1YYJA

The nmr solution structure of a redesigned apocytochrome b562:rd-apocyt b562
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
105
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANGKVKEAQAAAEQLKTTIRAYNQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords redesigned apocytochrome B562
publication title Specific non-native hydrophobic interactions in a hidden folding intermediate: implications for protein folding
pubmed doi rcsb
molecule tags De novo protein
total genus 40
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2005-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yyjA00
5JLIA 2XLWA 2J9BA 3HNKA 5JP7A 4L6RA 3HNJA 4D4XA 3VRCA 2XLEA 1JAFA 3M4CA 5B3IA 3U8PA 4D4NA 3QW1A 1YYXA 2YL7A 4CDVA 3NMJA 5JVEA 2XLVA 2XLOA 4CJGA 2J8WA 4N4WA 3C63A 3L1MA 3QVZA 2YKZA 1YZCA 4WGYA 1GQAA 4JE9A 4NC3A 3ZQVA 3NMKA 5JT4A 2YLIA 3ZQYA 1CPQA 1BBHA 1RCPA 2QLAA 3DE8A 1QPUA 2XLMA 3HNIA 3FOOA 4IAQA 256BA 4U9EA 4CDAA 3DE9A 1MQVA 1CPRA 1LM3B 2XL6A 4JEBA 2YLDA 1YYJA 3FOPA 1CGOA 5JSLA 2XM4A 1APCA 4N6HA 5AGFA 1CGNA 4CX9A 4IARA 1A7VA 4ER9A 2XLDA 3HNLA 3QVYA 3ZWIA 3C62A 2XLHA 3ZTMA 5JUAA 3ZTZA 3IQ5A 2BC5A 2YL1A 1E84A 2XM0A 4IB4A 4CJOA 4JKVA 4WGZA 1E86A 1YZAA 3TOLA 3NMIA 3M79A 4U9DA 4ULVA 5JS5A 1E85A 4CDYA 3M4BA 1NBBA 1M6TA 2XL8A 3M15A 4EIYA 4CIPA 2CCYA 3TOMA 3QW0A 2YL3A 1EKYA 2YLGA 5JRAA 1QQ3A 4JEAA 1E83A 1S05A 2YL0A 3IQ6A
chains in the Genus database with same CATH superfamily
1T5OA 3U2MA 3LS1A 4F4BA 2EPOA 1M57C 1F1MA 2Y3DA 5A6JA 3ZVRA 3V5XA 4NTAA 3DZAA 3ATPA 5IY5C 3FAPB 4LDKA 4JCHA 3OEOA 2NUPB 4D4XA 1ORSC 3TQOA 2ICWG 4C3BA 1JAFA 3ABMC 4D4NA 3H2UA 2Y39A 3A9CA 4HEAJ 4E17A 1HMOA 5BQIA 5BQHA 4C3DA 4LLCA 5JVEA 2L6HA 3A11A 1Q0KA 1VYIA 2IXOA 2JD3A 2W45A 2UUIA 1SF8A 2IM8A 2M4EA 3DAFA 3G4XA 4FX5A 3VM6A 2R7RA 2E87A 3T4RA 1SYQA 5COGA 3SXMA 5T1DB 5E33A 1T6QA 4N4WA 2HV7A 2OJED 1MMNA 4DRIB 4E7ZA 1RKCA 3W2VA 1LE2A 3IQCA 1D1BA 2Q3TA 4PR9A 2HSBA 1VYKA 3L0IA 2R02A 4JCZA 3SNHA 3U3BA 2I8BA 4WGYA 1JR8A 1ZHXA 2EPMX 4A2NB 1C17M 5F5FA 2ZXRA 1RKEB 2XS8A 3GWLA 2J45A 3CSKA 3FVYA 2X0CA 4DJ9A 5BUOA 5JT4A 4OD5A 3EZIA 2Y3HA 3NYMA 3C8GA 1IZMA 3EGXA 4PJNA 3IQTA 1FMWA 1A7EA 1W2WA 1YA9A 4G78A 4XLPF 1XZQA 3LEOA 4XEVA 2CYDA 2XSEA 4N6CA 3HNIA 1K05A 4MTFA 1HE9A 5F28E 3RQFA 2AP3A 2OKUA 1T6UA 2JX0A 4U9EA 4U5EE 5KYYA 3O39A 4EUKB 2QNLA 2EILC 4MVRA 2EIMC 1CPRA 2WVQA 4DBQA 4MVOA 4NCQA 4P6IC 3ZSUA 2XL6A 4QI0A 1A7DA 1NU9C 4JEBA 2W4MA 1L7CA 3RIPA 1OR2A 1QSPA 3M1CB 4PJMA 2XM4A 3AJMA 2CGEA 1G4WR 4N6HA 1LPEA 1CGNA 3EHMA 1GGQA 4IARA 2ETSA 3HJCA 5AGFA 1A7VA 4DRHB 5L3QA 1O3UA 3DI5A 4RBNA 3K6BA 1I4YA 3FMSA 4XEFA 1WOLA 4YK5A 3T6GB 5BQGA 3RF3A 4G7OF 2NSFA 3C62A 4YN0B 1VB5A 3ZTMA 5KYWA 4ZLDA 1Q0GA 5L0FA 2YL1A 4RD9A 2QTVA 1WN0A 2EPNA 3T9OA 1Z5ZA 4BJTA 3H2VA 3W8HA 2LFFA 4BJ5A 1ZU5A 4ULWA 1BDJB 3NMIA 3B9QA 4EHPA 2WZFA 5JS5A 2IXMA 1E85A 4MVMA 4CDYA 3M4BA 2BL2A 2B0JA 4YJWA 3J06A 2L7AA 2PP4A 4MVUA 4J7YA 3WHNA 2L6FA 2KYHA 1KTMA 2VCAA 4EIYA 3JT1A 2QY9A 3EJNA 2Q9AA 3ITFA 4CIPA 3JSEO 1NZEA 3TOMA 3JYYA 3SEOA 2QUPA 2AU5A 4CS8A 5DQZA 1TFKB 3S29A 5JRAA 3GODA 2LQGA 2Q9CA 3O10A 2Q00A 4M63A 4CS7A 3UGOA 4NTFA 3U9MA 4O6NA 3B0UX 5A69A 2KK1A 5DVWA 4EBBA 5JLIA 3DD7A 3TD7A 3U3FA 2CDQA 1M2VB 4XPWA 3H65A 2A0BA 3JRMO 3MX3A 4MQ9F 5JP7A 1Z63A 1BZ4A 3B29A 4DOZA 2DYSC 1U6HA 1Z23A 1V55C 2H8AA 2X51A 5HV9A 3TULA 4X0RA 4XPYA 1LI7A 4JJGA 3SZRA 1FAPB 2TMVP 3Q6NA 1C02A 4LDQA 2EIKC 3VRCA 2MYSA 3U8PA 3ABLC 3QW1A 5F5HA 3W8IA 5COFA 2JPUA 3KMIA 3KPHA 1YYXA 2PFDA 3WAQA 4AL0A 3HKKA 1M2VA 2OCCC 1HW2A 1WTYA 3I5PA 1T6IA 3LLIA 3R7CA 2HKVA 2P1AA 3LUTB 3SYNA 1XZPA 2J9WA 1YA7O 4CJGA 1NU7D 2J8WA 5COMA 1TWAA 4Q7CA 1MMDA 2C03A 3ZG1A 2AWYA 1YLMA 2PX3A 3G4ZA 4P9TA 1QZXA 2R05A 3C18A 3L1MA 4N06A 4JURI 2YHSA 3AG3C 3ASOC 1PV3A 4JJFA 3FDQA 3UR3C 2KC3A 5DS6A 2QE9A 3BRJA 2DB4A 3U2LA 1NFNA 2XS1A 1C03A 1ZHTA 2NUTB 3EQLF 1GQAA 4O7GA 5A6KA 4JE9A 3N24A 1NG1A 3ZQVA 4OIQF 3NKEA 1ZW3A 4U5DE 3S90A 3RQEA 2Q7RA 3CQZA 1MNDA 2PF4E 3US6A 3GWNA 3S0XA 3ZQYA 1U0BB 1DOWA 2LD6A 2Q9BA 2LSEA 4I1MA 3DXJF 2HZ8A 1RCPA 3TK0A 1WGWA 2YQYA 4IRUA 3PCVA 3RH3A 2NUTA 4A4AA 1Y6DA 3DAGA 1TWHA 3FOOA 4IAQA 1Y4CA 2ZXWC 3KKBA 4BJ6C 1XWJA 3S84A 4DBRA 2HMQA 2L81A 4CDAA 2LIGA 3KYJA 2MHRA 1MQVA 1VK5A 4W8KA 5D92A 1U89A 3C8GB 1LM3B 2O9XA 1ZYRF 3EGXB 1O5HA 4BPMA 1SR2A 2R7VA 3DMDA 1Q0FA 1ZZPA 1MMGA 1YYJA 4E0IA 2LCHA 1WWPA 1LIHA 2HUJA 1NLXA 2L9JA 3JSZA 4E0HA 1B68A 3POVA 3X2QC 3PDMP 5KYUA 3LEVA 4CX9A 4EWCA 2L6GA 2P61A 2PBEA 1LS4A 3CZ6A 4YT2A 5KYYB 1CGME 1UG7A 4ER9A 2XLDA 3QTHA 1RJ9A 4JTAB 1GM5A 1JOGA 3HNLA 5CIVA 4W8PA 3QVYA 4DRJB 2A0UA 2MWQA 2XLHA 2ZPAA 3KYIA 3MLGA 2G3KA 1D0ZA 2YZSA 4JIOA 4U5HA 3RYLA 2DI3A 2BC5A 5L0CA 3EG9A 2GAQA 2J7PA 3KL4A 1A41A 1JMWA 4G7HF 4JKVA 2R7UA 4YL3A 4WGZA 1E86A 4OD4A 2WVNA 3UMKA 5L0GA 3MYFA 5L0IA 2DGJA 2KSFA 1YZAA 3FHDA 4DVZA 1G5ZA 3AG4C 3M79A 4ULVA 4CS9C 4YT5A 5KYXA 1BR4A 5KYWB 1UFBA 1M6TA 1NFOA 2FAPB 2XL8A 4MVQA 4RDAA 4WABA 1OCCC 4NTBA 3RVYA 4YT8A 2R03A 2R7WA 3NDBB 4HE8D 3K66A 4B6IA 4H4KC 4IJJA 3PMRA 1FFTC 4C7OB 1J8MF 2BE5F 2R9RB 3QW0A 4I1OB 1VMAA 2YLGA 2P6VA 4J30B 5K0IA 4BG0A 4GEHA 4U5CE 3RKOF 3U8VA 3E9VA 3EPVA 4U5GA 3U5SA 3ZC4A 3IQ6A 4IAOA 1M56C 2XLWA 2J9BA 3HNKA 2HJMA 4JRZA 1DOVA 4PJJA 1KNYA 2CW0F 4XEKA 4C7OA 1SMYF 2LK4A 2Y69C 3LESA 3MBGA 3F46A 3NRHA 1H6GA 3OWTA 3L8JA 3U0CA 4I3MA 3HLZA 1VTMP 3UMHA 1T9KA 2WZLA 4YWQA 4KNVA 2J7PD 2XLEA 2YVKA 3M4CA 3NYLA 2J0WA 3N2ZB 2WZGA 2YL7A 2R7QA 1TKNA 1YARO 3QZCA 4YT4A 5DS5A 3Q7LA 4GQHA 1J8YF 1YDIA 4ZLCA 1PD1A 1TWGA 4CSAA 4JTCB 3B0PA 3GEEA 1QLEC 3JYHA 4UDVA 3AGUA 3O6XA 1RMVA 1BR2A 3ECSA 2PNOA 1D0YA 3DJUB 3I5QA 3W2WA 1ORJA 4DXWA 1I5NA 3X1OA 2VCBA 1QVXA 2PX0A 2A1DD 2RSEB 3GEIA 3AOUA 3Q6MA 1H9TA 4LLEA 2XL4A 4EBKA 4IWBA 3SXKA 5A6BA 1Q0DA 3EGDA 1WASA 2YEVA 1A0BA 2HV6A 4MVZA 3RW0A 1FR0A 5GPGB 1OXKA 2GA0A 3AQBA 1O87A 1ZHYA 4NC3A 4JW1A 4P9FA 4FWVA 1Z7Qc 3O55A 4U5BE 3AQCA 1YAUO 3ASNC 3GM2A 4XLNF 5A6AA 3U9JA 3TJ5A 1EI7A 2LFDA 3R2PA 1OKKD 4OIOF 2IOQA 2C04A 4BEMJ 2KQ9A 1KU2A 2QLAA 3DE8A 1Z6AA 5E2QA 3EH1A 3GORA 3ZIBA 2G3VA 3RFYA 5D91A 3B0VC 3EH2A 1T01A 3AG2C 1ZW2A 4K7BA 1ST6A 2D5RB 3DE9A 2IYLD 4XWJA 5DS4A 1LE4A 3T6BA 3DM9B 1N1CA 1HY5A 3AGTA 3GANA 1LS1A 2YLDA 3I4UA 4GYTA 3RVZA 1TQGA 3FOPA 2IBFA 1JPJA 1CGOA 2ZXPA 3GM1A 1MNEA 4OIPF 4KBLA 1BR1A 3EFOA 2H7VC 4CBEA 1APCA 2ASRA 2VCCA 2Y3BA 3JZ0A 3LNRA 2KJGA 2P0NA 2YWAA 5A6BD 3TJ6A 3Q7GA 4IGGA 1IW7F 1D1CA 2DYRC 1D0XA 3HTKC 5L3VA 3ZWIA 4KI2A 2XXAB 3KH2A 1HE1A 3JTLO 3SXYA 3ZTZA 3IQ5A 1G8XA 1E84A 2XM0A 4JVSA 3VF0A 4IB4A 3CAXA 4Q5SF 2J9VA 5KYNA 1Q0MA 5KYUB 3VAYA 5B1AC 4NQFA 3DM5A 3K1IA 4H54A 1PCXA 2D4UA 5L0DA 1RJ9B 2XXAA 2IXNA 4QI2A 2NSGA 2F22A 1G4US 2IXPA 1SZIA 1R4TA 2GWWA 4KNWA 4O79A 3GM3A 4J32B 3S27A 1NBBA 4JZAA 4MVSA 1K40A 1VLTA 5AC5A 4CIHA 2V3CC 2OOCA 3EG9B 4U5FE 3E70C 1ZVZA 4WJ0A 5DLJA 4JC7A 4EKWA 2HMZA 2CCYA 2AWCA 2NUPA 4EBJA 1LI5A 5E3CA 4E18A 2R7XA 2Z15A 1EA8A 4JEAA 2OEXA 1S05A 1H9GA 2YL0A 2P7VA 1QPUA 5KYXB 4AX2A 1LVKA 2OG2A 2FFHA 1ZHZA 3LNMB 1TR2A 4K0DA 2KW3C 4E7SA 2R7SA 4L6RA 2A6HF 3HNJA 1OW6A 4Z9IA 3IPMO 1H7IA 3FAJA 2YRFA 1I4ZA 4LERA 2WL8A 2B0HA 4MW8A 1JPNA 5EGYA 1R5ID 1OQCA 3W4YA 5B3IA 4PFPA 1Z3IX 4YL1A 3UNGC 5HSWA 1VOMA 1YVIA 4HFKB 4CDVA 4BJ6A 2KNHA 4BJ5C 3NMJA 4XTKA 1FNTc 1V74B 3F47A 3K7DA 3N0TA 3SXZA 2ZXOA 3JRTA 2XLVA 1OXBA 1MMAA 1OW8A 2HSQA 2XLOA 4AE4B 4DVYP 4Q4ZF 1AEPA 1RKEA 2AVKA 3UGPA 1OW7A 2EPLX 4CSAC 2WB7A 3C63A 3LAYA 2R25A 3QMKA 1YJGA 4K1OA 3RQGA 4BEJA 3C7JA 1ORYA 3LJBA 4FESA 1TFOB 4KC9A 3L34A 4CS8C 3QVZA 4JTDB 2YKZA 1L3PA 1YZCA 2VC9A 4AE4A 4MW3A 1HW1A 4J7TA 4O6MA 4O6YA 5FCLA 2H7BA 1OKKA 5B1BC 4LDRA 2KGOA 3DJNB 3MYIA 2A6EF 3NMKA 1OR3A 1M2OA 5E3AA 3T6JA 2J9UA 4BJ1A 3EHNA 3C8ZA 2YLIA 1CPQA 2J0XA 4R32A 1BBHA 4OIRF 3WODF 1OCOC 2OEVA 2H7OA 3CEXA 2GDCA 2VASA 2EINC 2R7OA 3EGDB 2XLMA 4OINF 1PD0A 2W9YA 3IEEA 256BA 4PJLA 4C3EA 3IHUA 3C8GD 4MTGA 1TWCA 4CS9A 3ZDLA 1AUEA 4PFOA 3SP1A 2VH3A 1LKXA 2UUHA 3DWWA 4YL0A 3V5ZA 1FMVA 2W4BA 5EHHA 3B71A 4I44A 1K04A 3VYWA 1VLSA 2A69F 2OJQA 3EZHA 4NY3A 2V26A 5B3SC 4G7ZF 5EK0A 1FFHA 2A68F 4LACB 4ONSA 1JRAA 2FGYA 2CNWA 2NPUA 2OU6A 2LP4A 4Z9HA 5JSLA 2ZD9A 3ABKC 2J46A 3NKDA 4MS2A 2HS5A 3G50A 5FZTA 3V5YA 3LLKA 3S28A 1V4AA 3NYJA 5AC4A 3GEHA 1ZHWA 2EIJC 3K1HA 4MNDA 1S7ZA 1OCZC 2EPKX 4XPXA 5JUAA 3MFNA 5DQTA 5TJ5E 4QDLA 1V54C 2WVOA 2VB6A 3LS0A 4XQ1A 4CJOA 1E2XA 1FTSA 3AG1C 3EFOB 5CI8A 2HJ3A 4AK9A 2GFHA 2XRHA 1HMDA 2Y3GA 4G0HA 1AVOB 3TOLA 1RXQA 2Q4FA 3DKAA 3UMIA 3FXHA 4HFFB 1NSGB 4U9DA 5T3WA 5L0HA 4ANJA 1GS9A 1WATA 1OCRC 2G62A 2NG1A 2HFIA 2RD9A 4PACA 5CI9A 3K1IC 3M15A 2R7TA 1EQ1A 5L0JA 3K33A 4FAPB 3S9OA 3JCUQ 4AL1A 2OQMA 4PK4A 3OA1A 2YL3A 1EKYA 4MTOA 1QKRA 2CNWD 2M64A 3V7OA 4Z9JA 1D1AA 1QQ3A 5T3TA 3WG7C 1E83A 3NG1A 3L8IA 1ZU4A 2I15A 3BEHA 3PHF2
chains in the Genus database with same CATH topology
5JLIA 2XLWA 2J9BA 3HNKA 5JP7A 4L6RA 3HNJA 4D4XA 3VRCA 2XLEA 1JAFA 3M4CA 5B3IA 3U8PA 4D4NA 3QW1A 1YYXA 2YL7A 4CDVA 3NMJA 5JVEA 2XLVA 2XLOA 4CJGA 2J8WA 4N4WA 3C63A 3L1MA 3QVZA 2YKZA 1YZCA 4WGYA 1GQAA 4JE9A 4NC3A 3ZQVA 3NMKA 5JT4A 2YLIA 3ZQYA 1CPQA 1BBHA 1RCPA 2QLAA 3DE8A 1QPUA 2XLMA 3HNIA 3FOOA 4IAQA 256BA 4U9EA 4CDAA 3DE9A 1MQVA 1CPRA 1LM3B 2XL6A 4JEBA 2YLDA 1YYJA 3FOPA 1CGOA 5JSLA 2XM4A 1APCA 4N6HA 5AGFA 1CGNA 4CX9A 4IARA 1A7VA 4ER9A 2XLDA 3HNLA 3QVYA 3ZWIA 3C62A 2XLHA 3ZTMA 5JUAA 3ZTZA 3IQ5A 2BC5A 2YL1A 1E84A 2XM0A 4IB4A 4CJOA 4JKVA 4WGZA 1E86A 1YZAA 3TOLA 3NMIA 3M79A 4U9DA 4ULVA 5JS5A 1E85A 4CDYA 3M4BA 1NBBA 1M6TA 2XL8A 3M15A 4EIYA 4CIPA 2CCYA 3TOMA 3QW0A 2YL3A 1EKYA 2YLGA 5JRAA 1QQ3A 4JEAA 1E83A 1S05A 2YL0A 3IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLI A;  2XLW A;  2J9B A;  3HNK A;  5JP7 A;  4L6R A;  3HNJ A;  4D4X A;  3VRC A;  2XLE A;  1JAF A;  3M4C A;  5B3I A;  3U8P A;  4D4N A;  3QW1 A;  1YYX A;  2YL7 A;  4CDV A;  3NMJ A;  5JVE A;  2XLV A;  2XLO A;  4CJG A;  2J8W A;  4N4W A;  3C63 A;  3L1M A;  3QVZ A;  2YKZ A;  1YZC A;  4WGY A;  1GQA A;  4JE9 A;  4NC3 A;  3ZQV A;  3NMK A;  5JT4 A;  2YLI A;  3ZQY A;  1CPQ A;  1BBH A;  1RCP A;  2QLA A;  3DE8 A;  1QPU A;  2XLM A;  3HNI A;  3FOO A;  4IAQ A;  256B A;  4U9E A;  4CDA A;  3DE9 A;  1MQV A;  1CPR A;  1LM3 B;  2XL6 A;  4JEB A;  2YLD A;  1YYJ A;  3FOP A;  1CGO A;  5JSL A;  2XM4 A;  1APC A;  4N6H A;  5AGF A;  1CGN A;  4CX9 A;  4IAR A;  1A7V A;  4ER9 A;  2XLD A;  3HNL A;  3QVY A;  3ZWI A;  3C62 A;  2XLH A;  3ZTM A;  5JUA A;  3ZTZ A;  3IQ5 A;  2BC5 A;  2YL1 A;  1E84 A;  2XM0 A;  4IB4 A;  4CJO A;  4JKV A;  4WGZ A;  1E86 A;  1YZA A;  3TOL A;  3NMI A;  3M79 A;  4U9D A;  4ULV A;  5JS5 A;  1E85 A;  4CDY A;  3M4B A;  1NBB A;  1M6T A;  2XL8 A;  3M15 A;  4EIY A;  4CIP A;  2CCY A;  3TOM A;  3QW0 A;  2YL3 A;  1EKY A;  2YLG A;  5JRA A;  1QQ3 A;  4JEA A;  1E83 A;  1S05 A;  2YL0 A;  3IQ6 A; 
#chains in the Genus database with same CATH topology
 1T5O A;  3U2M A;  3LS1 A;  4F4B A;  2EPO A;  1M57 C;  1F1M A;  2Y3D A;  5A6J A;  3ZVR A;  3V5X A;  4NTA A;  3DZA A;  3ATP A;  5IY5 C;  3FAP B;  4LDK A;  4JCH A;  3OEO A;  2NUP B;  4D4X A;  1ORS C;  3TQO A;  2ICW G;  4C3B A;  1JAF A;  3ABM C;  4D4N A;  3H2U A;  2Y39 A;  3A9C A;  4HEA J;  4E17 A;  1HMO A;  5BQI A;  5BQH A;  4C3D A;  4LLC A;  5JVE A;  2L6H A;  3A11 A;  1Q0K A;  1VYI A;  2IXO A;  2JD3 A;  2W45 A;  2UUI A;  1SF8 A;  2IM8 A;  2M4E A;  3DAF A;  3G4X A;  4FX5 A;  3VM6 A;  2R7R A;  2E87 A;  3T4R A;  1SYQ A;  5COG A;  3SXM A;  5T1D B;  5E33 A;  1T6Q A;  4N4W A;  2HV7 A;  2OJE D;  1MMN A;  4DRI B;  4E7Z A;  1RKC A;  3W2V A;  1LE2 A;  3IQC A;  1D1B A;  2Q3T A;  4PR9 A;  2HSB A;  1VYK A;  3L0I A;  2R02 A;  4JCZ A;  3SNH A;  3U3B A;  2I8B A;  4WGY A;  1JR8 A;  1ZHX A;  2EPM X;  4A2N B;  1C17 M;  5F5F A;  2ZXR A;  1RKE B;  2XS8 A;  3GWL A;  2J45 A;  3CSK A;  3FVY A;  2X0C A;  4DJ9 A;  5BUO A;  5JT4 A;  4OD5 A;  3EZI A;  2Y3H A;  3NYM A;  3C8G A;  1IZM A;  3EGX A;  4PJN A;  3IQT A;  1FMW A;  1A7E A;  1W2W A;  1YA9 A;  4G78 A;  4XLP F;  1XZQ A;  3LEO A;  4XEV A;  2CYD A;  2XSE A;  4N6C A;  3HNI A;  1K05 A;  4MTF A;  1HE9 A;  5F28 E;  3RQF A;  2AP3 A;  2OKU A;  1T6U A;  2JX0 A;  4U9E A;  4U5E E;  5KYY A;  3O39 A;  4EUK B;  2QNL A;  2EIL C;  4MVR A;  2EIM C;  1CPR A;  2WVQ A;  4DBQ A;  4MVO A;  4NCQ A;  4P6I C;  3ZSU A;  2XL6 A;  4QI0 A;  1A7D A;  1NU9 C;  4JEB A;  2W4M A;  1L7C A;  3RIP A;  1OR2 A;  1QSP A;  3M1C B;  4PJM A;  2XM4 A;  3AJM A;  2CGE A;  1G4W R;  4N6H A;  1LPE A;  1CGN A;  3EHM A;  1GGQ A;  4IAR A;  2ETS A;  3HJC A;  5AGF A;  1A7V A;  4DRH B;  5L3Q A;  1O3U A;  3DI5 A;  4RBN A;  3K6B A;  1I4Y A;  3FMS A;  4XEF A;  1WOL A;  4YK5 A;  3T6G B;  5BQG A;  3RF3 A;  4G7O F;  2NSF A;  3C62 A;  4YN0 B;  1VB5 A;  3ZTM A;  5KYW A;  4ZLD A;  1Q0G A;  5L0F A;  2YL1 A;  4RD9 A;  2QTV A;  1WN0 A;  2EPN A;  3T9O A;  1Z5Z A;  4BJT A;  3H2V A;  3W8H A;  2LFF A;  4BJ5 A;  1ZU5 A;  4ULW A;  1BDJ B;  3NMI A;  3B9Q A;  4EHP A;  2WZF A;  5JS5 A;  2IXM A;  1E85 A;  4MVM A;  4CDY A;  3M4B A;  2BL2 A;  2B0J A;  4YJW A;  3J06 A;  2L7A A;  2PP4 A;  4MVU A;  4J7Y A;  3WHN A;  2L6F A;  2KYH A;  1KTM A;  2VCA A;  4EIY A;  3JT1 A;  2QY9 A;  3EJN A;  2Q9A A;  3ITF A;  4CIP A;  3JSE O;  1NZE A;  3TOM A;  3JYY A;  3SEO A;  2QUP A;  2AU5 A;  4CS8 A;  5DQZ A;  1TFK B;  3S29 A;  5JRA A;  3GOD A;  2LQG A;  2Q9C A;  3O10 A;  2Q00 A;  4M63 A;  4CS7 A;  3UGO A;  4NTF A;  3U9M A;  4O6N A;  3B0U X;  5A69 A;  2KK1 A;  5DVW A;  4EBB A;  5JLI A;  3DD7 A;  3TD7 A;  3U3F A;  2CDQ A;  1M2V B;  4XPW A;  3H65 A;  2A0B A;  3JRM O;  3MX3 A;  4MQ9 F;  5JP7 A;  1Z63 A;  1BZ4 A;  3B29 A;  4DOZ A;  2DYS C;  1U6H A;  1Z23 A;  1V55 C;  2H8A A;  2X51 A;  5HV9 A;  3TUL A;  4X0R A;  4XPY A;  1LI7 A;  4JJG A;  3SZR A;  1FAP B;  2TMV P;  3Q6N A;  1C02 A;  4LDQ A;  2EIK C;  3VRC A;  2MYS A;  3U8P A;  3ABL C;  3QW1 A;  5F5H A;  3W8I A;  5COF A;  2JPU A;  3KMI A;  3KPH A;  1YYX A;  2PFD A;  3WAQ A;  4AL0 A;  3HKK A;  1M2V A;  2OCC C;  1HW2 A;  1WTY A;  3I5P A;  1T6I A;  3LLI A;  3R7C A;  2HKV A;  2P1A A;  3LUT B;  3SYN A;  1XZP A;  2J9W A;  1YA7 O;  4CJG A;  1NU7 D;  2J8W A;  5COM A;  1TWA A;  4Q7C A;  1MMD A;  2C03 A;  3ZG1 A;  2AWY A;  1YLM A;  2PX3 A;  3G4Z A;  4P9T A;  1QZX A;  2R05 A;  3C18 A;  3L1M A;  4N06 A;  4JUR I;  2YHS A;  3AG3 C;  3ASO C;  1PV3 A;  4JJF A;  3FDQ A;  3UR3 C;  2KC3 A;  5DS6 A;  2QE9 A;  3BRJ A;  2DB4 A;  3U2L A;  1NFN A;  2XS1 A;  1C03 A;  1ZHT A;  2NUT B;  3EQL F;  1GQA A;  4O7G A;  5A6K A;  4JE9 A;  3N24 A;  1NG1 A;  3ZQV A;  4OIQ F;  3NKE A;  1ZW3 A;  4U5D E;  3S90 A;  3RQE A;  2Q7R A;  3CQZ A;  1MND A;  2PF4 E;  3US6 A;  3GWN A;  3S0X A;  3ZQY A;  1U0B B;  1DOW A;  2LD6 A;  2Q9B A;  2LSE A;  4I1M A;  3DXJ F;  2HZ8 A;  1RCP A;  3TK0 A;  1WGW A;  2YQY A;  4IRU A;  3PCV A;  3RH3 A;  2NUT A;  4A4A A;  1Y6D A;  3DAG A;  1TWH A;  3FOO A;  4IAQ A;  1Y4C A;  2ZXW C;  3KKB A;  4BJ6 C;  1XWJ A;  3S84 A;  4DBR A;  2HMQ A;  2L81 A;  4CDA A;  2LIG A;  3KYJ A;  2MHR A;  1MQV A;  1VK5 A;  4W8K A;  5D92 A;  1U89 A;  3C8G B;  1LM3 B;  2O9X A;  1ZYR F;  3EGX B;  1O5H A;  4BPM A;  1SR2 A;  2R7V A;  3DMD A;  1Q0F A;  1ZZP A;  1MMG A;  1YYJ A;  4E0I A;  2LCH A;  1WWP A;  1LIH A;  2HUJ A;  1NLX A;  2L9J A;  3JSZ A;  4E0H A;  1B68 A;  3POV A;  3X2Q C;  3PDM P;  5KYU A;  3LEV A;  4CX9 A;  4EWC A;  2L6G A;  2P61 A;  2PBE A;  1LS4 A;  3CZ6 A;  4YT2 A;  5KYY B;  1CGM E;  1UG7 A;  4ER9 A;  2XLD A;  3QTH A;  1RJ9 A;  4JTA B;  1GM5 A;  1JOG A;  3HNL A;  5CIV A;  4W8P A;  3QVY A;  4DRJ B;  2A0U A;  2MWQ A;  2XLH A;  2ZPA A;  3KYI A;  3MLG A;  2G3K A;  1D0Z A;  2YZS A;  4JIO A;  4U5H A;  3RYL A;  2DI3 A;  2BC5 A;  5L0C A;  3EG9 A;  2GAQ A;  2J7P A;  3KL4 A;  1A41 A;  1JMW A;  4G7H F;  4JKV A;  2R7U A;  4YL3 A;  4WGZ A;  1E86 A;  4OD4 A;  2WVN A;  3UMK A;  5L0G A;  3MYF A;  5L0I A;  2DGJ A;  2KSF A;  1YZA A;  3FHD A;  4DVZ A;  1G5Z A;  3AG4 C;  3M79 A;  4ULV A;  4CS9 C;  4YT5 A;  5KYX A;  1BR4 A;  5KYW B;  1UFB A;  1M6T A;  1NFO A;  2FAP B;  2XL8 A;  4MVQ A;  4RDA A;  4WAB A;  1OCC C;  4NTB A;  3RVY A;  4YT8 A;  2R03 A;  2R7W A;  3NDB B;  4HE8 D;  3K66 A;  4B6I A;  4H4K C;  4IJJ A;  3PMR A;  1FFT C;  4C7O B;  1J8M F;  2BE5 F;  2R9R B;  3QW0 A;  4I1O B;  1VMA A;  2YLG A;  2P6V A;  4J30 B;  5K0I A;  4BG0 A;  4GEH A;  4U5C E;  3RKO F;  3U8V A;  3E9V A;  3EPV A;  4U5G A;  3U5S A;  3ZC4 A;  3IQ6 A;  4IAO A;  1M56 C;  2XLW A;  2J9B A;  3HNK A;  2HJM A;  4JRZ A;  1DOV A;  4PJJ A;  1KNY A;  2CW0 F;  4XEK A;  4C7O A;  1SMY F;  2LK4 A;  2Y69 C;  3LES A;  3MBG A;  3F46 A;  3NRH A;  1H6G A;  3OWT A;  3L8J A;  3U0C A;  4I3M A;  3HLZ A;  1VTM P;  3UMH A;  1T9K A;  2WZL A;  4YWQ A;  4KNV A;  2J7P D;  2XLE A;  2YVK A;  3M4C A;  3NYL A;  2J0W A;  3N2Z B;  2WZG A;  2YL7 A;  2R7Q A;  1TKN A;  1YAR O;  3QZC A;  4YT4 A;  5DS5 A;  3Q7L A;  4GQH A;  1J8Y F;  1YDI A;  4ZLC A;  1PD1 A;  1TWG A;  4CSA A;  4JTC B;  3B0P A;  3GEE A;  1QLE C;  3JYH A;  4UDV A;  3AGU A;  3O6X A;  1RMV A;  1BR2 A;  3ECS A;  2PNO A;  1D0Y A;  3DJU B;  3I5Q A;  3W2W A;  1ORJ A;  4DXW A;  1I5N A;  3X1O A;  2VCB A;  1QVX A;  2PX0 A;  2A1D D;  2RSE B;  3GEI A;  3AOU A;  3Q6M A;  1H9T A;  4LLE A;  2XL4 A;  4EBK A;  4IWB A;  3SXK A;  5A6B A;  1Q0D A;  3EGD A;  1WAS A;  2YEV A;  1A0B A;  2HV6 A;  4MVZ A;  3RW0 A;  1FR0 A;  5GPG B;  1OXK A;  2GA0 A;  3AQB A;  1O87 A;  1ZHY A;  4NC3 A;  4JW1 A;  4P9F A;  4FWV A;  1Z7Q c;  3O55 A;  4U5B E;  3AQC A;  1YAU O;  3ASN C;  3GM2 A;  4XLN F;  5A6A A;  3U9J A;  3TJ5 A;  1EI7 A;  2LFD A;  3R2P A;  1OKK D;  4OIO F;  2IOQ A;  2C04 A;  4BEM J;  2KQ9 A;  1KU2 A;  2QLA A;  3DE8 A;  1Z6A A;  5E2Q A;  3EH1 A;  3GOR A;  3ZIB A;  2G3V A;  3RFY A;  5D91 A;  3B0V C;  3EH2 A;  1T01 A;  3AG2 C;  1ZW2 A;  4K7B A;  1ST6 A;  2D5R B;  3DE9 A;  2IYL D;  4XWJ A;  5DS4 A;  1LE4 A;  3T6B A;  3DM9 B;  1N1C A;  1HY5 A;  3AGT A;  3GAN A;  1LS1 A;  2YLD A;  3I4U A;  4GYT A;  3RVZ A;  1TQG A;  3FOP A;  2IBF A;  1JPJ A;  1CGO A;  2ZXP A;  3GM1 A;  1MNE A;  4OIP F;  4KBL A;  1BR1 A;  3EFO A;  2H7V C;  4CBE A;  1APC A;  2ASR A;  2VCC A;  2Y3B A;  3JZ0 A;  3LNR A;  2KJG A;  2P0N A;  2YWA A;  5A6B D;  3TJ6 A;  3Q7G A;  4IGG A;  1IW7 F;  1D1C A;  2DYR C;  1D0X A;  3HTK C;  5L3V A;  3ZWI A;  4KI2 A;  2XXA B;  3KH2 A;  1HE1 A;  3JTL O;  3SXY A;  3ZTZ A;  3IQ5 A;  1G8X A;  1E84 A;  2XM0 A;  4JVS A;  3VF0 A;  4IB4 A;  3CAX A;  4Q5S F;  2J9V A;  5KYN A;  1Q0M A;  5KYU B;  3VAY A;  5B1A C;  4NQF A;  3DM5 A;  3K1I A;  4H54 A;  1PCX A;  2D4U A;  5L0D A;  1RJ9 B;  2XXA A;  2IXN A;  4QI2 A;  2NSG A;  2F22 A;  1G4U S;  2IXP A;  1SZI A;  1R4T A;  2GWW A;  4KNW A;  4O79 A;  3GM3 A;  4J32 B;  3S27 A;  1NBB A;  4JZA A;  4MVS A;  1K40 A;  1VLT A;  5AC5 A;  4CIH A;  2V3C C;  2OOC A;  3EG9 B;  4U5F E;  3E70 C;  1ZVZ A;  4WJ0 A;  5DLJ A;  4JC7 A;  4EKW A;  2HMZ A;  2CCY A;  2AWC A;  2NUP A;  4EBJ A;  1LI5 A;  5E3C A;  4E18 A;  2R7X A;  2Z15 A;  1EA8 A;  4JEA A;  2OEX A;  1S05 A;  1H9G A;  2YL0 A;  2P7V A;  1QPU A;  5KYX B;  4AX2 A;  1LVK A;  2OG2 A;  2FFH A;  1ZHZ A;  3LNM B;  1TR2 A;  4K0D A;  2KW3 C;  4E7S A;  2R7S A;  4L6R A;  2A6H F;  3HNJ A;  1OW6 A;  4Z9I A;  3IPM O;  1H7I A;  3FAJ A;  2YRF A;  1I4Z A;  4LER A;  2WL8 A;  2B0H A;  4MW8 A;  1JPN A;  5EGY A;  1R5I D;  1OQC A;  3W4Y A;  5B3I A;  4PFP A;  1Z3I X;  4YL1 A;  3UNG C;  5HSW A;  1VOM A;  1YVI A;  4HFK B;  4CDV A;  4BJ6 A;  2KNH A;  4BJ5 C;  3NMJ A;  4XTK A;  1FNT c;  1V74 B;  3F47 A;  3K7D A;  3N0T A;  3SXZ A;  2ZXO A;  3JRT A;  2XLV A;  1OXB A;  1MMA A;  1OW8 A;  2HSQ A;  2XLO A;  4AE4 B;  4DVY P;  4Q4Z F;  1AEP A;  1RKE A;  2AVK A;  3UGP A;  1OW7 A;  2EPL X;  4CSA C;  2WB7 A;  3C63 A;  3LAY A;  2R25 A;  3QMK A;  1YJG A;  4K1O A;  3RQG A;  4BEJ A;  3C7J A;  1ORY A;  3LJB A;  4FES A;  1TFO B;  4KC9 A;  3L34 A;  4CS8 C;  3QVZ A;  4JTD B;  2YKZ A;  1L3P A;  1YZC A;  2VC9 A;  4AE4 A;  4MW3 A;  1HW1 A;  4J7T A;  4O6M A;  4O6Y A;  5FCL A;  2H7B A;  1OKK A;  5B1B C;  4LDR A;  2KGO A;  3DJN B;  3MYI A;  2A6E F;  3NMK A;  1OR3 A;  1M2O A;  5E3A A;  3T6J A;  2J9U A;  4BJ1 A;  3EHN A;  3C8Z A;  2YLI A;  1CPQ A;  2J0X A;  4R32 A;  1BBH A;  4OIR F;  3WOD F;  1OCO C;  2OEV A;  2H7O A;  3CEX A;  2GDC A;  2VAS A;  2EIN C;  2R7O A;  3EGD B;  2XLM A;  4OIN F;  1PD0 A;  2W9Y A;  3IEE A;  256B A;  4PJL A;  4C3E A;  3IHU A;  3C8G D;  4MTG A;  1TWC A;  4CS9 A;  3ZDL A;  1AUE A;  4PFO A;  3SP1 A;  2VH3 A;  1LKX A;  2UUH A;  3DWW A;  4YL0 A;  3V5Z A;  1FMV A;  2W4B A;  5EHH A;  3B71 A;  4I44 A;  1K04 A;  3VYW A;  1VLS A;  2A69 F;  2OJQ A;  3EZH A;  4NY3 A;  2V26 A;  5B3S C;  4G7Z F;  5EK0 A;  1FFH A;  2A68 F;  4LAC B;  4ONS A;  1JRA A;  2FGY A;  2CNW A;  2NPU A;  2OU6 A;  2LP4 A;  4Z9H A;  5JSL A;  2ZD9 A;  3ABK C;  2J46 A;  3NKD A;  4MS2 A;  2HS5 A;  3G50 A;  5FZT A;  3V5Y A;  3LLK A;  3S28 A;  1V4A A;  3NYJ A;  5AC4 A;  3GEH A;  1ZHW A;  2EIJ C;  3K1H A;  4MND A;  1S7Z A;  1OCZ C;  2EPK X;  4XPX A;  5JUA A;  3MFN A;  5DQT A;  5TJ5 E;  4QDL A;  1V54 C;  2WVO A;  2VB6 A;  3LS0 A;  4XQ1 A;  4CJO A;  1E2X A;  1FTS A;  3AG1 C;  3EFO B;  5CI8 A;  2HJ3 A;  4AK9 A;  2GFH A;  2XRH A;  1HMD A;  2Y3G A;  4G0H A;  1AVO B;  3TOL A;  1RXQ A;  2Q4F A;  3DKA A;  3UMI A;  3FXH A;  4HFF B;  1NSG B;  4U9D A;  5T3W A;  5L0H A;  4ANJ A;  1GS9 A;  1WAT A;  1OCR C;  2G62 A;  2NG1 A;  2HFI A;  2RD9 A;  4PAC A;  5CI9 A;  3K1I C;  3M15 A;  2R7T A;  1EQ1 A;  5L0J A;  3K33 A;  4FAP B;  3S9O A;  3JCU Q;  4AL1 A;  2OQM A;  4PK4 A;  3OA1 A;  2YL3 A;  1EKY A;  4MTO A;  1QKR A;  2CNW D;  2M64 A;  3V7O A;  4Z9J A;  1D1A A;  1QQ3 A;  5T3T A;  3WG7 C;  1E83 A;  3NG1 A;  3L8I A;  1ZU4 A;  2I15 A;  3BEH A;  3PHF 2; 
#chains in the Genus database with same CATH homology
 5JLI A;  2XLW A;  2J9B A;  3HNK A;  5JP7 A;  4L6R A;  3HNJ A;  4D4X A;  3VRC A;  2XLE A;  1JAF A;  3M4C A;  5B3I A;  3U8P A;  4D4N A;  3QW1 A;  1YYX A;  2YL7 A;  4CDV A;  3NMJ A;  5JVE A;  2XLV A;  2XLO A;  4CJG A;  2J8W A;  4N4W A;  3C63 A;  3L1M A;  3QVZ A;  2YKZ A;  1YZC A;  4WGY A;  1GQA A;  4JE9 A;  4NC3 A;  3ZQV A;  3NMK A;  5JT4 A;  2YLI A;  3ZQY A;  1CPQ A;  1BBH A;  1RCP A;  2QLA A;  3DE8 A;  1QPU A;  2XLM A;  3HNI A;  3FOO A;  4IAQ A;  256B A;  4U9E A;  4CDA A;  3DE9 A;  1MQV A;  1CPR A;  1LM3 B;  2XL6 A;  4JEB A;  2YLD A;  1YYJ A;  3FOP A;  1CGO A;  5JSL A;  2XM4 A;  1APC A;  4N6H A;  5AGF A;  1CGN A;  4CX9 A;  4IAR A;  1A7V A;  4ER9 A;  2XLD A;  3HNL A;  3QVY A;  3ZWI A;  3C62 A;  2XLH A;  3ZTM A;  5JUA A;  3ZTZ A;  3IQ5 A;  2BC5 A;  2YL1 A;  1E84 A;  2XM0 A;  4IB4 A;  4CJO A;  4JKV A;  4WGZ A;  1E86 A;  1YZA A;  3TOL A;  3NMI A;  3M79 A;  4U9D A;  4ULV A;  5JS5 A;  1E85 A;  4CDY A;  3M4B A;  1NBB A;  1M6T A;  2XL8 A;  3M15 A;  4EIY A;  4CIP A;  2CCY A;  3TOM A;  3QW0 A;  2YL3 A;  1EKY A;  2YLG A;  5JRA A;  1QQ3 A;  4JEA A;  1E83 A;  1S05 A;  2YL0 A;  3IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...