2PX0A

Crystal structure of flhf complexed with gmppnp/mg(2+)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
258
Chain Sequence
PEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Flagellar biosynthesis protein flhF
publication title The crystal structure of the third signal-recognition particle GTPase FlhF reveals a homodimer with bound GTP.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1380 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2px0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2px0A02
2QU8A 4MRPA 4PO9A 5FTNA 2G9NA 1OKKD 5AJXA 2IWHA 4D26A 3K0AB 2ZSBA 3TW4A 3LW7A 2CE7A 3L43A 3Q85A 3RS5A 4TT3A 1YRAA 4WAUA 4B34A 1VYTA 421PA 4DLRA 2RH5A 1E9EA 1U9IC 1HTWA 2QSYA 3B13B 4JLOA 2FSIA 3WP1B 1Z6GA 4C7OB 2WMOB 4NCKA 4DJTA 4M53A 2FGJA 2ZYTX 4HB4A 3PENA 3P1JA 1E2FA 3K9HA 1VIYA 2B7CA 3ZYCA 4DEXA 1W1WA 1EGAA 4G5QA 1DEKA 3OE7A 1WCV1 2CHQA 1KO1A 2QP4A 4L4UA 5CIQA 3QI2A 4D4LA 1OIVA 2H18A 2XNSA 2QI9C 4LRWA 3SOPA 4TMVA 2JLVA 4PPGA 621PA 2WBLC 1BYUA 1Z22A 1IXZA 2YC4C 5DO9A 3O8CA 1Q21A 2Z6VA 1GG2A 1R4AA 5K8IA 3EWSA 2G0NA 4Q48A 2V4ZA 3FE2A 1G3MA 2ZVPX 2WKQA 1T6NA 1VG0B 2MSEB 2R44A 4QG7A 2W6ID 1S4QA 1J99A 2OFOA 3AH8A 2ZAMA 4EQ6A 2QGNA 3HP1A 5B58C 4Q00A 4YDSA 1SKQA 4IVRA 1UDWA 2BHRA 1KAOA 4URWR 5FFMA 5JWHA 2GJSA 4EKDA 1ZNXA 4DBLC 1CRPA 1OHHA 3AUXA 4DIEA 1ZM3A 4DDVA 1ZU4A 2JEOA 4TWZA 4Q02A 3VFDA 5BQ5A 3E5HA 3RVBA 2R6CA 3H0KA 2PLFA 3DMNA 4GI7A 2GJ9A 4GP7A 4NYJR 3BFXA 4AKEA 1G7CA 3LX8A 3WXMA 3I62A 3AF4A 2J87A 3UMSA 4OQXA 2VO1A 3AKEA 4A0HA 4DUGD 4RD4A 5J4YA 2QMHA 1Z0AA 3MWLA 3FMFA 3UG6A 1KO4A 4EJSC 4PSVA 1OPXA 1TF5A 4PC1A 1QG4A 2WV9A 2WWWA 1FX0B 1D8TA 3P27A 4I1UA 1XJCA 2GEVA 2GRJA 3E70C 4GOXA 4BRWA 2WJHA 4C4PA 1ZVQA 3Q8XB 4ZCMA 2W6JD 4IEEA 5KSZA 3VR4A 3SJAA 4RD6A 1E2NA 5CK5A 2QQ0A 5G53C 1W49A 4OHVA 2ZQ5A 1OB5A 4J0QA 2HF8A 1KKMA 4AI6A 4ZO4A 3TVDA 2RMKA 2IF0A 4FMCF 3SYNA 1C4OA 2WSMA 1UBFA 2F3RA 4P3YA 3ETLA 1HY3A 5GJVC 3LQQA 3SYKA 4LHWA 2BEKA 3HU1A 5J4KA 4V0OA 4MKFA 3NHBA 3R7WB 3NDBB 1RIFA 4OJQA 4TQ9A 4UXIA 5KNDA 1T3SA 5UKDA 1PUIA 3JZMA 3DDCA 3PFIA 4ZDKA 3VMFA 1XJ0A 1SVWA 3CNLA 1A82A 1N0VC 2MMCA 4PHTA 1CXZA 4DLXA 4HEJA 3KL4A 1EX7A 3C7KA 1NBMA 2HLDD 4GZMA 1R6BX 4A15A 3U4QA 4IDHA 4IDPA 2GXUA 4YXWD 3VQTA 4MGKR 4R7ZA 3LD9A 4Q9IA 5FPHA 5JEEA 3GLGE 3OEHD 1NJFA 2XEXA 2BEJA 4C2TA 3T34A 2AXNA 4YMSA 4ZDWA 4PSKA 3GLIB 3CRRA 2H8KA 2ZE5A 1ONBA 4PQYA 2ODBA 3TUIC 821PA 3FB4A 1FP6A 3ZGXA 3RC8A 2ZRIA 1E98A 4FW9A 4I1SA 2FOLA 1OT3A 5EQTA 3WP0A 4NCHA 1NP6A 2FEMA 1P9RA 2ZU6A 4A8JB 5JI3E 2QPTA 3QNUA 2RGBA 3ONWA 2C95A 2YOHA 3U3JA 3DM5A 1G41A 2IHYA 3LBHA 4EFLA 3A36A 1N5LA 1LV7A 4CT4B 1K6MA 1I4DD 3ZD7A 2QY9A 1MOZA 4BGDA 2JIZA 5FUWA 1CP2A 3BXZA 4UXHA 4N0DA 5H70A 1AN0A 2QSZA 3W3ZB 1TQDA 1J70A 1KY2A 4KLNA 5KYKA 2GVDC 3CH5A 3OIWA 3T1VA 1GRNA 3CX7A 4TT3D 5EP1A 2EQBA 3B1VA 5FOUA 3FTQA 1KI2A 4W7SA 2ZXUA 2DFTA 3CM0A 3EARA 3ZS8A 4ARZB 2VQSA 4URXR 1L7VC 5HCNA 2Q6TA 4PHGA 2OCYC 1GP2A 2TMKA 1HT1E 3I72A 2AFIE 4LV5B 5AR1A 5JCPA 2A7QA 1E0KA 4DB4A 5TARA 2NMVA 3B60A 2GEDA 2A5JA 1BOFA 3OE7D 3OIVA 4BQSA 4TLEA 4CT5A 3EZ7A 4D2IA 1G7SA 1CR0A 2XZPA 1NBME 1E2GA 4GPTA 1E3MA 1R5BA 1P5ZB 4LJ7A 1P3JA 4N1AA 2A5DA 3T1QA 1CF4A 4OQMA 3CUEF 4KVAA 2CLCX 4NYJQ 3IEUA 3DL0A 4L5BA 1PLKA 2B7BA 1II8B 4PQRA 4ZPXA 3C4JA 1ZU5A 4TQUS 2DPXA 3PUYA 3FHTA 4GOJA 1CR4A 1JBKA 3IPYA 5TDHA 5LDDC 4R2HA 4RSGA 4TLCA 1FQJA 2ZRHA 5EXPA 3CO5A 3GJXC 5JSZA 1P2VA 4FMBB 3TW8B 5GJBA 2KBEA 1OHHD 3CB4A 2YYZA 4Q18A 1CJVC 1YVDA 2O52A 4IXMA 2VP4A 5TV2A 1KO7A 1TUIA 1UEJA 2K5UA 2VSFA 1GTVA 4P33A 2VP9A 2GJAA 3HYRA 4EPRA 5FOTA 5DNYB 4CEIB 5FL7A 5LD2C 3KX2A 2OSBA 3VAAA 3K70D 1EG7A 3PIRA 4R71A 1SXJA 4JS0A 1OFUX 4TTQA 3MUFA 2CJWA 4UJ5A 4PX9A 3SI7A 4F4JA 3LAWA 5F2EA 3A1VA 1YZLA 2E9SA 3QKUA 3MLEA 1GRQA 3I1FA 2JLXA 4G0NA 2VL7A 1XFAA 2HXSA 2XXAA 4E5UA 4HB0A 3TSWA 1RRFA 2ZRDA 4CRWB 4D6PA 1E2PA 3KUDA 3RRYA 3ZH9B 4CEJB 4KJZA 4URUR 2DWPA 3ZVLA 3O8RA 4X8MA 3IPXA 1ZUNB 5J4LA 4KITB 4RFSA 2CVFA 3L0PA 2Q21A 3VR3A 1SVLA 5G3ZA 3PV0A 1MH1A 2RAPA 1DO0A 1CJKC 2ERYA 1G8FA 2J0QA 3EIHA 2JJ8A 3PQCA 1JJVA 1RYHA 4POAA 2AWNA 2O8BA 1C1YA 1WRBA 3QBTA 3QG1A 3QVVA 4FWIB 4XH9B 2CEAA 2W58A 5AJYA 4DLWA 4RCZA 3WNDA 4GL2A 3AGPA 1ELOA 1XMSA 3EA0A 3KKMA 1XRJA 1QHXA 3IHLA 3AGQA 4I81A 2GCOB 1NBMD 5J5CA 3AV0B 3VR6A 4B6EA 1IONA 3AVVA 2IX3A 4AYTA 4AIIA 3SJCA 4JIMA 2WJVA 3B9PA 4ZIRA 2AD1A 4FMDB 1SGWA 5JBQA 5G3YA 3LXRA 5CB6A 5L8VA 2J0UB 5GJWC 1B0UA 1OYWA 3R8FA 1NLFA 3GJ5A 1DAHA 2E87A 4TYPA 2RCNA 4Q9HA 1EFCA 5BN5A 5KU1A 1EWQA 2WJIA 4TMWA 3DZDA 4BRUA 3BH6A 4Q5IA 1Q1ZA 3ND8A 1G5PA 2ZE6A 1E9FA 1E4YA 4RY2A 1ZM4A 2VHJA 4MQBA 3QOFA 2OESA 3DEFA 3NVAA 3RRMA 3ADDA 3BERA 2FFQA 2Z0MA 4WVFA 2LKCA 4IVPA 3FYHA 4LYFA 1K5GA 1SXJE 1R8SA 3RABA 1RE0A 3BS4A 1GKYA 1G7RA 2IUTA 3KTAA 3B1WA 3CZPA 2WKRA 1XEXB 1S9DA 5D3MB 3ADCA 1JAHA 1D9XA 2F1IA 2JIZD 1MT0A 1Y63A 3AF3A 5FBRB 4A8JC 4OKSA 1X8KA 4YONB 1R8QA 1M34E 4HUQA 2QBYA 1E2IA 3TKLA 1W4AA 1ESNA 1ZD1A 2VF8A 2VP0A 3H2YA 3OEED 4OI2A 3EZ2A 4Z54A 4O0MA 4MDEA 3ECCA 1ZBDA 4LC0A 4PR0A 3EPLA 2G1KA 4BZXA 4JJZA 2JLWA 3RRNA 2BJWA 4ESVA 1W4RA 4P4SB 1HA3A 3FHCB 3A1UA 2GILA 1E32A 5L3RA 3NKVA 1DPFA 1QHIA 2OLKA 1FNMA 3GLHA 3KXIA 4AKGA 2AKAB 3NC0C 2ZJ5A 4PPFA 5TMPA 1Z0KA 1KO8A 2A78A 2A2ZA 1N6PA 4Q4AB 2CHVA 1WF3A 3Q72A 4HZUB 5EP2A 2IXGA 2VYFA 2EFHB 4FINA 4JKYA 3AVUA 3FKSA 3LH5A 2WM9B 1TF2A 2ZE8A 3VKHA 3U7GA 5K8TA 4QHTA 2C9YA 3IIJA 4Q4HA 1OFTA 2BVNA 1DO2A 2BJVA 4KODA 4UNPA 2GZAA 4M1SA 1Z8FA 3K1JA 3LLMA 4A82A 1S96A 1UPTA 3QG5A 1W48A 1KJWA 1Q1BA 5F98A 4KO8A 4R2IA 2VP5A 2ZI7A 2CLSA 4IXNA 1D9ZA 1LFDB 3RLFA 1GFIA 5SZKB 2JDIA 5FBLB 4L16A 4TSFA 1KDPA 1XEWX 3DOEA 1JALA 1LF0A 2J9RA 1G6OA 1KSFX 4TL7A 3KQHA 2QTVB 4IFBA 4OHYA 2IYLD 1VCIA 3THYA 3LBNA 3TUJC 1AZSC 2ZJYA 4XTCS 2ZS8A 5B64A 2V8OA 4XWOA 1VKJA 4DXAA 5LBIA 2WAYA 4L15A 4LGMA 4M0LA 5DYGA 2REOA 2AWOA 4XTRA 5FL7D 2JLQA 6Q21A 1GILA 5FI0B 5EZ5A 2PX3A 2J59A 3FDIA 3KJHA 4G01B 4ZDJA 1Q57A 5FOSA 3TMKA 3QENA 2JCSA 3K9GA 4DSOA 1CR1A 4C0LA 2P0EA 1YJ5A 1GSIA 2YJTD 3BORA 3PEUA 3PR1A 2QMEA 4HAVA 3SHFA 2W2VA 3W6PA 5JCZA 4FI3C 1F2UA 4IDOA 4M1TA 4Z51A 4BFSA 2OAP1 4BASA 4Q03A 1DAFA 3A4NA 2PEZA 4MYCA 3PUVA 2JJ1A 1VG8A 2VHQA 3VX3A 2H17A 2YV5A 2IS1A 2MMGA 1CIPA 4M4SA 3TAHA 1AS0A 5JS7A 4JL5A 2OUKA 2Q3FA 4PC3A 3C5CA 1KSGA 3A58B 3KKNA 1OXVA 1TL7C 4ERNA 4EQ6B 3D3QA 2QPOA 2ZIAA 1XMVA 1W5SA 1FQKA 3WMFA 5FBVB 4KV9A 1G5RA 4F4IA 1S0UA 1YE8A 2PMDA 4MGYR 4LSGA 2ZRBA 2IK8A 2BKEA 2IS2A 1HURA 2NG1A 4M22A 2H16A 3UPUA 2G6BA 1U8ZA 4MRRA 5JZVA 1VG1A 1EFTA 1FTNA 1YZUA 2B6HA 4RJLA 4EPXA 2CDNA 3GQBA 3K70B 4JKIA 4D0GA 4B3BA 4UXJA 4II7A 2OEPA 2ORWA 1U94A 4OI4A 2FA9A 4KFTA 3K0CC 1Z08A 1LVGA 1W44A 2PZGA 2V6JA 1SHZA 1YZQA 4W5JA 5IDVA 5E7MA 4BLTA 1Z63A 1XEFA 1SULA 4NPHA 4JLJA 5FUXA 2HF9A 4MRNA 1CR2A 2QPAA 3W5IA 3M6AA 2YVUA 3FKQA 1ZNYA 5K8UA 2V7QA 2ZYUX 5KTYA 1CBUA 1LNZA 2I3BA 3KXKA 1XCPA 3VU9A 5AUPB 2F3TA 4XVRA 3QXCA 4JLNA 1ZC3A 2H92A 3LXXA 1DTSA 3NBXX 4NL4H 4Q1FA 1MO4A 2XJ4A 2R62A 2R9VA 2BWJA 4LBVA 1P60A 2DHRA 2FNAA 3VKWA 3NTUA 2IYUA 2P65A 3NDPA 2HYIC 5JS8A 2A5FA 1VG9B 4O2LA 3RSLA 3GPLA 2JLUA 1YR7A 2J45A 4M1MA 3ZQ6A 3BB4A 4RD1A 1RVDA 1R0ZA 1US8A 1NN1A 2C98A 3EPKA 1YU9A 4BZPA 3QF4A 2IBMA 2VHTA 3U4QB 4ZKEA 3I73A 4KYUA 1JQJC 3JZAA 5J40A 4CYMA 1R0YA 3PITA 5IF9A 1EWRA 3NBFA 5EP3A 2AHOA 2QRZA 3SFZA 2ORVA 4TYNA 3R9XA 1TU3A 3QKTA 1FMLA 1W2GA 3A8TA 3N2IA 3QXJA 2VH5R 2ZRKA 3GLFA 3TQFA 4QJ3A 1E9AA 3CIOA 3B8HA 3KB1A 1WMSA 5TY0A 3UKDA 3AVQA 2EVWX 5H8WA 1CJMA 1NIPA 3FKSD 4TTPA 1S3SA 3GD7A 1DVRA 4KFRA 4EIWA 1NY6A 2EFEB 4YMVA 5EE5B 4YQFA 1NF3A 2PMKA 3JVVA 3K09A 3RDPA 4ITRC 4US2R 1Z2CA 1N0UA 2BMEA 4LJ9A 1IM2A 4N3NA 3K0EA 1GZSA 3CWZA 5KSOA 3TRFA 1IN7A 1CS4C 2HJGA 4MRVA 2PH1A 1E1RA 2JJ2A 3L2OB 4L8GA 3GCGA 2JDID 2I4IA 4TSFD 3O47A 5DN6A 2X2EA 1A2KC 2JLZA 5JRZA 5F9HA 4JSTA 4KLZA 1RFLA 2ODNA 3QEOA 4P0TA 3T06B 4LHZA 3MJRA 3T61A 4WBSA 4QXAA 3FMIA 3SBDA 1Z06A 1T5IA 1VHTA 2F7SA 3GMTA 3M4YA 5HCIA 4NE2A 5LPNA 5KPDA 1BKDR 4IDQA 4TMXA 3QF7A 4MUBA 2ZSAA 3SE0A 2I1VB 4ZCLA 2A9KA 4OHXA 3WY9A 1GL9B 1ZD9A 2BBTA 2N46A 4JVLA 1SZPA 2ZRPA 2ZJBA 3WBJA 4CW7A 1IHUA 1Z0DA 5A0FA 4QM6A 1KI1A 2QMUA 3DVLA 1R5NA 2J46A 5JLJA 1TNDA 2L0XA 4DVGA 1XWIA 1D2EA 3X1XA 4IEIA 3L8YA 4KXFB 4B35A 3TUZC 4I1OA 4IDNA 1E79D 1T0JB 5JEDA 1IJEA 3PUWA 2QNRA 1O87A 4LV6A 2R6GA 2X19A 3B85A 4QBFA 5FOVA 4AK9A 2WWHA 4S2EA 1Q12A 2ATXA 5CJPA 1KMHA 1YR9A 3GLGA 1CULC 2JJ1D 2YWFA 2H57A 1OH7A 3R20A 1UADA 3WMGA 4TL9A 3GLFE 5LD2B 1G17A 2GAAA 1GITA 4BFVA 3A6PC 4XWAA 1E9CA 4NYMR 2WVJA 2XTNA 4RCYA 1OYYA 4X8OA 221PA 2IW3A 4XVQA 4QFMA 5G40A 1OXUA 4BFWA 2O5VA 3T12A 4LV8B 2ONKA 4BZQA 2XGJA 4JZKA 4LBZA 5JSZB 4BFZA 1OSNA 1P6XA 1R7RA 1NLYA 4Q1AA 4X8LA 4PC6A 4U00A 5JWRA 1MABA 4C0SA 2QORA 4RD0A 1FTSA 1H8EA 3CRVA 1MRNA 5GADl 3VR5A 2GXSA 4CIDA 4JT2A 5LB2A 2YHSA 4G5SA 2IYWA 2Q9AA 2ZJAA 3AUYA 4Q4JA 4DCTA 4EPWA 2QM7A 3ADBA 3RSOA 2EWVA 4UJ3A 1H8HA 1WDTA 3KZ1E 2DCUA 1UF9A 1RZ3A 2A30A 2WSSD 3F5FA 3IO5A 4L9WA 4P32A 1J8MF 1SXJB 3T15A 4M21A 2GEUA 5HZHA 2CJWB 4AC9A 3CPHA 1NN0A 4GZLA 3LWNA 3T5DA 2IT1A 2AR7A 3MSXA 2O8CA 2VTKA 1G19A 2LWIA 3B1ZA 4YMTA 1Z0IA 721PA 4LYJA 2EU8A 2ASEA 2XXAB 2G88A 3K70C 3D6TB 1DAMA 4NMMA 2V7QD 1KI7A 4QGHA 3TIFA 3TSOA 2CMKA 2KE5A 4NONA 4TLBA 1O3YA 3KQUA 4RFSB 1KIMA 1RRPA 2FG5A 1Z2AA 3DZ8A 1MO6A 3C8UA 5CJ2A 4W9MC 1OH5A 3NWJA 2ZRMA 2C99A 3TR0A 3HJNA 4RZ3A 5CIWA 1XCMA 3TJZA 3C16C 5EXXA 5EE9A 2O8BB 2ECKA 3CF0A 4RFVA 3O8BA 1N6OA 1V5WA 1DAEA 2VF7A 4KAXA 1VCOA 2HDNB 1E94E 1ZD8A 1K5DA 1YZNA 3CR8A 3AVTA 1IQPA 2FV8A 1QHSA 4YMUA 4JLMA 2YOFA 4C0KA 4D0NA 1JXOA 4Q19A 1KJYA 4O3MA 2QENA 1UM8A 5IRCD 3NHAA 3TQCA 4JT4A 4QNRA 3EX7C 5ELXA 4LYHA 2NO0A 2BBSA 1Z0FA 3C41J 1AM4D 5HZKA 4B32A 1KI3A 4Q9KA 4ZIRB 1GOTA 3ZLJA 2V55B 3UK6A 4OHWA 1KI4A 2AK2A 3EXAA 5FR1A 3TBKA 4EFNA 4A1FA 4JYBA 3G82C 3S1AA 4XVUA 1WBBA 2Z4SA 1AQUA 2YC2C 4HUTA 3NEYA 2ZEJA 4V0KA 4YMWA 2P6NA 3TGPA 1A1VA 4BLRA 5DGXA 1Z83A 4OYHA 1LS6A 3BWDD 4PO8A 2DFKB 1ZIPA 1XD2A 3BE4A 2DR3A 4URZR 4GDFA 2H5EA 4B2LA 3SC3A 1G5TA 4HDQB 4Q21A 4XD7A 4BE7B 2P6RA 1E9BA 2JJ2D 2ZSDA 2ZRGA 3KTAB 4Q66C 2X2FA 5AUNB 1YZKA 2R6FA 3WYFA 3FOZA 2XTMA 4GNKA 1XTQA 2RGNA 2ZE7A 1N5IA 1M7BA 4HDOB 4JBYA 1XEWY 3X1YA 5DN6D 1Z6XA 4DLTA 5E4FA 1NMZA 5EXSA 4Q7JB 4HUQB 2QBYB 1X86B 2OXRA 4GOKA 1I4LD 2XX3A 5DI3A 3LQRA 2IL1A 3AKCA 4QHYA 5EUMA 2AXPA 5DIFA 2FSGA 3LNCA 5SZIA 5DHFA 1I2DA 2CK3A 2QTFA 1FOEB 2KI5A 1GNPA 1YZTA 4BLQA 1FPMA 4H9GA 2WICA 2WTUA 4MRSA 1UAAA 2P6UA 5L3QA 1SHKA 3GLHB 2XTZA 2C8VA 3RS2A 2OCPA 2IYZA 2GBLA 1M74A 2RGNC 2ZS9A 1U98A 5FTJA 2A5YB 1S1CA 2ZRAA 3KXLA 4AYXA 1OW3B 1RRGA 4NYMQ 5JECA 2V6IA 1PVOA 3ND9A 1KY3A 2PEYA 1JQLB 2UKDA 3DO6A 3U3OA 5DYIA 1G21E 4O25A 5TVKA 3EPJA 3SZRA 5KPJA 3HU2A 4GMDA 2JAQA 2XSZA 4C0JA 4S35A 2NZ8A 1W36C 1KI6A 1HE8B 2C77A 2NQ2C 4Q7LA 4Q4HB 3A37A 1DAGA 1J8YF 2BIFA 4E22A 2HXYA 5HPYB 4A2PA 3HPQA 3K0FA 1U2RA 3IO3A 1SQ5A 1KMQA 3U61B 3GJ6A 3RS7A 4LY6A 5P21A 4A2WA 5G41A 1YKSA 2Z5FA 3FHOA 4ACBA 1Q0UA 3D8BA 2QT1A 4TLAA 4GBMA 3MWKA 2GBLC 2FH5B 4EUNA 2R6AA 1KK3A 1KDOA 3LA6A 3MJHA 1HQCA 4DDUA 1TQ4A 1M6NA 4D4JA 5DI9A 4BEBA 1KZGB 3HU3A 3QKRA 4B43A 1NKSA 3K9NA 3L8ZA 1OXTA 3BAFA 2D06A 3THYB 2O8DA 4B76A 4ZI2A 4MGZR 1GVNB 1H8ED 4D0LB 1XP8A 1N6IA 3BBPA 3ASZA 2LCFA 5AJWA 4C0HA 2RGGA 2OAQ1 4AY2A 1Z07A 1H8HD 2VRWA 2H1LA 1J7KA 2AK3A 2ZUBA 3SJZA 2E1RA 1N0WA 1LS1A 1NMYA 1G3QA 4KU4A 4M9SA 1IBRA 3KKPA 2GESA 3LDAA 2GAOA 2CL0X 2ZUCA 1Z29A 1A2BA 2XJ9A 3U2QA 5FH9A 2QGZA 2ZREA 2C9CA 5JHHB 2DBYA 5KNCA 3BH0A 4PZYA 2GJ8A 4MYTA 4XIGS 3LX5A 4FCWA 4ZKDA 2ZJZA 1T9HA 2Q0HA 3LO5A 1SVSA 1NY5A 4EAQA 3EZ6A 1SXJC 1F2UB 1OE0A 5JHGB 2CLDX 5AUOB 1L2TA 2RGEA 4LJ4A 1VYUA 3FMOB 4FMDF 4DSTA 3EIQA 2ODEA 3SDZA 2O0JA 4GFDA 5AWFC 8OHMA 3DPUA 2GKSA 4F7WA 2WHXA 3SQXA 1R2QA 3U3KA 1ZAKA 2CXXA 1II0A 3DKPA 1PLJA 5KO2A 5KDLA 4QGAA 1RJ9A 3IBYA 3X1ZA 4Q01A 5JJKA 4ABYA 3UMRA 2IC5A 4PFSA 3RC3A 4URVR 4A0RA 1NVUQ 1BS1A 1A7JA 3LLUA 2QP3A 4JLKA 1VYVA 3ZIAA 3SYLA 4GP6A 4XJXA 1UKZA 2GK6A 3IILA 2GZDA 2HEIA 1JNYA 4BUJA 4TQAA 1F5NA 4QJ5A 3BRWD 2X77A 3E1SA 4OQNA 3T1OA 3KFVA 1KSHA 1RKBA 5FUVA 2ZYWX 2IEYA 2IWRA 3LY5A 5BYKA 2P67A 3TSZA 4PANA 3OZXA 4H1VA 1JAIA 1T8TA 4Z8XA 1P2SA 1X8JA 1RW4A 4A6PA 4BLPA 2BDTA 1N5JA 3B78A 2I1QA 2Q9CA 4F91B 4DRZA 2SHKA 1OFHA 5AUQA 1GRRA 3CR7A 3P26A 2YWHA 3E2IA 1JB1A 4KVGA 3AVWA 1P61B 3VU9B 3QPWA 1HUQA 2YNMA 2O8FA 2VEDA 3RWMB 3A4MA 3N2EA 2CE2X 1IOZA 3OF5A 3QE0A 2DFNA 4XD7D 3CONA 3SJBA 4FD2A 1KI8A 2QA5A 4A4DA 1IY2A 1EFUA 1OJLA 1XPUA 1GWNA 3LVQE 2ONJA 5C2JB 1IY0A 3KKOA 1J2JA 3RANA 1YR8A 4Q47A 3PEVA 3CX8A 4Q1CA 1P9WA 2D7CA 2W0MA 5FBWB 4TMZA 1CKEA 5JJIA 2REBA 1W0KA 4BFXA 1Q1EA 1HE1C 4LK2A 1EX6A 1YRBA 1KDTA 1Y3AA 1W36D 2RB4A 3U44A 1US8B 4M1KA 2CK3D 5KSYA 1KTVA 4XSGA 4I99A 3WNBA 1E0JA 1W0JA 3QF4B 4JLVA 2VP2A 1ZUIA 4DCNA 4EPYA 2NZJA 3FFBA 1HV8A 2NTYC 4C3ZA 4F92B 2F6RA 2DWOA 2ZRLA 4D80A 2CCGA 3DHWC 5F9FA 4JBXA 4GT1A 1VHLA 4KI0A 1LF5A 1DG1G 2QZ4A 4DEYA 2DFLA 2XZOA 3GLFB 2IYRA 1DAKA 2N1BA 4QBIA 2W00A 3BK7A 2QE7A 1XU4A 3JVUA 1Z47A 3TVTA 1XF9A 2XOKA 2D4HA 2BMFA 3H84A 4PZLA 4TMKA 1CTQA 4M1WA 2XSZD 3MMPA 4NCIA 2J7KA 4PPNA 3GFTA 2QM8A 2NO6A 5FUYA 3ZVNA 1C9KA 2GDJA 2FSHA 2WAXA 4JVSB 1SVKA 2D2EA 3ZD6A 4L9SA 3FMPB 4Q1EA 5IK2A 4HDCA 1KO5A 4US1R 5FI1B 4NZYA 5F3WB 1W47A 4B75A 1D5CA 1BO6A 1PUJA 1NG9A 3IEVA 1QHHA 1XTJA 2OT3B 2JGNA 3UATA 2CL7X 2Z43A 2CBZA 4AKIA 1NN5A 3Q3JB 3LW8A 3CKLA 1SXJD 1CRQA 4M2LA 2B21A 3SS8A 2Q3MA 4WZBE 1KDRA 1S2MA 3MRSA 4LYAA 1E2QA 1IN5A 4Q9JA 2FMXA 4WZAE 1E2LA 3TAUA 1G8PA 4U5XA 2ZRFA 2AD5A 4X8HA 2FFAA 5TB5A 1E2KA 1AS3A 1KJZA 1QVRA 2OCBA 3U6KA 3L0IB 1VCNA 2BM0A 1XBTA 2GVZC 1VDZA 2IYYA 1G8HA 3AF2A 1XMJA 4Q7MB 5BYJA 3D31A 4A0GA 2WWYA 4JMPA 1FZQA 1TMKA 3VNVA 4HI0E 1ZUHA 4MH0R 2J1LA 1UJ2A 1ZM7A 3TE6A 1KSJA 3MCAA 1KMHB 3GLGB 2FZ4A 1AQYA 2FPKA 4QC2A 4DLUA 3OESA 3L82B 4KFSA 1U0LA 1VIAA 1TTTA 1IJFA 2EW1A 2YZ2A 1W4CA 3BB3A 3BJIC 2NO1A 4HLDA 4HLUA 5J4HA 2F1JA 4LBYA 1X8LA 1QF9A 3AP2A 3DOFA 2QEQA 3UXMA 1QBKC 3MFYA 1T3LA 2XNDA 3UWOA 1UKYA 3QJYA 4RD2A 2VPPA 4M8NE 1R5OA 2QAGA 3B2EA 1M8PA 1MABB 3ZIAD 2D74A 4B48A 3G0HA 3PJRA 1W5TA 1XJQA 2Q3HA 4LX0A 3PG5A 1UBEA 4Q4JB 3W6NA 2J0SA 1U81A 4K46A 4F38A 2ZS7A 2ZRJA 2P2LA 3AB3A 1RPZA 4IOJA 1S3GA 4HLUC 5TXGA 2VBCA 4NTZA 1N6RA 4DT1A 4LJ5A 3A4LA 2O8CB 2FWRA 1NL3A 3QBVA 2KBFA 3KQNA 4A0FA 3QXHA 4W5WA 2ZRNA 1E9DA 1GNQA 2GETA 1Z3IX 2P3SA 4FCVA 3VX4A 1QHGA 3QSYA 2F1RA 3EAQA 1IY1A 1VTKA 2QAGC 4V02A 2F9LA 3U3RA 3THWA 2XZLA 2JATA 2FN4A 2IXEA 5JI2E 1OF1A 5B30A 5GJCA 3ZZTA 1FP7A 2NO9A 4AD8A 2JASA 3GJ4A 4OI0A 2Y8EA 3MGCA 3SN6A 4EDHA 2VHCA 2XB2A 1G18A 1NG1A 1XTRA 1JJ7A 1NLZA 4P4UA 3REGA 1S9HA 2NGRA 4RKFA 3PVSA 2P5TB 3SHWA 4KFUA 5CB8A 5EUQB 2GNOA 2WWGA 4AWXA 1U8AA 3CRW1 1W0KD 3IIMA 1UBGA 1P72A 4ACAA 4DB2A 2VA8A 1BYIA 1X1RA 1NN3A 3B5JA 2ZYVX 5AJZA 4KCGA 1ZIOA 1ZMXA 3CF2A 3R8CA 3RRZA 5FPKA 1W2HA 1W0JD 5BN3A 2GXAA 5M04A 3U7HB 1HQYE 1X6VA 1DELA 1JECA 2F43A 2KB0A 3B9QA 5C4GB 1IN4A 2W2TA 4QOSA 1ODFA 2ZSEA 3AP3A 2RHMA 3FGNA 5B2ZA 1EFRA 2HV8A 4E09A 4JLPA 3AVXA 1T91A 3S1AB 2QE7D 4PAQA 4UNQA 3U7EB 2XOKD 3BB1A 4ON9A 1E0SA 4B2IA 1FW6A 1XTIA 3DMDA 5EZ6B 5JJLA 4MYUA 4QBGB 2ZR7A 2AX4A 3F8TA 2OE2A 2JLYA 2BCJQ 4MKGA 4W5HA 2ZVQX 3SFVA 4D25A 1EXMA 3KKQA 3NEJA 3I32A 4DIDA 3L0OA 1XD2B 3F0TA 2FF7A 3AEZA 2VSOA 3IQXA 3D7MA 4JVMA 5IK2D 3U60B 4MDFA 3SNHA 1NRJB 3WHLA 4AURA 1NVWQ 1J90A 1HEIA 4Q1BA 3W5JA 1XPOA 1ANKA 1G9XA 1ZYUA 4LCBA 4V03A 5CDFA 5CLQA 1ZP6A 5HE9A 1GKUB 4UKDA 2ZI4A 2ZAOA 3K09C 4Q4LA 1WXQA 2CNWA 3KJEA 5E95A 1JEEA 1SKYE 5HKKA 1R0XA 1F6BA 2C5LA 3HR7A 3NIBA 3RWOA 2AN9A 5DI3B 4PQFA 2PZEA 4IOMA 3IIKA 1W36B 4RKEA 4ASUA 1F60A 3KJGA 4GSYA 1E4VA 3PUZA 3CW2A 2CL6X 2HCBA 3F3YA 2BBWA 1MO3A 3QEJA 3ASYA 4V0LA 1AK2A 1HT2E 5FTMA 1G8GA 4LPKA 5L3QB 1NSTA 1DBSA 2IS6A 2NIPA 2PT7A 4DCSA 4CEHA 1NVXQ 3DM9B 2IYTA 3A1TA 4UQOA 1XMIA 1G20E 2IS4A 2IYSA 4B74A 1BIFA 2HCJB 3B1XA 1Z6YA 1XX6A 3AQ4A 4ESHA 3SBEA 4DWJA 4DZZA 3GJ3A 4Y0AA 2R8RA 1KI6B 3PUXA 4OQLA 5A4JA 1EK0A 2C03A 3K0FB 4QBHA 1T3HA 2VHUA 2V1XA 4N0EA 2V3CC 3O8DA 1OH8A 4BFTA 3LV8A 4D4KA 2GCPA 4JVNA 2PLRA 1TADA 1A4RA 3CRMA 2OV2A 4PC7A 4B3XA 4E07A 3NXSA 4EJSA 4KYIB 2ATVA 1E2JA 3CF6R 3BIFA 4JSYA 3AF0A 1AGRA 2IA5A 1RC8A 1N6NA 2YWGA 3K9LA 4NU0A 2XNDD 3EA5A 3HPRA 4Q9LA 2IXFA 3QKRB 3UWKA 3Q5DA 1H65A 4V0ME 1AA9A 2O8DB 2NO7A 1XXHA 4U7DA 4HB3A 1VMAA 2IEZA 1W4BA 1Q3HA 2KJQA 2CVHA 4B33A 1Z28A 1FUUA 2ZANA 5CDFE 4TL6A 3C15C 3QPUA 2EFDB 5C18A 3THXA 2C96A 2D7DA 5EJEA 1GIAA 2HJVA 1Q20A 2BOVA 4HAWA 1Z5ZA 5L3SA 4MITA 5KDDA 1CJTC 1K8RA 5DISB 1X1SA 1CJUC 1L4YA 1PLLA 2WOJA 5CYOA 5SZJA 4WXPA 5CITA 1KGDA 5DSZA 2GJKA 1YZGA 4MGIR 2C9OA 1WB9A 3HR8A 4IRUB 1AKYA 3GEHA 3QKSA 4C0BA 3KQLA 4LUCA 3ZZ0A 2BCGY 2UVQA 2VSXA 3LRPA 5J47A 3B1YA 1U99A 1T8UA 2PJZA 4Z1MA 2EFCB 1SVMA 5FPTA 2W83A 1DAIA 2RGAA 5J4VA 1E9SA 4B3DA 4HAZA 4NYIR 3ZVRA 2C78A 2H7VA 4G5RA 5DHAA 1JPNA 2RGDA 4HLCA 4EFMA 3PCRB 1YR6A 4P31A 521PA 4CVNA 1COWA 3AKDA 1RYFA 3KUCA 2IUSA 2NOAA 2ZETA 1N6KA 1QDEA 4PZZA 2QUZA 5FL3A 1RJ9B 3BC1A 5C46F 3VHLB 4LWZA 4Q7KA 3HWSA 2AKYA 2Z4RA 5AJVB 1E96A 3VR2A 3OAAA 2OBMA 2ZROA 4FMCB 2GF9A 1KAGA 1TUEA 3UMFA 1GNRA 4JBWA 1P73A 2RKOA 5AK0A 2OO7A 4JLBA 5HR5A 4E03A 3ADKA 3IBGA 1E0AA 1LW7A 3VTKA 4GMXA 1XZPA 4LHVA 2GCNA 5HTKA 1M7HA 1F2TA 2EYUA 4QHSA 4A9AA 2HT1A 3I4LA 1EFRD 4DLVA 1N25A 1MKYA 121PA 5B57C 2XB4A 3WYGA 3EC1A 2OHFA 1QHNA 1XXHE 3H4MA 3NH9A 1XTSA 1ZNWA 1WP9A 5DH9A 3C14C 1EESA 3ZVMA 1DS6A 1E1RD 1MO5A 3AKYA 1UKVY 1DOAA 2GXQA 3U7FB 1JR6A 3Q7QA 2O8EA 2BMDA 3GJ7A 3CNNA 3VKGA 1LB1B 5E7JA 3K0SA 2O8FB 2PL3A 2VLIA 4B3FX 4OHZA 1QVAA 4YC7A 1MR3F 1G3IA 3K0AA 2D3WA 3SU8A 4LC1A 2ZJ8A 3U5ZB 3OIUA 4LJ8A 2JA1A 4KBGA 1KKLA 1W7AA 3V4FA 4DLYA 3MD0A 2CNWD 2G3YA 2FFBA 4GRAA 1DARA 4QKQA 5HKKD 4C7OA 4PHFA 3I8XA 3OEEA 3WMEA 5FOWA 2FE4A 4Y0VA 3I5YA 2MSCB 4KSCA 4D4MA 1MRSA 1OIWA 2ZI6A 1P7CA 1VECA 2RHDA 3AP1A 3EZ9A 2OFWA 3U44B 4ASUD 4G3XA 1W46A 3ZZUA 1HYQA 1AJEA 1M2OB 3EIEA 4LI0A 2FDCA 2WOOA 4K81B 3L0SA 2WZQA 5FPSA 3FFAA 2QT0A 2RGXA 2RGCA 1GDDA 3GP8A 4PC2A 3AVPA 2FU5C 1GM5A 5BN4A 2QTHA 2NPFA 1XPRA 1CLUA 3I61A 3M1IA 2PCLA 1JR3A 1Z0JA 3RNLA 4A36A 4TZ6A 4PPQA 1OFIA 1NMXA 5FTLA 1E2DA 5C4MA 4PAMA 4DDWA 4ZI3A 4M1YA 3NBYC 4QL3A 1FL9A 3KJIA 1R10A 2QG6A 4TLDA 3GFOA 4C0AC 2IYQA 4DKXA 4B3GA 1SVOA 3W3AA 2ZPTX 2OILA 4LDJA 1TX4B 2VIIA 5FOXA 5CLLA 2ZI9A 2EYQA 2OZEA 3HDTA 2JLSA 4AG5A 1TPZA 4F4CA 1QHHB 1IAQA 2ZI5A 1G3UA 1UDXA 3CRQA 2HYDA 4QGFA 5IHPA 2WIAA 1AIPA 3P4XA 4LPSA 4PHHA 3W8NA 4AKHA 1S8FA 4LHXA 2PZFA 1XCGB 4BWYA 2WJGA 4JLDA 1I2MA 3TR5A 1P4SA 1UFQA 3BOSA 1FX0A 2UZ3A 1CEEA 1UEIA 4JLAA 3CBQA 3LBIA 3X2SA 4BLOA 3SQWA 4DC9A 1TEXA 1I4TD 1EFHA 1G3RA 4LJ6A 4NYIQ 2FPMA 4TL8A 3PXGA 2J5XA 2B8WA 3NH6A 2EFGA 2N42A 3C5HA 1YHNA 2X8AA 3MG9A 3CX6A 1XDBA 1A5TA 1E99A 1BMFA 1FNNA 4QRHA 2F55A 1OXSC 4PO1A 5KNBA 4IKEA 1AS2A 2XAUA 5K8LA 3CPJB 1HH4A 1ZNZA 1NNEA 1FMJA 2BM1A 4LHYA 1VPLA 1E69A 1ZRHA 3QVUA 4MA4A 4C30A 4F93B 3R7WA 1G6HA 1M7GA 3K53A 4RD3A 4Z1MD 4LZZA 3ICQB 3REFA 2YOGA 3B6EA 3X1WA 4FIDA 1X3SA 3WHKA 2JLRA 4IOLA 1ETUA 1ESMA 2GHIA 1TAGA 4MKHA 2WPDA 1E9RA 4BFUA 1D2MA 5BWMA 1JR3E 4PXAA 1COWD 4BLSA 3R9WA 4XOIA 2DY1A 3VHXA 2V54A 2DB3A 5FBQB 3RS0A 1G7TA 3EC2A 4AG6A 2FX3A 2ZU0C 2PX0A 4CZ2A 4XSHA 2FJUA 5JFGA 1SVIA 3OAAD 1Z6AA 3W6OA 3GEIA 4UNNA 1Q1QA 1OIXA 4OBEA 5DE3A 2QAGB 5CYPA 3P20A 3GLIA 2IUUA 2D62A 4Q1DA 2G1JA 4FN5A 3CZQA 5DLQC 4QGGA 3KQKA 4JL6A 3VR1A 5FPYA 4B3CA 4C9BA 3J81k 3EASA 1Q22A 2ZR9A 1PJRA 2ZSFA 2HUPA 3GJ8A 4US0R 1OH6A 2ZR0A 4KBFA 1WE2A 4I1VA 3EW9A 2W0SA 4OK5A 3IHWA 1OXXK 1KK1A 4A8JA 4ZV4A 1ZC4A 1F48A 1L8QA 2Z83A 2GK7A 3LVRE 4DT1B 4A6XA 1T5LA 4ZDIA 1ZM9A 1JI0A 1ZJ6A 2QN6A 3FVQA 1PZNA 1N6HA 4LBWA 2ZRCA 1G16A 2IF2A 4WIAA 4WZ6A 3EPHA 4NBSA 4TYQA 4YLGA 1OLOA 1SKYB 3THWB 4MKIA 1GKIA 2WWXA 4CDGA 4B6FA 4UNRA 3EG5A 1L4UA 1KOFA 1G64A 1E1QA 3FWYA 4URYR 4JJKA 4OI1A 2OXCA 5EE0A 2LKDA 2FPLA 2BKUA 4OJKA 4DCUA 2CCJA 1U90A 1JPJA 4HAXA 1VCMA 3FPAA 4U02A 1T4GA 4LJYA 2WWIA 4PTLA 1XD9A 4NKRA 4TTRA 2YINC 1NVVR 1U0JA 2EWWA 1DADA 2O0HA 4WA7A 4DLSA 2HT6A 1B23P 5C1BA 2D2FA 3PEWA 4ARZA 3KFXA 2GF0A 2G0TA 4HLQB 3GJ0A 3X1DA 1OB2A 4G1UC 1DG3A 3KB2A 3WNCA 3BH7A 5CM9C 2F1HA 4P4TA 3QPVA 5A5GA 4BPBA 4G5OA 3A1WA 3B7GA 2FSFA 1N3BA 3NBZC 3UIEA 4K8OA 1QRAA 2J7PA 2J41A 4DSNA 1N2CE 4AYWA 1AZTA 1ZINA 3A1SA 3TLXA 2F43B 2F9MA 4RZ2A 4B71A 2OLJA 1AKEA 1P62B 2QRNA 4FCTA 5KSPA 2O0KA 3N70A 3MAAC 3QIAA 2OBLA 3P32A 1S1MA 2P5SA 4HB2A 4TN1A 1ZM2A 2ZUDA 3IGFA 4B73A 3HYTA 4JYCA 3OHMA 1D2NA 2BBOA 3ICEA 1UBCA 5EP4A 1JR3D 4HYYA 2GWHA 3GLIE 3CLVA 5FR2A 1II8A 4B44A 5EE3A 3G5UA 1E2MA 4IVQA 2R65A 4C2UA 4M9QA 2UZIR 4RZXA 3OFNA 3IKJA 3SR0A 3T1TA 1KZ7B 4DHEA 2V1UA 1XD8A 2BC9A 2G77B 4LJAA 1P2TA 3CWQA 2FGKA 3T5GA 2ZJ2A 3V9PA 2G83A 5H1YA 4Z8YA 4D82A 1OKKA 5JMTA 4QNMA 3SEAA 2QQEA 1N6LA 2PT5A 3WYAA 5KHOC 5EXTA 2ZI3A 3CNOA 3CPEA 4A2QA 4BEJA 4ILEA 2FFHA 5ANRB 3W9YA 3Q7PA 1D6JA 4CEIA 3IQWA 1XNJA 2AL7A 5SZHB 5H68A 4TYWA 2FZLA 3BGWA 1ZCBA 4ZCIA 1QZXA 2ORIA 4NP6A 2OG2A 2ANBA 1IN8A 5GVRA 3I3SR 4EPTA 3MWYW 2KSQA 3KDSE 3MWJA 3UG7A 4BFYA 1Q44A 3TK1A 3U3MA 1KNQA 5L3VA 2ZTSA 4B47A 5CK4A 5KDOA 1T0HB 1MV5A 1QHYA 4DCVA 2IYVA 2WJJA 5JWOA 4CEJA 4CEHB 4M1OA 5KUTA 1LY1A 2WJYA 4R9UC 5HE8A 1KK0A 1N5KA 1YQTA 3IDQA 2QROA 1BMFD 1ZCAA 2QAJA 1U0HC 3AF1A 1G4UR 1E79A 3QQ5A 1NIJA 1RRCA 2A3RA 3RAPR 2A5GA 3K8YA 5GVSA 3TNFA 2OCAA 2BV3A 4LOAA 4V0NA 1DE0A 3EZFA 4PAOA 5BXQC 2W6IA 4DLZA 2VP6A 2FEOA 1F3OA 3GLHE 2BMJA 2ZITA 4JL8A 2ZJOA 4NCJA 3AVOA 4NHOA 4OQFA 4EPVA 4TYYA 4IHQA 4RVCA 3RS4A 5E3HA 4R98A 2WPDD 1G8YA 2X1VA 2GCOA 1XTKA 2IYXA 1PV4A 2QP9X 3K0CA 1G1MA 4NH0A 3PEYA 5FTKA 3ZDQA 3ZQJA 3W90A 4EJSB 4G5GA 1NKTA 4OK6A 5LB4A 1NI3A 5IT5A 4I4LA 2ERXA 5KOYA 4UNSA 3QXSA 1UKEA 1GAJA 2J0UA 3WRXC 4DSUA 2IHBA 2NPIA 4DUGA 4HATA 3RS3A 1G4AE 4IFEA 1XXHB 2PJRA 3GEEA 3LFUA 1R0WA 3ZS9A 2KWIA 4FXPA 1BH2A 1P75A 2DWQA 1GL6A 2C2HA 1Z6TA 3R9IA 3WBKA 1NJGA 2WSSA 4M9XA 3IUYA 4WXRA 2DYKA 1TF7A 3BD9A 3GFPA 3THXB 4A92A 2GZHA 2W6JA 4BECA 2ODWA 1TQ6A 2YWEA 4HAYA 5L3SB 1ZW6A 1WBDA 4CGZA 2ANCA 4DDTA 2PBRA 3ZJYA 2R2AA 4FWTA 1NVVQ 4MYHA 3V00A 4M9ZA 4C0QC 2W2XA 2OM2A 3QXXA 1TU4A 4WOPA 1IN6A 1XEXA 4NCNA 5D3MA 1M1YE 4QJ4A 4IOKA 3V4RA 3QKSB 5E7IA 3NG1A 1IXRC 2WWFA 3N5CA 3W34A 1IXSB 3I8SA 1E1QD 3NC1C 2CHGA 3Q5EA 1XB2A 4RZUA 3WRYC 4TMTA 3T35A 1Q3TA 1TQ2A 5JRJA 5EE1A 3CH4B 3BFKA 2QMOA 5BW8A 2HLDA 2C04A 4P4SA 1KNXA 2WMNB 1NSFA 2GA8A 4YXWA 3RYTC 2CCKA 1FUKA 1II9A 4HAUA 3OEHA 3QY0A 3AM1A 2V9PA 1WA5A 4HZIA 5D3QA 3VNUA 1E6CA 2B8TA 4OK3A 3H1TA 1JXMA 2GTPA 1V43A 1WQ1R 2REXB 1KI9A 4Q4AA 2J7PD 2OBNA 3I92A 4OL0A 4HZUA 2PCJA 4TZ0A 4WW0A 3DKVA 2MSDB 1FFHA 3U6BA 4B2PA 2J0VA 1LTQA 3QUSA 3BFVA 2AFHE 1CU1A 2QL6A 4HSEA 3W8RA 1TEVA 1F2TB 1KK2A 3H86A 4D81A 2Q9BA 4KHZA 1P2UA 2YKGA 3M0EA 3AVYA 2J3EA 4H1UA 4PSAA 4YDHB 4NDZA 3RHFA 1U9IA 4V0MA 2XITA 1KHTA 2OFXA 1QG2A 2WIBA 3P4YA 1GUAA 4KSBA 4O2RA 3UANA 1E2EA 2ZM5A 1U8YA 3B82A 1GL7A 1KYIA 3OIYA 4CF7A 1G291 3OFND 5CM8B 3THOA 4QM7A 1AGPA 2B92A 1JEDA 1OV4A 4IW3B 3Q9LA 2O8EB 4MUAA 3EWAA 1XZQA 4IJMA 4XWKA 1P9NA 2R6DA 3TH5A 1E2HA 2WKPA 3I5XA
chains in the Genus database with same CATH superfamily
3MUNA 1VB3A 4WAUA 3VPBA 3WWCA 1HTWA 3ESCA 1R5ID 4EOGA 3O94A 1Z6GA 3HXTA 1EBBA 2I34A 2B35A 1YS2X 4CN9A 2B7CA 4R8LA 5A3RA 1E1NA 1DEKA 2BY4A 2CHQA 4K9OA 1SBTA 4IGAA 4DZRA 3BWXA 3SOPA 4MYSA 2AOTB 5CBPB 2NUBA 5EA2A 2C7GA 3FHDA 3FW1A 3IDZA 1T6NA 2R44A 1J99A 3RSFA 1EUZA 3IJ5A 2RI0A 4X3PA 2WVHA 4URWR 3TLAA 3WXBA 1NYTA 3R6TA 4I8IA 3WGMA 4CLEA 1PFYA 1Q0HA 4NYJR 1JP7A 4GP7A 1XGKA 1L3PA 3OQPA 5A3VA 3WWZA 4CM8B 4EBBA 4R6WA 1D1SA 4PC1A 4Y6RA 2WJHA 4UTRA 3AETB 3LS2A 1V3QE 4RD6A 5CK5A 3PC2A 3TVDA 4QASA 3ZJVA 1C4OA 2FPIA 3R3VA 2FZ5A 1JFFB 3H9JA 4ER0A 3F8SA 1LK7A 2EGUA 4JYAB 4C3OB 2GXUA 3OQVA 4EDFA 5FPHA 4JBGA 1DJNA 1F8UA 4C2TA 1ZL2A 3UHJA 3EH1A 2ODBA 2WJ3A 3TUIC 1IUKA 1C3OA 5JQGB 3ZGXA 4PX5A 2ZPAA 5DNVA 4MIOA 3EISA 3GY0A 1E1CB 2NT4A 3RRJA 1N5LA 3Q11A 4WKNA 5DGDA 1QK4A 4J0JA 1JQEA 1X80B 1FAPB 1GRNA 2B1JA 2CXHA 5EP1A 4PFKA 2JK0A 3WOVA 1GPYA 3N7AA 5B2EA 4QPNA 5JCPA 1E0KA 1PTJA 2GEDA 3UMIA 1BOFA 3ANLA 3M7IA 2VDJA 3ELDA 3ZHUA 1EDBA 4HGPA 2WMDA 5TIIA 4D02A 1RBYA 3HNOA 4NYJQ 2O4CA 3O92A 2VWHA 2ACWA 4ZAZA 4TWJA 4G89A 5I9MA 1BS9A 5FWYA 3FGOA 5KWSA 1CR4A 4W7HA 4IICA 4MV0A 3DD7A 3OJXA 3PNKA 2BUAA 3KPYA 4NEQA 4WUTA 1NF8A 4MUIA 3KX2A 2OSBA 2BE7A 4E94A 3UHOA 3S28A 4XXHA 5GGXA 4W5NA 1XFAA 4ES6A 3OLCX 1JF8A 3UMJA 3ZVLA 3FX2A 3HNPA 3VTZA 2QG4A 4HQLA 4QUAA 4KK3A 4XH9B 3LGSA 4BLWA 3HTXA 4ZU3A 1QU3A 1XMSA 3OZEA 4B6EA 3SK0A 4ZFNA 2HJWA 5JBQA 3SIWA 2H7YA 4G9GA 2NN3C 2P9CA 4H15A 3RVRA 1AMUA 4CDRA 3VRHA 4Q5IA 2D0OB 3OT1B 4PYLA 2C2BA 1AHPA 3RRMA 1W5EA 4LYFA 1K5GA 1R8SA 4U9EA 3DZAA 5IJ9A 4JTCB 1YV9A 1R8QA 1FS4A 4HUQA 1TWCA 2HJSA 2VDVE 1ZD1A 1MENA 1U65A 3OEED 3AM3A 1MNAA 5JPDA 3EPLA 2Y1EA 1HA3A 2AKAB 3ZD8A 1C3LA 1NKVA 1OX4B 4XEHA 4EHDA 1TCVA 3VKHA 5BNFA 1PSDA 5KS2A 3FTPA 4UC0A 5A1TA 4RAOA 1WZIA 3QG5A 1Q1BA 4M9RA 2VP5A 5FBLB 2ENWA 4PZPA 4TTSA 4LYYA 4AZ3B 1VCIA 3LBNA 2WFLB 4DXAA 3QFCA 4ZQGA 1C14A 3HXOA 1NVKA 1YLMA 2QRJA 5FOSA 5DW0A 2B5OA 3LL4A 2EINC 3MN1A 2PGXA 4PYQA 4YPFA 3WBFA 1LBSA 1N7IA 2P0EA 2YJTD 3UUWA 4YV2A 3UCFA 3DLTA 4BFSA 1H5QA 3SOZA 1Z7Qc 1AE1A 5GY7A 3EDOA 2YDXA 3A58B 3L84A 2AFHA 2X4IA 3VSCA 1I7PA 3IALA 1ZESA 3T3IA 4X1YB 2DX7A 3TO5A 1PJ8A 2QZPA 2GBFA 1LV8A 4OM7A 1TW2A 3ZN2A 2VXYA 1E6MA 4MQMA 1JA1A 2IELA 1EHIA 3CMCO 4RVNA 4YJFB 3LSYA 3I23A 5CAEB 3R76A 4JLJA 4XYBA 4MUXA 3VU9A 2YKZA 4H4KC 1EWYA 1Y6GA 2Q7RA 3L93A 3G59A 1F7UA 3NDPA 4Q39A 3ELUA 1YRWA 2J5QA 4CHGA 1XXLA 4D44A 3E9NA 3GEGA 5EP3A 2QRZA 3R9XA 2D13A 4G67A 3T0IA 4XLNF 3ILYA 1E9AA 2YASA 3PA6A 4TTPA 1S3SA 3FNHA 3JQGA 2XL4A 5JZ9A 4WKBA 1BU5A 5IBRA 1GZSA 5IHXA 1B8UA 1E3LA 3RSGA 4MRVA 4TVOA 2CXUA 1RQRA 1BCRA 4TKZA 5F9HA 1G8MA 1N2OA 3U39A 1T0BA 4NWIA 4OAPA 3O1IC 2ZFUA 2WL8A 3GMTA 4PLPA 1QWSA 1TR2A 4NULA 3WLTA 1SZPA 4EX6A 1HF3A 2V5AA 1OTXA 2GHRA 1DFHA 3AJEA 3MILA 3PLAE 3HVRA 3KLNA 1SKAA 4TL9A 2WA1A 2CVPA 2Y3BA 2AJBA 2HJRA 1S01A 5A9SA 3D6NB 1ZPDA 4XVQA 3NWBA 3PNVA 2C2GA 2OXEA 4LBZA 4JP2A 4BFZA 1BE6A 4U00A 1MABA 4HH0A 4H1WA 2EF1A 4G5SA 3AUYA 2DCUA 3NRBA 1SXJB 5IT0A 2W9YA 1MJGM 4GYJA 1ZHHA 2F48A 4D0RA 5FDFA 2G88A 4NMMA 3AUSA 4WCFC 1NT4A 1SN7A 1RZRA 4EY6A 1TD1A 5ED4A 3RSHA 1JLMA 5DFAA 2ZB8A 3DV9A 3AGTA 5EE9A 4RSRA 1ST3A 4GNRA 1V1MA 1K5DA 3CR8A 4N9QA 1GY8A 2AC4A 1XOIA 1QP0A 3DZIA 1I4OA 2JIOA 3HB5X 4I36A 4OINF 5T7BA 1EKXA 2F1OA 2W4MA 4V0KA 3R3WA 1O54A 5DGXA 3D6VA 4BC1A 1H42A 2VOJA 2CV0A 2P9GA 1LQTA 4URZR 1VYHA 1SNYA 4HDQB 1L7DA 2VBIA 2D8AA 3CGGA 2HHCA 5DT2A 2ZE7A 4D5GA 3IPCA 1XEWY 3JQRA 1K05A 4JIOA 3A6FA 5T1DB 3EEBA 1ULZA 3IULA 4NXMB 4JJIA 4CS9A 3BSSA 4Q9AA 1Z0SA 2O6LA 2CK3A 1A04A 4H9GA 2WICA 3C87A 2OBYA 3HKKA 3LLVA 4Y2UA 4Q93A 1XZAA 1XN4A 1A9RA 2Q5LA 1ZI6A 4KVFA 2Y1FA 1T0IA 4JJ6A 4C7JA 3SZRA 3TS1A 2A33A 2H29A 2QN1A 4D9BA 2E3JA 2L6GA 1KMQA 2D6FA 3X2QC 4UBKA 1BDJA 1Q0UA 3MWKA 4WJLA 4IFIA 6AT1A 4KIWA 2JD3A 1PBNA 2QLLA 3MRVA 4H7HA 2J0XA 2JCYA 3DMYA 5EUBA 1YIDA 3P2KA 1SXIA 2H1LA 1G3QA 4F3TA 5DGIA 1M34A 2ZUCA 2HMSA 1T6BY 3X2EA 3CX3A 4LZNA 4FYVA 3WJ2A 1I2BA 3T9EA 4H3SA 3FPLA 5SYNA 2RGEA 3I2KA 4ZTUB 1LLCA 4TXLA 4GFDA 4AZVA 2BHSA 3DPUA 4MJ7A 4IGGA 2VRNA 1SRRA 3W2VA 2Q5OA 1V25A 1II0A 1SBCA 5B1DA 3FAKA 1Z5PA 3K6KA 4ND7A 1Z5VA 5ADVA 1KQ3A 1ESZA 4CCWA 2AOUB 3JQAA 1G4WR 1RAFA 1Z4KA 3BRWD 1ZZEA 1J09A 3L9XA 1Y42X 3KFVA 3T7RA 1XRRA 2RHTA 2PLWA 4AM8A 2W93A 5LZ8A 1GCOA 4DBVO 2BDTA 2Z2KA 4HK4A 4DRZA 1MJ5A 4N5MA 4WXYB 1QQBA 2YWHA 5HVNA 3EAGA 3INNA 3RWMB 3N2EA 1HNNA 1GWNA 1JIKA 5HFAA 2X9QA 3W2EA 3AUFA 5IFLA 1W0KA 4E15A 1EX6A 1KDTA 3F47A 1TTPB 1US8B 4XSGA 3I28A 3UR3C 3U9SA 2HRZA 2KW3C 1PFGA 2OEVA 1BXGB 3U4MA 4YIKA 1VHLA 1LF5A 4DEYA 2DFLA 2XZOA 2IYRA 1OWLA 1N33B 2XVXA 1Z4IA 4LVOA 4P4GA 1U2DC 2R7AA 1RYZA 2XCUA 4ENWA 3I0MA 4JVSB 3JQEA 3IHUA 4CKBB 3KSBC 2OEXA 2C1ZA 2PXAA 1KO5A 3KEQA 3I53A 1QGZA 4I1MA 2Y1GA 3KLBA 1SUIA 3KCQA 2BGIA 1S2MA 4LYAA 1FNBA 3OU2A 1UMDB 3AW8A 2B7LA 2HWKA 5F51A 1GTSA 4E5PA 4IJ6A 4BVHA 3UB3A 5KNCD 1YA4A 1K3FA 3GPDG 5KC9A 1ZAYA 5LJIA 1J9ZA 4L4XA 2YY7A 3SS7X 4QC2A 5LJLA 5EQFA 4LOKA 5EIAA 1X8LA 4UZFA 4JXXA 4M8NE 3N39C 4DR2B 2GHTA 4PCAA 3NCHA 3E9EA 4U9HS 4UUAA 4M1ZA 1Z88A 1CLEA 4PRZA 5DCLA 3CC8A 2XWSA 4EI8A 5BVHB 2VBCA 2I0FA 4B4UA 2FWRA 3JWHA 4B3RB 3B5EA 1H3NA 3KQNA 1E9DA 1P29A 4M7RA 3QSYA 1V7PC 3GUHA 2FN4A 2IXEA 5KB3A 3I58A 2DBVO 4DFDA 3JW8A 4BKMA 2EX4A 2Z57A 1WMFA 1CUVA 4LVUA 2BTQA 1XVLA 4BBPA 1DEAA 4N76A 4DB2A 4OLFA 3B5JA 3BWMA 3OF2A 3OCUA 4A2NB 1UINA 1X7WA 3FGNA 4W8GA 5B2ZA 2F8TA 4KDEA 1L5HB 2A0FA 4BIMA 2DRIA 1EUYA 4PSUA 1J5XA 1K40A 1JWBB 4DIMA 4MKGA 5KNBH 3QX9A 4L5AA 4LWOA 1MCZA 2BE9A 3KQYA 3G1UA 1LRKA 4HNTA 4BIIA 5C7LO 4PG5A 3LF1A 4TTTS 3TECE 4HKTA 5AGFA 3QKIA 3EGWA 3U1TA 1F60A 3R6DA 4LVNA 1VP9A 1SUCA 1C3XA 1GPWB 5F12A 5FTMA 3ZHZA 3W9UA 4C20A 4J7AA 5SY6A 4BEVA 2PN1A 3C3CA 4CS7A 3QVXA 3IX7A 4BVLA 2PPLA 4QBHA 3EJWA 3ZDYB 2J31A 4B3XA 2RK6A 3NXSA 5CFZA 4CIYA 1N6NA 3R4VA 1KORA 1CX9B 3NJ4A 2R79A 3CVOA 3FSJX 3T9DA 4DNFA 4L3OA 4CKCB 2PKQO 2IEZA 1WSWA 3RRXA 1V1RA 2KJQA 2NO4A 1FUUA 1LBHA 1XO1A 1S2IA 3QPUA 1WETA 1AKUA 1TZBA 3THXA 4HBGA 3S5UA 3A9WA 5DSZA 2IW1A 1AKYA 3GEHA 4JMLA 2VYVA 2VSXA 3B1YA 3RUCA 3PDJA 3CF4G 3W7AA 1DKNA 5JS2A 1JPNA 3H9GA 4RL4A 1TK3A 4ZTBA 3BFJA 4LXXA 1IL0A 5KC8A 1GZVA 2Z4RA 5G2OA 1NUPA 3OTGA 3ZE6A 1GL3A 5HR5A 2VRBA 4FFDA 1P44A 5IDYA 3U48A 1UFBA 2EYUA 4B6OA 3D0KA 2BFFB 1AX9A 1R15A 2JGAA 1PHRA 1ZI8A 3LOQA 4FZRA 2QX8A 3CNNA 3VZSA 1BBHA 1MTZA 4YYZA 1JL3A 2YMLA 2CF6A 3LKDA 2FE4A 4BV2A 1DOHA 3OJFA 3IP3A 2ICWG 1NSGB 3Q9SA 4QDZA 2JHCA 4LRQA 3KHUA 2CMGA 2WOOA 1TCAA 3PWTA 2PSJA 4PSCA 1NUUA 3EFHA 1NURA 5DXFA 1N7JA 2HSZA 4RQBA 2BJHA 1W85A 4MKRA 1B00A 2ZI9A 1UDXA 3CRQA 3ZW8A 4UHKA 4FS8A 2WVGA 3BXEA 2OMKA 3CBQA 3V1LA 4B6JA 3WYNA 1I4TD 1RYYA 2VKTA 1P2BA 1FMFA 1FQWA 1WPXA 3EXHB 3EVDA 2CNKA 3MG9A 1XDBA 1GSHA 3RIHA 1R37A 4QEZA 4C30A 3AR7A 3O8OA 2OHIA 2OORC 2R4QA 2YOGA 3B6EA 4D9MA 3HXQA 5DM4A 2J6CA 4YRAA 2XHZA 1PZXA 3C3KA 4GQBA 3HXMA 4HLNA 3KYCB 5G1PA 4H77A 2X2OA 1NW7A 1Z6AA 3ZDFA 5JO0A 1BU8A 4Q1DA 4EB6A 5DS6A 4QGGA 4S2UA 2IYNA 3UKOA 2C2YA 3F4BA 1IUOA 1O77A 3ZU5A 1J8QA 3VBCA 1WLYA 2W0SA 3PS9A 2R1VB 1ZJ6A 1N6HA 4LBWA 2ZRCA 3DO8A 5EEGA 1JYFA 1SIOA 3ZU6A 2FX2A 3OA1A 4HBZA 1NVVR 5B7QA 2YNMC 2D2FA 3AR2A 3MQFA 3D6UA 1UWKA 1Y6JA 3DSRA 3WK9A 3BSYA 1QP8A 1VXRA 5JMOA 3HDJA 2J41A 3GNLA 4GICA 1XK6A 1HRDA 3BCHA 2O0KA 4U2GA 4B73A 4PR9A 3PD0A 2YDYA 2ZIUB 3SR0A 2GASA 3IKJA 1U04A 1GTMA 1RWXA 2IU3A 2AQ8A 3E48A 3A25A 3TTUA 1AXGA 1T1SA 4BJ6C 5I47A 1U2QA 4CQLA 2V3WA 3Q7PA 4PYMA 1IM8A 4CMAA 5GVRA 3CN9A 1G2IA 4D43A 2B99A 3GEPA 1YL6A 1MV5A 1MHTA 3DDOA 4CEHB 1ECGA 2PQ2A 4E1BA 4NNOA 4MYDA 3BE5A 1E79A 4N3AA 3RAPR 3CLHA 2FLKA 2H7OA 1F3OA 4J2TA 3PL1A 5B1IA 1Z5UA 4IHQA 3RS4A 2WD7B 4GMKA 1YNSA 1PV4A 1W9HA 4CQJA 3ANNA 3P9KA 5IVHA 1HFEL 3D7KA 1IN1A 3GFGA 2FDRA 1C1DB 3PWSA 1PF7E 3R9IA 7REQB 4WXRA 3QELB 1TF7A 1KTMA 4JB2A 2ANCA 1NVVQ 2RKBA 1H2HA 3C74A 3QA9A 2ZIXA 4OIQF 1GG9A 3C3XA 4XTKA 3WRYC 4FFNA 5H7XA 5JMPA 4HOYA 1Q50A 1OVMA 2W37A 3GAAA 5DLPA 3W1WA 1FRVA 3LXUX 1UANA 4F04A 3NCTA 3GZTB 4U63A 4XCQA 1OLXA 1E6CA 2VQ3A 4JYMA 4FYJA 4C4SA 1WMBA 1D07A 2H1OA 4WW0A 3S8EA 5KYNA 3UNXA 1UKAA 1Z4OA 1U9IA 3WYEA 3SXYA 4MAAA 4MI3A 2BGRA 5E8JA 3B82A 2J3JA 3EXFA 4XWKA 1UUFA 4I8DA 4PO9A 1WULS 2HW8A 2NP7A 5TQJA 5EWJB 1G63A 3OQ1A 5G4KA 1R74A 4RVDA 3ZBTA 3K5WA 4QUKA 4DJ5X 5CEEA 4UFNA 6CHYA 3LPCA 2KYRA 3PENA 1YDHA 1LK5A 3Q7IA 3BIWA 5DM1A 1EGAA 4L4UA 4HNQA 3HB0A 1OAOA 4JNKA 5I9SA 3O8CA 5CDUA 1RWOA 9MHTA 4CLOB 5EXEA 3KYDA 5AM3A 4Y9TA 2NADA 2NSHA 3GRYA 4G23A 4DM7A 3AB8A 3CVXA 1G7CA 4A8HA 3AKEA 5IZCC 3MM4A 4II3A 1A7VA 4MQLA 2ODPA 5B55A 5A9RA 2XADA 1ZVQA 1JR4A 1NC3A 3GJYA 2N9UA 1YOBA 2X4GA 1QGAA 2IGBA 2VHXA 2BEKA 3NUQA 2QYOA 4EHIA 5HZMA 2MHRA 2ZTLA 4LX8A 4NECA 5EYPB 4A15A 2HLDD 4FDUA 2HSWA 2OB1A 4Q9IA 1DV1A 1JU3A 2DY0A 1Z39A 4ZXPA 5KMGA 1L7PA 4LYEA 3EGDA 4GMFA 3K66A 5A9TA 5JI3E 1MP0A 4DMUB 2AMFA 4MUJA 1EE9A 1A50B 5EJIA 5K0LA 4CT4B 4BGDA 3B7WA 3TM5A 3VPSA 1JHPA 3HUFA 3HWX1 4IP0A 4PS1A 3RBVA 3T4PA 3L8IA 4EGQA 2Q1XA 1N2IA 3HCOA 2UZ1A 1JKJB 4OGFA 1Y3FE 1L7VC 4LV5B 1Y1QA 4ZV7A 1EVZA 5TARA 2J0EA 3P45A 3F9IA 3TLMA 2GN6A 2AE1A 3SWWA 1J07A 2I4TA 3L49A 3R3XA 1KVRA 3VYVA 7MHTA 5I7HA 3TDNA 2H5JA 3C4JA 4G86A 1JBKA 3ZWQA 1JZQA 3RVQA 3DFMA 2ZUTA 1BDHA 4RTQA 3RGGA 4LGYA 1KO7A 1ENPA 1K97A 5DNYB 4TKLA 1RHQA 1EG7A 1Q0ZA 5CNKA 2VL7A 3Q3VA 3OT4A 1RRFA 4U4AA 3SICE 2MSKA 3B3QA 1JSCA 1G0NA 4F9TA 3JXEA 5IC6A 2JFVA 3TL3A 1ODIA 3EIHA 2B36A 2PSDA 1I7LA 2XQGA 5BY2A 1CIJA 5TF4A 2DE0X 3U9LA 2I55A 3KRTA 3EGEA 2IOHA 5KTKA 1IONA 5TC4A 3LP8A 5G3YA 1B0UA 1NXXA 5KOIA 1BD4A 2LIPA 3H99A 3HYSA 5AH0A 4DDKA 1E62A 1FYVA 1ZM4A 2FE1A 3DEFA 4MW6A 4WCVA 1XDZA 4M98A 4M8SA 2O23A 3QQPA 2DAPA 1GKYA 2I1WA 4I5GA 1S9DA 3ADCA 4MULA 3AF3A 5CT8A 1TC1A 4AMVA 1T1EA 4CQMA 1NVMB 3E9VA 1VTMP 3WG9A 3ZHOA 1H66A 2QRPA 3A0UA 4K03A 3EGOA 4D9EA 4TXNA 1KYWA 5BQ3A 5CFMA 3LT5A 2ZT7A 2WF5A 4G1BA 4DILA 2W2LD 2G5GX 3R3YA 4IDEA 3TJ6A 1KC3A 3CG4A 1T4BA 3ZPXA 1AUPA 4WV3A 5KNDH 5K6RA 5KJEA 2CLSA 1RZVA 4FN4A 3IOEA 2Q49A 2VZ8A 4FJ0A 4B4DA 2IPNA 2EQAA 5H82A 3GOHA 2AZTA 2K4MA 4TRMA 4A91A 2NZWA 5EZ5A 1W88B 1Y8QA 2PX3A 2J59A 2Q99A 1WXXA 2IDZA 4MVWA 3P8ZA 2IYAA 4MV8A 1BFDA 2PEZA 4CKEB 4P6VF 2VHQA 4BUCA 4JOCA 4HVAA 3IP8A 2VAMA 4NQRA 4HC4A 3C5CA 1A98A 4RH1A 3RR2A 3LPNA 4EMTA 1B7GO 5KBYA 3DBVO 2IS2A 2BKEA 2I80A 4L3VA 2P1ZA 4CCYB 5JZVA 2TECE 1U2GC 3PCVA 3HB1A 5HM8A 2FA9A 5L4SA 4FNOA 1V45E 4FGKA 3W5IA 3CZ9A 4CMEC 4QTTB 4W5QA 1YB2A 4WXMA 1ORDA 1TA4A 2R9VA 3ZHBA 2BWJA 1KMNA 2FDXA 3DLCA 4HTAA 2XDQA 1SBZA 4YRMA 3OM8A 3CISA 2PSEA 1SHTX 1YR7A 5TGDA 3CNEA 1FC0A 5ULLA 2H8AA 4Y2XA 2IBMA 5KQSA 3NALA 4CYMA 5J40A 1GHTA 1X7DA 3STYA 5L3ZA 4YJGB 3X1MA 3SFZA 3MTJA 1N1GA 3HXLA 5HP4A 3U4AA 1NR5A 5F21A 5KTSA 4BKQA 1MIOB 1FFYA 1NVDA 1Y5NA 2X6TA 1CS4C 1T29A 4UFOA 4KR7A 1OXKB 1EINA 3H2SA 3BWBA 4P83A 3SE0A 4IARA 2KC3A 1X42A 4GQAA 4OFZA 1Z0DA 2QUAA 1H5UA 1NFNA 1ONOA 3E9CA 3ZSUA 5L7YA 4FFLA 4S2EA 3IURA 1O97C 1CULC 3FYDA 1G17A 1MJGA 1NE2A 3KTFA 3W4YA 4EJ6A 4NYMR 3FWPA 1OYYA 3V42A 2OBXA 4LV8B 1ZK0A 3FCEA 2DLNA 1UG7A 3GFFA 4KE9A 4Z1OA 2X5NA 2ZJAA 4CLDA 1XYYA 2CJWB 1FBNA 4FLFA 2IT1A 4OREX 2VTKA 4AW9A 2OWDA 2V7WA 4PLZA 1DAMA 3E53A 4FFVA 3ITFA 4RFSB 4FOLA 1YS7A 3C8UA 1A7UA 1FJ2A 1HL7A 1KR2A 2EKDA 1E94E 2OKGA 3KG2A 5LFAA 1U7HA 1KOLA 5AW7A 1KJYA 4O3MA 5SY9A 2VDWA 3MUOA 3ZDBA 5JTTA 2AQKA 2BBSA 1Z0FA 1SCJA 3JZIA 4C03A 3G82C 1ESDA 1T9AA 2O9XA 4C6RA 4GE0A 3V8BA 5JY6A 4PO8A 1ZIPA 4GXNA 2H5EA 5TQVA 2VSYA 3KTAB 4LJKA 5I9IA 2MDTA 2GBIA 4QJBA 1XTQA 1ODCA 3D3JA 2IP2A 5DI3A 5ALQA 1GGHA 5DIFA 3IDAA 3LNCA 4KR6A 2QTFA 3BWVA 3OPNA 3QVOA 3Q6IA 2HU2A 3V5XA 2P6UA 4YS6A 4WGZA 1ZUWA 3RS2A 2GBLA 5FTJA 1U98A 5AVSA 2I1LA 4FGZA 4NYMQ 5HZGA 4X1OA 2HMWA 1HYEA 1T5TA 1HE3A 2HXYA 4E6PA 1U2RA 2GPTA 2BKVA 2CF5A 1QZTA 3DAFA 4TLAA 4GKAA 1A88A 1M6NA 1L5MA 1NE7A 3K9NA 1IRXA 4JK3A 2BC5A 3EJNA 4C0HA 4M0PA 2RGGA 3LBAA 3UTCA 3RAFC 2E1RA 3TDMA 1IBRA 4PGMA 5FH9A 1M72A 1UQRA 4ALIA 1OGJA 1MMNA 4R5HA 1B6SA 5LMNB 1JXAA 4PIVA 1N9ZA 4L8LA 1NRWA 3SKVA 3ZX4A 1SVSA 1L2TA 3EH2A 2VKQA 4MW9A 3DH0A 1FPQA 2GZRA 1U0RA 4LDNA 3U3KA 3OO0A 3MRXA 3IBYA 1YC5A 4NARA 4FDLA 3IVGA 4MVJF 4URVR 4JE9A 3LA8A 5ERXA 2FHPA 5JSQA 2EBWA 2IY9A 2ZBVA 1E86A 2IEYA 4AJIA 3ACDA 4R8VA 3A6KA 4RLSA 1VIMA 4KX3A 1X8JA 4M88A 1Z2EA 3L1UA 4M38A 2PO5A 4Y1RA 1N57A 1CF9A 4WJZA 2CE2X 1PR9A 1UC5B 2CLEB 2IEDA 3CONA 3MT7A 4GBGA 1XPUA 5JJ5A 1RHKA 1IG0A 1PTKA 1GZ5A 2REBA 1EP1B 5CVVA 3UCXA 3JQBC 3R5KA 4R7GA 1W36D 3MGBA 4WACA 1E0JA 1XMXA 2PUCA 1O5OA 4D80A 4J16A 2P5YA 4KI0A 1BEZA 1DG1G 3DE9A 3WK8A 4J43A 2BMFA 4TWRA 3BICA 5IUNC 1HMYA 4R2WA 3ZVNA 1YTLA 1KJIA 4LXHA 2YUIA 4HYTA 1LPOA 3CJQA 3PFCA 3QLUC 4UCWA 2ACKA 1B6TA 1DC6A 2I7VA 3P9IA 1Z37A 2R25A 4WVLA 3FTEA 3QP9A 2H4ZA 1IN5A 4MCAA 2PX4A 4UBJA 4X8HA 4CDNA 3FH0A 2GVZC 3F6PA 3AF2A 4IIJA 4JMPA 2ZULA 1CR6A 1NZDA 4EFDA 4ONEA 2AI3A 1R50A 5MN4A 2EW1A 1PK9A 5IAJA 2TRSB 3MFYA 2VPPA 3HLZA 2AR9A 2PS0A 1AO0A 2BGLA 3UVEA 2VT3A 5DBHX 3NNDA 1KDYA 3G13A 3AB3A 2GN9A 3KYJB 2GZSA 3ZQKA 5T5QA 3R7NA 3IBTA 5HGXA 4KI2A 4Z5XA 2XZLA 1FIUA 5B30A 3EQ9A 1FP7A 5E9WA 1U4SA 1BEEA 1XZJA 3GJ4A 3WB9A 2ONZA 5FFFA 3CKKA 1WD5A 5JAHA 2NGRA 1ZD4A 3ZOZA 1Z3CA 4JJ7A 3EMBA 3MWEA 5A4AA 3RRZA 3K1ZA 1W2HA 2HM7A 5JZBA 2RE8A 2H0QA 2R6HA 5JNUA 1QRTA 1PZMA 2XZDA 4E09A 2C2MA 3S1AB 3H1BA 4BP1A 1N2EA 3VDXA 2N75A 3I32A 2GYYA 5GONF 3W5HA 3F0TA 2FF7A 5DVWA 2G08A 3D7MA 3O55A 4TT8A 2VJAA 3SNHA 1OAAA 3L6EA 5AKLA 2CJXA 1XPOA 1G9XA 3LUJA 2OO5A 4FNAA 1GKUB 3MGKA 2CNWA 3HR7A 3OFSA 4XUGB 4ASUA 2JIBA 3KJGA 3CW2A 1X7YB 2A9QA 4OHKA 3QEKA 4LPKA 2NIPA 2PL5A 3S6JA 4UAJA 3UQYS 3A3YA 1G20E 3T0GA 1PGQA 4ZQHA 1WASA 4WQMA 1BMDA 3QVJA 4M89A 2QTLA 1S7CA 3LC1O 2PLRA 4G8CA 4KW7A 3K9LA 2BT4A 1RHMA 3JVEA 1X2BA 4RX1A 3B51X 3FOWA 2NXNA 2R3SA 5KDDA 1Z8DA 2XS8A 4JT9A 4IV5A 4WXHA 3FWHA 1WB9A 2REQB 2XB6A 3B12A 4L51A 2PJZA 4N7BA 3MJEA 1DAIA 3ITKA 1E9SA 1P5HA 1AKTA 4DMGA 1JDUA 4NYIR 1QDEA 4AJ9A 4LWZA 5ALEA 1I5OA 4PNEA 3GUYA 1Q11A 1OW6A 2SICE 4IXTA 2G9QA 3WB1A 3GO4A 2WJAA 1ZN9A 2FPPB 3F67A 3QE4A 3CH6A 2HT1A 4QEKA 3VMMA 3G8DA 2QPLA 3NHFA 1PD1A 5AMXA 3EC1A 3NH9A 4PLCA 4DSZA 1QKKA 1CUWA 2FSVA 5SYMA 3ZVMA 3AKYA 3IA2A 2J9GA 1MR3F 2H3EA 1FP4A 2BMWA 1X14A 3U5ZB 3Q7GA 3LEOA 2G3YA 1DARA 1QH0A 4IUDS 1E1DA 2C3PA 3PMRA 1DHTA 1GSAA 4FKMA 3GRFA 4TTAA 1QOQB 4I4TF 3EGIA 3ETNA 2IUYA 2PXXA 4YAUA 4YAEA 4CU5A 4PC2A 3AVPA 5BN4A 3JQ8A 3I61A 3HBFA 3NW9A 1YZ3A 4WKPA 3HBAA 3G0CA 4YJKA 5ICMA 2ZT8A 1WM1A 1YJAA 3R24A 2X1HA 1PG2A 5TT1A 3UGKA 4C0AC 1YQGA 3W3AA 2VIIA 2EYQA 3RWBA 1ZLXA 5JAIA 4AZ0A 5B6JA 2WJGA 2JLBA 3NYWA 1E5DA 2FQ1A 5C1OA 1TJPB 3P96A 3TM4A 2BH2A 4NYIQ 4G0WA 1TKCA 4P5PA 4YAJA 3BDIA 1BMFA 3ZQVA 4F93B 1E69A 1N7GA 4N5DA 4OIOF 4Q5SF 2QN7A 4DXDA 1U5BA 1O89A 1Z0ZA 3I9MA 1MB0A 1NPYA 1CUBA 1PEYA 2G72A 3NATA 1Q0QA 2V9ZA 1RCPA 4OGWA 4DR5B 4ZGWA 2FRDC 1A2OA 3J81k 1Q22A 2ILVA 3O1HB 3IHWA 2WIGA 1L8QA 5A05A 4FQ5A 2VN8A 3QK7A 3HLYA 1OCOC 2L9JA 5EJ8A 4NAVA 5CW1A 5KU7A 3IQTA 4PZCA 3SHOA 4LHEA 3A70A 3KB8A 2A9JA 4HLQB 2A1TS 2L18A 2Q3JA 3GHYA 3RIXA 1QIDA 1Z0UA 4DQDA 1QRAA 3VU3A 3ISJA 2WI8A 2VS1A 1F3LA 3D6FA 4M0UA 1CUSA 5A7FA 4NOKA 5EP4A 4I6JA 2QE9A 7MDHA 3NOOA 3OFNA 3HVIA 2O3SA 5EAIA 1QRSA 3IE2A 4DMKA 1O7JA 4I19A 1K7SN 2GPWA 3NBAA 2GZ2A 2XH8A 3E1GA 3GGSA 3A9UA 2EIHA 4EPTA 2KSQA 2UZAA 1V16A 4BFYA 1RM3A 2UZ0A 3MQ4A 2DYSC 3LDGA 1QHYA 5CYFA 2DG2A 4TPKA 4MA5A 5K3BA 3W9BA 3DONA 2GKGA 3RIGA 1RVV1 2MR5A 1TM2A 3DP7A 1V35A 2ZJOA 2ZJ3A 3B1FA 4C1NA 3I01M 2JEYA 3WL5A 3PEYA 4GZ3A 3W90A 1NKTA 1EXDA 4S1OA 3F6SA 4F9FA 3E2PA 3O3OB 1XXHB 1R0WA 1Z6TA 1NJGA 3QNMA 3MYIA 4KH1A 5JT1A 3A27A 3V00A 1XEXA 3V4RA 3ZQYA 1L0BA 4ZYXA 5FCDA 4BN4A 3ZHSA 2QMOA 1HKUA 1LI4A 2Q1SA 1SELA 3W2FA 4CL2A 5JE8A 1GDHA 2BFBB 3AEKB 3GDOA 3H1TA 4AMYA 3NPAA 3I92A 1U1EA 1AD2A 2B78A 1TAQA 1LTQA 2IBSA 1ODTC 3J06A 4YLEA 1HDIA 3QPDA 1VLLA 2SKEA 2OFXA 4OVKA 2Q0SA 1E3QA 1XSEA 3G2IA 4MUAA 5AOAA 3QV2A 3ITNA 1E2HA 3DBIA 4RV4A 2HRQA 4KIJA 4LTNA 5E2QA 1YRYE 1JHRA 5AW3A 5LZ2A 1E9EA 4AJKA 4RAQA 2WMOB 3CWCA 4XKJA 4X93A 3N74A 1CGNA 3HS3A 3ZYCA 3RW9A 3PE3A 5AVKA 4D7AA 4TMVA 2M1ZA 1D0SA 4ICIA 3U0BA 2UUAB 2LSEA 5FBZA 1ZIXA 5LWHA 1U3DA 2JEOA 4WECA 3VFDA 4TZKA 4Q7QA 3U1BA 3IBSA 3T7SA 4H6VA 1AQJA 1H6DA 4QUDA 4BE4A 5JCOC 2YW2A 1VSQA 4I50F 3ND6A 3ROTA 4K1XA 1CZLA 4GPZA 1IDOA 3K0KA 2BISA 2AZMA 3JZDA 2VAWA 5H80A 4O4IF 5F1OA 1KVTA 5AK6A 4P3YA 3ETLA 3NGMA 3KEGA 1PEDA 3BMOB 3L1IA 2PRIA 5BOSB 3PPVA 2GKOA 3AOEC 4YXWD 3LG2A 2Q07A 5I3CA 4FYHA 4CM9D 3GLGE 2H7VC 1O57A 2YWRA 1XALA 3OIGA 3GLIB 3SQMA 3HBLA 1GGJA 3HCDA 5DCWA 3SYMA 4X65B 4GZ5A 1E98A 4FW9A 3DZCA 5AXBA 5COBA 4B3JA 5K0ZA 2XLDA 1KFCB 2IHYA 2WYIA 1BDIA 1VYIA 3RYIA 3HSSA 1H4SA 1HFKA 5K8CA 4D3SA 3GLKA 2OHOA 1EWVA 1LTKA 4TT3D 1ZVMA 3PFBA 3CM0A 1DCFA 2Q0QA 2Q6TA 2XRMA 4BU1A 4IMJB 2NMVA 3GGPA 4LF6B 3K0HA 2IU0A 2Q4RA 4RHXA 4CT5A 1CR0A 3CINA 4GDMA 1R5BA 4N1AA 2A5DA 1MDBA 1RXQA 1UL1X 4IO1A 4MW1A 4RPJA 3IEUA 5EXDA 3WX0A 4JXJA 4E5SA 4TQUS 2DPXA 2WTBA 4YRQA 3GJXC 1HMOA 1AUQA 2EV9A 3TSAA 4LRXA 4BJ5C 1IQUA 1EX1A 1TC2A 2Y0PA 3QUTA 1OC2A 1YJBA 3T3NA 5F2EA 1ISHA 1KPHA 4HH3C 1JLLA 4L6RA 4GOOD 3PJEA 2HXSA 5HQTA 1KAEA 2D5IA 4D6PA 3HE3A 4CEJB 1IOVA 2WHQA 1KEUA 4RTPA 3NU1A 2J4FA 2JAOA 1DO0A 2ERYA 3ZNPA 3FNEA 3AEQA 1JJVA 2W8BA 2NM0A 1JKMA 1BQ3A 5T3WA 3QVVA 2W58A 2E89A 4QI0A 3LCRA 4RNCA 4I81A 4NV3A 4L0QA 5J5CA 1UMBA 2ZBFA 3SJCA 1RQ2A 4O8ZA 3N2LA 3OA2A 3CXRA 1UBOS 2BF7A 3NDRA 3G4ZA 1YK1A 4A10A 5IKMA 4P5EA 1E9FA 4J76A 2CBXA 3DVAB 3JYLA 3NVAA 4L74A 3BERA 4KREA 4IGEA 3MLGA 3RABA 3L0BA 2YXBA 2F4VB 1BCSA 3GRCA 5E1BA 3PDCA 1NU8A 1UK8A 2PWPA 4OKSA 4AX8A 4ANJA 1PS9A 3S0JA 4Z54A 4DY4A 4PR0A 1J1ZA 4BZXA 1VCHA 2FUNB 4CE6A 5KJCA 3FHCB 1A7DA 5L3RA 5BWNA 5DPMA 4ZLCA 4GVXA 5FQOA 4JKYA 5HUQA 1MFZA 2BUBA 2DPYA 3B9RA 3HGMA 1Z8FA 2IHTA 2IEIA 1P7PA 4BFLA 1KJWA 1GPDG 3RLFA 3QWFA 4L16A 1TLTA 3DOEA 1QONA 2WM2A 2Y71A 2X3UA 1P2DA 2AJLI 2ZJYA 1F1JA 5B64A 3QRWA 2WAYA 2OR3A 1T5HX 4TKUA 3FOEC 5KYYA 2QUBA 1HNXB 1GILA 1Y37A 3MJFA 1Q57