4GSYA 3PEYA 3ASZA 2ZRLA 3ZS8A 2A30A 621PA 1ZP6A 3W5IA 2IS6A 2Q3FA 1NI3A 1U98A 4E22A 3MG9A 4EPWA 2QUZA 4A4DA 3I3SR 3N2EA 2ZRIA 1V43A 1TX4B 4DWJA 4DDWA 4BLPA 2ZJ2A 3KB2A 3VKHA 4FCWA 2O0JA 4QHTA 4QBGB 3PUZA 5KDDA 2PZEA 3D7MA 3HYTA 3K9LA 3QKRB 4I81A 4LRWA 3SDZA 1FQJA 4EIWA 3RS7A 4S2EA 4KODA 4LV5B 1KKMA 4OJKA 1G7CA 1Q0UA 3MUFA 2BKEA 2BWJA 2ANBA 4MH0R 1AJEA 3EZ7A 4HLUC 1WA5A 1OJLA 1KY2A 2EFCB 1ZD9A 1PZNA 4KHZA 1IHUA 1HY3A 1Q22A 4GL2A 1VYVA 4ON9A 2YINC 4HLCA 3B1WA 3GLGE 2HCBA 4EJSC 4CEJB 2GF0A 4M9ZA 4ARZA 3IBYA 1BS1A 1ZD1A 1PVOA 4V0KA 3ND9A 2HXSA 1UBCA 3CNNA 4LHZA 1KI6B 4Y0AA 2J59A 2W83A 4B3DA 3FMPB 1SULA 4A15A 3QKTA 5EP4A 5DIFA 5AJZA 3AQ4A 4MGZR 4RSGA 2FSGA 3B6EA 1NBME 1Z6XA 1KJWA 4AG6A 4M1OA 4ERNA 1IOZA 1KTVA 2R44A 2UVQA 1G8YA 4UNSA 3TSOA 1GL7A 5HCNA 1WQ1R 3FWYA 5G40A 1CU1A 1XWIA 5C4MA 4WZAE 1HURA 1IXRC 3G0HA 4KYUA 2IYQA 1M2OB 3SN6A 4PO9A 2VO1A 4BLTA 1OKKD 4NCHA 5DI9A 2ZJYA 2KE5A 3LH5A 1T3HA 2ZRJA 3MCAA 3MWJA 3DKVA 2OILA 2QGNA 5CLQA 2YWFA 1DELA 2OBNA 2FV8A 3F5FA 1P9NA 2Q21A 2ZRPA 2VLIA 1W36B 4FWTA 5BQ5A 1KDTA 4RFSA 2YKGA 1JR6A 3V4FA 1KDOA 1XTKA 3UXMA 3ZD7A 2F1RA 2VHCA 4TZ0A 5EE3A 3VKGA 1CLUA 4PSAA 1S8FA 1TPZA 2WOJA 5IF9A 3FHOA 2VPPA 3H4MA 4PTLA 3KJGA 2A5FA 4FIDA 2NO9A 1ZRHA 3BE4A 1UKZA 3KL4A 3L0OA 3W3ZB 2VA8A 4URYR 5C4GB 3GLIB 1XEWX 1AQYA 2ZAMA 2OAQ1 3IPXA 3TSWA 3AUYA 3T5DA 3CPHA 3LBNA 3Q5EA 1XD2B 1VYTA 1S3GA 4QL3A 3OF5A 1GRRA 3SQXA 4JL8A 1WBDA 2KB0A 4Q9HA 2GCOB 2XAUA 5IDVA 4A2WA 1JJVA 1E2IA 1KK0A 2YWEA 2ZRMA 5AR1A 3S1AA 4PR0A 2YHSA 2XJ4A 1JR3A 2J41A 3KKQA 4GOXA 2R6AA 2XNSA 3CPJB 1M7GA 2G6BA 3JVVA 1IXZA 3P20A 1WP9A 1DAGA 1S2MA 4TMVA 3MSXA 3ADCA 2ZITA 4C0QC 4BFTA 3P4YA 3TQFA 3SYNA 1DG1G 2ZYTX 4UNPA 5DN6D 2EFGA 2YWGA 5KO2A 1P6XA 1E9DA 4BASA 4AY2A 2ZJ8A 2J0SA 2Z5FA 2J0UB 3BJIC 4ZDJA 2WJYA 5BWMA 4XJXA 1UPTA 3EX7C 1CULC 3B8HA 1EXMA 1XJQA 2WICA 3EG5A 4EFNA 2WHXA 1CEEA 2FGJA 5F9HA 3GLHA 2NOAA 2BBTA 2ZRHA 3TAHA 2IUUA 1E0AA 4AKHA 2QZ4A 3FGNA 4UXJA 3TW8B 1N25A 1OF1A 5BN5A 3AKCA 1QG2A 5DH9A 3QJYA 3LD9A 3WNBA 1KOFA 3FMOB 4HZIA 5TY0A 1N0WA 3TNFA 2OV2A 5KPDA 4HAXA 2CHVA 2Q9BA 4LJ9A 2BJWA 4MRVA 2GEVA 1ZM3A 1R0XA 4LI0A 3K09A 2GILA 3N2IA 1GFIA 2DFKB 4JYBA 2AR7A 2QMUA 1SHZA 4BLOA 4M4SA 2WKRA 4PPFA 2CNWA 4V0NA 1OB5A 2CHGA 2QAJA 1OFUX 1Z28A 3AVWA 4B32A 2G1KA 3HU2A 3BB1A 3K1JA 4Z1MD 4EPRA 3Q7PA 4DBLC 4PZLA 1AZTA 1NVWQ 2QBYA 2CEAA 3SZRA 4BFWA 2KWIA 2D2FA 1VTKA 2FPLA 2QT0A 1SKYB 4FMBB 2PEYA 1QF9A 1IY1A 1L4UA 1Z0DA 2A9KA 3NH9A 1GP2A 2CXXA 4W9MC 4MA4A 4LY6A 1XF9A 4NHOA 5KSZA 2WPDD 1E1QA 3NG1A 1S0UA 1Q20A 2ZE5A 2IS1A 1N2CE 3G5UA 3LFUA 1KI3A 1FNMA 3THOA 2AD1A 3TR0A 4TT3D 1TUEA 1E2FA 2FF7A 1G7RA 2WWYA 2QP4A 3EAQA 4DDVA 1UBGA 1LF0A 2NTYC 3Q8XB 2E1RA 3RDPA 1JNYA 4Y0VA 5E7IA 3ZDQA 1ZIOA 2GVZC 2IYVA 1HEIA 3C5CA 3DEFA 3F8TA 4DUGA 3UG7A 2PT7A 1M1YE 3QNUA 4ESHA 2AL7A 5KSOA 2P6NA 1US8B 4NU0A 3SYKA 3VAAA 4MYCA 4XVUA 1E2JA 3L0PA 1KI9A 4P4UA 5HTKA 1NF3A 1R2QA 4BZQA 1W48A 2IEZA 5GJWC 4DEXA 4DEYA 2BVNA 5L8VA 4NDZA 5KDLA 2PMDA 1NN3A 2ZR9A 1KSJA 1S1CA 4GBMA 4DLYA 4EKDA 4EPXA 2BMEA 2IF2A 5IK2D 1E79D 4IFBA 3OAAD 1S96A 2NZJA 3U4QB 2FNAA 2WKQA 1HA3A 3FDIA 3OEED 4C7OA 1U8ZA 4LJAA 1XU4A 1L2TA 3LBHA 1JEDA 3UWKA 1GZSA 4PAOA 1N3BA 2YC4C 3WNDA 1E98A 3U3JA 1N6PA 4OHXA 4V0LA 2W6JD 3OFND 2IYSA 3K0SA 2NPIA 4JIMA 2ASEA 3RS3A 4JT4A 4EFLA 1G21E 2IS2A 3QBTA 1OLOA 5LPNA 4KCGA 2AXNA 1R5BA 2QA5A 4C0BA 4A1FA 4JBYA 5GADl 1COWA 3LW7A 1KKLA 4UJ3A 5FOWA 4IXMA 1NVVR 3GD7A 4DSTA 2C98A 1G3UA 1UFQA 3CH5A 2C03A
chains in the Genus database with same CATH superfamily
1E7QA 1YDMA 1ZOOA 2OC9A 3P2YA 1AN0A 1H22A 1IYZA 2EW2A 1XFAA 2ZYAA 1GV1A 2QX8A 1N7HA 3RVOA 3LVRE 2XSZD 1T9AA 3RVZA 4UBOA 2Y1XA 3V3KA 1D8TA 1X13A 4Q9NA 3DPUA 4L7QA 3CRVA 1VRWA 1K5DA 2G0TA 4OO3A 1S4QA 3AKZA 1CEXA 2BGNA 4UHCA 2OV1A 2R8PA 2I7TA 2E4AA 3DO8A 3BHIA 4OFXA 3MMNA 5I7WA 1E18A 3EGDB 3AGUA 4RTOA 1W9MA 3ZTMA 2WHEA 4HLUA 4FGZA 5K7SA 1O95C 2QAIA 3LUBA 2BH9A 3R3XA 1IY9A 3LHFA 1Y9AA 4NYJQ 3KOMA 4URZR 4LOKA 5I51A 2IPLA 3KTAB 2PUBA 1OVMA 2SKEA 2HJRA 3QUCA 3BMCA 3IHLA 1YDFA 2UYHA 2AC2A 1EFPA 1HYQA 1AQIA 3CXUA 4HUQB 4WOJA 2R6GA 4XR9A 1RXVA 5CFZA 2L6HA 5A4KA 1XQ9A 4GMXA 1ESCA 1IPEA 2PN1A 2XZOA 4L50A 1USKA 4AL4A 2VI5A 3D2LA 4WEOA 2JC3A 3G8BA 1M2HA 1SXIA 1I36A 3WLHA 5EWJA 2FU5C 1A8IA 4IARA 2WV7A 1WOMA 4I55A 2FPXA 3IERA 4JLMA 1T4GA 3RIMA 2IPNA 3DOUA 2R7UA 3T3NA 4ZWNA 3ZHOA 2X2OA 4LYAA 4D3FA 4WHMA 3ZCQA 4E14A 1QH8B 3T1OA 3G5MA 1QFXA 2IUYA 4C6RA 1N75A 5EYPA 3WLAA 3Q0EA 1VSBA 3KQTA 2B82A 3AY7A 3R9KA 1M1UA 1F1BA 2EP7A 1BNCA 3OUZA 4UE2A 2PZAA 2ZDGA 4D9IA 2XYHA 1OFGA 3L6UA 4AUEA 3OJEA 4DPMA 4CM1A 2PQ2A 4FC6A 1UBMS 3NIBA 2DECA 1GS9A 4CLXA 3ZDCA 3S9OA 2R1VA 3JZAA 2H18A 3S27A 2YZKA 4CTKA 1BMDA 2W90A 3GG9A 1KYIA 1NLMA 3VU8A 1E94E 1XEWY 3U2LA 1LB1B 5BN4B 3HCEA 2XQKA 1KVRA 5FL7D 3TL2A 2H1OA 3TZ6A 1U1DA 1N4DA 2WYHA 3GJ6A 3CPEA 5LYJA 5KX5A 2WB2A 4XEKA 1AXRA 3M9LA 2NU6B 3DMTC 1H8HD 1RM5A 2PK3A 3VR1A 2P9BA 2DB4A 2CKMA 2AFIB 2EP8A 1H4TA 3VX3A 2CKDA 5CDUA 4NL4H 1OFIA 3KFLA 1M8GA 3VAYA 1Y3CE 3AR3A 4AS3A 1X86B 1DC4A 2QRGA 4OHPA 3J80A 3CWZA 3KYIA 2XW6A 3O9VA 3PFBA 5JQGF 4YQZA 3IB6A 1RJEA 1TJ3A 3WKAA 1RKEB 3PRJA 3NHAA 4JB3A 1U65A 1Y6JA 5FAKA 1JSLA 2ARKA 2ZDQA 4IDDA 1X1DA 1E60A 2QSZA 4MIOA 2PUHA 4I9FA 5ALJA 3TLZA 5C8XA 4CM9A 4RV9A 3CW2A 1WD7A 4G5SA 5HZKA 3TOCA 5ECYA 1U8TA 3LTNC 2EJUA 3IQXA 3OLYA 4KWCA 4KBFA 1F5NA 4Q9DA 5LMUB 5L3SB 1V5WA 4ARBA 5CI8A 5BYKA 2ATCA 5KSPA 3SKVA 5J43A 4CM3A 2IU6A 4AK9A 3E9VA 5LVAA 1UMBB 2A4MA 4Z2AA 1UQUA 2J3LA 5LQCA 1D07A 1EUQA 1ZIYA 2P7VA 1CR4A 3FLBA 3U0CA 4MWGA 5JBNA 2B30A 2PT6A 4NBTA 5LLDA 1E2EA 3HTKC 1SU8A 3QP9A 5BOSB 5CM8B 1MFPA 4PO1A 3WYAA 4Q48A 2VYVD 2JAPA 5CT8A 4Q34A 2W9XA 3CLSD 4E51A 4BDSA 3DV2A 1BCRB 4FNMA 1E9BA 2F64A 1JAFA 1GCOA 3AEXA 2Y0CA 4KN8A 3IV7A 5FKJA 2AK2A 1GXSA 3L79A 1XEFA 3D7KA 1XN4A 3QUSA 4PFQA 4ZEMA 1ZBQA 3JSAA 1FQOA 4JJIA 1C17M 5EE5B 3F6CA 2XMSA 3X43A 4YFVA 3SBEA 2JHPA 2A69F 5BUZA 4I2VA 3TLXA 3Q7GA 3EISA 4CM5A 3TM4A 4AX4A 4YV2A 2CLLB 5LIPA 3HJNA 3NBQA 1X2BA 3VU0A 3RR2A 3M6AA 3NFRA 4ZAZA 5LYYA 2QNLA 5KMGB 4UASA 3EJNA 2VJQA 3HB4X 4LZJA 1TYCA 3KOWA 5B30A 3Q15C 4XVHA 1CDOA 4U5GA 1MD9A 2ZXEA 1XVLA 3OEYA 4YBZA 1XBTA 5JAUA 3EQ7A 4RL6A 3U61B 4M9XA 4L6AA 1YI8A 4QYXA 4MKHA 2MSDB 4L73A 3U7IA 5CFRA 2LDBA 2OBMA 4EGSA 1PTJC 1XKXA 4FB5A 2D1FA 3BERA 2GWRA 5CEEA 4ARAA 3WHLA 3DONA 1I4LD 1X3SA 2ERXA 1HDGO 2OENG 2XVZA 3BMOB 3KSBC 1WMAA 3D59A 4AYTA 4H4CA 4KMOA 1A5SB 2Z4SA 1JHXA 4H27A 2Z57A 4H3VA 4OB8A 1X7ZB 1YZHA 1VKJA 2VAPA 4RWZA 1JBQA 5DCUA 1XTQA 2YQZA 5SY4A 2VFAA 2GCIA 3THYA 2XBLA 1WSWA 5GVRA 4LV8B 1ULHA 3H0KA 5I3CA 2HD4A 3V4SA 2FJ0A 1J8YF 1ZI9A 4KVZA 5J4YA 4JLPA 5CCEA 2DLDA 2DU8A 2R02A 3G2MA 4L3VA 4N6NA 4AG3A 1OE0A 2HQBA 4CDMA 1N8TA 3UWDA 4QX6A 5AQEA 3AVTA 3S81A 2BM0A 3KLPX 3PGVA 2YRXA 1CRPA 4BGEA 1P1BA 4L85A 3C87A 2FWBA 2EKQA 1O89A 1DC8A 3H16A 1Q0PA 2Y3IA 4I5DA 4ER5A 1UXKA 4YAOA 3VRCA 4DR1B 1BFUA 2PRYA 4ENQA 2IOFA 2IODA 2PYDA 1PQUA 3C98A 3NHYA 1Z6PA 3N58A 3NRJA 4CBVA 5I47A 1SCIA 1Z3CA 4M8IA 3TDNA 2XOEA 3F73A 2R6DA 5DM60 4B7XA 3BWVA 3T41A 2OECA 2HBZA 5EJ2A 2X2EA 3F6PA 3ABRB 3PJFA 1JFLA 4KU4A 2PKQO 2VT6A 4OQMA 3DF9A 2X4IA 4RA9B 1C4XA 3B7GA 1U6KA 1NJ2A 1H9GA 2ZM6B 3PS9A 2Q2QA 2C58A 1XTVA 4KMRA 2HMVA 1ITZA 3A6GA 3BE5A 4HEA1 3NKDA 5JO9A 2IXNA 4D98A 2RCNA 1EP9A 4J03A 4AL0A 5K4AA 5FO0A 5LQSA 2OFOA 2NMVA 2CF5A 3SYMA 4OM7A 2BDUA 5AD1A 2IEAA 2OFFA 4NBKA 4HI0E 4E1BA 1AQNA 4MUXA 3UICA 5CNIA 5EFZA 5L6MB 3UB3A 1FP6A 3K5WA 5EJ8A 1UJ6A 3REFA 4DZZA 3KUCA 1QE5A 4JELA 1FTSA 2Q07A 1YVDA 1BIFA 2C31A 4YAGA 1N2SA 5FUMA 4D45A 3DAYA 3IBCA 1FNSA 3EGVA 1E2HA 4Q4DA 3K53A 1ODTC 4WXPA 4PG6A 4MHTA 2CNOA 1BWPA 4MQ4A 2ZSUA 4DJAA 1IQRA 4I46A 3GEHA 4N18A 4EDFA 3O2QB 5IT4A 1DO2A 3IFSA 2Z6QA 4UHFA 1QIKA 2AMFA 5CPFA 2HNBA 1GFZA 3TLGB 3M49A 4FYHA 3W8RA 4ZDIA 1KP2A 1NM5A 3PNLA 1FMVA 3DDSA 1H9AA 1BAPA 2BAGA 1BD4A 3WRWA 2VP5A 3BTUA 1B8OA 3PJEA 2HQSA 3H9GA 3FE2A 2DJ5A 4MP3A 5F78A 1D6SA 2CVFA 3KU4A 3V6MA 1L8XA 2HHLA 2P91A 1JBEA 2CXTA 1OLXB 1LK0A 4BGDA 1U5CA 3RSQA 1KZ6A 4GSKA 3T4UA 4QNMA 2ET6A 4LLCA 3VPXA 3PITA 2P62A 3QIVA 1WSBA 1TKBA 1YB5A 1E7YA 2QF7A 1VHTA 1QAMA 4UPEA 3ODPA 2PMCA 3WWPA 3QTHA 1ORJA 4CQMB 1A41A 5K0EA 1ELOA 2I33A 1KEEB 4DOZA 2PO7A 3OOSA 4HMOA 3BS4A 3NATA 4CYMA 1E4EB 3GROA 3HMKA 2YL2A 4WJLA 3TR5A 4D9EA 1CJBA 1Y5MA 1T2FA 5C8YA 3W6NA 3JD4A 1PV4A 4J0QA 1JQEA 6ADHA 3GQVA 1J7KA 4ZQFA 1KH2A 3FOAA 3ZTTA 4Z4CA 1Y5RA 1SVMA 2RI1A 4WCDA 3LUFA 2XL6A 4HTFB 4BE7B 2P3QA 2ZBDA 4N6CA 4A0RA 2W42A 4GUAA 1WJGA 4B3JA 4JW1A 5AI6A 1LQTA 3VUEA 4JURI 1U0LA 4PRKA 4Q1AA 4MITA 2HBRA 4FZ5A 4UNRA 3TOLA 3QLUA 3OEEA 3EDRA 3OE5A 3NMUF 1JJBA 3ML1A 1KDYA 3O95A 1VOMA 3IV9A 1MQ9A 2NQ2C 4IUBS 2K5UA 2QMOA 4W8PA 3LHSA 1T25A 2R2AA 2VOEA 2HRCA 4GLLA 4DUGD 1UP6A 2FWMX 2E87A 1NFFA 3R6GA 5DMXA 5B6IA 4Q7EA 4B75A 3DLCA 4EATA 4F45A 5COGA 3HR7A 5EJ9A 1UFBA 1TF2A 3X1ZA 2MSCB 2AEEA 1IZ9A 4GZLA 3ORRA 3LQFA 3DZAA 2JPUA 2LCHA 2XLBA 1SC4A 1LLUA 2EFJA 1M7HA 2P11A 4FFSA 3KAQA 4RENA 4O0LA 4C0SA 4G4SO 4PBTA 1Y9JA 2IVFA 4IZHA 2M98A 4XPIB 5CFOA 2ZAGA 1T9GS 2ZU6A 5FPPA 2AGVA 1JTEA 4M98A 4JI4B 3WS7A 1SKQA 3RASA 3FNQA 4U5HA 5LQKA 4KAAA 1DEOA 1U1CA 3HJUA 4R2KA 5AHRA 3UK2A 3NWPA 2BTEA 1DRWA 4AJIA 5HF9A 4CU5A 2ID4A 4XAQA 4F0JA 1F06A 1SURA 2AHOA 3K70C 4Q4ZF 2JFXA 2Q8QA 3C6QA 2Q9AA 2WPNA 2ODNA 5GONF 2A9VA 1KWGA 2WEKA 3ETLA 1M8KA 2MHRA 3KKOA 3OZVA 3T5TA 1I33A 4WGGA 3WI7A 3HY6A 3NNNA 3BRQA 1ZJ6A 5KB3A 2HEIA 2C8VA 1XCLA 4G01B 3PR2B 2I2WA 2XNCA 4ZHSA 1VG0B 2WU4A 4JKIA 4LNUA 3L0DA 1JA1A 2G9UA 1N9GB 1EFVB 2FG7C 4EG7A 1IBCA 4JVOA 1OB2A 4G5YA 4BJ3A 1DWPA 2KNHA 4CDAA 2OTCA 4QM6A 5ICCA 3PXUA 2E0IA 3FOCA 3OZGA 1JVSA 4O4IF 4R9VA 3KMIA 1Q0LA 3OMXA 5EGSA 3WGTA 4C3EA 1HNNA 1N0HA 2JGNA 4W63A 2ZJOA 1VPLA 3F8WA 1YZCA 1TM7E 3ZE6A 1RAGA 1DIBA 4RZHA 3BOSA 4P31A 3IXQA 3GLFE 1XHFA 1R8QA 1B8NA 2VDNB 5BUCA 3QU2A 2H5IA 3F97A 3O7MA 4M1YA 3O73A 1VMAA 3BF8A 4A9AA 2R1ZA 4HXEB 3AF1A 3EZYA 4FSHA 1ISFA 3IAM6 2RD2A 1U90A 4UAVA 2D1RA 5F77A 1MNAA 5B6PA 3TL3A 3VXKA 2UVPA 4V3CA 2PXAA 4XLNF 2VNAA 3AIKA 1WF3A 1B1CA 3NDJA 5EIBD 1CE8A 4H15A 3F6YA 1P2UA 4PO3X 2NZXA 3SQDA 2YMQA 4PC1A 3K7DA 3ZVLA 3KJZA 2XDQB 2GA8A 1ULZA 4I4TA 4F12A 3M5DA 1UJMA 2VK2A 4V0RA 2BF7A 4Q4JB 2PMEA 1PTKA 3Q12A 3FD8A 1JU3A 1XMOB 2C9YA 4S12A 1IY2A 2Y1WA 1U3VA 4U9IS 2YHUA 3ZN2A 4BX3A 4AJJA 2ZRLA 2A0YA 3LQ4A 4MB2A 3PA6A 3AWIA 1I5NA 4INOA 4DBRA 2HV9A 4ZOLA 3KB2A 1BROA 4PYMA 2WDZA 3D7MA 3Q3GE 3E9NA 3RS7A 4S2EA 4XEUA 1C9EA 1B68A 3EZ7A 2RI0A 3SEOA 2C92A 2HM7A 4IO1A 2YLGA 3B1WA 1M2JA 4M9ZA 3R77A 3IA2A 3JASB 1IOLA 4BNFA 1TCBA 1MHTA 1NBME 1Z6XA 1JR4A 4UNSA 2CJXA 3NAQA 2COKA 3ED5A 1KS2A 3G0HA 1M2OB 4MCHA 2DHEA 5G02A 1PSDA 2CDRA 2ZJYA 1Z73A 3HKEB 3KALA 2OILA 1RWMA 1LZLA 1PGNA 2AOUA 5DHPA 2IZZA 2WABA 4YAWA 1R50A 2AXEA 4PZPA 4YV7A 3O31A 3TD7A 2B3DA 4RVDA 3NV9A 1TPZA 3GAFA 4F4BA 2XA1A 2OHJA 5C4GB 4JU8A 3V8BA 2JHCA 3LBNA 4QJIA 1UEXC 3H2GA 2YWEA 3QKIA 4YK5A 3O4VA 1AY0A 1FTYA 1SVNA 1R27A 1TEHA 5ALMA 4EO9A 5U9CA 4INJA 4TSRA 3L7BA 3K15A 4G1BA 2ZJ7A 4RTQA 2Q4EA 1O9HA 1I4EB 3Q6MA 3KB8A 2BL2A 2V5VA 1T0UA 4N7MA 1R9MA 2CBXA 1QG2A 2YVQA 4G24A 1CD5A 1NC1A 2ZIGA 5KWSA 1D03A 3D6UA 4MB0A 1OB5A 2JAXA 4LMBA 3DHEA 4B32A 4L9AA 3WAGA 2M6LA 3R6WA 1J24A 3TRDA 4ZOBA 3WKBA 1JHUA 5BV0A 3PLAE 3PLNA 5BP7A 3U40A 1OAAA 1S0UA 1H0HA 4CL2A 3TR0A 1E2FA 1DL5A 3VSEA 4YMLA 3SQOA 4Y0VA 4UATA 3DNFA 1BN7A 4HXGA 1RYNA 2BVNA 1S1CA 3BEOA 3O6VA 3TOMA 1EKYA 4JI5B 2DI3A 2WKQA 1HA3A 4HT3B 3WGJA 5JTUA 4D8YA 1M0TA 2IYSA 5D92A 2ASEA 1VMIA 3QBTA 2QTAA 3AB8A 4YIHA 2QA5A 1ZESA 3A3KA 1COWA 1KTIA 1UFQA 4KQFA 3HXMA 3ROZA 2HREA 4OX9Y 4FHFA 3BB4A 3KPHA 1KO7A 4MP6A 1M1XB 1Z2DA 4EHLA 4IAQA 2GN6A 1FRQA 4CIPA 3KQLA 1L9XA 2PX5A 3ASUA 1EG2A 2FWPA 1WOLA 1E1RA 1UM9A 3GXBA 3IDFA 3K0BA 4P34A 2J7PA 3QYAA 1BW9A 2H06A 2ACWA 2VH5R 3QF4A 2DJIA 3UG6A 3E6AA 2J3QA 3TLYA 1B1AA 4XQCA 3LS1A 3ESQA 2RHLA 1W5AA 5ICFA 4RABA 1B3RA 2HIHA 2HV6A 1DJNA 3KQWA 4XD7D 1YC5A 1E2DA 3ZV3A 4UHKA 3CX7A 2ROQA 4NR0A 4RD9A 3IOYA 4IJ5A 1L7DA 4Q03A 2GFQA 3JYYA 3ERCA 3TUIC 4R05A 4CNBA 4DNPA 4R2MA 1GYRA 3UEOA 4YS6A 3LEVA 2GJSA 4MQ5A 2XZPA 5EJMA 2JJ1D 4ZV4A 3MFNA 2DR2A 3BIWA 2E2WA 4I9UA 4RNCA 4IUDS 5GONB 5KYWA 1JE1A 1LKZA 2X9VA 2V1UA 5DN9A 2I54A 2X6RA 4WNCA 3DVRX 2R7AA 2HSEA 2Z8ZA 4IXWA 1FP4B 4IF6A 1CQJA 2O5RA 1RRKA 5AESA 2ORYA 5IVDA 2OGZA 4ETMA 1Z8DA 1J33A 5JHGB 4O2LA 3I62A 4M9RA 2D2XA 3RFXA 5AUNB 3BH6A 2FGYA 4LS3A 2ZRBA 4AO8A 5C8VA 2I3GA 3I4FA 3WKEA 4OQDA 4XCVA 1YVRA 4Q4HB 3QOXA 1EI7A 3ONEA 3KH2A 2PAAA 5EZYA 4KJXA 2ZRNA 4FW9A 4O4IB 5A03A 2O3TA 5I4IA 3BFKA 4QDZA 5KCMA 3QVYA 4RSRA 3GMDA 5EZ5A 1BOFA 1KXZA 5A1TA 3DE4X 1Z6TA 2WINI 2HK8A 2B4KA 4TX1A 2WHYA 4POOA 1YUMA 2OQMA 4R2WA 4JROA 1Z7YA 1SIBE 3MMZA 4MRAA 1E3QA 2OCXA 5JH7F 1SRQA 4ZVQA 3T12A 4O4JA 2AK3A 4ZKEA 2YUIA 2J0WA 2ZBPA 3A8TA 3NETA 2QZZA 4RVSA 4CMEA 1YULA 4JFRA 3ICOA 1EA7A 3FLMA 4GAEA 3VR5H 1T5OA 1YUBA 2CB0A 2A59A 5IX8A 4Q12A 3LAWA 4YFYA 5JPDA 5JAOA 4F2HA 5IP5A 1C1DA 1E5DA 2Q29A 3RUFA 2OZLA 3PFWO 3DBRB 1T0IA 4XWWA 2CLHB 2G72A 5HQ3B 4IIHA 1GTMA 2YR0A 1AUXA 4QC2A 2QN1A 1X8JA 5K0IA 1U0SY 2J9YB 5F98A 1WM1A 1ZCJA 3KOXA 2OJED 2D4UA 3M4CA 3NHUA 3O8LA 5EIOA 4BNYA 4RH3A 3KLBA 2EJTA 4R2LA 5TLSA 4CEJA 3L7OA 2I22A 3P9ZA 3JVDA 3O8OA 3BK1A 5BQPA 2C8LA 1Y89A 1DJQA 1O95A 1P29A 2OGSA 2W70A 4M60A 4H1TA 2VAWA 1EVJA 4NCAA 4TTRA 4BNZA 1YDIA 3FCCA 3OUTA 4WW0A 1HYHA 4TTSA 1SUIA 2ZJAA 5DLYA 2P0AA 1UQRA 4MI6A 3DC2A 4HRYA 3N3AC 4P3KA 1VLLA 4YO7A 1JAHA 2HT6A 4EK9A 2LIGA 5HKKD 4Y98A 5EJ5A 1IK6A 1MH9A 1ZMBA 3H6HA 2RH4A 5HILA 1RTTA 4QXOA 1T5BA 4OX9B 1EQUA 1Z5WA 1YCDA 3HCCA 2G6TA 1SXGA 4D25A 5CYGA 1C50A 3KQYA 4IDGA 4K6KA 4XB6B 4FCTA 3TNDA 2DFVA 3WHKA 3TZHA 4QBIA 5IC5A 3RUHA 1FFEA 4HFFB 2XUHA 4LCBA 5BSUA 1AKVA 4HWGA 1TTPB 3OE7A 1UBNA 3IEIA 2ZJ5A 5HSWA 4EBFA 1MEEA 2G36A 2PUVA 4QPCA 5TEVA 3WISA 5B4UA 2VF7A 1RT9A 4I14A 4NEGA 3QTBA 4Z9HA 5EQTA 1KQOA 4GZMA 2XF8A 4KIWA 1XRPA 5EVCA 2R65A 2JBAB 1M76A 2W6JA 3ZU5A 5HUHA 2AW5A 4RH0A 3GDFA 2FSIA 5AJUA 5LA6A 3G3EA 5E2QA 2XRFA 3AG2C 1W4CA 1QK3A 1Y82A 3U4QA 3WYCA 2QMYA 1SIOA 1WULS 1QIGA 5LFAA 4P7FA 3EDCA 5EXTA 1M6TA 4MZDA 1PL7A 4CGYA 1Z68A 4Y2RA 1UK9A 2FJUA 4JXZA 2QD5A 3G4ZA 1T43A 4IG9A 1JG2A 4JOSA 3HK2A 3D2AA 1VLTA 3OE1A 4AURA 3VMMA 4J0CA 2QE7A 1MOZA 3COYA 3O75A 4ND2A 3QVGB 3DMTA 2VHZA 1LF5A 3L3BA 4C21A 4O29A 4RIGA 4UDXX 1UZAA 3RANA 1Y9DA 3GFBA 1TRKA 4J16C 2BFWA 4IDQA 1XSEA 3VR4H 3ZXIA 5JCPA 3EHDA 2C84A 3HFSA 5KTYA 1C3JA 4P83A 1RBYA 5IRCD 4TXHA 4NYIR 1TTTA 4C2BA 3KHTA 2GXAA 2NU8A 3JV7A 5FI1B 2A5GA 5LXTA 4L4RA 3KQKA 1VDZA 3PDHA 3FNRA 4YP6A 5DM0A 3QK7A 1USVA 3JQDA 3NEYA 1ECPA 5EG5A 5DI3B 4O1IA 3FYSA 4Y67A 4MUEA 4KITB 1AS3A 3B1VA 3UCEA 3E35A 3IUEA 4PPGA 1Y6FA 4S2UA 2Z1MA 1NG1A 3E2IA 3PC7A 3ZXUB 3RLFA 3RRYA 1T9CA 1YR1A 3PKIA 3P71T 2QX4A 5F9MA 3JQEA 1BDIA 2OCPA 5LNK6 3NBZC 2Y0EA 1X1AA 3I9FA 4LDPA 1AKEA 3N74A 1SB8A 2ID7A 3RYHB 5JOQA 1RLMA 2IIQA 4JCOA 1D2RA 3WADA 4X41A 5HGXA 1CYEA 1M5TA 2HA6A 1V47A 2EILC 2G71A 3VZBA 2F8LA 2XKKA 1PFQA 3WMXA 1WV1A 5DLPA 4H3KB 3QLJA 4BEJA 1P7YA 1YAHA 3KEQA 4M1TA 3SHQA 4DLPA 5JANA 4N65A 5CYOA 3HBJA 1AV7A 1AMUA 1WXEA 3FVQA 4KPFC 1UUFA 2JFUA 3CF2A 4ER7A 3O21A 5BQHA 5KTRA 5CJ2A 5FWNA 2W6MA 3OPXA 4MDEA 1AKNA 4XIJA 2IHBA 2R8OA 1I6MA 2NUTA 2EATA 1WXHA 4B40A 1PJ4A 4D4HA 4EGCB 3ABSB 1G9TA 5FQOA 4DLNA 3H6KA 5ALVA 3KS9A 4BY9E 4WVFA 5LQAA 2VUHB 2GZHA 1Y1PA 3TGWA 1V1RA 1QHGA 3RW0A 2GRAA 2FN4A 5CH8A 4KYIB 4WBNF 2ZYDA 3DV0B 3NDBB 4KX3A 4R1TA 3L7NA 2IYOA 1M1YA 4BKPA 1TQDA 4PQYA 4URWR 1QP8A 5K0GA 3HKDA 4L9SA 4JX9A 4FIZA 2J0QA 3KYCA 1TT7A 5DKFA 2KSFA 3JTMA 3E1GA 1PTJA 4QFBA 3W5CA 3GDHA 3T1QA 2AH5A 2YRWA 2YXPX 3TFQA 3EULA 1O54A 5F3DA 4RACA 1A04A 1CUFA 4P7GA 1LTQA 4NPAA 3I92A 3JPWA 4MVSA 1PL0A 1FZQA 4Y2YA 3I73A 3HB7A 3T7SA 4UTNA 3R74A 1TK2A 3K4HA 5FBVB 3RJ5A 5MDHA 4GGPA 2O0KA 4YJFB 1XZQA 3NWEA 4PC7A 2PYIA 3TPFA 3I5YA 1P2TA 5KYNA 2WZQA 1E2PA 5FPQA 1J7JA 3EG9A 2X3FA 3PHF2 4JB2A 1NE2A 2QP9X 2QLJA 1QVZA 1W6UA 1ZW3A 2BGKA 2A92A 3CE6A 5H9VA 2VH1A 5EINA 1FCJA 2A84A 2FN7A 1JIIA 2ZTMA 3D9QX 3GNTA 2P0YA 4AF8A 1DAMA 3W4IA 1J42A 1LTHR 1V8PA 1LM3B 1L4MA 3H1AA 1IC6A 1PJRA 1M2WA 3M4YA 3FYUC 5CLIA 1SUSA 5L4LA 2ZIFA 4N0MA 2VP4A 4Y6RA 1L7PA 4OHRA 3OWTA 4K9QA 3ZI0A 1O03A 2AFRA 5C7IO 4TKUB 1P4AA 2FQWA 4YGYA 1DRVA 3DLIA 1CUEA 1OXMA 3R5TA 3EMBA 3W2IA 4DFDA 2GEKA 3CZ4A 1YJQA 1TJ5A 4E30A 2IX3A 2WD9A 2E89A 1MV8A 1CP3A 4JEHA 3K6KA 3CZAA 8LDHA 3B3QA 2WRZA 5TQ2B 2ZJ0A 5CK5A 2ZJBA 4K2AA 4NU6A 2NU9B 1M73E 4E2XA 2W2MA 3DR3A 1EDOA 1SXJE 2GZ2A 1GRVA 3RKUA 1C1XB 4G65A 4LRSB 4ZD6A 1YYJA 1HQCA 2EZ4A 2VWGA 3D8SA 1T5TA 1AS0A 1YJXA 3L0IB 3LQ2A 3CH7A 3DJFA 4X1YA 5BT8A 1SY7A 2RD9A 2YYZA 4P2BA 3VDQA 1DKMA 4V2UA 1SUWA 2LCQA 4CRWB 1J2JA 721PA 2IYFA 5ERYA 4ZZ2A 5FT9A 1WE2A 4UEJA 4MTOA 1MB3A 2HYIC 1SPBS 1OTYA 5AICA 1MA0A 2VHQA 2JZOA 3NHBA 4DVJA 3M5CA 2GBLC 3EF3A 4LJYA 3IE2A 2PLWA 4FE3A 3DDWA 1XZFA 5HWSA 1HV8A 4MW9A 5HJEA 1EGAA 3GYBA 4QWWA 3L2OB 2RMKA 2A0XA 1H65A 3CHYA 4Q7MB 1RRMA 2FR8C 4WINA 3SHFA 4YRPA 4KR0A 1QHHB 4K03A 2DHRA 3K0AA 3OLQA 4EG4A 5E3HA 3MWDB 1WDLA 2WF6A 3DEZA 1EWYA 3B0PA 2V98A 1QYXA 5KQPA 5JS7A 3I28A 2I4MA 4GPTA 2QTVB 3KJNA 2B1GA 4D3ZA 1HK7A 3E9ZA 3JQAB 5EZQA 4JMPA 3IVGA 5B1HA 1Z7BA 2WTMA 1NX6A 1FLVA 5GTDA 2JFPA 1XRRA 3IALA 2QUJA 5ESWA 2R8XA 1HYEA 5A4JA 3AGQA 3LL7A 1DG3A 4IHAA 1KDPA 5K05A 2PX6A 5H81A 3WQSB 1Z18A 3F6SA 1ZXLA 4P2GA 5JCJD 2OZEA 3V1KA 1JXAA 3VBCA 1ISGA 1EWQA 3ZWWA 1SFRA 4DLSA 5FX2A 1Q1AA 4N03A 4I1VA 1D2EA 3FKQA 2MU1A 1HDZA 3IVMA 1JG6A 3T1NA 3U6BA 4MSUA 4TTVA 3MMSA 3FSJX 3HWRA 1O97C 1N8SA 1O96B 1WVGA 3E58A 1U4NA 3BD7A 3G2LA 4P93A 3GEGA 3SDBA 2H5LA 5A6BD 3I9NA 5C80A 3AH8A 4KPEC 1F4VA 3DKIA 5E2IA 2JI8A 3IJ5A 1PJAA 3NIWA 2F59A 3C3AA 4LY9A 1Z22A 3K20A 4I1OA 2EX1A 1L5GB 1RRGA 4UW9A 1DO8A 1XTJA 4OU5A 1PYDA 4J49A 2CWDA 1WX1A 2RGBA 1Z16A 3DLAA 1QOZA 5MN6A 4IH4A 3TMAA 7MHTA 2IM8A 1OR8A 5IKXA 3GLRA 1NNSA 5HJ7A 3OP4A 4BUJA 1YB2A 3PWKA 4LHSA 1TD9A 4L5AA 2CDCA 1UMCB 2DH6A 1S7GA 1WCV1 1YFZA 3ZVNA 3UA3A 3F5SA 4B31A 3PFHA 4B3BA 4GRIA 4CS9C 2KMLA 1QCCA 2I2XB 3E15A 3JSEO 1T4CA 3NU1A 4MTFA 2E9SA 1R4AA 4G0PA 4FCVA 1FYDA 3VR6D 3I9MA 1R0WA 1PZXA 2F4NA 1NOIA 3BZBA 4HZUA 2DMRA 2UYQA 3DD1A 5L0FA 2GPSA 1Q16A 1R37A 2O0MA 1I10A 2XS8A 2FQ1A 1NW6A 1AA6A 4BAUA 2NV6A 3GUCA 1K8YB 5IAGA 2QUBA 5BV2P 3G2KA 4R5MA 3ER9A 3W8FA 3V4RA 3SQNA 3GA0A 3CLTD 5CGZA 2MHCA 3AEQA 4X3OA 1Y1SA 2R87A 3DHNA 2G5TA 3RIEA 1ZYUA 4DRYA 4C5CA 2OP0A 3OWHA 2HPVA 1S9DA 3CVWA 3INYA 2D0OB 2WWWA 3UGJA 3G0BA 3P9XA 4WZBE 3HADA 4US0R 4RZXA 2C0QA 2OAP1 3SVTA 3T7AA 4JZAA 5JSFA 4WBNB 3HL4A 3OA2A 3CYFA 1JGTA 1NI3A 5DTQA 4A4DA 1PHRA 1EVYA 4ISCA 4QHTA 4LRWA 1KJJA 1K6JA 3IQZA 4MQUA 4YMGA 4FKZA 1Y98A 2AJDA 1YS4A 2L81A 4NQZA 1BS9A 1NP7A 3C3KA 1G2QA 3GLGE 3IBYA 5CNMA 4WACA 3ND6A 2J59A 4B3DA 3AEUA 1QFMA 3W9SA 4LG1A 4ERNA 1VRVA 3UMKA 4KYUA 4Y2QA 2JHFA 1XA4A 1ZH0A 5DJ5A 3F7MA 3D2BA 3NVMB 1DELA 2QTCA 2Q21A 3UQYS 3R4CA 1T35A 1U2ZA 3OCXA 3QLEA 3TYXA 4JTCB 1KY5A 4RHXA 3TI7A 3R40A 3GWNA 2G9RA 5JG7A 4BQRA 3IDSA 2ZB8A 3JVVA 4MW6A 2UYOA 4O6MA 1APBA 1ZSYA 3SYNA 1ZN2A 2OPBA 2EFGA 2O07A 1TGVA 2DX7A 2VUIB 4ZDJA 4AJHA 3MEQA 4XJXA 5IPFA 3C8GA 4PRZA 2WICA 3IAUA 1E3WB 1MAAA 1ZVKA 1NWCA 1Y81A 2D2VA 2TS1A 1ZWLA 2EL7A 2GX6A 1CY7A 1EK6A 4ZJPA 3JRWA 1V9LA 4NNOA 4LI0A 2GM3A 3N2IA 4BLOA 2Z30A 4M4SA 2VWHA 2CNWA 3QH4A 1WDKA 3D6AA 2DY0A 4UZEA 1VLMA 1KJQA 1VTKA 3HDJA 1SKYB 2JI7A 4D3SA 2A9KA 3WA7A 3PCTA 3A6KA 1KI3A 5KNDH 1TUEA 2QP4A 1UBGA 1TA4A 5T4HA 5E7IA 3W7VA 2FPPB 2AL7A 2WJ4A 1NUUA 4MYCA 4UU7A 2AOXA 1NF3A 5JNWA 2CZCA 1SELA 4LEIA 5JSYA 3DGEC 2VCBA 1XVVA 3PUJA 2FY8A 3ZDDA 4AY5A 3PL1A 3SAJA 4MR7A 5K99A 1JHPA 2F3SA 5AW9A 1R12A 1KKLA 2M9MA 3HBNA 1G3UA 3H11A 3QIAA 2PR2A 1IXYA 4CKEA 3PQ7A 2EX4A 2XLVA 4EW2A 5DFAA 3WGMA 2O4UX 3DE5X 1FMCA 4MVJH 3ZBTA 3TRFA 4RYLA 4REMA 3HNPA 1RKBA 2WKPA 1ECBA 1MB9A 4R1SA 2J5BA 3IMKA 3QV1A 1Z06A 1V5IA 3N53A 5IT9A 3BX1A 3SMQA 3AR2A 1V9SA 2QOEA 1YC2A 4J4TA 3QBEA 5AK5A 3A4TA 3KZXA 5JPCA 3P5BA 2XRYA 3HB9A 2IQIA 3K8YA 1GCAA 2IZ1A 1Y5LA 4A6PA 2Q0SA 5FJJA 2GN9A 2E1PA 1ST3A 5EXPA 1FSFA 4EL0A 5B2FA 1OZ0A 5JHHB 1MCZA 3FMFA 2UXBB 2VS1A 3BHNA 4DARA 3O9MA 1ICIA 2R48A 5KQMA 1KAGA 2BGLA 3ETNA 3QEMB 1CEYA 2GYVA 1OSNA 2QM7A 2V58A 3CB2A 1NJ6A 3BFVA 1O7JA 5CG1A 3MILA 3EJWA 4EQ6B 2D1QA 4PLWA 4LGCA 4E1VA 1DV2A 2OEXA 1CIPA 3GZNA 1E8DA 2IXEA 4OLHA 5E1MA 2OEVA 1H1TA 3TGPA 5JD6A 2JPDA 3GWLA 2R25B 4S0XA 3EMVA 4A4AA 3OM9A 3EYWA 2GI4A 2W98A 2HN9A 3PEEA 3HKCA 1T3TA 2XZDA 3ROGA 5FOTA 1MIHA 2BFDA 5JT4A 5CDSA 4YMSA 4XYMA 1DAFA 4F4JA 3GH1A 3BDVA 1A97A 4N5IX 3S90A 2ECFA 1QLWA 3A05A 3W4KA 1YJGA 4ND6A 3I1YA 4LYFA 5AP9A 1K8XB 2XTZA 4LLEA 3BZWA 3QEOA 4IUYA 2X76A 3B1JA 4OM8A 1P3Y1 1U8YA 1U8FO 1UBHS 4E08A 3MAJA 1NN5A 2HK9A 2G76A 3PEFA 3ZLJA 3E8XA 4IEEA 1PS0A 2YZ2A 2P67A 5ER6A 1LVUA 3UPDA 1OXXK 3W8NA 4QVGA 3WLNA 2X2FA 1TJNA 4FMDF 4CMGA 2YJ3A 4OPMA 5SYMA 3GEIA 1CXZA 3BGVA 4QTUB 5CIQA 5FWYA 4LXXA 1O5TA 3PEUA 2P2GA 3KZCA 4LACB 4FDAA 3F4BA 2B7BA 5ADWA 4LFAB 3ORYA 4WFQA 1SBQA 4U5BE 2G25A 1EX1A 3WZ2A 2XM4A 2YIMA 4GDMA 3NXSA 3WL8A 3ZXXA 3OCWA 2EJVA 3OZXA 3P0RA 4CG3A 2ZI6A 3RSFA 3RRJA 3PQ5A 1ZR2A 2AF3C 2Z56A 4LF5B 2O6HA 3CM0A 2NYRA 5ALGA 4FMCF 2LP4Y 4EA9A 5DGHA 5DU2A 4NFSA 2ZULA 2BM1A 2C4WA 1TLTA 4M22A 1AF7A 1B73A 3KXDA 4DMKA 3C45A 3VPFA 3NKVA 3PQ4A 4MW1A 3FWPA 2R84A 3GUZA 4TROA 3A9TA 1UK8A 2GM5A 4DA0A 4FYPA 4OJTA 5I7AA 3KUUA 2IPAB 2WC1A 3FYDA 3E2MA 1DDGA 3G9UA 5KNBD 2AKYA 4BQFA 3ZG6A 1XVAA 3O8QB 4DJ5X 1FW8A 4ACBA 4IY1A 1HH4A 1GUAA 4LJLA 1OH6A 4EG3A 3QWHA 1MPTA</