1YYJA

The nmr solution structure of a redesigned apocytochrome b562:rd-apocyt b562
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
106
structure length
105
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANGKVKEAQAAAEQLKTTIRAYNQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords redesigned apocytochrome B562
publication title Specific non-native hydrophobic interactions in a hidden folding intermediate: implications for protein folding
pubmed doi rcsb
total genus 40
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2005-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yyjA00
5B3IA 3C62A 4IAQA 1JAFA 2YL0A 5JSLA 3DE8A 1BBHA 3QVZA 3NMIA 1QQ3A 4ULVA 4EIYA 4CDVA 5JLIA 1M6TA 3ZTMA 4IB4A 3FOOA 2YLGA 4WGYA 4CX9A 1LM3B 2YKZA 4N6HA 2XLHA 1CGOA 2BC5A 1YYJA 4CDAA 4JKVA 5JUAA 1APCA 4D4XA 2XLDA 2J9BA 2XL8A 5AGFA 3M79A 4IARA 3C63A 3M15A 4ER9A 1A7VA 1QPUA 2YL7A 3QW0A 3U8PA 2XLOA 3ZWIA 4CDYA 1CGNA 3QW1A 1NBBA 3IQ5A 5JP7A 2XLMA 2XL6A 4CIPA 1CPRA 1E84A 4NC3A 2XLWA 3TOLA 4WGZA 1EKYA 1MQVA 2YLIA 5JT4A 1YZCA 1RCPA 1YYXA 3M4CA 256BA 3QVYA 4JEBA 2XLEA 1S05A 3HNKA 2XM4A 4U9DA 3L1MA 3IQ6A 2J8WA 4L6RA 3ZQVA 5JS5A 2YLDA 2QLAA 3ZTZA 3DE9A 4JE9A 1E85A 1CPQA 3ZQYA 4JEAA 5JRAA 1E86A 3M4BA 2XM0A 3TOMA 1YZAA 4N4WA 1GQAA 4CJGA 3HNJA 2YL3A 3NMKA 5JVEA 3NMJA 2XLVA 4U9EA 2YL1A 3HNIA 3HNLA 4D4NA 2CCYA 1E83A 3VRCA 4CJOA 3FOPA
chains in the Genus database with same CATH superfamily
5B3IA 2R7OA 4KNVA 4JVSA 2YVKA 2ASRA 2ZD9A 2A6EF 5E3AA 4DRIB 1QKRA 3J06A 2L81A 1KU2A 1N1CA 1D1AA 3O39A 3U2LA 4AL1A 1DOWA 1QQ3A 1ZVZA 2WVOA 1O5HA 2LP4A 3LAYA 4ULVA 4YL0A 5JLIA 4C7OB 4G7OF 2YEVA 4JTDB 4U5FE 1G4WR 3C8GA 4IB4A 4E18A 3VAYA 2AU5A 3B71A 3NG1A 1NFOA 1YA7O 2WB7A 5L0HA 3HLZA 1O87A 4JJFA 4G78A 4M63A 3LNRA 1MMDA 1IZMA 1T6IA 2XRHA 1HE9A 1TKNA 3Q7LA 4ZLCA 2Y3BA 3TULA 1LKXA 1R4TA 4Z9IA 3SXYA 1M56C 1BR2A 3DJUB 5K0IA 3LNMB 4HE8D 4YT4A 1ORJA 4X0RA 2OJQA 2KC3A 4BEJA 3IPMO 3TK0A 3F47A 3MX3A 3C8ZA 1K05A 1WOLA 2EINC 3S27A 3W8HA 1TWCA 4Q5SF 1YA9A 3W8IA 3OWTA 4OD4A 2BE5F 4K0DA 2IM8A 3ZDLA 4GEHA 1H9TA 5DQZA 2EIKC 1LE2A 3EGDB 5L0CA 3PDMP 5HSWA 2L6GA 4NTFA 1PD0A 3GANA 4YN0B 3JRMO 3B0UX 1JMWA 4NQFA 1ZZPA 2Z15A 2A0UA 1CGNA 3W4YA 3K6BA 3JSZA 3MYIA 2XL6A 1U89A 1ZU4A 2ZXRA 3WG7C 4E0HA 3AG4C 4DRJB 3K1IC 1CPRA 2O9XA 4LDQA 3S0XA 1M2VA 4PJMA 3EG9B 2B0HA 2G3KA 1EI7A 1XZPA 2OG2A 1OXBA 4KC9A 2Q00A 1JPNA 2J9VA 3KPHA 3LEOA 3TD7A 2G62A 4NCQA 4I1OB 2P0NA 4JURI 4U5HA 3K1IA 4XWJA 3US6A 3V5XA 2IXOA 3NYLA 2G3VA 1OR3A 1MNEA 1KTMA 3GWNA 3C8GB 3SYNA 1WGWA 4C3DA 4H4KC 4XPXA 5F5FA 3G50A 3DD7A 2XM4A 2Y3GA 3B0PA 4PJNA 3DAGA 4GYTA 2HKVA 1M2OA 3N2ZB 2J8WA 4DVZA 4BJTA 3KH2A 3ZQVA 4MS2A 5JS5A 3LLIA 3U9JA 2YLDA 3GODA 4IGGA 3DE9A 4KI2A 4MVZA 4G0HA 3ZQYA 1OW6A 3FAPB 3NYJA 3WHNA 2I8BA 3RVYA 3TJ6A 1AEPA 2XM0A 2OU6A 1YZAA 1G8XA 1SF8A 4N4WA 1GQAA 4Q7CA 3TOMA 2C04A 3SXZA 3GEIA 4CJGA 2I15A 3HNJA 4IWBA 1LI5A 2RSEB 3WAQA 2Y3DA 2PFDA 3OA1A 2CNWD 3ITFA 1C03A 3VYWA 1VYIA 3HNLA 5FZTA 2PX0A 4P9TA 2CCYA 3EQLF 2EILC 2A1DD 2HJ3A 3AOUA 1E83A 1TFKB 2R7WA 5B1AC 3B29A 3K1HA 3F46A 3CAXA 2HSBA 3C62A 1QVXA 4MTGA 5KYWA 5L0JA 5JSLA 3QVZA 3C8GD 1OCCC 2QNLA 4IRUA 4AX2A 2LIGA 1CGME 4CDVA 5BUOA 1D0YA 3EGDA 5HV9A 3ABKC 1NLXA 5L0DA 2HZ8A 4PR9A 1YJGA 2A69F 1LM3B 2WZLA 4U5DE 5T3WA 1FMVA 2P7VA 3WODF 2Q3TA 3DKAA 4PFOA 4MVQA 2MHRA 4LLEA 3EGXA 4RDAA 4XTKA 3U2MA 4A2NB 1LI7A 1I4YA 4KNWA 3AJMA 3DMDA 3EZHA 4I1MA 1TWAA 1FNTc 2ICWG 2KQ9A 2HUJA 1ZHZA 2DB4A 3AG1C 4ULWA 2WL8A 3AGTA 5BQGA 3EG9A 5F5HA 1AVOB 1TWHA 5JUAA 3V7OA 3RIPA 4MVRA 2YQYA 5A69A 5EGYA 5EHHA 2XLDA 2J9BA 3LS1A 5AGFA 4F4BA 3M79A 5KYYA 2Q9CA 1JPJA 3M1CB 4IARA 4U5BE 3UMKA 2J0WA 4CS9C 1A7VA 2F22A 1A7DA 4EBKA 2KNHA 2TMVP 2JD3A 2ZXPA 4BJ1A 4FWVA 4YL1A 4EBBA 1Q0FA 4I3MA 3S90A 3QTHA 2YL7A 1RKCA 2ZXOA 2NG1A 2OKUA 1Q0DA 3BRJA 3QW0A 4JCHA 3W2WA 3SXMA 5L0IA 1QLEC 3RFYA 2OEXA 4U5EE 3ZWIA 3FHDA 4LLCA 3CSKA 1Z5ZA 1DOVA 5GPGB 4CS9A 2LK4A 2VH3A 1OXKA 3CZ6A 2XLMA 2D5RB 3AG2C 1YARO 5E33A 2OQMA 4C3BA 2YHSA 5L0GA 3EFOA 1T5OA 4YT2A 4NC3A 2R7RA 4IJJA 5A6JA 1OKKA 1I4ZA 1QSPA 2AVKA 2DGJA 2IOQA 3K66A 3TOLA 3U9MA 4MTFA 4O7GA 4NTBA 1UG7A 4MW8A 4YL3A 2X0CA 4FESA 5KYWB 3ASOC 3L0IA 1NG1A 5AC5A 4XPYA 1MQVA 3L8JA 2YLIA 5JT4A 2GA0A 4FX5A 5KYUA 2PX3A 1M57C 4I44A 2IXPA 2NSGA 4MNDA 3T6JA 3RQGA 2DYSC 2ZPAA 1K04A 2J46A 2VASA 1EQ1A 3NDBB 1WTYA 1PV3A 3IQ6A 3RQEA 2V26A 3W2VA 4ANJA 3DI5A 2OJED 3EGXB 2A0BA 1ZYRF 4EHPA 2PNOA 3AG3C 3JCUQ 3LUTB 3JZ0A 4JIOA 1GGQA 1VOMA 4O6NA 2HSQA 2IXMA 3G4ZA 4XPWA 1E85A 2OEVA 4E7SA 1D1CA 2J7PA 4JEAA 3ZG1A 3ZVRA 1E86A 2R7UA 1S7ZA 1HW1A 3X2QC 2XSEA 1WWPA 1XZQA 1QZXA 3T6GB 3I5PA 4K7BA 3KMIA 1PCXA 3U3BA 1K40A 3PMRA 2Q7RA 2Y69C 4KBLA 3H2VA 3R7CA 2WVNA 5T1DB 5KYYB 5JVEA 1V4AA 3L34A 3NMJA 2L6FA 4XLNF 2XLVA 4MVUA 3A9CA 1BZ4A 1L3PA 3O55A 4U9EA 1SYQA 3RH3A 3HNIA 4BG0A 3JRTA 3SXKA 3T4RA 3GWLA 2R7TA 3UMIA 2AWYA 2KW3C 3EZIA 4JJGA 3VRCA 3IEEA 1RMVA 2FFHA 5E2QA 5L0FA 1MMAA 1JR8A 4MTOA 3T6BA 4DJ9A 1U0BB 3LESA 3GORA 1R5ID 4AK9A 4IAQA 4E7ZA 3MBGA 1A0BA 1LS4A 2LSEA 2YL0A 4CS8C 2KYHA 4MQ9F 4O6MA 4CBEA 4OIPF 1OW8A 3NMIA 2NUPA 2HMQA 4EIYA 3EFOB 3S84A 1ZHXA 2R05A 3MYFA 4XLPF 1ZW2A 4JZAA 2CW0F 4WGYA 1HW2A 2UUHA 3IQCA 2RD9A 3G4XA 3LJBA 4XEVA 3NRHA 4CS8A 4EWCA 4H54A 1YAUO 1HMDA 5KYUB 4XQ1A 2MYSA 1RKEB 3O6XA 4N6HA 5A6BD 2NUTA 4B6IA 4YT8A 3GM2A 1CGOA 2L9JA 4N6CA 3K33A 2P1AA 1HE1A 3DZAA 1PD1A 1Z3IX 2IXNA 4JKVA 2ZXWC 3HJCA 4C3EA 2KJGA 3LLKA 2WZFA 1MMNA 1APCA 2A6HF 3AQCA 3GEEA 1LVKA 1Y4CA 3VF0A 4AL0A 1J8MF 2J9WA 3ASNC 1NSGB 2PF4E 2HJMA 1WATA 2R02A 4D4XA 2XL8A 3IHUA 1ZW3A 3EHMA 2R9RB 3Q6NA 3QZCA 3JSEO 5DVWA 1NFNA 1T9KA 3C63A 1VB5A 4ER9A 5CI9A 1OCZC 1QPUA 4LDKA 3N24A 3SEOA 3FVYA 2LFDA 1T6QA 1TR2A 1H6GA 4G7ZF 3X1OA 2Y39A 1UFBA 3SNHA 4UDVA 3JT1A 4DXWA 5B1BC 4G7HF 3ATPA 1ZHYA 4CDYA 2GAQA 2L6HA 4XEFA 3ZSUA 2R7VA 1J8YF 4AE4A 4O6YA 5JP7A 1H9GA 3RQFA 5COFA 1OKKD 4CIPA 5TJ5E 1JRAA 2W45A 2AP3A 3POVA 3VM6A 1SMYF 1Q0KA 1A41A 2A68F 2GWWA 3NKDA 1E84A 2VB6A 2XLWA 2H7OA 2NPUA 2WVQA 4MVSA 3RYLA 4BEMJ 2GFHA 1BR4A 3RVZA 3TQOA 1YDIA 5BQIA 3C7JA 4R32A 1YZCA 4E17A 2NUPB 1ORYA 1VYKA 2VCCA 4BPMA 1Z63A 2VCAA 1HMOA 2QTVA 3L8IA 4JTAB 4BJ6C 3M4CA 1ORSC 1G4US 2J45A 3QVYA 1KNYA 4NTAA 4JEBA 2JX0A 1S05A 1FR0A 3HNKA 1Z6AA 2H8AA 3EH2A 4DVYP 4MVMA 4WABA 3L1MA 2J9UA 1FAPB 2XXAB 4CIHA 2NUTB 5DQTA 4QI2A 3IQTA 2MWQA 3GM3A 1I5NA 2J7PD 3KL4A 4QDLA 4BJ6A 1LIHA 3ZC4A 2QLAA 2EPMX 3EH1A 4JE9A 2HS5A 1T01A 5DS4A 1TFOB 2IYLD 1D0XA 3M4BA 5T3TA 2X51A 2QUPA 2B0JA 3AQBA 4NY3A 3RF3A 3S28A 1SZIA 3R2PA 3MLGA 3FDQA 1XWJA 1MMGA 1LPEA 3A11A 1MNDA 3FXHA 1IW7F 3JYHA 5DS5A 3RKOF 1OR2A 1JOGA 5EK0A 1RKEA 2P6VA 3ABLC 4Q4ZF 3UR3C 2W4MA 4PFPA 2Q9BA 3GM1A 4Z9HA 3TJ5A 1D0ZA 1SR2A 3DM9B 5IY5C 4P6IC 4OIQF 3LS0A 5CI8A 4ZLDA 2UUIA 1Z23A 1ZHTA 2EIJC 3FOPA 1A7EA 1FFTC 3U5SA 5D91A 4IAOA 2LCHA 4FAPB 1TQGA 3GEHA 3HTKC 4QI0A 4AE4B 2DYRC 3E70C 4W8PA 5A6KA 1JAFA 4OINF 4PK4A 3DE8A 1BBHA 3AGUA 1NU9C 1YVIA 4YJWA 5KYNA 1VTMP 4MVOA 1H7IA 4N06A 1OCOC 3B9QA 3DAFA 1OQCA 4RBNA 1BDJB 1G5ZA 1C17M 1M6TA 4LERA 4ONSA 4W8KA 3MFNA 3FOOA 2YLGA 3ZTMA 4CX9A 2Y3HA 5KYXA 4CSAC 1Y6DA 3KYJA 4OD5A 5D92A 5DLJA 2C03A 1U6HA 2YKZA 4A4AA 5B3SC 1W2WA 1V55C 1ST6A 2XLHA 4PACA 2IBFA 3QMKA 4CSAA 3S29A 2QY9A 2BC5A 1YYJA 3FMSA 3H2UA 2Q9AA 4CDAA 5CIVA 4HEAJ 4J30B 4JW1A 1VLTA 3OEOA 1GS9A 4HFKB 1V74B 4Z9JA 3SZRA 3KYIA 4J32B 3KKBA 2M4EA 1YLMA 1FMWA 3EJNA 2LD6A 2CDQA 3C18A 3UGOA 2EPKX 2EPOA 2OCCC 4PJJA 1WASA 3ZIBA 1AUEA 3N0TA 1GM5A 1Q0GA 1LE4A 2FAPB 3M15A 3DJNB 3Q6MA 2R25A 3BEHA 4MW3A 3U3FA 2NSFA 1RJ9A 2HMZA 1ZU5A 2BL2A 3DM5A 3PCVA 1L7CA 1C02A 3NKEA 1EA8A 3PHF2 2PBEA 3ABMC 4EUKB 4DBQA 3CEXA 3Q7GA 2XLOA 4U5GA 3ECSA 3U8PA 5A6AA 2XXAA 4P9FA 1TWGA 5E3CA 2CGEA 3QW1A 1E2XA 1RXQA 1NBBA 2R03A 3IQ5A 3V5ZA 3RW0A 3UGPA 2QE9A 2W9YA 1WN0A 2P61A 2CYDA 2HFIA 2OOCA 2EPLX 4HFFB 4O79A 4C7OA 3EHNA 3JYYA 2LFFA 4BJ5C 4K1OA 2JPUA 4YWQA 2H7BA 2R7QA 3DWWA 4JCZA 1V54C 1NZEA 2XS1A 2XS8A 4JRZA 4WGZA 4WJ0A 1EKYA 4DOZA 5FCLA 3V5YA 2E87A 2R7XA 2Q4FA 2HV7A 1B68A 3JTLO 2AWCA 4GQHA 2PP4A 5F28E 1RCPA 3LEVA 4E0IA 4LACB 1FTSA 1YYXA 4BJ5A 3DXJF 2J0XA 2D4UA 3CQZA 256BA 3H65A 4YT5A 5KYXB 3U8VA 2HV6A 4CS7A 2XLEA 3B0VC 5COMA 2R7SA 4J7TA 2YWAA 1HY5A 4U9DA 3EPVA 1OW7A 1T6UA 1VLSA 3O10A 4U5CE 1VMAA 1NU7D 1Q0MA 2GDCA 2KGOA 2YZSA 4L6RA 4DRHB 5BQHA 5L3QA 2KK1A 2FGYA 2L7AA 4XEKA 4OIRF 3E9VA 2WZGA 2W4BA 3ZTZA 2ETSA 1CPQA 4YK5A 5COGA 2VC9A 2YRFA 4J7YA 1O3UA 1M2VB 3UMHA 5JRAA 1ZHWA 4LDRA 2EIMC 3SP1A 3U0CA 1D1BA 1FFHA 2EPNA 2M64A 2XL4A 3I5QA 2YL3A 4JTCB 3NMKA 3NYMA 4EBJA 3FAJA 4PJLA 4EKWA 4DBRA 1F1MA 1BR1A 3HKKA 5AC4A 4JC7A 3UNGC 2H7VC 2VCBA 1OCRC 1VK5A 2YL1A 3K7DA 2V3CC 1RJ9B 4D4NA 4OIOF 2DI3A 2CNWA 1Z7Qc 5L3VA 3S9OA 2KSFA 3T9OA 4CJOA 1LS1A 5DS6A 5A6BA 2LQGA 3I4UA 4RD9A
chains in the Genus database with same CATH topology
5B3IA 3C62A 4IAQA 1JAFA 2YL0A 5JSLA 3DE8A 1BBHA 3QVZA 3NMIA 1QQ3A 4ULVA 4EIYA 4CDVA 5JLIA 1M6TA 3ZTMA 4IB4A 3FOOA 2YLGA 4WGYA 4CX9A 1LM3B 2YKZA 4N6HA 2XLHA 1CGOA 2BC5A 1YYJA 4CDAA 4JKVA 5JUAA 1APCA 4D4XA 2XLDA 2J9BA 2XL8A 5AGFA 3M79A 4IARA 3C63A 3M15A 4ER9A 1A7VA 1QPUA 2YL7A 3QW0A 3U8PA 2XLOA 3ZWIA 4CDYA 1CGNA 3QW1A 1NBBA 3IQ5A 5JP7A 2XLMA 2XL6A 4CIPA 1CPRA 1E84A 4NC3A 2XLWA 3TOLA 4WGZA 1EKYA 1MQVA 2YLIA 5JT4A 1YZCA 1RCPA 1YYXA 3M4CA 256BA 3QVYA 4JEBA 2XLEA 1S05A 3HNKA 2XM4A 4U9DA 3L1MA 3IQ6A 2J8WA 4L6RA 3ZQVA 5JS5A 2YLDA 2QLAA 3ZTZA 3DE9A 4JE9A 1E85A 1CPQA 3ZQYA 4JEAA 5JRAA 1E86A 3M4BA 2XM0A 3TOMA 1YZAA 4N4WA 1GQAA 4CJGA 3HNJA 2YL3A 3NMKA 5JVEA 3NMJA 2XLVA 4U9EA 2YL1A 3HNIA 3HNLA 4D4NA 2CCYA 1E83A 3VRCA 4CJOA 3FOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  3C62 A;  4IAQ A;  1JAF A;  2YL0 A;  5JSL A;  3DE8 A;  1BBH A;  3QVZ A;  3NMI A;  1QQ3 A;  4ULV A;  4EIY A;  4CDV A;  5JLI A;  1M6T A;  3ZTM A;  4IB4 A;  3FOO A;  2YLG A;  4WGY A;  4CX9 A;  1LM3 B;  2YKZ A;  4N6H A;  2XLH A;  1CGO A;  2BC5 A;  1YYJ A;  4CDA A;  4JKV A;  5JUA A;  1APC A;  4D4X A;  2XLD A;  2J9B A;  2XL8 A;  5AGF A;  3M79 A;  4IAR A;  3C63 A;  3M15 A;  4ER9 A;  1A7V A;  1QPU A;  2YL7 A;  3QW0 A;  3U8P A;  2XLO A;  3ZWI A;  4CDY A;  1CGN A;  3QW1 A;  1NBB A;  3IQ5 A;  5JP7 A;  2XLM A;  2XL6 A;  4CIP A;  1CPR A;  1E84 A;  4NC3 A;  2XLW A;  3TOL A;  4WGZ A;  1EKY A;  1MQV A;  2YLI A;  5JT4 A;  1YZC A;  1RCP A;  1YYX A;  3M4C A;  256B A;  3QVY A;  4JEB A;  2XLE A;  1S05 A;  3HNK A;  2XM4 A;  4U9D A;  3L1M A;  3IQ6 A;  2J8W A;  4L6R A;  3ZQV A;  5JS5 A;  2YLD A;  2QLA A;  3ZTZ A;  3DE9 A;  4JE9 A;  1E85 A;  1CPQ A;  3ZQY A;  4JEA A;  5JRA A;  1E86 A;  3M4B A;  2XM0 A;  3TOM A;  1YZA A;  4N4W A;  1GQA A;  4CJG A;  3HNJ A;  2YL3 A;  3NMK A;  5JVE A;  3NMJ A;  2XLV A;  4U9E A;  2YL1 A;  3HNI A;  3HNL A;  4D4N A;  2CCY A;  1E83 A;  3VRC A;  4CJO A;  3FOP A; 
#chains in the Genus database with same CATH topology
 5B3I A;  2R7O A;  4KNV A;  4JVS A;  2YVK A;  2ASR A;  2ZD9 A;  2A6E F;  5E3A A;  4DRI B;  1QKR A;  3J06 A;  2L81 A;  1KU2 A;  1N1C A;  1D1A A;  3O39 A;  3U2L A;  4AL1 A;  1DOW A;  1QQ3 A;  1ZVZ A;  2WVO A;  1O5H A;  2LP4 A;  3LAY A;  4ULV A;  4YL0 A;  5JLI A;  4C7O B;  4G7O F;  2YEV A;  4JTD B;  4U5F E;  1G4W R;  3C8G A;  4IB4 A;  4E18 A;  3VAY A;  2AU5 A;  3B71 A;  3NG1 A;  1NFO A;  1YA7 O;  2WB7 A;  5L0H A;  3HLZ A;  1O87 A;  4JJF A;  4G78 A;  4M63 A;  3LNR A;  1MMD A;  1IZM A;  1T6I A;  2XRH A;  1HE9 A;  1TKN A;  3Q7L A;  4ZLC A;  2Y3B A;  3TUL A;  1LKX A;  1R4T A;  4Z9I A;  3SXY A;  1M56 C;  1BR2 A;  3DJU B;  5K0I A;  3LNM B;  4HE8 D;  4YT4 A;  1ORJ A;  4X0R A;  2OJQ A;  2KC3 A;  4BEJ A;  3IPM O;  3TK0 A;  3F47 A;  3MX3 A;  3C8Z A;  1K05 A;  1WOL A;  2EIN C;  3S27 A;  3W8H A;  1TWC A;  4Q5S F;  1YA9 A;  3W8I A;  3OWT A;  4OD4 A;  2BE5 F;  4K0D A;  2IM8 A;  3ZDL A;  4GEH A;  1H9T A;  5DQZ A;  2EIK C;  1LE2 A;  3EGD B;  5L0C A;  3PDM P;  5HSW A;  2L6G A;  4NTF A;  1PD0 A;  3GAN A;  4YN0 B;  3JRM O;  3B0U X;  1JMW A;  4NQF A;  1ZZP A;  2Z15 A;  2A0U A;  1CGN A;  3W4Y A;  3K6B A;  3JSZ A;  3MYI A;  2XL6 A;  1U89 A;  1ZU4 A;  2ZXR A;  3WG7 C;  4E0H A;  3AG4 C;  4DRJ B;  3K1I C;  1CPR A;  2O9X A;  4LDQ A;  3S0X A;  1M2V A;  4PJM A;  3EG9 B;  2B0H A;  2G3K A;  1EI7 A;  1XZP A;  2OG2 A;  1OXB A;  4KC9 A;  2Q00 A;  1JPN A;  2J9V A;  3KPH A;  3LEO A;  3TD7 A;  2G62 A;  4NCQ A;  4I1O B;  2P0N A;  4JUR I;  4U5H A;  3K1I A;  4XWJ A;  3US6 A;  3V5X A;  2IXO A;  3NYL A;  2G3V A;  1OR3 A;  1MNE A;  1KTM A;  3GWN A;  3C8G B;  3SYN A;  1WGW A;  4C3D A;  4H4K C;  4XPX A;  5F5F A;  3G50 A;  3DD7 A;  2XM4 A;  2Y3G A;  3B0P A;  4PJN A;  3DAG A;  4GYT A;  2HKV A;  1M2O A;  3N2Z B;  2J8W A;  4DVZ A;  4BJT A;  3KH2 A;  3ZQV A;  4MS2 A;  5JS5 A;  3LLI A;  3U9J A;  2YLD A;  3GOD A;  4IGG A;  3DE9 A;  4KI2 A;  4MVZ A;  4G0H A;  3ZQY A;  1OW6 A;  3FAP B;  3NYJ A;  3WHN A;  2I8B A;  3RVY A;  3TJ6 A;  1AEP A;  2XM0 A;  2OU6 A;  1YZA A;  1G8X A;  1SF8 A;  4N4W A;  1GQA A;  4Q7C A;  3TOM A;  2C04 A;  3SXZ A;  3GEI A;  4CJG A;  2I15 A;  3HNJ A;  4IWB A;  1LI5 A;  2RSE B;  3WAQ A;  2Y3D A;  2PFD A;  3OA1 A;  2CNW D;  3ITF A;  1C03 A;  3VYW A;  1VYI A;  3HNL A;  5FZT A;  2PX0 A;  4P9T A;  2CCY A;  3EQL F;  2EIL C;  2A1D D;  2HJ3 A;  3AOU A;  1E83 A;  1TFK B;  2R7W A;  5B1A C;  3B29 A;  3K1H A;  3F46 A;  3CAX A;  2HSB A;  3C62 A;  1QVX A;  4MTG A;  5KYW A;  5L0J A;  5JSL A;  3QVZ A;  3C8G D;  1OCC C;  2QNL A;  4IRU A;  4AX2 A;  2LIG A;  1CGM E;  4CDV A;  5BUO A;  1D0Y A;  3EGD A;  5HV9 A;  3ABK C;  1NLX A;  5L0D A;  2HZ8 A;  4PR9 A;  1YJG A;  2A69 F;  1LM3 B;  2WZL A;  4U5D E;  5T3W A;  1FMV A;  2P7V A;  3WOD F;  2Q3T A;  3DKA A;  4PFO A;  4MVQ A;  2MHR A;  4LLE A;  3EGX A;  4RDA A;  4XTK A;  3U2M A;  4A2N B;  1LI7 A;  1I4Y A;  4KNW A;  3AJM A;  3DMD A;  3EZH A;  4I1M A;  1TWA A;  1FNT c;  2ICW G;  2KQ9 A;  2HUJ A;  1ZHZ A;  2DB4 A;  3AG1 C;  4ULW A;  2WL8 A;  3AGT A;  5BQG A;  3EG9 A;  5F5H A;  1AVO B;  1TWH A;  5JUA A;  3V7O A;  3RIP A;  4MVR A;  2YQY A;  5A69 A;  5EGY A;  5EHH A;  2XLD A;  2J9B A;  3LS1 A;  5AGF A;  4F4B A;  3M79 A;  5KYY A;  2Q9C A;  1JPJ A;  3M1C B;  4IAR A;  4U5B E;  3UMK A;  2J0W A;  4CS9 C;  1A7V A;  2F22 A;  1A7D A;  4EBK A;  2KNH A;  2TMV P;  2JD3 A;  2ZXP A;  4BJ1 A;  4FWV A;  4YL1 A;  4EBB A;  1Q0F A;  4I3M A;  3S90 A;  3QTH A;  2YL7 A;  1RKC A;  2ZXO A;  2NG1 A;  2OKU A;  1Q0D A;  3BRJ A;  3QW0 A;  4JCH A;  3W2W A;  3SXM A;  5L0I A;  1QLE C;  3RFY A;  2OEX A;  4U5E E;  3ZWI A;  3FHD A;  4LLC A;  3CSK A;  1Z5Z A;  1DOV A;  5GPG B;  4CS9 A;  2LK4 A;  2VH3 A;  1OXK A;  3CZ6 A;  2XLM A;  2D5R B;  3AG2 C;  1YAR O;  5E33 A;  2OQM A;  4C3B A;  2YHS A;  5L0G A;  3EFO A;  1T5O A;  4YT2 A;  4NC3 A;  2R7R A;  4IJJ A;  5A6J A;  1OKK A;  1I4Z A;  1QSP A;  2AVK A;  2DGJ A;  2IOQ A;  3K66 A;  3TOL A;  3U9M A;  4MTF A;  4O7G A;  4NTB A;  1UG7 A;  4MW8 A;  4YL3 A;  2X0C A;  4FES A;  5KYW B;  3ASO C;  3L0I A;  1NG1 A;  5AC5 A;  4XPY A;  1MQV A;  3L8J A;  2YLI A;  5JT4 A;  2GA0 A;  4FX5 A;  5KYU A;  2PX3 A;  1M57 C;  4I44 A;  2IXP A;  2NSG A;  4MND A;  3T6J A;  3RQG A;  2DYS C;  2ZPA A;  1K04 A;  2J46 A;  2VAS A;  1EQ1 A;  3NDB B;  1WTY A;  1PV3 A;  3IQ6 A;  3RQE A;  2V26 A;  3W2V A;  4ANJ A;  3DI5 A;  2OJE D;  3EGX B;  2A0B A;  1ZYR F;  4EHP A;  2PNO A;  3AG3 C;  3JCU Q;  3LUT B;  3JZ0 A;  4JIO A;  1GGQ A;  1VOM A;  4O6N A;  2HSQ A;  2IXM A;  3G4Z A;  4XPW A;  1E85 A;  2OEV A;  4E7S A;  1D1C A;  2J7P A;  4JEA A;  3ZG1 A;  3ZVR A;  1E86 A;  2R7U A;  1S7Z A;  1HW1 A;  3X2Q C;  2XSE A;  1WWP A;  1XZQ A;  1QZX A;  3T6G B;  3I5P A;  4K7B A;  3KMI A;  1PCX A;  3U3B A;  1K40 A;  3PMR A;  2Q7R A;  2Y69 C;  4KBL A;  3H2V A;  3R7C A;  2WVN A;  5T1D B;  5KYY B;  5JVE A;  1V4A A;  3L34 A;  3NMJ A;  2L6F A;  4XLN F;  2XLV A;  4MVU A;  3A9C A;  1BZ4 A;  1L3P A;  3O55 A;  4U9E A;  1SYQ A;  3RH3 A;  3HNI A;  4BG0 A;  3JRT A;  3SXK A;  3T4R A;  3GWL A;  2R7T A;  3UMI A;  2AWY A;  2KW3 C;  3EZI A;  4JJG A;  3VRC A;  3IEE A;  1RMV A;  2FFH A;  5E2Q A;  5L0F A;  1MMA A;  1JR8 A;  4MTO A;  3T6B A;  4DJ9 A;  1U0B B;  3LES A;  3GOR A;  1R5I D;  4AK9 A;  4IAQ A;  4E7Z A;  3MBG A;  1A0B A;  1LS4 A;  2LSE A;  2YL0 A;  4CS8 C;  2KYH A;  4MQ9 F;  4O6M A;  4CBE A;  4OIP F;  1OW8 A;  3NMI A;  2NUP A;  2HMQ A;  4EIY A;  3EFO B;  3S84 A;  1ZHX A;  2R05 A;  3MYF A;  4XLP F;  1ZW2 A;  4JZA A;  2CW0 F;  4WGY A;  1HW2 A;  2UUH A;  3IQC A;  2RD9 A;  3G4X A;  3LJB A;  4XEV A;  3NRH A;  4CS8 A;  4EWC A;  4H54 A;  1YAU O;  1HMD A;  5KYU B;  4XQ1 A;  2MYS A;  1RKE B;  3O6X A;  4N6H A;  5A6B D;  2NUT A;  4B6I A;  4YT8 A;  3GM2 A;  1CGO A;  2L9J A;  4N6C A;  3K33 A;  2P1A A;  1HE1 A;  3DZA A;  1PD1 A;  1Z3I X;  2IXN A;  4JKV A;  2ZXW C;  3HJC A;  4C3E A;  2KJG A;  3LLK A;  2WZF A;  1MMN A;  1APC A;  2A6H F;  3AQC A;  3GEE A;  1LVK A;  1Y4C A;  3VF0 A;  4AL0 A;  1J8M F;  2J9W A;  3ASN C;  1NSG B;  2PF4 E;  2HJM A;  1WAT A;  2R02 A;  4D4X A;  2XL8 A;  3IHU A;  1ZW3 A;  3EHM A;  2R9R B;  3Q6N A;  3QZC A;  3JSE O;  5DVW A;  1NFN A;  1T9K A;  3C63 A;  1VB5 A;  4ER9 A;  5CI9 A;  1OCZ C;  1QPU A;  4LDK A;  3N24 A;  3SEO A;  3FVY A;  2LFD A;  1T6Q A;  1TR2 A;  1H6G A;  4G7Z F;  3X1O A;  2Y39 A;  1UFB A;  3SNH A;  4UDV A;  3JT1 A;  4DXW A;  5B1B C;  4G7H F;  3ATP A;  1ZHY A;  4CDY A;  2GAQ A;  2L6H A;  4XEF A;  3ZSU A;  2R7V A;  1J8Y F;  4AE4 A;  4O6Y A;  5JP7 A;  1H9G A;  3RQF A;  5COF A;  1OKK D;  4CIP A;  5TJ5 E;  1JRA A;  2W45 A;  2AP3 A;  3POV A;  3VM6 A;  1SMY F;  1Q0K A;  1A41 A;  2A68 F;  2GWW A;  3NKD A;  1E84 A;  2VB6 A;  2XLW A;  2H7O A;  2NPU A;  2WVQ A;  4MVS A;  3RYL A;  4BEM J;  2GFH A;  1BR4 A;  3RVZ A;  3TQO A;  1YDI A;  5BQI A;  3C7J A;  4R32 A;  1YZC A;  4E17 A;  2NUP B;  1ORY A;  1VYK A;  2VCC A;  4BPM A;  1Z63 A;  2VCA A;  1HMO A;  2QTV A;  3L8I A;  4JTA B;  4BJ6 C;  3M4C A;  1ORS C;  1G4U S;  2J45 A;  3QVY A;  1KNY A;  4NTA A;  4JEB A;  2JX0 A;  1S05 A;  1FR0 A;  3HNK A;  1Z6A A;  2H8A A;  3EH2 A;  4DVY P;  4MVM A;  4WAB A;  3L1M A;  2J9U A;  1FAP B;  2XXA B;  4CIH A;  2NUT B;  5DQT A;  4QI2 A;  3IQT A;  2MWQ A;  3GM3 A;  1I5N A;  2J7P D;  3KL4 A;  4QDL A;  4BJ6 A;  1LIH A;  3ZC4 A;  2QLA A;  2EPM X;  3EH1 A;  4JE9 A;  2HS5 A;  1T01 A;  5DS4 A;  1TFO B;  2IYL D;  1D0X A;  3M4B A;  5T3T A;  2X51 A;  2QUP A;  2B0J A;  3AQB A;  4NY3 A;  3RF3 A;  3S28 A;  1SZI A;  3R2P A;  3MLG A;  3FDQ A;  1XWJ A;  1MMG A;  1LPE A;  3A11 A;  1MND A;  3FXH A;  1IW7 F;  3JYH A;  5DS5 A;  3RKO F;  1OR2 A;  1JOG A;  5EK0 A;  1RKE A;  2P6V A;  3ABL C;  4Q4Z F;  3UR3 C;  2W4M A;  4PFP A;  2Q9B A;  3GM1 A;  4Z9H A;  3TJ5 A;  1D0Z A;  1SR2 A;  3DM9 B;  5IY5 C;  4P6I C;  4OIQ F;  3LS0 A;  5CI8 A;  4ZLD A;  2UUI A;  1Z23 A;  1ZHT A;  2EIJ C;  3FOP A;  1A7E A;  1FFT C;  3U5S A;  5D91 A;  4IAO A;  2LCH A;  4FAP B;  1TQG A;  3GEH A;  3HTK C;  4QI0 A;  4AE4 B;  2DYR C;  3E70 C;  4W8P A;  5A6K A;  1JAF A;  4OIN F;  4PK4 A;  3DE8 A;  1BBH A;  3AGU A;  1NU9 C;  1YVI A;  4YJW A;  5KYN A;  1VTM P;  4MVO A;  1H7I A;  4N06 A;  1OCO C;  3B9Q A;  3DAF A;  1OQC A;  4RBN A;  1BDJ B;  1G5Z A;  1C17 M;  1M6T A;  4LER A;  4ONS A;  4W8K A;  3MFN A;  3FOO A;  2YLG A;  3ZTM A;  4CX9 A;  2Y3H A;  5KYX A;  4CSA C;  1Y6D A;  3KYJ A;  4OD5 A;  5D92 A;  5DLJ A;  2C03 A;  1U6H A;  2YKZ A;  4A4A A;  5B3S C;  1W2W A;  1V55 C;  1ST6 A;  2XLH A;  4PAC A;  2IBF A;  3QMK A;  4CSA A;  3S29 A;  2QY9 A;  2BC5 A;  1YYJ A;  3FMS A;  3H2U A;  2Q9A A;  4CDA A;  5CIV A;  4HEA J;  4J30 B;  4JW1 A;  1VLT A;  3OEO A;  1GS9 A;  4HFK B;  1V74 B;  4Z9J A;  3SZR A;  3KYI A;  4J32 B;  3KKB A;  2M4E A;  1YLM A;  1FMW A;  3EJN A;  2LD6 A;  2CDQ A;  3C18 A;  3UGO A;  2EPK X;  2EPO A;  2OCC C;  4PJJ A;  1WAS A;  3ZIB A;  1AUE A;  3N0T A;  1GM5 A;  1Q0G A;  1LE4 A;  2FAP B;  3M15 A;  3DJN B;  3Q6M A;  2R25 A;  3BEH A;  4MW3 A;  3U3F A;  2NSF A;  1RJ9 A;  2HMZ A;  1ZU5 A;  2BL2 A;  3DM5 A;  3PCV A;  1L7C A;  1C02 A;  3NKE A;  1EA8 A;  3PHF 2;  2PBE A;  3ABM C;  4EUK B;  4DBQ A;  3CEX A;  3Q7G A;  2XLO A;  4U5G A;  3ECS A;  3U8P A;  5A6A A;  2XXA A;  4P9F A;  1TWG A;  5E3C A;  2CGE A;  3QW1 A;  1E2X A;  1RXQ A;  1NBB A;  2R03 A;  3IQ5 A;  3V5Z A;  3RW0 A;  3UGP A;  2QE9 A;  2W9Y A;  1WN0 A;  2P61 A;  2CYD A;  2HFI A;  2OOC A;  2EPL X;  4HFF B;  4O79 A;  4C7O A;  3EHN A;  3JYY A;  2LFF A;  4BJ5 C;  4K1O A;  2JPU A;  4YWQ A;  2H7B A;  2R7Q A;  3DWW A;  4JCZ A;  1V54 C;  1NZE A;  2XS1 A;  2XS8 A;  4JRZ A;  4WGZ A;  4WJ0 A;  1EKY A;  4DOZ A;  5FCL A;  3V5Y A;  2E87 A;  2R7X A;  2Q4F A;  2HV7 A;  1B68 A;  3JTL O;  2AWC A;  4GQH A;  2PP4 A;  5F28 E;  1RCP A;  3LEV A;  4E0I A;  4LAC B;  1FTS A;  1YYX A;  4BJ5 A;  3DXJ F;  2J0X A;  2D4U A;  3CQZ A;  256B A;  3H65 A;  4YT5 A;  5KYX B;  3U8V A;  2HV6 A;  4CS7 A;  2XLE A;  3B0V C;  5COM A;  2R7S A;  4J7T A;  2YWA A;  1HY5 A;  4U9D A;  3EPV A;  1OW7 A;  1T6U A;  1VLS A;  3O10 A;  4U5C E;  1VMA A;  1NU7 D;  1Q0M A;  2GDC A;  2KGO A;  2YZS A;  4L6R A;  4DRH B;  5BQH A;  5L3Q A;  2KK1 A;  2FGY A;  2L7A A;  4XEK A;  4OIR F;  3E9V A;  2WZG A;  2W4B A;  3ZTZ A;  2ETS A;  1CPQ A;  4YK5 A;  5COG A;  2VC9 A;  2YRF A;  4J7Y A;  1O3U A;  1M2V B;  3UMH A;  5JRA A;  1ZHW A;  4LDR A;  2EIM C;  3SP1 A;  3U0C A;  1D1B A;  1FFH A;  2EPN A;  2M64 A;  2XL4 A;  3I5Q A;  2YL3 A;  4JTC B;  3NMK A;  3NYM A;  4EBJ A;  3FAJ A;  4PJL A;  4EKW A;  4DBR A;  1F1M A;  1BR1 A;  3HKK A;  5AC4 A;  4JC7 A;  3UNG C;  2H7V C;  2VCB A;  1OCR C;  1VK5 A;  2YL1 A;  3K7D A;  2V3C C;  1RJ9 B;  4D4N A;  4OIO F;  2DI3 A;  2CNW A;  1Z7Q c;  5L3V A;  3S9O A;  2KSF A;  3T9O A;  4CJO A;  1LS1 A;  5DS6 A;  5A6B A;  2LQG A;  3I4U A;  4RD9 A; 
#chains in the Genus database with same CATH homology
 5B3I A;  3C62 A;  4IAQ A;  1JAF A;  2YL0 A;  5JSL A;  3DE8 A;  1BBH A;  3QVZ A;  3NMI A;  1QQ3 A;  4ULV A;  4EIY A;  4CDV A;  5JLI A;  1M6T A;  3ZTM A;  4IB4 A;  3FOO A;  2YLG A;  4WGY A;  4CX9 A;  1LM3 B;  2YKZ A;  4N6H A;  2XLH A;  1CGO A;  2BC5 A;  1YYJ A;  4CDA A;  4JKV A;  5JUA A;  1APC A;  4D4X A;  2XLD A;  2J9B A;  2XL8 A;  5AGF A;  3M79 A;  4IAR A;  3C63 A;  3M15 A;  4ER9 A;  1A7V A;  1QPU A;  2YL7 A;  3QW0 A;  3U8P A;  2XLO A;  3ZWI A;  4CDY A;  1CGN A;  3QW1 A;  1NBB A;  3IQ5 A;  5JP7 A;  2XLM A;  2XL6 A;  4CIP A;  1CPR A;  1E84 A;  4NC3 A;  2XLW A;  3TOL A;  4WGZ A;  1EKY A;  1MQV A;  2YLI A;  5JT4 A;  1YZC A;  1RCP A;  1YYX A;  3M4C A;  256B A;  3QVY A;  4JEB A;  2XLE A;  1S05 A;  3HNK A;  2XM4 A;  4U9D A;  3L1M A;  3IQ6 A;  2J8W A;  4L6R A;  3ZQV A;  5JS5 A;  2YLD A;  2QLA A;  3ZTZ A;  3DE9 A;  4JE9 A;  1E85 A;  1CPQ A;  3ZQY A;  4JEA A;  5JRA A;  1E86 A;  3M4B A;  2XM0 A;  3TOM A;  1YZA A;  4N4W A;  1GQA A;  4CJG A;  3HNJ A;  2YL3 A;  3NMK A;  5JVE A;  3NMJ A;  2XLV A;  4U9E A;  2YL1 A;  3HNI A;  3HNL A;  4D4N A;  2CCY A;  1E83 A;  3VRC A;  4CJO A;  3FOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...