4PACA

Crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
153
Chain Sequence
MEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AHP2 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords Histidine-containing phosphotransfer protein 2
total genus 68
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4pacA00
2OOCA 1FR0A 1OXBA 4EUKB 1SR2A 1A0BA 1QSPA 3IQTA 3US6A 3KYJA 1TQGA 1C03A 1OXKA 1C02A 2LP4A 3U3BA 2LCHA 4PACA 2R25A 1I5NA 2Q4FA 1WN0A 3MYFA 1Y6DA 1BDJB 2A0BA 4G78A 3KYIA 1YVIA 2LD6A
chains in the Genus database with same CATH superfamily
2J7PA 3RYLA 4CS8C 3IEEA 4GQHA 1ZVZA 4CDYA 1Q0GA 3RIPA 4D4XA 2JX0A 3OA1A 5BQGA 5CIVA 3IQ5A 5EGYA 3QVYA 3S29A 4JVSA 3IQTA 1QKRA 2XLWA 3DE8A 2YEVA 3EZIA 3I5PA 3KL4A 1LI7A 2GAQA 4MTOA 4C3BA 5L0JA 4IRUA 3UNGC 4MTFA 1Z3IX 2LQGA 2IXMA 1R4TA 3VAYA 1JPJA 4MQ9F 4JIOA 2P7VA 1TWGA 2R03A 1F1MA 3AGTA 2GWWA 3VYWA 3HNKA 1OKKA 4JEAA 2R7TA 3VM6A 1LS4A 1K40A 2YRFA 1H9TA 3KKBA 1H9GA 3O10A 256BA 2M64A 3O55A 4H4KC 4WJ0A 1Y4CA 2CNWD 4JW1A 4MVSA 1W2WA 2ETSA 4X0RA 4U9EA 3L1MA 4IB4A 2J0XA 2PBEA 3U2LA 4J7YA 5HSWA 4KBLA 4ZLDA 2A6HF 4ER9A 1UG7A 1NBBA 4NTFA 4GYTA 1FTSA 1ZU5A 2FGYA 1E83A 2R7SA 2A1DD 1NFOA 1MNDA 1YLMA 2W9YA 3FHDA 1VOMA 2HMQA 1OKKD 3JTLO 5KYWA 1ST6A 2V26A 4U5FE 2PF4E 3AG1C 4QI0A 4W8PA 3MLGA 4AL0A 4F4BA 4PACA 4OINF 1TWAA 5L0HA 3HKKA 1TFKB 4N4WA 5KYWB 5F5FA 1Z7Qc 2NUTA 4JKVA 5A6BA 4BJ5A 3W4YA 4CIPA 2HS5A 4XEFA 1E2XA 3K6BA 3S28A 2DB4A 2IXNA 3RKOF 4N06A 4LDQA 4LDKA 2ICWG 3KYIA 5JP7A 1BR4A 4XWJA 4DXWA 1M57C 3B0VC 2C04A 4OIPF 3SXYA 1DOVA 4UDVA 1VLTA 1FAPB 1M56C 2P61A 1SMYF 3NKDA 1ZZPA 4JTAB 4OD5A 5DLJA 2VASA 2LK4A 4LACB 5COMA 3DM5A 5AC5A 1H7IA 2AP3A 5JT4A 1CGME 4MVQA 4LLEA 2HV6A 2HSBA 2QY9A 4J32B 5KYYA 4CSAC 1QZXA 4G7OF 2XLOA 4L6RA 3UGOA 3ZIBA 3AG2C 2LCHA 1A41A 3B0PA 5L0CA 3CEXA 1T9KA 3ASOC 3GM3A 1KTMA 3NMJA 4KC9A 5T3WA 1NG1A 1I5NA 1N1CA 4CJGA 4YT2A 1LM3B 1Z23A 1D1AA 1GM5A 1VTMP 4NTAA 4E17A 1VB5A 1J8MF 3EH2A 1O5HA 1RXQA 3HJCA 4U5CE 1BDJB 1YDIA 1TWHA 1WASA 4CBEA 3T9OA 4K0DA 4AE4B 5L0FA 1YAUO 3ZTZA 2I8BA 2WZLA 5CI9A 5EHHA 3EPVA 2QTVA 4YJWA 2NPUA 1DOWA 2IBFA 1FMVA 1ORYA 2C03A 1MMAA 2E87A 2KYHA 2L7AA 3EGXB 2W4BA 3GEEA 4U5HA 2YHSA 2YKZA 1YJGA 2IM8A 3UMKA 2OKUA 2FFHA 1OXKA 3HNJA 3BRJA 4MVUA 3V5YA 1MMGA 2XL6A 5B1AC 3EGDB 3WG7C 3GODA 3GEHA 3W8HA 4YT5A 2OJQA 3HNLA 5L3QA 4E7SA 3L0IA 4MW3A 3SNHA 2G62A 4MW8A 2XXAB 3C8GA 2LIGA 3NMKA 2PFDA 5L0GA 3CAXA 3MBGA 5D91A 1E86A 3ASNC 1OR3A 3ITFA 5JSLA 3AQBA 3RVZA 2EPKX 3EJNA 4JJGA 4PK4A 3U3BA 2A69F 3O6XA 1CGNA 2R7UA 1RCPA 4YN0B 5AC4A 4JJFA 2WVNA 3OWTA 4BPMA 3B0UX 2M4EA 3ATPA 2NSGA 1L7CA 3AOUA 4N6CA 3RQGA 2EIJC 4A2NB 2R7QA 1AUEA 4KNVA 5A6AA 3DWWA 4Q4ZF 2R7VA 3Q6MA 1D0XA 5L0IA 1SF8A 2MHRA 1JRAA 3DXJF 3PHF2 2J9VA 2VB6A 1ZYRF 3S9OA 3PDMP 1D1BA 3FOPA 2XS1A 1RKEB 2DGJA 1EI7A 4CDVA 5AGFA 2R9RB 1ORJA 2XRHA 4JEBA 5IY5C 3DM9B 3K1HA 3PMRA 3RW0A 3C8ZA 2H7OA 3NG1A 1T6QA 4FWVA 4AX2A 3U8VA 2J0WA 2J45A 1EKYA 3ZVRA 1T5OA 3V5XA 4ULWA 3C63A 5JLIA 2YLIA 1SZIA 2EIMC 3SXMA 4M63A 1YARO 3EFOB 3TULA 2H7BA 3NYLA 3V7OA 3U0CA 3ABLC 1Z5ZA 1JR8A 2HMZA 3LJBA 4O6MA 3ZDLA 5L3VA 5KYUB 1QLEC 1A0BA 3EZHA 5F28E 1VMAA 2P6VA 5A6BD 2AWYA 1TKNA 1WATA 2VH3A 2Y69C 3OEOA 3GWLA 1CGOA 3DMDA 4Q5SF 3SEOA 3FAJA 3IQ6A 2ZPAA 1VYKA 2XLMA 3NKEA 5B3SC 1YZAA 2X51A 2AVKA 3CSKA 1MQVA 3GEIA 3A11A 3JYHA 4DRIB 1WWPA 1PV3A 2XLEA 2Y3HA 1T01A 3JRMO 3QZCA 1QPUA 3M79A 3F46A 4MS2A 4R32A 4OIRF 4A4AA 4PR9A 1HMOA 3L8JA 2OG2A 1KU2A 1ZHTA 3LLIA 3S90A 4OIQF 2Q00A 1IZMA 4NY3A 4BJ1A 3FVYA 4JURI 4FAPB 3FAPB 3FXHA 3LS1A 4B6IA 1HY5A 2EPMX 4WGYA 5A6JA 4LDRA 4CDAA 1LI5A 1XWJA 1PD0A 3HTKC 1ZHYA 2EILC 2L6HA 3G4XA 3KMIA 1Q0FA 4J30B 3C8GB 4C7OB 4PJJA 1A7EA 3L34A 3L8IA 1T6UA 4N6HA 5B3IA 3U8PA 5E3AA 1JOGA 2IOQA 1O3UA 3N24A 4DBRA 1S05A 3T6GB 3N2ZB 3NMIA 4O6YA 3TJ6A 4EWCA 2ZD9A 4WABA 5T3TA 1B68A 1CPQA 2D4UA 2V3CC 5GPGB 1OR2A 1YVIA 2ASRA 5A6KA 2HSQA 1BBHA 2G3VA 2J9BA 2NG1A 2YQYA 3DAGA 3DE9A 3JSEO 4NC3A 3U9MA 2P1AA 1SR2A 5T1DB 2XXAA 5TJ5E 4AL1A 1GS9A 3A9CA 3T4RA 4CSAA 2JPUA 4I1MA 1BZ4A 1Z6AA 4G0HA 1C03A 3W2WA 5KYXA 5DQTA 3JRTA 1I4ZA 3I5QA 3ZG1A 2EINC 3TD7A 1HE1A 4U5EE 2L81A 1RKCA 3GANA 1JMWA 4IAOA 1SYQA 3G50A 2Q3TA 1VK5A 4CIHA 2J46A 2EIKC 5KYXB 3ZSUA 3T6BA 3MYIA 2D5RB 4CS9C 4OIOF 1PD1A 1HW2A 1QVXA 2HV7A 1NU7D 2MYSA 1ORSC 4BJ6C 4E0HA 3E9VA 2PP4A 4MVRA 1UFBA 1G4US 2IXOA 3C8GD 1C17M 3Q7LA 1OW7A 3QMKA 4BJ5C 4CJOA 3KPHA 2BC5A 4BEMJ 3SXZA 2KGOA 4ULVA 1R5ID 3NDBB 3UR3C 3I4UA 4XLNF 4CS8A 1QSPA 2IXPA 4JTDB 2HJ3A 2ZXOA 2KQ9A 4U5BE 5COFA 2L6FA 3RH3A 4QDLA 2Y3DA 2X0CA 2UUIA 3M15A 1C02A 2HZ8A 2Q7RA 2A0UA 3EH1A 4D4NA 1YYJA 4P9TA 1FFHA 1FMWA 3W8IA 4C3DA 3K1IA 2Q4FA 2YL0A 2XSEA 4JCZA 1WN0A 3ABMC 4K7BA 1U89A 3GWNA 4JZAA 2YWAA 2RSEB 2WVQA 2ZXRA 4LLCA 4IAQA 2R05A 1D0ZA 5DS5A 3DJUB 3EG9B 1GGQA 4EUKB 3FDQA 1IW7F 2W45A 3F47A 4YL3A 3LEOA 2R7OA 3Q6NA 3VF0A 2LSEA 4W8KA 5JUAA 2WZFA 2NUPB 4I3MA 4CS7A 2Q9BA 4HFKB 3JT1A 1TQGA 1FFTC 3U5SA 2Q9AA 1OCCC 4JC7A 1VLSA 3SZRA 4ANJA 4JE9A 4PFPA 1MNEA 3JCUQ 3DJNB 5EK0A 1JAFA 3M4CA 4IWBA 1V54C 4KI2A 2CGEA 4OD4A 3H2UA 5E3CA 1G5ZA 1HE9A 3DZAA 2A6EF 3QW0A 4WGZA 4I44A 1CPRA 2WL8A 1XZQA 3QTHA 2HJMA 2H7VC 2WB7A 3DKAA 3KH2A 2YL7A 1AVOB 3EGDA 2B0JA 3MYFA 2NUPA 1LE4A 2KC3A 3K66A 4DVZA 5DS6A 3EQLF 3TQOA 5BQIA 1TWCA 3SYNA 1O87A 4ZLCA 5BQHA 5K0IA 2KK1A 2R7XA 4QI2A 3VRCA 1FR0A 1OXBA 3U2MA 4AK9A 2OQMA 3E70C 3NRHA 1OW8A 2Q9CA 2XL8A 2Y39A 4C3EA 2TMVP 2L9JA 3TJ5A 1FNTc 1NZEA 3US6A 1LVKA 3B29A 3KYJA 5HV9A 5JVEA 4AE4A 4DJ9A 1PCXA 1XZPA 4YWQA 3LNRA 1D1CA 1QQ3A 1K05A 4NCQA 2P0NA 2RD9A 2J9UA 4Q7CA 3RVYA 3TOLA 2F22A 2XLVA 3MX3A 3GM1A 1RKEA 4XPWA 5COGA 5BUOA 2R25A 4JCHA 2YLDA 2QNLA 2CYDA 1M2VA 1Q0MA 2CNWA 1OW6A 3AG3C 3LEVA 3U9JA 3DAFA 3AQCA 4GEHA 4IGGA 4O6NA 5DVWA 3V5ZA 2VCCA 1EA8A 4RD9A 3Q7GA 4G78A 3TK0A 3UMIA 1YYXA 2J7PD 3ABKC 1LE2A 3LUTB 5JS5A 1Z63A 1A7VA 2HUJA 2CDQA 1LPEA 2YL1A 3LNMB 4RDAA 1E85A 2W4MA 4U5DE 3ZC4A 3DI5A 1Q0KA 1NFNA 4U9DA 4YK5A 4XLPF 2LFFA 4JTCB 4MTGA 5CI8A 3S84A 1EQ1A 4MVOA 2MWQA 3M1CB 3LS0A 4DRHB 1RJ9A 1H6GA 2GFHA 2BE5F 3H2VA 1I4YA 4DVYP 2YZSA 1LIHA 1NU9C 3SP1A 4C7OA 4O7GA 2VCBA 3ZQVA 1WOLA 2J9WA 3C18A 1APCA 1ZW2A 4HFFB 1NLXA 2KW3C 3R7CA 4BJTA 1V74B 2PX3A 2R7RA 2LD6A 2WZGA 1AEPA 2I15A 4DBQA 2WVOA 3C62A 1V55C 4Z9IA 4JRZA 4NTBA 4YL0A 3ZTMA 5A69A 4G7HF 2CCYA 4YT4A 3FMSA 3JSZA 1D0YA 4PJMA 3HLZA 5DS4A 2VC9A 3B9QA 4Z9HA 2UUHA 4LERA 3G4ZA 2YL3A 2CW0F 4MVMA 4XEKA 3IPMO 1GQAA 3UGPA 2AU5A 4KNWA 1HW1A 3ZWIA 3SXKA 4ONSA 5E33A 1TR2A 5L0DA 2GA0A 3QVZA 1A7DA 1NSGB 1OCRC 2XM4A 4MVZA 4XEVA 4XTKA 4DOZA 5KYYB 1G8XA 2DYSC 3WODF 1Y6DA 3TOMA 2H8AA 3GORA 2IYLD 3X2QC 5KYNA 3J06A 4YT8A 1WGWA 4EKWA 2OOCA 1ZHZA 2O9XA 2OU6A 1L3PA 2AWCA 5KYUA 3FOOA 1V4AA 2A68F 4E18A 3AJMA 3R2PA 5FZTA 2OCCC 3ZQYA 5JRAA 2ZXWC 3EFOA 3GM2A 2XM0A 3POVA 2HFIA 1M2OA 2QE9A 1ZU4A 4XPXA 3RQEA 1RMVA 2G3KA 1M6TA 4XPYA 2GDCA 4K1OA 1U6HA 2PX0A 4HEAJ 5DQZA 2NUTB 3NYJA 1BR2A 1OCOC 1OCZC 4I1OB 3W2VA 1J8YF 4RBNA 4P6IC 3LESA 5B1BC 2Y3BA 2Z15A 3EHNA 2XLDA 3X1OA 3IHUA 4IJJA 4FX5A 3BEHA 3NYMA 2FAPB 2OEXA 1YA9A 3AG4C 3LLKA 1U0BB 4YL1A 3S0XA 2YLGA 4BJ6A 1G4WR 4Z9JA 4PJLA 4EIYA 1LS1A 1ZHWA 4MNDA 2Y3GA 3DD7A 4NQFA 1JPNA 4XQ1A 2R7WA 3WAQA 4BG0A 2YVKA 3H65A 4EBKA 3K7DA 2LFDA 4J7TA 4CS9A 2OJED 3C7JA 1BR1A 2KSFA 3T6JA 2NSFA 2ZXPA 4E0IA 2DYRC 3QW1A 1VYIA 2HKVA 2BL2A 3MFNA 3PCVA 5FCLA 4CX9A 3EG9A 2EPLX 3S27A 3EHMA 2QLAA 3CQZA 4EBJA 4U5GA 3IQCA 3JZ0A 1Q0DA 3RF3A 3U3FA 3EGXA 2L6GA 4E7ZA 2J8WA 3RFYA 4O79A 1K04A 1TFOB 2R02A 1MMNA 3CZ6A 1YA7O 2DI3A 2EPNA 1RJ9B 2OEVA 2XLHA 3B71A 3HNIA 5F5HA 1T6IA 4IARA 4P9FA 3LAYA 1ZW3A 3JYYA 4PJNA 3AGUA 1M2VB 3K1IC 2KNHA 2LP4A 3RQFA 4DRJB 1YZCA 4EBBA 2EPOA 1S7ZA 5E2QA 1OQCA 4PFOA 4EHPA 3N0TA 3UMHA 2KJGA 1LKXA 2QUPA 2B0HA 1ZHXA 1MMDA 4HE8D 3ECSA 3K33A 2JD3A 5D92A 4BEJA 1KNYA 3M4BA 1HMDA 3O39A 2XS8A 4FESA 4H54A 3WHNA 1E84A 2XL4A 2A0BA 4G7ZF 2PNOA 2VCAA 1WTYA
chains in the Genus database with same CATH topology
2OOCA 1FR0A 1OXBA 4EUKB 1SR2A 1A0BA 1QSPA 3IQTA 3US6A 3KYJA 1TQGA 1C03A 1OXKA 1C02A 2LP4A 3U3BA 2LCHA 4PACA 2R25A 1I5NA 2Q4FA 1WN0A 3MYFA 1Y6DA 1BDJB 2A0BA 4G78A 3KYIA 1YVIA 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  1FR0 A;  1OXB A;  4EUK B;  1SR2 A;  1A0B A;  1QSP A;  3IQT A;  3US6 A;  3KYJ A;  1TQG A;  1C03 A;  1OXK A;  1C02 A;  2LP4 A;  3U3B A;  2LCH A;  4PAC A;  2R25 A;  1I5N A;  2Q4F A;  1WN0 A;  3MYF A;  1Y6D A;  1BDJ B;  2A0B A;  4G78 A;  3KYI A;  1YVI A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 2J7P A;  3RYL A;  4CS8 C;  3IEE A;  4GQH A;  1ZVZ A;  4CDY A;  1Q0G A;  3RIP A;  4D4X A;  2JX0 A;  3OA1 A;  5BQG A;  5CIV A;  3IQ5 A;  5EGY A;  3QVY A;  3S29 A;  4JVS A;  3IQT A;  1QKR A;  2XLW A;  3DE8 A;  2YEV A;  3EZI A;  3I5P A;  3KL4 A;  1LI7 A;  2GAQ A;  4MTO A;  4C3B A;  5L0J A;  4IRU A;  3UNG C;  4MTF A;  1Z3I X;  2LQG A;  2IXM A;  1R4T A;  3VAY A;  1JPJ A;  4MQ9 F;  4JIO A;  2P7V A;  1TWG A;  2R03 A;  1F1M A;  3AGT A;  2GWW A;  3VYW A;  3HNK A;  1OKK A;  4JEA A;  2R7T A;  3VM6 A;  1LS4 A;  1K40 A;  2YRF A;  1H9T A;  3KKB A;  1H9G A;  3O10 A;  256B A;  2M64 A;  3O55 A;  4H4K C;  4WJ0 A;  1Y4C A;  2CNW D;  4JW1 A;  4MVS A;  1W2W A;  2ETS A;  4X0R A;  4U9E A;  3L1M A;  4IB4 A;  2J0X A;  2PBE A;  3U2L A;  4J7Y A;  5HSW A;  4KBL A;  4ZLD A;  2A6H F;  4ER9 A;  1UG7 A;  1NBB A;  4NTF A;  4GYT A;  1FTS A;  1ZU5 A;  2FGY A;  1E83 A;  2R7S A;  2A1D D;  1NFO A;  1MND A;  1YLM A;  2W9Y A;  3FHD A;  1VOM A;  2HMQ A;  1OKK D;  3JTL O;  5KYW A;  1ST6 A;  2V26 A;  4U5F E;  2PF4 E;  3AG1 C;  4QI0 A;  4W8P A;  3MLG A;  4AL0 A;  4F4B A;  4PAC A;  4OIN F;  1TWA A;  5L0H A;  3HKK A;  1TFK B;  4N4W A;  5KYW B;  5F5F A;  1Z7Q c;  2NUT A;  4JKV A;  5A6B A;  4BJ5 A;  3W4Y A;  4CIP A;  2HS5 A;  4XEF A;  1E2X A;  3K6B A;  3S28 A;  2DB4 A;  2IXN A;  3RKO F;  4N06 A;  4LDQ A;  4LDK A;  2ICW G;  3KYI A;  5JP7 A;  1BR4 A;  4XWJ A;  4DXW A;  1M57 C;  3B0V C;  2C04 A;  4OIP F;  3SXY A;  1DOV A;  4UDV A;  1VLT A;  1FAP B;  1M56 C;  2P61 A;  1SMY F;  3NKD A;  1ZZP A;  4JTA B;  4OD5 A;  5DLJ A;  2VAS A;  2LK4 A;  4LAC B;  5COM A;  3DM5 A;  5AC5 A;  1H7I A;  2AP3 A;  5JT4 A;  1CGM E;  4MVQ A;  4LLE A;  2HV6 A;  2HSB A;  2QY9 A;  4J32 B;  5KYY A;  4CSA C;  1QZX A;  4G7O F;  2XLO A;  4L6R A;  3UGO A;  3ZIB A;  3AG2 C;  2LCH A;  1A41 A;  3B0P A;  5L0C A;  3CEX A;  1T9K A;  3ASO C;  3GM3 A;  1KTM A;  3NMJ A;  4KC9 A;  5T3W A;  1NG1 A;  1I5N A;  1N1C A;  4CJG A;  4YT2 A;  1LM3 B;  1Z23 A;  1D1A A;  1GM5 A;  1VTM P;  4NTA A;  4E17 A;  1VB5 A;  1J8M F;  3EH2 A;  1O5H A;  1RXQ A;  3HJC A;  4U5C E;  1BDJ B;  1YDI A;  1TWH A;  1WAS A;  4CBE A;  3T9O A;  4K0D A;  4AE4 B;  5L0F A;  1YAU O;  3ZTZ A;  2I8B A;  2WZL A;  5CI9 A;  5EHH A;  3EPV A;  2QTV A;  4YJW A;  2NPU A;  1DOW A;  2IBF A;  1FMV A;  1ORY A;  2C03 A;  1MMA A;  2E87 A;  2KYH A;  2L7A A;  3EGX B;  2W4B A;  3GEE A;  4U5H A;  2YHS A;  2YKZ A;  1YJG A;  2IM8 A;  3UMK A;  2OKU A;  2FFH A;  1OXK A;  3HNJ A;  3BRJ A;  4MVU A;  3V5Y A;  1MMG A;  2XL6 A;  5B1A C;  3EGD B;  3WG7 C;  3GOD A;  3GEH A;  3W8H A;  4YT5 A;  2OJQ A;  3HNL A;  5L3Q A;  4E7S A;  3L0I A;  4MW3 A;  3SNH A;  2G62 A;  4MW8 A;  2XXA B;  3C8G A;  2LIG A;  3NMK A;  2PFD A;  5L0G A;  3CAX A;  3MBG A;  5D91 A;  1E86 A;  3ASN C;  1OR3 A;  3ITF A;  5JSL A;  3AQB A;  3RVZ A;  2EPK X;  3EJN A;  4JJG A;  4PK4 A;  3U3B A;  2A69 F;  3O6X A;  1CGN A;  2R7U A;  1RCP A;  4YN0 B;  5AC4 A;  4JJF A;  2WVN A;  3OWT A;  4BPM A;  3B0U X;  2M4E A;  3ATP A;  2NSG A;  1L7C A;  3AOU A;  4N6C A;  3RQG A;  2EIJ C;  4A2N B;  2R7Q A;  1AUE A;  4KNV A;  5A6A A;  3DWW A;  4Q4Z F;  2R7V A;  3Q6M A;  1D0X A;  5L0I A;  1SF8 A;  2MHR A;  1JRA A;  3DXJ F;  3PHF 2;  2J9V A;  2VB6 A;  1ZYR F;  3S9O A;  3PDM P;  1D1B A;  3FOP A;  2XS1 A;  1RKE B;  2DGJ A;  1EI7 A;  4CDV A;  5AGF A;  2R9R B;  1ORJ A;  2XRH A;  4JEB A;  5IY5 C;  3DM9 B;  3K1H A;  3PMR A;  3RW0 A;  3C8Z A;  2H7O A;  3NG1 A;  1T6Q A;  4FWV A;  4AX2 A;  3U8V A;  2J0W A;  2J45 A;  1EKY A;  3ZVR A;  1T5O A;  3V5X A;  4ULW A;  3C63 A;  5JLI A;  2YLI A;  1SZI A;  2EIM C;  3SXM A;  4M63 A;  1YAR O;  3EFO B;  3TUL A;  2H7B A;  3NYL A;  3V7O A;  3U0C A;  3ABL C;  1Z5Z A;  1JR8 A;  2HMZ A;  3LJB A;  4O6M A;  3ZDL A;  5L3V A;  5KYU B;  1QLE C;  1A0B A;  3EZH A;  5F28 E;  1VMA A;  2P6V A;  5A6B D;  2AWY A;  1TKN A;  1WAT A;  2VH3 A;  2Y69 C;  3OEO A;  3GWL A;  1CGO A;  3DMD A;  4Q5S F;  3SEO A;  3FAJ A;  3IQ6 A;  2ZPA A;  1VYK A;  2XLM A;  3NKE A;  5B3S C;  1YZA A;  2X51 A;  2AVK A;  3CSK A;  1MQV A;  3GEI A;  3A11 A;  3JYH A;  4DRI B;  1WWP A;  1PV3 A;  2XLE A;  2Y3H A;  1T01 A;  3JRM O;  3QZC A;  1QPU A;  3M79 A;  3F46 A;  4MS2 A;  4R32 A;  4OIR F;  4A4A A;  4PR9 A;  1HMO A;  3L8J A;  2OG2 A;  1KU2 A;  1ZHT A;  3LLI A;  3S90 A;  4OIQ F;  2Q00 A;  1IZM A;  4NY3 A;  4BJ1 A;  3FVY A;  4JUR I;  4FAP B;  3FAP B;  3FXH A;  3LS1 A;  4B6I A;  1HY5 A;  2EPM X;  4WGY A;  5A6J A;  4LDR A;  4CDA A;  1LI5 A;  1XWJ A;  1PD0 A;  3HTK C;  1ZHY A;  2EIL C;  2L6H A;  3G4X A;  3KMI A;  1Q0F A;  4J30 B;  3C8G B;  4C7O B;  4PJJ A;  1A7E A;  3L34 A;  3L8I A;  1T6U A;  4N6H A;  5B3I A;  3U8P A;  5E3A A;  1JOG A;  2IOQ A;  1O3U A;  3N24 A;  4DBR A;  1S05 A;  3T6G B;  3N2Z B;  3NMI A;  4O6Y A;  3TJ6 A;  4EWC A;  2ZD9 A;  4WAB A;  5T3T A;  1B68 A;  1CPQ A;  2D4U A;  2V3C C;  5GPG B;  1OR2 A;  1YVI A;  2ASR A;  5A6K A;  2HSQ A;  1BBH A;  2G3V A;  2J9B A;  2NG1 A;  2YQY A;  3DAG A;  3DE9 A;  3JSE O;  4NC3 A;  3U9M A;  2P1A A;  1SR2 A;  5T1D B;  2XXA A;  5TJ5 E;  4AL1 A;  1GS9 A;  3A9C A;  3T4R A;  4CSA A;  2JPU A;  4I1M A;  1BZ4 A;  1Z6A A;  4G0H A;  1C03 A;  3W2W A;  5KYX A;  5DQT A;  3JRT A;  1I4Z A;  3I5Q A;  3ZG1 A;  2EIN C;  3TD7 A;  1HE1 A;  4U5E E;  2L81 A;  1RKC A;  3GAN A;  1JMW A;  4IAO A;  1SYQ A;  3G50 A;  2Q3T A;  1VK5 A;  4CIH A;  2J46 A;  2EIK C;  5KYX B;  3ZSU A;  3T6B A;  3MYI A;  2D5R B;  4CS9 C;  4OIO F;  1PD1 A;  1HW2 A;  1QVX A;  2HV7 A;  1NU7 D;  2MYS A;  1ORS C;  4BJ6 C;  4E0H A;  3E9V A;  2PP4 A;  4MVR A;  1UFB A;  1G4U S;  2IXO A;  3C8G D;  1C17 M;  3Q7L A;  1OW7 A;  3QMK A;  4BJ5 C;  4CJO A;  3KPH A;  2BC5 A;  4BEM J;  3SXZ A;  2KGO A;  4ULV A;  1R5I D;  3NDB B;  3UR3 C;  3I4U A;  4XLN F;  4CS8 A;  1QSP A;  2IXP A;  4JTD B;  2HJ3 A;  2ZXO A;  2KQ9 A;  4U5B E;  5COF A;  2L6F A;  3RH3 A;  4QDL A;  2Y3D A;  2X0C A;  2UUI A;  3M15 A;  1C02 A;  2HZ8 A;  2Q7R A;  2A0U A;  3EH1 A;  4D4N A;  1YYJ A;  4P9T A;  1FFH A;  1FMW A;  3W8I A;  4C3D A;  3K1I A;  2Q4F A;  2YL0 A;  2XSE A;  4JCZ A;  1WN0 A;  3ABM C;  4K7B A;  1U89 A;  3GWN A;  4JZA A;  2YWA A;  2RSE B;  2WVQ A;  2ZXR A;  4LLC A;  4IAQ A;  2R05 A;  1D0Z A;  5DS5 A;  3DJU B;  3EG9 B;  1GGQ A;  4EUK B;  3FDQ A;  1IW7 F;  2W45 A;  3F47 A;  4YL3 A;  3LEO A;  2R7O A;  3Q6N A;  3VF0 A;  2LSE A;  4W8K A;  5JUA A;  2WZF A;  2NUP B;  4I3M A;  4CS7 A;  2Q9B A;  4HFK B;  3JT1 A;  1TQG A;  1FFT C;  3U5S A;  2Q9A A;  1OCC C;  4JC7 A;  1VLS A;  3SZR A;  4ANJ A;  4JE9 A;  4PFP A;  1MNE A;  3JCU Q;  3DJN B;  5EK0 A;  1JAF A;  3M4C A;  4IWB A;  1V54 C;  4KI2 A;  2CGE A;  4OD4 A;  3H2U A;  5E3C A;  1G5Z A;  1HE9 A;  3DZA A;  2A6E F;  3QW0 A;  4WGZ A;  4I44 A;  1CPR A;  2WL8 A;  1XZQ A;  3QTH A;  2HJM A;  2H7V C;  2WB7 A;  3DKA A;  3KH2 A;  2YL7 A;  1AVO B;  3EGD A;  2B0J A;  3MYF A;  2NUP A;  1LE4 A;  2KC3 A;  3K66 A;  4DVZ A;  5DS6 A;  3EQL F;  3TQO A;  5BQI A;  1TWC A;  3SYN A;  1O87 A;  4ZLC A;  5BQH A;  5K0I A;  2KK1 A;  2R7X A;  4QI2 A;  3VRC A;  1FR0 A;  1OXB A;  3U2M A;  4AK9 A;  2OQM A;  3E70 C;  3NRH A;  1OW8 A;  2Q9C A;  2XL8 A;  2Y39 A;  4C3E A;  2TMV P;  2L9J A;  3TJ5 A;  1FNT c;  1NZE A;  3US6 A;  1LVK A;  3B29 A;  3KYJ A;  5HV9 A;  5JVE A;  4AE4 A;  4DJ9 A;  1PCX A;  1XZP A;  4YWQ A;  3LNR A;  1D1C A;  1QQ3 A;  1K05 A;  4NCQ A;  2P0N A;  2RD9 A;  2J9U A;  4Q7C A;  3RVY A;  3TOL A;  2F22 A;  2XLV A;  3MX3 A;  3GM1 A;  1RKE A;  4XPW A;  5COG A;  5BUO A;  2R25 A;  4JCH A;  2YLD A;  2QNL A;  2CYD A;  1M2V A;  1Q0M A;  2CNW A;  1OW6 A;  3AG3 C;  3LEV A;  3U9J A;  3DAF A;  3AQC A;  4GEH A;  4IGG A;  4O6N A;  5DVW A;  3V5Z A;  2VCC A;  1EA8 A;  4RD9 A;  3Q7G A;  4G78 A;  3TK0 A;  3UMI A;  1YYX A;  2J7P D;  3ABK C;  1LE2 A;  3LUT B;  5JS5 A;  1Z63 A;  1A7V A;  2HUJ A;  2CDQ A;  1LPE A;  2YL1 A;  3LNM B;  4RDA A;  1E85 A;  2W4M A;  4U5D E;  3ZC4 A;  3DI5 A;  1Q0K A;  1NFN A;  4U9D A;  4YK5 A;  4XLP F;  2LFF A;  4JTC B;  4MTG A;  5CI8 A;  3S84 A;  1EQ1 A;  4MVO A;  2MWQ A;  3M1C B;  3LS0 A;  4DRH B;  1RJ9 A;  1H6G A;  2GFH A;  2BE5 F;  3H2V A;  1I4Y A;  4DVY P;  2YZS A;  1LIH A;  1NU9 C;  3SP1 A;  4C7O A;  4O7G A;  2VCB A;  3ZQV A;  1WOL A;  2J9W A;  3C18 A;  1APC A;  1ZW2 A;  4HFF B;  1NLX A;  2KW3 C;  3R7C A;  4BJT A;  1V74 B;  2PX3 A;  2R7R A;  2LD6 A;  2WZG A;  1AEP A;  2I15 A;  4DBQ A;  2WVO A;  3C62 A;  1V55 C;  4Z9I A;  4JRZ A;  4NTB A;  4YL0 A;  3ZTM A;  5A69 A;  4G7H F;  2CCY A;  4YT4 A;  3FMS A;  3JSZ A;  1D0Y A;  4PJM A;  3HLZ A;  5DS4 A;  2VC9 A;  3B9Q A;  4Z9H A;  2UUH A;  4LER A;  3G4Z A;  2YL3 A;  2CW0 F;  4MVM A;  4XEK A;  3IPM O;  1GQA A;  3UGP A;  2AU5 A;  4KNW A;  1HW1 A;  3ZWI A;  3SXK A;  4ONS A;  5E33 A;  1TR2 A;  5L0D A;  2GA0 A;  3QVZ A;  1A7D A;  1NSG B;  1OCR C;  2XM4 A;  4MVZ A;  4XEV A;  4XTK A;  4DOZ A;  5KYY B;  1G8X A;  2DYS C;  3WOD F;  1Y6D A;  3TOM A;  2H8A A;  3GOR A;  2IYL D;  3X2Q C;  5KYN A;  3J06 A;  4YT8 A;  1WGW A;  4EKW A;  2OOC A;  1ZHZ A;  2O9X A;  2OU6 A;  1L3P A;  2AWC A;  5KYU A;  3FOO A;  1V4A A;  2A68 F;  4E18 A;  3AJM A;  3R2P A;  5FZT A;  2OCC C;  3ZQY A;  5JRA A;  2ZXW C;  3EFO A;  3GM2 A;  2XM0 A;  3POV A;  2HFI A;  1M2O A;  2QE9 A;  1ZU4 A;  4XPX A;  3RQE A;  1RMV A;  2G3K A;  1M6T A;  4XPY A;  2GDC A;  4K1O A;  1U6H A;  2PX0 A;  4HEA J;  5DQZ A;  2NUT B;  3NYJ A;  1BR2 A;  1OCO C;  1OCZ C;  4I1O B;  3W2V A;  1J8Y F;  4RBN A;  4P6I C;  3LES A;  5B1B C;  2Y3B A;  2Z15 A;  3EHN A;  2XLD A;  3X1O A;  3IHU A;  4IJJ A;  4FX5 A;  3BEH A;  3NYM A;  2FAP B;  2OEX A;  1YA9 A;  3AG4 C;  3LLK A;  1U0B B;  4YL1 A;  3S0X A;  2YLG A;  4BJ6 A;  1G4W R;  4Z9J A;  4PJL A;  4EIY A;  1LS1 A;  1ZHW A;  4MND A;  2Y3G A;  3DD7 A;  4NQF A;  1JPN A;  4XQ1 A;  2R7W A;  3WAQ A;  4BG0 A;  2YVK A;  3H65 A;  4EBK A;  3K7D A;  2LFD A;  4J7T A;  4CS9 A;  2OJE D;  3C7J A;  1BR1 A;  2KSF A;  3T6J A;  2NSF A;  2ZXP A;  4E0I A;  2DYR C;  3QW1 A;  1VYI A;  2HKV A;  2BL2 A;  3MFN A;  3PCV A;  5FCL A;  4CX9 A;  3EG9 A;  2EPL X;  3S27 A;  3EHM A;  2QLA A;  3CQZ A;  4EBJ A;  4U5G A;  3IQC A;  3JZ0 A;  1Q0D A;  3RF3 A;  3U3F A;  3EGX A;  2L6G A;  4E7Z A;  2J8W A;  3RFY A;  4O79 A;  1K04 A;  1TFO B;  2R02 A;  1MMN A;  3CZ6 A;  1YA7 O;  2DI3 A;  2EPN A;  1RJ9 B;  2OEV A;  2XLH A;  3B71 A;  3HNI A;  5F5H A;  1T6I A;  4IAR A;  4P9F A;  3LAY A;  1ZW3 A;  3JYY A;  4PJN A;  3AGU A;  1M2V B;  3K1I C;  2KNH A;  2LP4 A;  3RQF A;  4DRJ B;  1YZC A;  4EBB A;  2EPO A;  1S7Z A;  5E2Q A;  1OQC A;  4PFO A;  4EHP A;  3N0T A;  3UMH A;  2KJG A;  1LKX A;  2QUP A;  2B0H A;  1ZHX A;  1MMD A;  4HE8 D;  3ECS A;  3K33 A;  2JD3 A;  5D92 A;  4BEJ A;  1KNY A;  3M4B A;  1HMD A;  3O39 A;  2XS8 A;  4FES A;  4H54 A;  3WHN A;  1E84 A;  2XL4 A;  2A0B A;  4G7Z F;  2PNO A;  2VCA A;  1WTY A; 
#chains in the Genus database with same CATH homology
 2OOC A;  1FR0 A;  1OXB A;  4EUK B;  1SR2 A;  1A0B A;  1QSP A;  3IQT A;  3US6 A;  3KYJ A;  1TQG A;  1C03 A;  1OXK A;  1C02 A;  2LP4 A;  3U3B A;  2LCH A;  4PAC A;  2R25 A;  1I5N A;  2Q4F A;  1WN0 A;  3MYF A;  1Y6D A;  1BDJ B;  2A0B A;  4G78 A;  3KYI A;  1YVI A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...