1YYJA

The nmr solution structure of a redesigned apocytochrome b562:rd-apocyt b562
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
105
Chain Sequence
b'ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANGKVKEAQAAAEQLKTTIRAYNQKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords redesigned apocytochrome B562
publication title Specific non-native hydrophobic interactions in a hidden folding intermediate: implications for protein folding
pubmed doi rcsb
molecule tags De novo protein
total genus 40
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2005-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yyjA00
3C62A 3DE8A 2XM0A 4WGYA 3ZTMA 5JRAA 2CCYA 3NMIA 4CDYA 1E83A 4IARA 2YLDA 1CGOA 3C63A 1CPQA 4CX9A 3NMJA 5JS5A 3ZQYA 1MQVA 1YYXA 3NMKA 4U9EA 1BBHA 3IQ5A 2XLMA 2XLWA 2YLIA 4U9DA 3M79A 1RCPA 1YYJA 3HNKA 4CDAA 3L1MA 4JEBA 2XLDA 1M6TA 4JE9A 3TOMA 3ZTZA 4D4NA 2YL0A 5JVEA 3VRCA 2YL3A 5JSLA 1APCA 1JAFA 4N4WA 1LM3B 2XL8A 4CJGA 3QVZA 4WGZA 1E85A 1CGNA 1QPUA 2QLAA 3HNIA 3HNLA 4CIPA 5JT4A 4IAQA 2BC5A 5JLIA 3IQ6A 2XLOA 5B3IA 2YL1A 5JP7A 2YLGA 4ER9A 4JKVA 2YKZA 3QW0A 5AGFA 4L6RA 2J9BA 2XLVA 3ZQVA 3TOLA 2XLHA 1S05A 3ZWIA 5JUAA 4ULVA 1CPRA 1EKYA 3M4CA 3FOPA 4JEAA 2YL7A 1QQ3A 2XLEA 1E86A 1A7VA 3QW1A 1YZAA 3HNJA 2XL6A 4CJOA 4N6HA 4D4XA 3M4BA 1YZCA 3FOOA 4IB4A 4EIYA 3QVYA 2XM4A 4NC3A 3U8PA 3DE9A 4CDVA 2J8WA 3M15A 1GQAA 256BA 1NBBA 1E84A
chains in the Genus database with same CATH superfamily
3OA1A 1YLMA 2PX3A 1M57C 2EPNA 5COFA 2CDQA 5TJ5E 2CCYA 1SZIA 3NMIA 1T9KA 5DQTA 4DRHB 4CS8C 2VC9A 2WZLA 4DBQA 3IEEA 1K05A 3HKKA 4YWQA 1VB5A 4H4KC 2IXNA 1Y6DA 3EJNA 1VMAA 3MYIA 3AG4C 4RDAA 5L3VA 1ORSC 4FWVA 3LNMB 1MMDA 4HFKB 4NCQA 4YK5A 3QZCA 5L0IA 1YYXA 3A9CA 1NZEA 5DQZA 5T3TA 2VH3A 3E70C 2A68F 3H2UA 4U9EA 3R7CA 2R7QA 3EZHA 2BL2A 2QNLA 5DS5A 4LDQA 3POVA 4HEAJ 4CS9A 2J9WA 1YYJA 4CBEA 4LACB 3LAYA 3QMKA 1OCRC 2V26A 1NU7D 2A0BA 3LEOA 4MQ9F 4EBJA 2KSFA 2XLDA 1Q0MA 4JE9A 1G4US 2D5RB 1RKEB 2ICWG 3EG9A 3O6XA 4DOZA 2EPMX 5L0FA 1TFKB 1IW7F 3NDBB 4AX2A 4YN0B 3DAGA 4JTCB 4BJ5C 3ASOC 1PD1A 3K1IC 4PJMA 2DI3A 3GEEA 4JURI 3U3FA 4CJGA 1OKKD 1U89A 4P9FA 3KYIA 1GGQA 4Z9HA 2KC3A 3K7DA 1PD0A 3NG1A 4KC9A 3B71A 2NSFA 4NTFA 4P6IC 4CIPA 4E7ZA 5JT4A 3JRTA 2J9VA 5L0CA 4I44A 1FFHA 4MW8A 2IYLD 2AVKA 2XSEA 4IAQA 2LK4A 4LLCA 3S9OA 4G7OF 4J30B 2NG1A 4EKWA 4PFOA 2P1AA 3O10A 2NPUA 2Q3TA 2YLGA 4A2NB 2R7TA 3K66A 4A4AA 2A0UA 3UMKA 2CW0F 3CZ6A 1HW2A 1HE1A 5DVWA 1HE9A 1YAUO 3BRJA 4WJ0A 4XEKA 2R7RA 5AGFA 3ITFA 2J7PA 2MWQA 2Q4FA 4MVOA 1FMWA 3EH1A 3LEVA 3RIPA 2I8BA 3K6BA 2OKUA 3ZWIA 1M56C 1OR2A 3HLZA 1H6GA 1Z5ZA 3L34A 5JUAA 1CPRA 3GEIA 4MVZA 2MYSA 1EKYA 3RH3A 4E17A 2LD6A 3M4CA 1ZHZA 1YVIA 1OW6A 2HUJA 2JD3A 3SXZA 2YWAA 5K0IA 2G62A 4N06A 1E86A 2CYDA 1D1CA 2PP4A 3W8HA 4J7TA 3TULA 3HNJA 4NTBA 5DLJA 4G78A 2P61A 2XL6A 3C8ZA 3JSZA 3MFNA 4CJOA 2NUPA 1H7IA 3JCUQ 5BUOA 2L9JA 3TK0A 3L8IA 1E2XA 3MYFA 4EHPA 5A6KA 2R02A 1JR8A 4IWBA 4NC3A 2KW3C 3W2WA 4AE4A 4Z9JA 1RMVA 3W4YA 4JTDB 4AK9A 2IM8A 3EZIA 5EHHA 5KYNA 2KYHA 5HSWA 2J8WA 3DD7A 3AG2C 4JZAA 5L0JA 1EI7A 3ABMC 1XZQA 2KGOA 1ZZPA 3M15A 3RF3A 4XTKA 2NUTB 5KYWB 1NBBA 3SNHA 2R7WA 1MMAA 3HTKC 5BQHA 4C3EA 4U5BE 2EILC 3ECSA 4LERA 4YT8A 4O6YA 4XLNF 3DE8A 3LS1A 4XEVA 2Y69C 3ZTMA 5JRAA 1YARO 2AWCA 2M4EA 3DKAA 3JTLO 3NYLA 4C3DA 4CDYA 3AJMA 1OW8A 3PHF2 3VF0A 3MBGA 3LJBA 4IARA 1U6HA 1WTYA 2KNHA 4IRUA 3SP1A 3EGDA 1CGOA 2VASA 2Z15A 1CPQA 2FAPB 1D0ZA 4Q4ZF 3VRCA 3NMJA 2R05A 3B9QA 4NY3A 4ZLCA 1S7ZA 3GORA 4AL0A 1UFBA 1Z63A 1VTMP 3X1OA 1O87A 2H7VC 2IOQA 4U5GA 2D4UA 2E87A 5DS4A 1BDJB 4JIOA 4X0RA 4OIOF 1BBHA 1QKRA 4MTFA 3RW0A 3CEXA 4Q5SF 3IQ5A 5DS6A 2HV7A 2XLWA 1OKKA 2BE5F 4IJJA 4PR9A 2L6GA 3KH2A 3ABLC 1JOGA 5FZTA 1AEPA 5B1BC 1TWGA 4CS9C 3EPVA 2PX0A 3NYMA 1I5NA 4HFFB 1WGWA 4J7YA 1Z6AA 3N0TA 3L8JA 4JEBA 4YL0A 1PV3A 4XQ1A 1H9GA 5AC4A 1T6QA 2PFDA 3TOMA 2YZSA 1J8YF 4O6NA 3ZTZA 2IXPA 1RJ9A 2HV6A 4DRJB 1LE2A 1JMWA 3V7OA 2HFIA 1ZVZA 2RD9A 2YRFA 3AOUA 3LLKA 2G3KA 4N4WA 5E3CA 5F28E 5L3QA 1PCXA 2H7BA 4EBKA 1OCCC 2L81A 2L7AA 1E85A 4WGZA 3AG3C 1CGNA 3EFOB 1MMNA 3F46A 2EINC 3ZSUA 5A6BA 1G5ZA 5L0DA 2QLAA 4YT4A 4U5CE 3DM9B 3AGUA 1FFTC 1AUEA 4FAPB 1YDIA 3LESA 1D0XA 2XS1A 1B68A 1ZHYA 3ZC4A 4CSAA 3PMRA 1SF8A 3AGTA 2BC5A 1QLEC 2YEVA 3DJNB 3GEHA 2P0NA 4U5FE 3H65A 2ZXRA 1V74B 3NRHA 3S90A 3S28A 2H7OA 2YL1A 2WVQA 3GWLA 1N1CA 3US6A 4ER9A 3S84A 2RSEB 1Q0KA 1LS4A 5A6JA 1I4YA 2W4BA 1VYIA 3EH2A 4L6RA 2B0HA 5COGA 2XLVA 4JCZA 3KPHA 4R32A 4DBRA 1LKXA 2R7XA 3PDMP 3HJCA 4C7OB 5B1AC 4QI2A 4BJ6A 4BPMA 1LI5A 3UR3C 1QZXA 2WZFA 4EUKB 3EGXB 5KYYB 3LNRA 4FESA 1W2WA 5KYUA 5L0HA 2Y3BA 3C18A 1OR3A 1YZAA 3QW1A 1M2OA 1WASA 2HS5A 4JTAB 5T1DB 2R7VA 3KKBA 5CIVA 2HSQA 2OU6A 4JJFA 4CS8A 2W45A 2L6HA 4D4XA 3U9MA 3EHNA 5GPGB 1TKNA 4GYTA 4JJGA 2Q7RA 3FDQA 5KYXB 2AWYA 2JX0A 4MVQA 4BJ1A 1BZ4A 3IHUA 3R2PA 3S27A 2XM4A 3U8PA 3DE9A 3OEOA 2EIKC 1RKEA 2ZPAA 3WAQA 2QE9A 2WVOA 1TWAA 2VCAA 1LI7A 2WVNA 3SXKA 2KJGA 3AQBA 3DMDA 3WHNA 1F1MA 3V5YA 3I5QA 2CNWD 4P9TA 4XWJA 2XXAB 4BEJA 1GQAA 2IBFA 4MVSA 4XPYA 2OJED 1TR2A 1I4ZA 2J45A 3T6GB 1L3PA 1RXQA 2Y39A 4EWCA 1T6UA 2LFDA 3PCVA 5CI9A 4WGYA 1D1AA 1NSGB 4ANJA 5EK0A 3JT1A 1OCZC 2FGYA 2EIJC 2F22A 1VLSA 2Y3DA 4DVYP 4CX9A 3S29A 1HMOA 3AG1C 4B6IA 5JS5A 1ZW2A 1Q0FA 2XS8A 3QTHA 3U2MA 2EIMC 3I5PA 4KBLA 4W8KA 4BEMJ 2LSEA 2HSBA 3JRMO 2W9YA 3EHMA 4I1OB 2A6HF 3DZAA 3L0IA 3NMKA 2TMVP 3JYHA 4OD5A 4PFPA 3WODF 4E0HA 2GFHA 3FAJA 4DVZA 2C03A 1ZHWA 1A7DA 2WB7A 2YLIA 4RBNA 3M79A 1G8XA 2GDCA 2P6VA 3UGPA 1TWCA 4OD4A 1V54C 1WWPA 2VCCA 5D91A 3ZVRA 1M2VB 2J9UA 4QI0A 3W8IA 4CDAA 4I1MA 5COMA 3L1MA 2VCBA 3EQLF 4YJWA 3V5XA 3CSKA 3U3BA 2R7UA 3JZ0A 2DGJA 1D1BA 2CGEA 4MW3A 4DJ9A 5E2QA 1M6TA 1NFOA 2QY9A 2UUHA 4XEFA 1ZHTA 4KI2A 3U2LA 3V5ZA 4GEHA 3B0PA 2A69F 2GA0A 2YL0A 3C8GB 1TWHA 2YHSA 3RQGA 1WOLA 5JVEA 2YL3A 5JSLA 4E18A 1APCA 1YA9A 2WL8A 1O5HA 3H2VA 3VYWA 5A6AA 2DYRC 2GAQA 2Q9AA 4XPXA 4N6CA 1T01A 3QVZA 1Q0DA 2OEXA 1TQGA 2LQGA 1QVXA 3C7JA 1R5ID 1HY5A 2OJQA 2VB6A 2KK1A 3AQCA 4XLPF 2MHRA 3HNIA 2W4MA 3JSEO 2L6FA 1Z3IX 3B0UX 1FAPB 2NUTA 3ZDLA 3FHDA 2ZD9A 4CSAC 2Q9CA 1LS1A 4XPWA 2JPUA 5HV9A 4ONSA 2XLOA 3VAYA 2ETSA 3IQCA 2OEVA 1J8MF 5B3IA 5JP7A 4UDVA 1VK5A 1QSPA 3GM1A 3NKDA 1VLTA 4O7GA 4WABA 3Q6NA 3IPMO 5BQGA 1XWJA 4YL3A 3CAXA 3E9VA 1NLXA 2PF4E 3QW0A 4MVMA 5E3AA 1YJGA 2XLHA 4BJTA 3A11A 4DRIB 2J0XA 3MX3A 4FX5A 3GODA 3UMIA 5B3SC 1MMGA 2B0JA 3FMSA 3FOPA 5D92A 4JEAA 3SEOA 3UMHA 1NG1A 1NU9C 1A7VA 1VOMA 2QTVA 3T4RA 3TD7A 5A69A 3TJ6A 1CGME 3RQEA 3N2ZB 2CNWA 1HW1A 3DM5A 4AL1A 3NYJA 4KNVA 4N6HA 2AP3A 1ZU4A 1ORYA 4MNDA 3I4UA 4PJNA 3EG9B 4MS2A 2EPOA 2IXMA 1YZCA 3CQZA 3JYYA 2M64A 4JRZA 3ZIBA 4LDKA 2C04A 2OCCC 3DWWA 1H9TA 3QVYA 4U5DE 4U5HA 2HKVA 1R4TA 1JPJA 3RYLA 1MNEA 3O39A 3LS0A 4H54A 3G50A 4PJLA 1A0BA 2AU5A 3Q7GA 4PK4A 4MTOA 4W8PA 4CDVA 1KTMA 1GS9A 1ST6A 5KYUB 1OCOC 2OG2A 4U5EE 1FNTc 2PBEA 3FXHA 3U9JA 1OW7A 3WG7C 4JVSA 3EFOA 3G4ZA 4JW1A 4KNWA 2X51A 1LE4A 3B0VC 256BA 4PACA 3SXYA 4JC7A 2LP4A 3NKEA 3KL4A 3ABKC 4Q7CA 3C62A 3LUTB 2G3VA 3DI5A 2XM0A 3F47A 5F5FA 1T5OA 4JCHA 4HE8D 4YL1A 4PJJA 4I3MA 3SZRA 1ZHXA 5E33A 4RD9A 1KNYA 1E83A 3C8GD 2YLDA 3C63A 1SMYF 4OIPF 1NFNA 2P7VA 1U0BB 2Y3HA 3N24A 4OIQF 1OXKA 1G4WR 3ZQYA 4J32B 1TFOB 2DB4A 4K0DA 2HZ8A 4QDLA 3OWTA 3UGOA 1FR0A 1MQVA 5FCLA 1ZU5A 4YT5A 2R25A 4LLEA 4ZLDA 2PNOA 4C7OA 2A6EF 4OIRF 3T9OA 3LLIA 1C17M 2XLMA 4E0IA 3O55A 4U9DA 5F5HA 5KYYA 1LPEA 3EGXA 2A1DD 2NUPB 1RCPA 3TQOA 5IY5C 2LCHA 3HNKA 1JPNA 3T6BA 2QUPA 1JRAA 2YQYA 4K1OA 3W2VA 4K7BA 3FAPB 3ZG1A 2NSGA 5L0GA 4AE4B 3Q7LA 1C03A 2HMZA 1K04A 1L7CA 3RKOF 4D4NA 1DOWA 5A6BD 5KYXA 1T6IA 4E7SA 1DOVA 1Q0GA 1V4AA 2ZXWC 4BJ5A 1JAFA 1YA7O 3K1IA 1LM3B 1SYQA 5AC5A 2XL8A 4MVRA 5T3WA 4G7ZF 1K40A 2XRHA 1QPUA 5BQIA 3Q6MA 3U5SA 4M63A 3HNLA 1FMVA 1LVKA 3K33A 3M1CB 2ZXPA 1BR4A 3GWNA 2GWWA 2HMQA 4CS7A 2XXAA 4DXWA 2FFHA 2UUIA 1FTSA 2J46A 1AVOB 2EPLX 5JLIA 4OINF 3IQ6A 1RKCA 1ORJA 3DXJF 2DYSC 2J0WA 1UG7A 2HJMA 2OQMA 3EGDB 3SYNA 4C3BA 3UNGC 1WN0A 3GANA 1Y4CA 3RFYA 4JKVA 1BR1A 2YKZA 3T6JA 2Q9BA 1OQCA 4BG0A 1Z23A 1XZPA 2J9BA 3BEHA 3ZQVA 1ZYRF 1A7EA 3TOLA 2V3CC 1S05A 3DAFA 3FVYA 4CIHA 3TJ5A 3KYJA 1WATA 4ULVA 2EPKX 3RQFA 3RVZA 1IZMA 4MVUA 5EGYA 4LDRA 3U8VA 1VYKA 2OOCA 4MTGA 2YL7A 2YVKA 1QQ3A 1Z7Qc 2XLEA 3X2QC 1KU2A 3B29A 2ZXOA 2I15A 1BR2A 3DJUB 3KMIA 1HMDA 2R7OA 3K1HA 5KYWA 3ASNC 3ATPA 2ASRA 2Y3GA 4O79A 2J7PD 2Q00A 3M4BA 3GM3A 1M2VA 1D0YA 4O6MA 3FOOA 4IB4A 4F4BA 1O3UA 1RJ9B 4IGGA 3VM6A 4YT2A 1LIHA 4EBBA 4EIYA 1SR2A 2HJ3A 2X0CA 3U0CA 3J06A 1OXBA 1GM5A 1C02A 4GQHA 3G4XA 1MNDA 4Z9IA 4G0HA 3SXMA 3C8GA 4G7HF 2LFFA 1EA8A 2R7SA 4ULWA 3IQTA 3S0XA 4NQFA 5CI8A 4BJ6C 1ZW3A 2H8AA 1EQ1A 3GM2A 2IXOA 3MLGA 1A41A 4IAOA 2LIGA 2R9RB 4NTAA 2KQ9A 3RVYA 2WZGA 2R03A 1V55C 1E84A 2XL4A 2O9XA
chains in the Genus database with same CATH topology
3C62A 3DE8A 2XM0A 4WGYA 3ZTMA 5JRAA 2CCYA 3NMIA 4CDYA 1E83A 4IARA 2YLDA 1CGOA 3C63A 1CPQA 4CX9A 3NMJA 5JS5A 3ZQYA 1MQVA 1YYXA 3NMKA 4U9EA 1BBHA 3IQ5A 2XLMA 2XLWA 2YLIA 4U9DA 3M79A 1RCPA 1YYJA 3HNKA 4CDAA 3L1MA 4JEBA 2XLDA 1M6TA 4JE9A 3TOMA 3ZTZA 4D4NA 2YL0A 5JVEA 3VRCA 2YL3A 5JSLA 1APCA 1JAFA 4N4WA 1LM3B 2XL8A 4CJGA 3QVZA 4WGZA 1E85A 1CGNA 1QPUA 2QLAA 3HNIA 3HNLA 4CIPA 5JT4A 4IAQA 2BC5A 5JLIA 3IQ6A 2XLOA 5B3IA 2YL1A 5JP7A 2YLGA 4ER9A 4JKVA 2YKZA 3QW0A 5AGFA 4L6RA 2J9BA 2XLVA 3ZQVA 3TOLA 2XLHA 1S05A 3ZWIA 5JUAA 4ULVA 1CPRA 1EKYA 3M4CA 3FOPA 4JEAA 2YL7A 1QQ3A 2XLEA 1E86A 1A7VA 3QW1A 1YZAA 3HNJA 2XL6A 4CJOA 4N6HA 4D4XA 3M4BA 1YZCA 3FOOA 4IB4A 4EIYA 3QVYA 2XM4A 4NC3A 3U8PA 3DE9A 4CDVA 2J8WA 3M15A 1GQAA 256BA 1NBBA 1E84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C62 A;  3DE8 A;  2XM0 A;  4WGY A;  3ZTM A;  5JRA A;  2CCY A;  3NMI A;  4CDY A;  1E83 A;  4IAR A;  2YLD A;  1CGO A;  3C63 A;  1CPQ A;  4CX9 A;  3NMJ A;  5JS5 A;  3ZQY A;  1MQV A;  1YYX A;  3NMK A;  4U9E A;  1BBH A;  3IQ5 A;  2XLM A;  2XLW A;  2YLI A;  4U9D A;  3M79 A;  1RCP A;  1YYJ A;  3HNK A;  4CDA A;  3L1M A;  4JEB A;  2XLD A;  1M6T A;  4JE9 A;  3TOM A;  3ZTZ A;  4D4N A;  2YL0 A;  5JVE A;  3VRC A;  2YL3 A;  5JSL A;  1APC A;  1JAF A;  4N4W A;  1LM3 B;  2XL8 A;  4CJG A;  3QVZ A;  4WGZ A;  1E85 A;  1CGN A;  1QPU A;  2QLA A;  3HNI A;  3HNL A;  4CIP A;  5JT4 A;  4IAQ A;  2BC5 A;  5JLI A;  3IQ6 A;  2XLO A;  5B3I A;  2YL1 A;  5JP7 A;  2YLG A;  4ER9 A;  4JKV A;  2YKZ A;  3QW0 A;  5AGF A;  4L6R A;  2J9B A;  2XLV A;  3ZQV A;  3TOL A;  2XLH A;  1S05 A;  3ZWI A;  5JUA A;  4ULV A;  1CPR A;  1EKY A;  3M4C A;  3FOP A;  4JEA A;  2YL7 A;  1QQ3 A;  2XLE A;  1E86 A;  1A7V A;  3QW1 A;  1YZA A;  3HNJ A;  2XL6 A;  4CJO A;  4N6H A;  4D4X A;  3M4B A;  1YZC A;  3FOO A;  4IB4 A;  4EIY A;  3QVY A;  2XM4 A;  4NC3 A;  3U8P A;  3DE9 A;  4CDV A;  2J8W A;  3M15 A;  1GQA A;  256B A;  1NBB A;  1E84 A; 
#chains in the Genus database with same CATH topology
 3OA1 A;  1YLM A;  2PX3 A;  1M57 C;  2EPN A;  5COF A;  2CDQ A;  5TJ5 E;  2CCY A;  1SZI A;  3NMI A;  1T9K A;  5DQT A;  4DRH B;  4CS8 C;  2VC9 A;  2WZL A;  4DBQ A;  3IEE A;  1K05 A;  3HKK A;  4YWQ A;  1VB5 A;  4H4K C;  2IXN A;  1Y6D A;  3EJN A;  1VMA A;  3MYI A;  3AG4 C;  4RDA A;  5L3V A;  1ORS C;  4FWV A;  3LNM B;  1MMD A;  4HFK B;  4NCQ A;  4YK5 A;  3QZC A;  5L0I A;  1YYX A;  3A9C A;  1NZE A;  5DQZ A;  5T3T A;  2VH3 A;  3E70 C;  2A68 F;  3H2U A;  4U9E A;  3R7C A;  2R7Q A;  3EZH A;  2BL2 A;  2QNL A;  5DS5 A;  4LDQ A;  3POV A;  4HEA J;  4CS9 A;  2J9W A;  1YYJ A;  4CBE A;  4LAC B;  3LAY A;  3QMK A;  1OCR C;  2V26 A;  1NU7 D;  2A0B A;  3LEO A;  4MQ9 F;  4EBJ A;  2KSF A;  2XLD A;  1Q0M A;  4JE9 A;  1G4U S;  2D5R B;  1RKE B;  2ICW G;  3EG9 A;  3O6X A;  4DOZ A;  2EPM X;  5L0F A;  1TFK B;  1IW7 F;  3NDB B;  4AX2 A;  4YN0 B;  3DAG A;  4JTC B;  4BJ5 C;  3ASO C;  1PD1 A;  3K1I C;  4PJM A;  2DI3 A;  3GEE A;  4JUR I;  3U3F A;  4CJG A;  1OKK D;  1U89 A;  4P9F A;  3KYI A;  1GGQ A;  4Z9H A;  2KC3 A;  3K7D A;  1PD0 A;  3NG1 A;  4KC9 A;  3B71 A;  2NSF A;  4NTF A;  4P6I C;  4CIP A;  4E7Z A;  5JT4 A;  3JRT A;  2J9V A;  5L0C A;  4I44 A;  1FFH A;  4MW8 A;  2IYL D;  2AVK A;  2XSE A;  4IAQ A;  2LK4 A;  4LLC A;  3S9O A;  4G7O F;  4J30 B;  2NG1 A;  4EKW A;  4PFO A;  2P1A A;  3O10 A;  2NPU A;  2Q3T A;  2YLG A;  4A2N B;  2R7T A;  3K66 A;  4A4A A;  2A0U A;  3UMK A;  2CW0 F;  3CZ6 A;  1HW2 A;  1HE1 A;  5DVW A;  1HE9 A;  1YAU O;  3BRJ A;  4WJ0 A;  4XEK A;  2R7R A;  5AGF A;  3ITF A;  2J7P A;  2MWQ A;  2Q4F A;  4MVO A;  1FMW A;  3EH1 A;  3LEV A;  3RIP A;  2I8B A;  3K6B A;  2OKU A;  3ZWI A;  1M56 C;  1OR2 A;  3HLZ A;  1H6G A;  1Z5Z A;  3L34 A;  5JUA A;  1CPR A;  3GEI A;  4MVZ A;  2MYS A;  1EKY A;  3RH3 A;  4E17 A;  2LD6 A;  3M4C A;  1ZHZ A;  1YVI A;  1OW6 A;  2HUJ A;  2JD3 A;  3SXZ A;  2YWA A;  5K0I A;  2G62 A;  4N06 A;  1E86 A;  2CYD A;  1D1C A;  2PP4 A;  3W8H A;  4J7T A;  3TUL A;  3HNJ A;  4NTB A;  5DLJ A;  4G78 A;  2P61 A;  2XL6 A;  3C8Z A;  3JSZ A;  3MFN A;  4CJO A;  2NUP A;  1H7I A;  3JCU Q;  5BUO A;  2L9J A;  3TK0 A;  3L8I A;  1E2X A;  3MYF A;  4EHP A;  5A6K A;  2R02 A;  1JR8 A;  4IWB A;  4NC3 A;  2KW3 C;  3W2W A;  4AE4 A;  4Z9J A;  1RMV A;  3W4Y A;  4JTD B;  4AK9 A;  2IM8 A;  3EZI A;  5EHH A;  5KYN A;  2KYH A;  5HSW A;  2J8W A;  3DD7 A;  3AG2 C;  4JZA A;  5L0J A;  1EI7 A;  3ABM C;  1XZQ A;  2KGO A;  1ZZP A;  3M15 A;  3RF3 A;  4XTK A;  2NUT B;  5KYW B;  1NBB A;  3SNH A;  2R7W A;  1MMA A;  3HTK C;  5BQH A;  4C3E A;  4U5B E;  2EIL C;  3ECS A;  4LER A;  4YT8 A;  4O6Y A;  4XLN F;  3DE8 A;  3LS1 A;  4XEV A;  2Y69 C;  3ZTM A;  5JRA A;  1YAR O;  2AWC A;  2M4E A;  3DKA A;  3JTL O;  3NYL A;  4C3D A;  4CDY A;  3AJM A;  1OW8 A;  3PHF 2;  3VF0 A;  3MBG A;  3LJB A;  4IAR A;  1U6H A;  1WTY A;  2KNH A;  4IRU A;  3SP1 A;  3EGD A;  1CGO A;  2VAS A;  2Z15 A;  1CPQ A;  2FAP B;  1D0Z A;  4Q4Z F;  3VRC A;  3NMJ A;  2R05 A;  3B9Q A;  4NY3 A;  4ZLC A;  1S7Z A;  3GOR A;  4AL0 A;  1UFB A;  1Z63 A;  1VTM P;  3X1O A;  1O87 A;  2H7V C;  2IOQ A;  4U5G A;  2D4U A;  2E87 A;  5DS4 A;  1BDJ B;  4JIO A;  4X0R A;  4OIO F;  1BBH A;  1QKR A;  4MTF A;  3RW0 A;  3CEX A;  4Q5S F;  3IQ5 A;  5DS6 A;  2HV7 A;  2XLW A;  1OKK A;  2BE5 F;  4IJJ A;  4PR9 A;  2L6G A;  3KH2 A;  3ABL C;  1JOG A;  5FZT A;  1AEP A;  5B1B C;  1TWG A;  4CS9 C;  3EPV A;  2PX0 A;  3NYM A;  1I5N A;  4HFF B;  1WGW A;  4J7Y A;  1Z6A A;  3N0T A;  3L8J A;  4JEB A;  4YL0 A;  1PV3 A;  4XQ1 A;  1H9G A;  5AC4 A;  1T6Q A;  2PFD A;  3TOM A;  2YZS A;  1J8Y F;  4O6N A;  3ZTZ A;  2IXP A;  1RJ9 A;  2HV6 A;  4DRJ B;  1LE2 A;  1JMW A;  3V7O A;  2HFI A;  1ZVZ A;  2RD9 A;  2YRF A;  3AOU A;  3LLK A;  2G3K A;  4N4W A;  5E3C A;  5F28 E;  5L3Q A;  1PCX A;  2H7B A;  4EBK A;  1OCC C;  2L81 A;  2L7A A;  1E85 A;  4WGZ A;  3AG3 C;  1CGN A;  3EFO B;  1MMN A;  3F46 A;  2EIN C;  3ZSU A;  5A6B A;  1G5Z A;  5L0D A;  2QLA A;  4YT4 A;  4U5C E;  3DM9 B;  3AGU A;  1FFT C;  1AUE A;  4FAP B;  1YDI A;  3LES A;  1D0X A;  2XS1 A;  1B68 A;  1ZHY A;  3ZC4 A;  4CSA A;  3PMR A;  1SF8 A;  3AGT A;  2BC5 A;  1QLE C;  2YEV A;  3DJN B;  3GEH A;  2P0N A;  4U5F E;  3H65 A;  2ZXR A;  1V74 B;  3NRH A;  3S90 A;  3S28 A;  2H7O A;  2YL1 A;  2WVQ A;  3GWL A;  1N1C A;  3US6 A;  4ER9 A;  3S84 A;  2RSE B;  1Q0K A;  1LS4 A;  5A6J A;  1I4Y A;  2W4B A;  1VYI A;  3EH2 A;  4L6R A;  2B0H A;  5COG A;  2XLV A;  4JCZ A;  3KPH A;  4R32 A;  4DBR A;  1LKX A;  2R7X A;  3PDM P;  3HJC A;  4C7O B;  5B1A C;  4QI2 A;  4BJ6 A;  4BPM A;  1LI5 A;  3UR3 C;  1QZX A;  2WZF A;  4EUK B;  3EGX B;  5KYY B;  3LNR A;  4FES A;  1W2W A;  5KYU A;  5L0H A;  2Y3B A;  3C18 A;  1OR3 A;  1YZA A;  3QW1 A;  1M2O A;  1WAS A;  2HS5 A;  4JTA B;  5T1D B;  2R7V A;  3KKB A;  5CIV A;  2HSQ A;  2OU6 A;  4JJF A;  4CS8 A;  2W45 A;  2L6H A;  4D4X A;  3U9M A;  3EHN A;  5GPG B;  1TKN A;  4GYT A;  4JJG A;  2Q7R A;  3FDQ A;  5KYX B;  2AWY A;  2JX0 A;  4MVQ A;  4BJ1 A;  1BZ4 A;  3IHU A;  3R2P A;  3S27 A;  2XM4 A;  3U8P A;  3DE9 A;  3OEO A;  2EIK C;  1RKE A;  2ZPA A;  3WAQ A;  2QE9 A;  2WVO A;  1TWA A;  2VCA A;  1LI7 A;  2WVN A;  3SXK A;  2KJG A;  3AQB A;  3DMD A;  3WHN A;  1F1M A;  3V5Y A;  3I5Q A;  2CNW D;  4P9T A;  4XWJ A;  2XXA B;  4BEJ A;  1GQA A;  2IBF A;  4MVS A;  4XPY A;  2OJE D;  1TR2 A;  1I4Z A;  2J45 A;  3T6G B;  1L3P A;  1RXQ A;  2Y39 A;  4EWC A;  1T6U A;  2LFD A;  3PCV A;  5CI9 A;  4WGY A;  1D1A A;  1NSG B;  4ANJ A;  5EK0 A;  3JT1 A;  1OCZ C;  2FGY A;  2EIJ C;  2F22 A;  1VLS A;  2Y3D A;  4DVY P;  4CX9 A;  3S29 A;  1HMO A;  3AG1 C;  4B6I A;  5JS5 A;  1ZW2 A;  1Q0F A;  2XS8 A;  3QTH A;  3U2M A;  2EIM C;  3I5P A;  4KBL A;  4W8K A;  4BEM J;  2LSE A;  2HSB A;  3JRM O;  2W9Y A;  3EHM A;  4I1O B;  2A6H F;  3DZA A;  3L0I A;  3NMK A;  2TMV P;  3JYH A;  4OD5 A;  4PFP A;  3WOD F;  4E0H A;  2GFH A;  3FAJ A;  4DVZ A;  2C03 A;  1ZHW A;  1A7D A;  2WB7 A;  2YLI A;  4RBN A;  3M79 A;  1G8X A;  2GDC A;  2P6V A;  3UGP A;  1TWC A;  4OD4 A;  1V54 C;  1WWP A;  2VCC A;  5D91 A;  3ZVR A;  1M2V B;  2J9U A;  4QI0 A;  3W8I A;  4CDA A;  4I1M A;  5COM A;  3L1M A;  2VCB A;  3EQL F;  4YJW A;  3V5X A;  3CSK A;  3U3B A;  2R7U A;  3JZ0 A;  2DGJ A;  1D1B A;  2CGE A;  4MW3 A;  4DJ9 A;  5E2Q A;  1M6T A;  1NFO A;  2QY9 A;  2UUH A;  4XEF A;  1ZHT A;  4KI2 A;  3U2L A;  3V5Z A;  4GEH A;  3B0P A;  2A69 F;  2GA0 A;  2YL0 A;  3C8G B;  1TWH A;  2YHS A;  3RQG A;  1WOL A;  5JVE A;  2YL3 A;  5JSL A;  4E18 A;  1APC A;  1YA9 A;  2WL8 A;  1O5H A;  3H2V A;  3VYW A;  5A6A A;  2DYR C;  2GAQ A;  2Q9A A;  4XPX A;  4N6C A;  1T01 A;  3QVZ A;  1Q0D A;  2OEX A;  1TQG A;  2LQG A;  1QVX A;  3C7J A;  1R5I D;  1HY5 A;  2OJQ A;  2VB6 A;  2KK1 A;  3AQC A;  4XLP F;  2MHR A;  3HNI A;  2W4M A;  3JSE O;  2L6F A;  1Z3I X;  3B0U X;  1FAP B;  2NUT A;  3ZDL A;  3FHD A;  2ZD9 A;  4CSA C;  2Q9C A;  1LS1 A;  4XPW A;  2JPU A;  5HV9 A;  4ONS A;  2XLO A;  3VAY A;  2ETS A;  3IQC A;  2OEV A;  1J8M F;  5B3I A;  5JP7 A;  4UDV A;  1VK5 A;  1QSP A;  3GM1 A;  3NKD A;  1VLT A;  4O7G A;  4WAB A;  3Q6N A;  3IPM O;  5BQG A;  1XWJ A;  4YL3 A;  3CAX A;  3E9V A;  1NLX A;  2PF4 E;  3QW0 A;  4MVM A;  5E3A A;  1YJG A;  2XLH A;  4BJT A;  3A11 A;  4DRI B;  2J0X A;  3MX3 A;  4FX5 A;  3GOD A;  3UMI A;  5B3S C;  1MMG A;  2B0J A;  3FMS A;  3FOP A;  5D92 A;  4JEA A;  3SEO A;  3UMH A;  1NG1 A;  1NU9 C;  1A7V A;  1VOM A;  2QTV A;  3T4R A;  3TD7 A;  5A69 A;  3TJ6 A;  1CGM E;  3RQE A;  3N2Z B;  2CNW A;  1HW1 A;  3DM5 A;  4AL1 A;  3NYJ A;  4KNV A;  4N6H A;  2AP3 A;  1ZU4 A;  1ORY A;  4MND A;  3I4U A;  4PJN A;  3EG9 B;  4MS2 A;  2EPO A;  2IXM A;  1YZC A;  3CQZ A;  3JYY A;  2M64 A;  4JRZ A;  3ZIB A;  4LDK A;  2C04 A;  2OCC C;  3DWW A;  1H9T A;  3QVY A;  4U5D E;  4U5H A;  2HKV A;  1R4T A;  1JPJ A;  3RYL A;  1MNE A;  3O39 A;  3LS0 A;  4H54 A;  3G50 A;  4PJL A;  1A0B A;  2AU5 A;  3Q7G A;  4PK4 A;  4MTO A;  4W8P A;  4CDV A;  1KTM A;  1GS9 A;  1ST6 A;  5KYU B;  1OCO C;  2OG2 A;  4U5E E;  1FNT c;  2PBE A;  3FXH A;  3U9J A;  1OW7 A;  3WG7 C;  4JVS A;  3EFO A;  3G4Z A;  4JW1 A;  4KNW A;  2X51 A;  1LE4 A;  3B0V C;  256B A;  4PAC A;  3SXY A;  4JC7 A;  2LP4 A;  3NKE A;  3KL4 A;  3ABK C;  4Q7C A;  3C62 A;  3LUT B;  2G3V A;  3DI5 A;  2XM0 A;  3F47 A;  5F5F A;  1T5O A;  4JCH A;  4HE8 D;  4YL1 A;  4PJJ A;  4I3M A;  3SZR A;  1ZHX A;  5E33 A;  4RD9 A;  1KNY A;  1E83 A;  3C8G D;  2YLD A;  3C63 A;  1SMY F;  4OIP F;  1NFN A;  2P7V A;  1U0B B;  2Y3H A;  3N24 A;  4OIQ F;  1OXK A;  1G4W R;  3ZQY A;  4J32 B;  1TFO B;  2DB4 A;  4K0D A;  2HZ8 A;  4QDL A;  3OWT A;  3UGO A;  1FR0 A;  1MQV A;  5FCL A;  1ZU5 A;  4YT5 A;  2R25 A;  4LLE A;  4ZLD A;  2PNO A;  4C7O A;  2A6E F;  4OIR F;  3T9O A;  3LLI A;  1C17 M;  2XLM A;  4E0I A;  3O55 A;  4U9D A;  5F5H A;  5KYY A;  1LPE A;  3EGX A;  2A1D D;  2NUP B;  1RCP A;  3TQO A;  5IY5 C;  2LCH A;  3HNK A;  1JPN A;  3T6B A;  2QUP A;  1JRA A;  2YQY A;  4K1O A;  3W2V A;  4K7B A;  3FAP B;  3ZG1 A;  2NSG A;  5L0G A;  4AE4 B;  3Q7L A;  1C03 A;  2HMZ A;  1K04 A;  1L7C A;  3RKO F;  4D4N A;  1DOW A;  5A6B D;  5KYX A;  1T6I A;  4E7S A;  1DOV A;  1Q0G A;  1V4A A;  2ZXW C;  4BJ5 A;  1JAF A;  1YA7 O;  3K1I A;  1LM3 B;  1SYQ A;  5AC5 A;  2XL8 A;  4MVR A;  5T3W A;  4G7Z F;  1K40 A;  2XRH A;  1QPU A;  5BQI A;  3Q6M A;  3U5S A;  4M63 A;  3HNL A;  1FMV A;  1LVK A;  3K33 A;  3M1C B;  2ZXP A;  1BR4 A;  3GWN A;  2GWW A;  2HMQ A;  4CS7 A;  2XXA A;  4DXW A;  2FFH A;  2UUI A;  1FTS A;  2J46 A;  1AVO B;  2EPL X;  5JLI A;  4OIN F;  3IQ6 A;  1RKC A;  1ORJ A;  3DXJ F;  2DYS C;  2J0W A;  1UG7 A;  2HJM A;  2OQM A;  3EGD B;  3SYN A;  4C3B A;  3UNG C;  1WN0 A;  3GAN A;  1Y4C A;  3RFY A;  4JKV A;  1BR1 A;  2YKZ A;  3T6J A;  2Q9B A;  1OQC A;  4BG0 A;  1Z23 A;  1XZP A;  2J9B A;  3BEH A;  3ZQV A;  1ZYR F;  1A7E A;  3TOL A;  2V3C C;  1S05 A;  3DAF A;  3FVY A;  4CIH A;  3TJ5 A;  3KYJ A;  1WAT A;  4ULV A;  2EPK X;  3RQF A;  3RVZ A;  1IZM A;  4MVU A;  5EGY A;  4LDR A;  3U8V A;  1VYK A;  2OOC A;  4MTG A;  2YL7 A;  2YVK A;  1QQ3 A;  1Z7Q c;  2XLE A;  3X2Q C;  1KU2 A;  3B29 A;  2ZXO A;  2I15 A;  1BR2 A;  3DJU B;  3KMI A;  1HMD A;  2R7O A;  3K1H A;  5KYW A;  3ASN C;  3ATP A;  2ASR A;  2Y3G A;  4O79 A;  2J7P D;  2Q00 A;  3M4B A;  3GM3 A;  1M2V A;  1D0Y A;  4O6M A;  3FOO A;  4IB4 A;  4F4B A;  1O3U A;  1RJ9 B;  4IGG A;  3VM6 A;  4YT2 A;  1LIH A;  4EBB A;  4EIY A;  1SR2 A;  2HJ3 A;  2X0C A;  3U0C A;  3J06 A;  1OXB A;  1GM5 A;  1C02 A;  4GQH A;  3G4X A;  1MND A;  4Z9I A;  4G0H A;  3SXM A;  3C8G A;  4G7H F;  2LFF A;  1EA8 A;  2R7S A;  4ULW A;  3IQT A;  3S0X A;  4NQF A;  5CI8 A;  4BJ6 C;  1ZW3 A;  2H8A A;  1EQ1 A;  3GM2 A;  2IXO A;  3MLG A;  1A41 A;  4IAO A;  2LIG A;  2R9R B;  4NTA A;  2KQ9 A;  3RVY A;  2WZG A;  2R03 A;  1V55 C;  1E84 A;  2XL4 A;  2O9X A; 
#chains in the Genus database with same CATH homology
 3C62 A;  3DE8 A;  2XM0 A;  4WGY A;  3ZTM A;  5JRA A;  2CCY A;  3NMI A;  4CDY A;  1E83 A;  4IAR A;  2YLD A;  1CGO A;  3C63 A;  1CPQ A;  4CX9 A;  3NMJ A;  5JS5 A;  3ZQY A;  1MQV A;  1YYX A;  3NMK A;  4U9E A;  1BBH A;  3IQ5 A;  2XLM A;  2XLW A;  2YLI A;  4U9D A;  3M79 A;  1RCP A;  1YYJ A;  3HNK A;  4CDA A;  3L1M A;  4JEB A;  2XLD A;  1M6T A;  4JE9 A;  3TOM A;  3ZTZ A;  4D4N A;  2YL0 A;  5JVE A;  3VRC A;  2YL3 A;  5JSL A;  1APC A;  1JAF A;  4N4W A;  1LM3 B;  2XL8 A;  4CJG A;  3QVZ A;  4WGZ A;  1E85 A;  1CGN A;  1QPU A;  2QLA A;  3HNI A;  3HNL A;  4CIP A;  5JT4 A;  4IAQ A;  2BC5 A;  5JLI A;  3IQ6 A;  2XLO A;  5B3I A;  2YL1 A;  5JP7 A;  2YLG A;  4ER9 A;  4JKV A;  2YKZ A;  3QW0 A;  5AGF A;  4L6R A;  2J9B A;  2XLV A;  3ZQV A;  3TOL A;  2XLH A;  1S05 A;  3ZWI A;  5JUA A;  4ULV A;  1CPR A;  1EKY A;  3M4C A;  3FOP A;  4JEA A;  2YL7 A;  1QQ3 A;  2XLE A;  1E86 A;  1A7V A;  3QW1 A;  1YZA A;  3HNJ A;  2XL6 A;  4CJO A;  4N6H A;  4D4X A;  3M4B A;  1YZC A;  3FOO A;  4IB4 A;  4EIY A;  3QVY A;  2XM4 A;  4NC3 A;  3U8P A;  3DE9 A;  4CDV A;  2J8W A;  3M15 A;  1GQA A;  256B A;  1NBB A;  1E84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...