4PACA

Crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
153
Chain Sequence
MEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Histidine-containing phosphotransfer protein 2
publication title Crystal structure of AHP2 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
total genus 68
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4pacA00
1FR0A 1I5NA 1WN0A 2LCHA 4EUKB 1BDJB 3IQTA 4PACA 2OOCA 1QSPA 1TQGA 1SR2A 2A0BA 2Q4FA 3MYFA 4G78A 1A0BA 3KYIA 1C03A 1YVIA 3U3BA 2LP4A 1OXBA 2LD6A 1Y6DA 2R25A 3US6A 3KYJA 1OXKA 1C02A
chains in the Genus database with same CATH superfamily
4IAQA 3S28A 1YZCA 1T01A 2YHSA 1RCPA 3G4ZA 1NU9C 1VB5A 1VYIA 2C04A 3DM5A 3EJNA 2XLEA 4P6IC 1XWJA 3LJBA 5D92A 3ZIBA 2AVKA 3VRCA 5B3IA 1NFOA 2KW3C 2Z15A 3TQOA 2OEXA 2VB6A 2AWCA 3NKDA 3V5XA 4F4BA 5KYUB 2KK1A 3U0CA 1O5HA 2ETSA 3ZDLA 1TWHA 2KC3A 3IQ5A 3NYLA 4K1OA 4R32A 3MLGA 1IW7F 5DQZA 3UGPA 3DI5A 2LFDA 1M57C 2HKVA 1E86A 2XSEA 4I44A 1BZ4A 1M56C 3LS0A 2GWWA 5L3QA 3C8GB 2PP4A 3JSZA 5DVWA 4FWVA 3TD7A 2YVKA 4LDQA 2XS1A 1A7EA 4MTOA 1Y4CA 2W4MA 1E83A 2PBEA 3UNGC 4L6RA 4O79A 1E84A 3B9QA 5EK0A 1YZAA 2BL2A 2XRHA 3QTHA 5L0HA 3DE9A 3WHNA 3DKAA 4D4XA 2MHRA 3EZIA 3G50A 4MTGA 4CS8C 1Q0DA 1NZEA 2Y3DA 4NY3A 2LCHA 3EZHA 3K1IC 4OD5A 5L0IA 1OCRC 1JAFA 1BR4A 3LEOA 3MX3A 5COMA 3K6BA 3UGOA 2KQ9A 1J8MF 2CYDA 1GGQA 2ZPAA 2IM8A 3HKKA 4AE4A 5COGA 4YT4A 4DRJB 1C17M 1VTMP 1OW7A 3KMIA 1AUEA 2BC5A 2J9BA 3OWTA 1WASA 1RMVA 1NSGB 3SXKA 2J9VA 4B6IA 2L81A 4WGYA 3EHMA 3JZ0A 4O6MA 1HE9A 1YVIA 2KGOA 2PNOA 2VCCA 3FMSA 4J7YA 1H7IA 4LDKA 4J7TA 4ULVA 3KL4A 3SNHA 3T4RA 5IY5C 3PHF2 2A1DD 2IOQA 3MFNA 4IAOA 1EKYA 1CPRA 4EHPA 2OOCA 3NMIA 4G0HA 2KSFA 4JEAA 3POVA 2J9UA 2NUPB 1WOLA 2CW0F 3ABKC 4HFKB 3RKOF 4C7OB 4MVUA 1UG7A 3L34A 4EKWA 1G4WR 3RF3A 3ZWIA 5L3VA 5A69A 1TQGA 1O87A 4OIOF 2Q9AA 2XLVA 3M1CB 3L8IA 1T6QA 3MYFA 3Q7LA 2R02A 2R7QA 3TK0A 4PJLA 3FDQA 4KNVA 4EWCA 1MMGA 1T6IA 1B68A 3V7OA 3UMHA 3V5YA 4BG0A 2GA0A 2H7VC 3KPHA 3EGXA 3DWWA 3AQBA 3FAPB 3M79A 1Z63A 4WGZA 1NU7D 3TOMA 3S29A 2HV7A 3NYJA 5COFA 1EI7A 4YT2A 4LLEA 2NG1A 1GS9A 4DRIB 4CS9C 1HE1A 1F1MA 1TWGA 3JSEO 1A7DA 2Q00A 4OIPF 4PJNA 1YA9A 3NDBB 2IXNA 4EIYA 1M2OA 1BDJB 4MW8A 4IARA 2HMQA 3SEOA 2NPUA 4BJ6A 4MVZA 2I15A 5CIVA 3SXYA 5BQHA 3RH3A 3AG1C 3C8GD 1FFHA 2WZFA 5D91A 4H4KC 2HFIA 1SZIA 4PJMA 4DRHB 5L0FA 3KYIA 4JKVA 5KYWA 1RKEA 3JT1A 2H8AA 1EQ1A 3LAYA 2OCCC 5A6BD 3EPVA 1WATA 3S9OA 5CI8A 2W45A 4E18A 3LESA 2QLAA 4AE4B 5HV9A 1SYQA 1VK5A 3GM3A 5L0GA 2J7PA 1LI7A 5E3CA 3AOUA 1FNTc 2CGEA 2G3VA 3NMKA 1U6HA 3WAQA 1D1AA 1FMWA 3C62A 1NLXA 3IHUA 3RQFA 2IXOA 1MMAA 2EPMX 4K7BA 3RW0A 2XLOA 2IYLD 2XM4A 4XLPF 4XWJA 3LLIA 2YEVA 4ONSA 3ABLC 2G3KA 5JRAA 4MQ9F 4DBRA 4MVMA 3GM2A 4I3MA 3HJCA 3RQGA 1V54C 2FGYA 3GWNA 3A11A 3K1IA 4ULWA 5BQGA 3VM6A 2OJED 1TR2A 3AG2C 4C3BA 3N2ZB 2VCAA 4CS7A 3QZCA 4XLNF 1JMWA 4HFFB 2F22A 3EG9A 2J8WA 1MQVA 1OQCA 1LM3B 2LP4A 3LUTB 4IRUA 1Q0GA 4XQ1A 1NG1A 5L0DA 3RVYA 1OR2A 1FFTC 3IQ6A 2L9JA 1ORJA 1QPUA 1G4US 2IXMA 3EQLF 2A69F 1M2VA 5GPGB 4DVZA 5DLJA 1LIHA 1QZXA 2GDCA 4JURI 2PF4E 3OEOA 4BEMJ 1BR2A 3O10A 2GAQA 3ZSUA 1LE4A 4J30B 5KYXA 4NTBA 3JYHA 4ZLDA 4U9EA 2D5RB 1ZHZA 2R03A 2R7OA 1YAUO 2EILC 4I1OB 4CJOA 4UDVA 4JCHA 1Z23A 1O3UA 3UMKA 1E2XA 2PX0A 4JIOA 3HTKC 3CAXA 3HNLA 3DE8A 2GFHA 3N0TA 2DI3A 4C3DA 4BEJA 1OR3A 2OG2A 4NC3A 3S90A 2QE9A 4ANJA 3C7JA 3M15A 1MNDA 1XZQA 2DB4A 2EPOA 1LVKA 2WZGA 3NYMA 4MVSA 4O7GA 4BJ5C 2V3CC 5B1AC 5T3TA 5KYWB 1RKEB 1ZHXA 5E33A 1LPEA 1V55C 4CS9A 3O6XA 2XLMA 3KH2A 2LK4A 4GEHA 1BBHA 2XLDA 2YWAA 2Q9BA 1OCCC 3M4BA 1G8XA 2A0UA 4CDVA 2XLWA 2EPNA 1YA7O 2XLHA 3FOOA 1D0XA 3N24A 2B0HA 2HJ3A 3B0PA 3QVZA 3ABMC 3W8IA 1H9TA 2NSFA 3JCUQ 5F5HA 3AGUA 4MVOA 2P0NA 2CDQA 2Y39A 3LLKA 3Q7GA 1OKKA 4J32B 4CSAC 3HNIA 1VOMA 3W2WA 1L7CA 1Y6DA 3G4XA 5B1BC 4AL0A 2R7SA 1TKNA 3RQEA 2JX0A 2HZ8A 3LS1A 1OXKA 1PV3A 1ZHTA 1T9KA 4XEKA 2HUJA 1QKRA 3EFOA 3K33A 1JRAA 3FXHA 3B0VC 3DJNB 2JPUA 3W4YA 4JZAA 2RD9A 1LE2A 4RD9A 1ZW3A 4W8KA 1E85A 1FAPB 3NRHA 3EG9B 4U5CE 3U9MA 4Z9IA 3WODF 4Z9HA 4KNWA 3I4UA 4OIQF 4HE8D 1YYXA 3C63A 4U5GA 5JUAA 2ZXWC 3AGTA 3ECSA 2WVQA 3O39A 1Z6AA 5A6JA 5DS4A 1M2VB 1L3PA 3DJUB 5AC5A 1FTSA 3EH2A 1GM5A 1TWCA 2L7AA 1EA8A 3B0UX 3X2QC 5K0IA 2R7VA 2P1AA 1H6GA 5L0CA 2E87A 1T5OA 2YKZA 4AX2A 3EH1A 2VH3A 4I1MA 2OU6A 5KYXB 1LS4A 3I5QA 3EGDA 4PFPA 2CNWA 1ZVZA 1HMOA 1Z5ZA 1NFNA 3V5ZA 1TWAA 1U89A 3RIPA 3U8VA 1OW6A 1GQAA 4DBQA 5L0JA 3VAYA 3JTLO 1WWPA 3S0XA 2YLGA 1T6UA 4X0RA 2A68F 1ZU5A 1YDIA 1HY5A 3E70C 4G7ZF 3ZQYA 1A7VA 4E17A 2WL8A 4D4NA 1R5ID 4K0DA 4U5DE 5E2QA 2KJGA 2PFDA 2YLDA 3Q6NA 3ZTMA 2DGJA 4A4AA 3J06A 1YLMA 2V26A 1APCA 3GWLA 5KYYA 5DS5A 3F46A 1SF8A 1PD1A 2VCBA 4KBLA 2IXPA 2Y3GA 4M63A 1AVOB 3U3BA 1VLTA 2OQMA 3SP1A 1KTMA 5FZTA 3K1HA 1ZU4A 2KYHA 1WTYA 4YWQA 3AG4C 3M4CA 1C02A 4E7SA 2XL6A 4IB4A 2L6HA 2NUTA 2HMZA 3HNJA 1PCXA 4N6CA 2EIKC 4GYTA 4G7OF 5EHHA 3B29A 1RKCA 4WJ0A 5DQTA 5AC4A 5KYNA 3S84A 3IPMO 3ZTZA 4PACA 4QI0A 1QSPA 3U3FA 2AWYA 2J7PD 3R2PA 4FESA 4N6HA 2I8BA 4JC7A 3U9JA 3MBGA 2HJMA 4G78A 4BJ5A 4KI2A 3CSKA 3JRMO 1CGOA 4IGGA 4YJWA 3ASOC 2M64A 3I5PA 4OD4A 4ER9A 1M6TA 2R9RB 3EFOB 1ORYA 3H65A 2XL4A 2P6VA 3AJMA 3QW0A 4RBNA 4YT5A 2HV6A 4MNDA 2J0WA 4OIRF 4YN0B 4AL1A 2YRFA 3HNKA 3X1OA 3GEEA 4LERA 3JYYA 2LSEA 4BPMA 4E0HA 2TMVP 4HEAJ 1I4ZA 4JW1A 2EIMC 4P9FA 3LNRA 3O55A 1TFOB 4CSAA 2VASA 3FAJA 4IJJA 4YL0A 5CI9A 2UUIA 1V74B 3DD7A 3Q6MA 1YYJA 1LI5A 3K7DA 3EGXB 2R7TA 1VYKA 2G62A 1Z3IX 1HW1A 4XEFA 1MMNA 2CCYA 2WZLA 1RJ9A 4NTFA 4EBJA 2R7WA 1K04A 2ASRA 3EGDB 3SZRA 3BRJA 4JRZA 1Q0FA 5HSWA 3L8JA 1A41A 1VMAA 3W2VA 2MWQA 3PCVA 4H54A 2ZXPA 1OXBA 5T1DB 2LD6A 3L0IA 5FCLA 2H7BA 2LIGA 4U5BE 2FAPB 2W4BA 3ZQVA 1CGME 3DZAA 4RDAA 2HSQA 2WVOA 4MVQA 3U2LA 2XXAA 4Q4ZF 1WN0A 1ZHWA 3CZ6A 5KYYB 1OCOC 4CIPA 4QI2A 3DAFA 4GQHA 4DXWA 4JEBA 2ZD9A 1VLSA 2Q9CA 4LACB 2B0JA 2YL0A 1G5ZA 5A6AA 2YZSA 2X51A 2XL8A 1Z7Qc 2MYSA 5BUOA 1UFBA 1A0BA 3H2VA 3UMIA 1HW2A 2R05A 2NUTB 1QVXA 2IBFA 2YQYA 5F28E 2JD3A 1OCZC 2RSEB 1RXQA 1ZZPA 3U2MA 1MNEA 4MS2A 4A2NB 2BE5F 2L6GA 3HLZA 3MYIA 4N4WA 2P61A 4N06A 1JPJA 4U9DA 3KYJA 4KC9A 3US6A 1YARO 1CPQA 2J9WA 2YL7A 3GEHA 4JJFA 3DM9B 1K40A 1XZPA 3IEEA 3TULA 4WABA 1I5NA 2PX3A 1OKKD 3WG7C 4IWBA 256BA 1Q0KA 3DMDA 5JSLA 3ZC4A 1HMDA 1ZYRF 3CQZA 4G7HF 4FX5A 3VYWA 2ZXRA 1D0YA 3T6BA 1ORSC 2AU5A 2Q7RA 4LLCA 4JTCB 2P7VA 3TJ6A 1J8YF 2A0BA 4CDYA 1S05A 1YJGA 2A6EF 2XM0A 4JVSA 2EPKX 2ICWG 2X0CA 2YL1A 3LNMB 2WVNA 2W9YA 4CX9A 5DS6A 1FR0A 1QLEC 3FHDA 2EINC 1ZW2A 5B3SC 1AEPA 4DVYP 4BJ1A 3PDMP 5AGFA 5JP7A 4MTFA 2D4UA 1RJ9B 1DOVA 1JOGA 1KNYA 4U5HA 3GM1A 2Y69C 2YLIA 3GORA 4W8PA 2QY9A 4PK4A 1R4TA 1JR8A 3IQTA 3A9CA 3ZVRA 5JS5A 4Z9JA 3CEXA 3SYNA 4XEVA 3QMKA 4YT8A 4Q5SF 3GODA 2A6HF 2CNWD 2QTVA 1DOWA 3KKBA 5T3WA 3SXMA 4MVRA 3QW1A 4AK9A 1Q0MA 2Q4FA 4NQFA 1H9GA 3QVYA 4EBKA 1IZMA 3U8PA 4C3EA 2XXAB 4OINF 5TJ5E 2OEVA 3F47A 1CGNA 2C03A 2R7UA 3OA1A 4YK5A 4NCQA 3S27A 3FVYA 4JCZA 3T6GB 5JVEA 2J45A 4JTDB 3NKEA 4XTKA 4JE9A 5KYUA 1LS1A 1I4YA 4E0IA 5BQIA 1BR1A 2LQGA 4JJGA 4PJJA 4U5EE 3SXZA 5JT4A 2EIJC 4PFOA 1FMVA 2HS5A 1MMDA 1ZHYA 2AP3A 4EUKB 1D0ZA 5F5FA 2LFFA 3C8GA 3E9VA 2DYSC 2OJQA 4QDLA 4DOZA 3RFYA 4EBBA 3ASNC 4XPYA 3ITFA 3RYLA 5E3AA 3VF0A 3C8ZA 1SR2A 4JTAB 2WB7A 4NTAA 3IQCA 5A6BA 1D1BA 3ATPA 1JPNA 2OKUA 2NSGA 3JRTA 3L1MA 3T6JA 1D1CA 3GEIA 3EHNA 4U5FE 3U5SA 5JLIA 2Y3BA 1C03A 3BEHA 4O6YA 2J0XA 1PD0A 3TOLA 3B71A 5EGYA 2QUPA 2M4EA 2H7OA 1OW8A 1K05A 3NG1A 3UR3C 1LKXA 5A6KA 2R25A 4CBEA 3GANA 1NBBA 2J46A 1ST6A 2Y3HA 4XPXA 1V4AA 2DYRC 2KNHA 1TFKB 4PR9A 4E7ZA 3W8HA 1S7ZA 3DXJF 3PMRA 1WGWA 2HSBA 4FAPB 2ZXOA 4CDAA 3FOPA 4MW3A 4YL1A 3LEVA 3T9OA 1N1CA 4XPWA 3R7CA 4CS8A 2YL3A 4CJGA 2VC9A 2R7XA 1KU2A 1W2WA 3H2UA 1SMYF 3TJ5A 2R7RA 2UUHA 3K66A 4C7OA 2NUPA 4DJ9A 3NMJA 2XS8A 4P9TA 1QQ3A 4CIHA 2QNLA 1U0BB 4BJTA 2EPLX 4YL3A 4LDRA 2FFHA 3AQCA 4ZLCA 4O6NA 2O9XA 3DAGA 3ZG1A 2Q3TA 4Q7CA 2L6FA 4BJ6C 3C18A 3RVZA 3AG3C
chains in the Genus database with same CATH topology
1FR0A 1I5NA 1WN0A 2LCHA 4EUKB 1BDJB 3IQTA 4PACA 2OOCA 1QSPA 1TQGA 1SR2A 2A0BA 2Q4FA 3MYFA 4G78A 1A0BA 3KYIA 1C03A 1YVIA 3U3BA 2LP4A 1OXBA 2LD6A 1Y6DA 2R25A 3US6A 3KYJA 1OXKA 1C02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR0 A;  1I5N A;  1WN0 A;  2LCH A;  4EUK B;  1BDJ B;  3IQT A;  4PAC A;  2OOC A;  1QSP A;  1TQG A;  1SR2 A;  2A0B A;  2Q4F A;  3MYF A;  4G78 A;  1A0B A;  3KYI A;  1C03 A;  1YVI A;  3U3B A;  2LP4 A;  1OXB A;  2LD6 A;  1Y6D A;  2R25 A;  3US6 A;  3KYJ A;  1OXK A;  1C02 A; 
#chains in the Genus database with same CATH topology
 4IAQ A;  3S28 A;  1YZC A;  1T01 A;  2YHS A;  1RCP A;  3G4Z A;  1NU9 C;  1VB5 A;  1VYI A;  2C04 A;  3DM5 A;  3EJN A;  2XLE A;  4P6I C;  1XWJ A;  3LJB A;  5D92 A;  3ZIB A;  2AVK A;  3VRC A;  5B3I A;  1NFO A;  2KW3 C;  2Z15 A;  3TQO A;  2OEX A;  2VB6 A;  2AWC A;  3NKD A;  3V5X A;  4F4B A;  5KYU B;  2KK1 A;  3U0C A;  1O5H A;  2ETS A;  3ZDL A;  1TWH A;  2KC3 A;  3IQ5 A;  3NYL A;  4K1O A;  4R32 A;  3MLG A;  1IW7 F;  5DQZ A;  3UGP A;  3DI5 A;  2LFD A;  1M57 C;  2HKV A;  1E86 A;  2XSE A;  4I44 A;  1BZ4 A;  1M56 C;  3LS0 A;  2GWW A;  5L3Q A;  3C8G B;  2PP4 A;  3JSZ A;  5DVW A;  4FWV A;  3TD7 A;  2YVK A;  4LDQ A;  2XS1 A;  1A7E A;  4MTO A;  1Y4C A;  2W4M A;  1E83 A;  2PBE A;  3UNG C;  4L6R A;  4O79 A;  1E84 A;  3B9Q A;  5EK0 A;  1YZA A;  2BL2 A;  2XRH A;  3QTH A;  5L0H A;  3DE9 A;  3WHN A;  3DKA A;  4D4X A;  2MHR A;  3EZI A;  3G50 A;  4MTG A;  4CS8 C;  1Q0D A;  1NZE A;  2Y3D A;  4NY3 A;  2LCH A;  3EZH A;  3K1I C;  4OD5 A;  5L0I A;  1OCR C;  1JAF A;  1BR4 A;  3LEO A;  3MX3 A;  5COM A;  3K6B A;  3UGO A;  2KQ9 A;  1J8M F;  2CYD A;  1GGQ A;  2ZPA A;  2IM8 A;  3HKK A;  4AE4 A;  5COG A;  4YT4 A;  4DRJ B;  1C17 M;  1VTM P;  1OW7 A;  3KMI A;  1AUE A;  2BC5 A;  2J9B A;  3OWT A;  1WAS A;  1RMV A;  1NSG B;  3SXK A;  2J9V A;  4B6I A;  2L81 A;  4WGY A;  3EHM A;  3JZ0 A;  4O6M A;  1HE9 A;  1YVI A;  2KGO A;  2PNO A;  2VCC A;  3FMS A;  4J7Y A;  1H7I A;  4LDK A;  4J7T A;  4ULV A;  3KL4 A;  3SNH A;  3T4R A;  5IY5 C;  3PHF 2;  2A1D D;  2IOQ A;  3MFN A;  4IAO A;  1EKY A;  1CPR A;  4EHP A;  2OOC A;  3NMI A;  4G0H A;  2KSF A;  4JEA A;  3POV A;  2J9U A;  2NUP B;  1WOL A;  2CW0 F;  3ABK C;  4HFK B;  3RKO F;  4C7O B;  4MVU A;  1UG7 A;  3L34 A;  4EKW A;  1G4W R;  3RF3 A;  3ZWI A;  5L3V A;  5A69 A;  1TQG A;  1O87 A;  4OIO F;  2Q9A A;  2XLV A;  3M1C B;  3L8I A;  1T6Q A;  3MYF A;  3Q7L A;  2R02 A;  2R7Q A;  3TK0 A;  4PJL A;  3FDQ A;  4KNV A;  4EWC A;  1MMG A;  1T6I A;  1B68 A;  3V7O A;  3UMH A;  3V5Y A;  4BG0 A;  2GA0 A;  2H7V C;  3KPH A;  3EGX A;  3DWW A;  3AQB A;  3FAP B;  3M79 A;  1Z63 A;  4WGZ A;  1NU7 D;  3TOM A;  3S29 A;  2HV7 A;  3NYJ A;  5COF A;  1EI7 A;  4YT2 A;  4LLE A;  2NG1 A;  1GS9 A;  4DRI B;  4CS9 C;  1HE1 A;  1F1M A;  1TWG A;  3JSE O;  1A7D A;  2Q00 A;  4OIP F;  4PJN A;  1YA9 A;  3NDB B;  2IXN A;  4EIY A;  1M2O A;  1BDJ B;  4MW8 A;  4IAR A;  2HMQ A;  3SEO A;  2NPU A;  4BJ6 A;  4MVZ A;  2I15 A;  5CIV A;  3SXY A;  5BQH A;  3RH3 A;  3AG1 C;  3C8G D;  1FFH A;  2WZF A;  5D91 A;  4H4K C;  2HFI A;  1SZI A;  4PJM A;  4DRH B;  5L0F A;  3KYI A;  4JKV A;  5KYW A;  1RKE A;  3JT1 A;  2H8A A;  1EQ1 A;  3LAY A;  2OCC C;  5A6B D;  3EPV A;  1WAT A;  3S9O A;  5CI8 A;  2W45 A;  4E18 A;  3LES A;  2QLA A;  4AE4 B;  5HV9 A;  1SYQ A;  1VK5 A;  3GM3 A;  5L0G A;  2J7P A;  1LI7 A;  5E3C A;  3AOU A;  1FNT c;  2CGE A;  2G3V A;  3NMK A;  1U6H A;  3WAQ A;  1D1A A;  1FMW A;  3C62 A;  1NLX A;  3IHU A;  3RQF A;  2IXO A;  1MMA A;  2EPM X;  4K7B A;  3RW0 A;  2XLO A;  2IYL D;  2XM4 A;  4XLP F;  4XWJ A;  3LLI A;  2YEV A;  4ONS A;  3ABL C;  2G3K A;  5JRA A;  4MQ9 F;  4DBR A;  4MVM A;  3GM2 A;  4I3M A;  3HJC A;  3RQG A;  1V54 C;  2FGY A;  3GWN A;  3A11 A;  3K1I A;  4ULW A;  5BQG A;  3VM6 A;  2OJE D;  1TR2 A;  3AG2 C;  4C3B A;  3N2Z B;  2VCA A;  4CS7 A;  3QZC A;  4XLN F;  1JMW A;  4HFF B;  2F22 A;  3EG9 A;  2J8W A;  1MQV A;  1OQC A;  1LM3 B;  2LP4 A;  3LUT B;  4IRU A;  1Q0G A;  4XQ1 A;  1NG1 A;  5L0D A;  3RVY A;  1OR2 A;  1FFT C;  3IQ6 A;  2L9J A;  1ORJ A;  1QPU A;  1G4U S;  2IXM A;  3EQL F;  2A69 F;  1M2V A;  5GPG B;  4DVZ A;  5DLJ A;  1LIH A;  1QZX A;  2GDC A;  4JUR I;  2PF4 E;  3OEO A;  4BEM J;  1BR2 A;  3O10 A;  2GAQ A;  3ZSU A;  1LE4 A;  4J30 B;  5KYX A;  4NTB A;  3JYH A;  4ZLD A;  4U9E A;  2D5R B;  1ZHZ A;  2R03 A;  2R7O A;  1YAU O;  2EIL C;  4I1O B;  4CJO A;  4UDV A;  4JCH A;  1Z23 A;  1O3U A;  3UMK A;  1E2X A;  2PX0 A;  4JIO A;  3HTK C;  3CAX A;  3HNL A;  3DE8 A;  2GFH A;  3N0T A;  2DI3 A;  4C3D A;  4BEJ A;  1OR3 A;  2OG2 A;  4NC3 A;  3S90 A;  2QE9 A;  4ANJ A;  3C7J A;  3M15 A;  1MND A;  1XZQ A;  2DB4 A;  2EPO A;  1LVK A;  2WZG A;  3NYM A;  4MVS A;  4O7G A;  4BJ5 C;  2V3C C;  5B1A C;  5T3T A;  5KYW B;  1RKE B;  1ZHX A;  5E33 A;  1LPE A;  1V55 C;  4CS9 A;  3O6X A;  2XLM A;  3KH2 A;  2LK4 A;  4GEH A;  1BBH A;  2XLD A;  2YWA A;  2Q9B A;  1OCC C;  3M4B A;  1G8X A;  2A0U A;  4CDV A;  2XLW A;  2EPN A;  1YA7 O;  2XLH A;  3FOO A;  1D0X A;  3N24 A;  2B0H A;  2HJ3 A;  3B0P A;  3QVZ A;  3ABM C;  3W8I A;  1H9T A;  2NSF A;  3JCU Q;  5F5H A;  3AGU A;  4MVO A;  2P0N A;  2CDQ A;  2Y39 A;  3LLK A;  3Q7G A;  1OKK A;  4J32 B;  4CSA C;  3HNI A;  1VOM A;  3W2W A;  1L7C A;  1Y6D A;  3G4X A;  5B1B C;  4AL0 A;  2R7S A;  1TKN A;  3RQE A;  2JX0 A;  2HZ8 A;  3LS1 A;  1OXK A;  1PV3 A;  1ZHT A;  1T9K A;  4XEK A;  2HUJ A;  1QKR A;  3EFO A;  3K33 A;  1JRA A;  3FXH A;  3B0V C;  3DJN B;  2JPU A;  3W4Y A;  4JZA A;  2RD9 A;  1LE2 A;  4RD9 A;  1ZW3 A;  4W8K A;  1E85 A;  1FAP B;  3NRH A;  3EG9 B;  4U5C E;  3U9M A;  4Z9I A;  3WOD F;  4Z9H A;  4KNW A;  3I4U A;  4OIQ F;  4HE8 D;  1YYX A;  3C63 A;  4U5G A;  5JUA A;  2ZXW C;  3AGT A;  3ECS A;  2WVQ A;  3O39 A;  1Z6A A;  5A6J A;  5DS4 A;  1M2V B;  1L3P A;  3DJU B;  5AC5 A;  1FTS A;  3EH2 A;  1GM5 A;  1TWC A;  2L7A A;  1EA8 A;  3B0U X;  3X2Q C;  5K0I A;  2R7V A;  2P1A A;  1H6G A;  5L0C A;  2E87 A;  1T5O A;  2YKZ A;  4AX2 A;  3EH1 A;  2VH3 A;  4I1M A;  2OU6 A;  5KYX B;  1LS4 A;  3I5Q A;  3EGD A;  4PFP A;  2CNW A;  1ZVZ A;  1HMO A;  1Z5Z A;  1NFN A;  3V5Z A;  1TWA A;  1U89 A;  3RIP A;  3U8V A;  1OW6 A;  1GQA A;  4DBQ A;  5L0J A;  3VAY A;  3JTL O;  1WWP A;  3S0X A;  2YLG A;  1T6U A;  4X0R A;  2A68 F;  1ZU5 A;  1YDI A;  1HY5 A;  3E70 C;  4G7Z F;  3ZQY A;  1A7V A;  4E17 A;  2WL8 A;  4D4N A;  1R5I D;  4K0D A;  4U5D E;  5E2Q A;  2KJG A;  2PFD A;  2YLD A;  3Q6N A;  3ZTM A;  2DGJ A;  4A4A A;  3J06 A;  1YLM A;  2V26 A;  1APC A;  3GWL A;  5KYY A;  5DS5 A;  3F46 A;  1SF8 A;  1PD1 A;  2VCB A;  4KBL A;  2IXP A;  2Y3G A;  4M63 A;  1AVO B;  3U3B A;  1VLT A;  2OQM A;  3SP1 A;  1KTM A;  5FZT A;  3K1H A;  1ZU4 A;  2KYH A;  1WTY A;  4YWQ A;  3AG4 C;  3M4C A;  1C02 A;  4E7S A;  2XL6 A;  4IB4 A;  2L6H A;  2NUT A;  2HMZ A;  3HNJ A;  1PCX A;  4N6C A;  2EIK C;  4GYT A;  4G7O F;  5EHH A;  3B29 A;  1RKC A;  4WJ0 A;  5DQT A;  5AC4 A;  5KYN A;  3S84 A;  3IPM O;  3ZTZ A;  4PAC A;  4QI0 A;  1QSP A;  3U3F A;  2AWY A;  2J7P D;  3R2P A;  4FES A;  4N6H A;  2I8B A;  4JC7 A;  3U9J A;  3MBG A;  2HJM A;  4G78 A;  4BJ5 A;  4KI2 A;  3CSK A;  3JRM O;  1CGO A;  4IGG A;  4YJW A;  3ASO C;  2M64 A;  3I5P A;  4OD4 A;  4ER9 A;  1M6T A;  2R9R B;  3EFO B;  1ORY A;  3H65 A;  2XL4 A;  2P6V A;  3AJM A;  3QW0 A;  4RBN A;  4YT5 A;  2HV6 A;  4MND A;  2J0W A;  4OIR F;  4YN0 B;  4AL1 A;  2YRF A;  3HNK A;  3X1O A;  3GEE A;  4LER A;  3JYY A;  2LSE A;  4BPM A;  4E0H A;  2TMV P;  4HEA J;  1I4Z A;  4JW1 A;  2EIM C;  4P9F A;  3LNR A;  3O55 A;  1TFO B;  4CSA A;  2VAS A;  3FAJ A;  4IJJ A;  4YL0 A;  5CI9 A;  2UUI A;  1V74 B;  3DD7 A;  3Q6M A;  1YYJ A;  1LI5 A;  3K7D A;  3EGX B;  2R7T A;  1VYK A;  2G62 A;  1Z3I X;  1HW1 A;  4XEF A;  1MMN A;  2CCY A;  2WZL A;  1RJ9 A;  4NTF A;  4EBJ A;  2R7W A;  1K04 A;  2ASR A;  3EGD B;  3SZR A;  3BRJ A;  4JRZ A;  1Q0F A;  5HSW A;  3L8J A;  1A41 A;  1VMA A;  3W2V A;  2MWQ A;  3PCV A;  4H54 A;  2ZXP A;  1OXB A;  5T1D B;  2LD6 A;  3L0I A;  5FCL A;  2H7B A;  2LIG A;  4U5B E;  2FAP B;  2W4B A;  3ZQV A;  1CGM E;  3DZA A;  4RDA A;  2HSQ A;  2WVO A;  4MVQ A;  3U2L A;  2XXA A;  4Q4Z F;  1WN0 A;  1ZHW A;  3CZ6 A;  5KYY B;  1OCO C;  4CIP A;  4QI2 A;  3DAF A;  4GQH A;  4DXW A;  4JEB A;  2ZD9 A;  1VLS A;  2Q9C A;  4LAC B;  2B0J A;  2YL0 A;  1G5Z A;  5A6A A;  2YZS A;  2X51 A;  2XL8 A;  1Z7Q c;  2MYS A;  5BUO A;  1UFB A;  1A0B A;  3H2V A;  3UMI A;  1HW2 A;  2R05 A;  2NUT B;  1QVX A;  2IBF A;  2YQY A;  5F28 E;  2JD3 A;  1OCZ C;  2RSE B;  1RXQ A;  1ZZP A;  3U2M A;  1MNE A;  4MS2 A;  4A2N B;  2BE5 F;  2L6G A;  3HLZ A;  3MYI A;  4N4W A;  2P61 A;  4N06 A;  1JPJ A;  4U9D A;  3KYJ A;  4KC9 A;  3US6 A;  1YAR O;  1CPQ A;  2J9W A;  2YL7 A;  3GEH A;  4JJF A;  3DM9 B;  1K40 A;  1XZP A;  3IEE A;  3TUL A;  4WAB A;  1I5N A;  2PX3 A;  1OKK D;  3WG7 C;  4IWB A;  256B A;  1Q0K A;  3DMD A;  5JSL A;  3ZC4 A;  1HMD A;  1ZYR F;  3CQZ A;  4G7H F;  4FX5 A;  3VYW A;  2ZXR A;  1D0Y A;  3T6B A;  1ORS C;  2AU5 A;  2Q7R A;  4LLC A;  4JTC B;  2P7V A;  3TJ6 A;  1J8Y F;  2A0B A;  4CDY A;  1S05 A;  1YJG A;  2A6E F;  2XM0 A;  4JVS A;  2EPK X;  2ICW G;  2X0C A;  2YL1 A;  3LNM B;  2WVN A;  2W9Y A;  4CX9 A;  5DS6 A;  1FR0 A;  1QLE C;  3FHD A;  2EIN C;  1ZW2 A;  5B3S C;  1AEP A;  4DVY P;  4BJ1 A;  3PDM P;  5AGF A;  5JP7 A;  4MTF A;  2D4U A;  1RJ9 B;  1DOV A;  1JOG A;  1KNY A;  4U5H A;  3GM1 A;  2Y69 C;  2YLI A;  3GOR A;  4W8P A;  2QY9 A;  4PK4 A;  1R4T A;  1JR8 A;  3IQT A;  3A9C A;  3ZVR A;  5JS5 A;  4Z9J A;  3CEX A;  3SYN A;  4XEV A;  3QMK A;  4YT8 A;  4Q5S F;  3GOD A;  2A6H F;  2CNW D;  2QTV A;  1DOW A;  3KKB A;  5T3W A;  3SXM A;  4MVR A;  3QW1 A;  4AK9 A;  1Q0M A;  2Q4F A;  4NQF A;  1H9G A;  3QVY A;  4EBK A;  1IZM A;  3U8P A;  4C3E A;  2XXA B;  4OIN F;  5TJ5 E;  2OEV A;  3F47 A;  1CGN A;  2C03 A;  2R7U A;  3OA1 A;  4YK5 A;  4NCQ A;  3S27 A;  3FVY A;  4JCZ A;  3T6G B;  5JVE A;  2J45 A;  4JTD B;  3NKE A;  4XTK A;  4JE9 A;  5KYU A;  1LS1 A;  1I4Y A;  4E0I A;  5BQI A;  1BR1 A;  2LQG A;  4JJG A;  4PJJ A;  4U5E E;  3SXZ A;  5JT4 A;  2EIJ C;  4PFO A;  1FMV A;  2HS5 A;  1MMD A;  1ZHY A;  2AP3 A;  4EUK B;  1D0Z A;  5F5F A;  2LFF A;  3C8G A;  3E9V A;  2DYS C;  2OJQ A;  4QDL A;  4DOZ A;  3RFY A;  4EBB A;  3ASN C;  4XPY A;  3ITF A;  3RYL A;  5E3A A;  3VF0 A;  3C8Z A;  1SR2 A;  4JTA B;  2WB7 A;  4NTA A;  3IQC A;  5A6B A;  1D1B A;  3ATP A;  1JPN A;  2OKU A;  2NSG A;  3JRT A;  3L1M A;  3T6J A;  1D1C A;  3GEI A;  3EHN A;  4U5F E;  3U5S A;  5JLI A;  2Y3B A;  1C03 A;  3BEH A;  4O6Y A;  2J0X A;  1PD0 A;  3TOL A;  3B71 A;  5EGY A;  2QUP A;  2M4E A;  2H7O A;  1OW8 A;  1K05 A;  3NG1 A;  3UR3 C;  1LKX A;  5A6K A;  2R25 A;  4CBE A;  3GAN A;  1NBB A;  2J46 A;  1ST6 A;  2Y3H A;  4XPX A;  1V4A A;  2DYR C;  2KNH A;  1TFK B;  4PR9 A;  4E7Z A;  3W8H A;  1S7Z A;  3DXJ F;  3PMR A;  1WGW A;  2HSB A;  4FAP B;  2ZXO A;  4CDA A;  3FOP A;  4MW3 A;  4YL1 A;  3LEV A;  3T9O A;  1N1C A;  4XPW A;  3R7C A;  4CS8 A;  2YL3 A;  4CJG A;  2VC9 A;  2R7X A;  1KU2 A;  1W2W A;  3H2U A;  1SMY F;  3TJ5 A;  2R7R A;  2UUH A;  3K66 A;  4C7O A;  2NUP A;  4DJ9 A;  3NMJ A;  2XS8 A;  4P9T A;  1QQ3 A;  4CIH A;  2QNL A;  1U0B B;  4BJT A;  2EPL X;  4YL3 A;  4LDR A;  2FFH A;  3AQC A;  4ZLC A;  4O6N A;  2O9X A;  3DAG A;  3ZG1 A;  2Q3T A;  4Q7C A;  2L6F A;  4BJ6 C;  3C18 A;  3RVZ A;  3AG3 C; 
#chains in the Genus database with same CATH homology
 1FR0 A;  1I5N A;  1WN0 A;  2LCH A;  4EUK B;  1BDJ B;  3IQT A;  4PAC A;  2OOC A;  1QSP A;  1TQG A;  1SR2 A;  2A0B A;  2Q4F A;  3MYF A;  4G78 A;  1A0B A;  3KYI A;  1C03 A;  1YVI A;  3U3B A;  2LP4 A;  1OXB A;  2LD6 A;  1Y6D A;  2R25 A;  3US6 A;  3KYJ A;  1OXK A;  1C02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...