4PACA

Crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
153
Chain Sequence
MEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-containing phosphotransfer protein 2
publication title Crystal structure of AHP2 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 68
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4pacA00
1BDJB 2R25A 3MYFA 3U3BA 1I5NA 4EUKB 2OOCA 1OXKA 3KYJA 2LD6A 4G78A 2LCHA 2Q4FA 1TQGA 2A0BA 1SR2A 4PACA 1OXBA 3IQTA 3KYIA 1A0BA 1WN0A 1C02A 3US6A 1QSPA 2LP4A 1C03A 1YVIA 1FR0A 1Y6DA
chains in the Genus database with same CATH superfamily
4DVYP 3IQCA 3LESA 4X0RA 2PFDA 3KH2A 2YQYA 2QY9A 3Q7GA 4XTKA 3SXZA 5A6BD 4OIPF 3M4CA 2R7VA 1LM3B 2HMQA 1RKCA 3HKKA 3ZQYA 2Y3HA 4OD5A 5JP7A 1A7VA 4HE8D 4YL1A 4XEFA 5KYYB 3Q6NA 3IEEA 3C8GD 4DOZA 5KYNA 2P6VA 1A41A 4CSAC 1LPEA 3U9MA 3ZQVA 2OJED 3AJMA 3S29A 4C7OB 1QPUA 1NG1A 3AQCA 5EGYA 2J7PA 2DB4A 5L0HA 3LS1A 2YL3A 2HJ3A 2IXOA 1VYKA 1JRAA 3EGXA 1W2WA 2IXMA 2J0WA 2O9XA 1TWAA 2R7OA 3RFYA 4DRJB 3JTLO 3NDBB 2BL2A 3UMHA 4YL3A 2XLWA 5JUAA 5EHHA 1CGME 4U5CE 3NYJA 2F22A 2EPKX 5L0JA 1M2VB 1WOLA 1Z3IX 2YZSA 1NU7D 3CZ6A 1B68A 3B0VC 1ZVZA 2Q9CA 2J9VA 5KYYA 3PHF2 1XWJA 3W8HA 3FDQA 3W2WA 4C7OA 4P6IC 5L3VA 1CGNA 1AVOB 4YN0B 4K7BA 3UGOA 4LLEA 3VF0A 2E87A 3CSKA 4NTAA 2XLMA 5E33A 4OINF 1RXQA 3Q7LA 2GA0A 2P7VA 5HSWA 3S90A 4J32B 1C17M 2R9RB 3B0UX 1OCOC 1ZW3A 1QSPA 1C03A 1NFNA 4MQ9F 4WJ0A 5A6BA 2A69F 3JRTA 4WGYA 5A69A 1M2VA 2EIJC 1H9GA 2Q7RA 1Q0KA 4AK9A 1VMAA 4CS8A 3C8GA 2QE9A 1MNEA 4O6NA 3X1OA 3DE8A 1VK5A 3JSZA 1U0BB 1Z5ZA 5DLJA 1JAFA 2V26A 4XPXA 2J0XA 2W4MA 4RD9A 1RMVA 3JYHA 1RKEA 3C63A 4U9EA 5BUOA 4M63A 4CIPA 2PBEA 5B3SC 3HNJA 2G62A 4N06A 1Z23A 2YL1A 3TOMA 3FVYA 4I3MA 5JS5A 5A6JA 4LDQA 1OQCA 3OWTA 1WN0A 4HFFB 1FTSA 1G4WR 3L34A 1O5HA 3O10A 4N6HA 1YARO 2M4EA 4U5BE 1J8MF 4JURI 4JJFA 1JPNA 256BA 3ITFA 3N24A 4O6MA 1F1MA 1KNYA 2H7BA 4AE4B 4AL0A 3S84A 4IRUA 2XRHA 2L9JA 4JTAB 3EFOA 4CJGA 4LACB 1WGWA 5COFA 2GFHA 1YA7O 4OD4A 2KK1A 5E3CA 4E18A 2R25A 1FMVA 2XS1A 3LAYA 3QVYA 2Y39A 5F5FA 3K1IA 4BEJA 3QVZA 4BEMJ 4GQHA 2ZXRA 1SMYF 1FMWA 3OA1A 4LDKA 3EZHA 2NG1A 4FX5A 4JE9A 1MMNA 2MWQA 2J9WA 3EG9B 3KYJA 4MW3A 2WL8A 1JOGA 3QW0A 3W8IA 2FFHA 1YA9A 1ZW2A 1ZHYA 2EPMX 1A7DA 3ZWIA 4U5EE 2Q9BA 2QUPA 4F4BA 3UR3C 3V5XA 3ZTZA 4KNWA 1LS4A 2BC5A 2XM4A 3DI5A 4XPWA 2J9UA 2OKUA 3X2QC 3IQ5A 4AE4A 1ZHTA 1APCA 3K1HA 2KGOA 1D0XA 2J7PD 2YVKA 1OR3A 4JEAA 1EI7A 5DS5A 5KYUB 3DKAA 2A6EF 4UDVA 1EQ1A 2H7OA 2B0JA 2EPLX 1L7CA 5JT4A 5L0CA 3B9QA 2R7QA 1D0ZA 2KYHA 4I1MA 1E2XA 3U8VA 1CGOA 1EA8A 4NC3A 2DI3A 4GYTA 2XL6A 2B0HA 1E85A 2OEVA 3EG9A 3NYMA 4LDRA 1GQAA 2OEXA 5L0FA 5GPGB 1M57C 3UMKA 1T6IA 3AG1C 2XXAB 4ULVA 1RJ9A 3IQTA 3OEOA 5E2QA 4IARA 3RVYA 1GS9A 4CDYA 4FAPB 4XLPF 4K1OA 1O3UA 2V3CC 4BG0A 1IZMA 3O39A 4ER9A 5K0IA 3O6XA 3U0CA 2ZXPA 4G0HA 2HSQA 4J7YA 2IM8A 3AG2C 4CS8C 2R7TA 3S9OA 1OW6A 3NKDA 4XEKA 4EWCA 2EPNA 1YYXA 1O87A 4E0IA 2LFFA 2CDQA 5JSLA 2QTVA 2GAQA 3U9JA 2I15A 2W9YA 4YT4A 4EBKA 2Y3BA 1HE1A 1I4YA 4P9TA 3JYYA 3CQZA 4MW8A 3SNHA 1H9TA 2HFIA 2VCAA 3C18A 4IGGA 2IOQA 4IB4A 2XL4A 1OCRC 2XS8A 5COGA 1VLTA 2KJGA 4PR9A 1V55C 1YLMA 4CDAA 3U5SA 2FAPB 4DBQA 3HNIA 3DMDA 2ZXOA 3TOLA 3V5ZA 5T3WA 1JMWA 4AX2A 2C03A 4ULWA 1LI5A 3ZTMA 3R7CA 2CW0F 2YL0A 1VB5A 1T6UA 4NTFA 4AL1A 2HS5A 3T6JA 4XEVA 3TULA 2NUTB 4JTDB 3L0IA 2PP4A 3K1IC 2NSFA 1NU9C 5FZTA 3SXMA 5F5HA 5KYWB 2JX0A 4W8KA 4U5HA 3TJ6A 4MVQA 3A11A 3K66A 1D0YA 2JPUA 2R7XA 2XSEA 4DRHB 3M79A 1LVKA 1V74B 3DAFA 4BPMA 4H54A 4ZLDA 2WVOA 1MMGA 4JZAA 2CGEA 3M4BA 4NCQA 2YLGA 1UFBA 5D91A 2YL7A 3JCUQ 1OXBA 4MVRA 1T9KA 1ZZPA 3DD7A 1Q0MA 3QMKA 3JRMO 3TJ5A 2PF4E 3HNKA 2P61A 4Q5SF 1K40A 1OR2A 3LNMB 4KNVA 2NUTA 3JT1A 2KNHA 3FHDA 1ZHWA 3FOOA 3EHMA 4GEHA 3SP1A 3SXYA 2EPOA 4PK4A 4U9DA 3ZG1A 4MS2A 4BJ6C 4PJLA 4XPYA 2R05A 3SEOA 1Z63A 1M56C 2OU6A 1BR1A 2MHRA 3G4XA 2RSEB 2VCCA 3BEHA 1OXKA 2M64A 3G4ZA 3KKBA 3SYNA 1JPJA 5CI9A 3K7DA 5DQZA 1TFKB 3GODA 2D5RB 4PACA 1QLEC 3WODF 1SYQA 1ZHXA 3GM1A 1XZPA 3IHUA 2VCBA 3WHNA 4A4AA 5DS4A 4IAQA 1BR2A 2RD9A 3EHNA 2LP4A 5JVEA 3AOUA 2HZ8A 2EIKC 3AGUA 3T6BA 4G7HF 2LFDA 3U8PA 1Y6DA 4JVSA 2HMZA 4L6RA 4E7SA 1GM5A 4LERA 5AGFA 3AQBA 2A68F 1YJGA 3I5QA 4NQFA 4LLCA 1WTYA 3I5PA 4BJ5A 2ASRA 2AU5A 2HV6A 2YLIA 4WGZA 4B6IA 4CIHA 2J46A 4IAOA 1HW1A 2WVNA 2X51A 5T1DB 4EHPA 1CPRA 2G3KA 3MX3A 2DYSC 3RIPA 2L7AA 5CI8A 3NG1A 2XLHA 4JJGA 1NFOA 3B0PA 3DAGA 3S28A 2Q4FA 3EPVA 2YLDA 2C04A 1G4US 3GANA 3KMIA 2VC9A 4NTBA 3T9OA 4YWQA 1FNTc 2HSBA 1S05A 2ICWG 3KYIA 3H65A 1ORSC 4JIOA 3A9CA 3ZSUA 1Z7Qc 2X0CA 4BJ1A 3EQLF 1H7IA 1C02A 1D1BA 4E0HA 1MMDA 4ONSA 2CNWA 3DZAA 2R7UA 4XWJA 3FOPA 3VRCA 3GWLA 3SXKA 3JZ0A 1UG7A 1WASA 3HLZA 4W8PA 2EILC 1BDJB 4MTGA 2NUPB 2ZPAA 3U3BA 4U5GA 2IXNA 2KSFA 4C3DA 3N0TA 4XQ1A 1D1CA 4O7GA 4ZLCA 1TWCA 1HY5A 2EIMC 1QZXA 2WZLA 3EZIA 1OKKA 4PFOA 2R02A 3UMIA 3L8JA 2IYLD 2OQMA 2QLAA 4NY3A 1TFOB 1YZAA 4G7ZF 4MTFA 4ANJA 3L8IA 1PCXA 3S27A 3GM3A 3FXHA 5CIVA 4DVZA 4OIRF 5HV9A 3K6BA 2OCCC 1KU2A 2Y69C 3H2UA 3HTKC 4JTCB 4DXWA 3RQFA 2LK4A 5L0DA 1SF8A 2JD3A 3KL4A 4I44A 3DJUB 1BR4A 1CPQA 1G5ZA 2DYRC 5KYUA 4CS9A 1KTMA 3EH2A 2KQ9A 3N2ZB 1T6QA 2I8BA 5BQHA 4MVZA 1Z6AA 2Y3GA 4YJWA 3B71A 3TD7A 4N6CA 2DGJA 3ATPA 3GEHA 4KBLA 1U6HA 2Q9AA 4H4KC 5F28E 4BJTA 1AEPA 3WAQA 1HMOA 2ETSA 3DE9A 5JLIA 2R7RA 1SZIA 4XLNF 3EJNA 1JR8A 3GEIA 1ZHZA 5B1AC 3V7OA 3GORA 2H8AA 4JC7A 3TK0A 2IBFA 2A0BA 4C3BA 2VH3A 2QNLA 4YK5A 2XXAA 2Z15A 4C3EA 4CS7A 3RQGA 3SZRA 2J45A 4Q4ZF 2LIGA 3PCVA 2BE5F 3DJNB 1NBBA 2PNOA 3WG7C 4FESA 2R7WA 4BJ5C 4N4WA 3RYLA 3VYWA 3T6GB 2XLOA 4QDLA 3E70C 2R7SA 2WB7A 2L81A 4CBEA 2IXPA 1LIHA 2TMVP 5D92A 2HKVA 3H2VA 3GEEA 3NRHA 3DM5A 1K05A 1QQ3A 4JRZA 3VAYA 1LS1A 1R5ID 4QI2A 3NYLA 4CDVA 1FFTC 4YT8A 4A2NB 1OCCC 3EGDB 3CEXA 2NSGA 3PMRA 4IJJA 1OW8A 3J06A 4G78A 2LD6A 3VM6A 3LUTB 1L3PA 1H6GA 4RBNA 3RH3A 1SR2A 4JCZA 4P9FA 1BBHA 4JEBA 2J9BA 5DVWA 3C62A 3FMSA 2YKZA 3NMIA 4RDAA 2ZD9A 3RF3A 1LE4A 3ASOC 1VOMA 5DQTA 4E7ZA 2P0NA 3LLIA 2YEVA 1WWPA 3MBGA 4YT2A 2D4UA 3ABMC 1M2OA 1V54C 3BRJA 2LSEA 4DRIB 5KYXB 1Q0GA 1Y4CA 1N1CA 1NSGB 1MNDA 5KYWA 2A6HF 1S7ZA 1LE2A 1PD0A 3UNGC 1VTMP 1Q0DA 1LI7A 3E9VA 1FAPB 4PJJA 5COMA 4Z9IA 2YHSA 5E3AA 2UUIA 1U89A 3C8GB 2Q00A 3LEVA 3ZIBA 2CNWD 3W4YA 3EGDA 3ZVRA 2UUHA 2OOCA 3ASNC 2ZXWC 3RVZA 3O55A 3Q6MA 4Z9JA 1RKEB 1HE9A 1PD1A 3U2MA 1OW7A 4J30B 1I4ZA 2LCHA 3AG3C 3DM9B 4QI0A 1TQGA 2WZGA 2R03A 1A7EA 3G50A 3PDMP 1OKKD 4CS9C 1R4TA 5BQIA 3C8ZA 4JCHA 4MTOA 5FCLA 3GWNA 3HNLA 3FAPB 5EK0A 4EKWA 3LS0A 1YDIA 4PJMA 5KYXA 1HW2A 4OIOF 5JRAA 2EINC 1E84A 1VYIA 2VB6A 3ZC4A 4MVSA 3EFOB 1TWHA 3RQEA 3UGPA 3T4RA 4KC9A 2HUJA 2W4BA 3LJBA 4MNDA 4O6YA 4E17A 2L6HA 2YRFA 1NZEA 3GM2A 4HEAJ 4YL0A 4CJOA 4WABA 1GGQA 4Q7CA 1MQVA 4DBRA 1Q0FA 1ZU5A 4D4NA 1LKXA 3QTHA 1TR2A 2L6FA 3QZCA 4EBBA 4CSAA 3ABKC 2AWCA 2MYSA 4JKVA 2WVQA 5TJ5E 1A0BA 3S0XA 2W45A 3EH1A 3MYIA 1ORYA 1DOVA 1NLXA 5B1BC 3AGTA 2XM0A 2Q3TA 4DJ9A 4G7OF 4O79A 4EIYA 2VASA 1ZU4A 2GDCA 4OIQF 4JW1A 5AC5A 1ST6A 2PX3A 4MVMA 2OJQA 4PJNA 2G3VA 1TKNA 1QKRA 1E83A 2XLEA 2PX0A 2AP3A 3R2PA 3LEOA 3TQOA 1J8YF 3IQ6A 1E86A 3DWWA 1M6TA 4MVUA 2XLVA 3L1MA 5BQGA 3M1CB 5IY5C 2XLDA 3AG4C 3IPMO 3W2VA 1OCZC 3LLKA 1ORJA 5DS6A 3B29A 2KW3C 3FAJA 1T01A 2FGYA 1RJ9B 3NMJA 3M15A 3V5YA 1EKYA 2NPUA 2GWWA 4D4XA 3C7JA 5A6KA 1DOWA 2XL8A 1T5OA 1IW7F 3JSEO 1FFHA 1RCPA 1G8XA 4R32A 2YWAA 3DXJF 1HMDA 5L0GA 2H7VC 2Y3DA 3MLGA 1YYJA 5B3IA 2HJMA 4HFKB 1WATA 4PFPA 3F47A 2OG2A 2NUPA 3MYFA 3HJCA 4U5DE 2A0UA 4J7TA 2L6GA 5A6AA 4MVOA 1I5NA 2CYDA 1ZYRF 2J8WA 1YAUO 2A1DD 3I4UA 4EUKB 1AUEA 5AC4A 3LNRA 1YZCA 3F46A 2CCYA 1K04A 3MFNA 2AWYA 3U2LA 4BJ6A 3ECSA 1MMAA 3CAXA 1BZ4A 2WZFA 3QW1A 5L0IA 5L3QA 3K33A 1QVXA 1XZQA 4KI2A 4K0DA 4FWVA 3RW0A 2HV7A 4U5FE 5T3TA 4CX9A 2KC3A 4YT5A 3US6A 4IWBA 3RKOF 1VLSA 1YVIA 3KPHA 3EGXB 1D1AA 4I1OB 2LQGA 1FR0A 4Z9HA 2P1AA 1TWGA 2AVKA 1V4AA 1PV3A 3NKEA 3NMKA 4EBJA 3POVA 3U3FA 3ZDLA 3ABLC
chains in the Genus database with same CATH topology
1BDJB 2R25A 3MYFA 3U3BA 1I5NA 4EUKB 2OOCA 1OXKA 3KYJA 2LD6A 4G78A 2LCHA 2Q4FA 1TQGA 2A0BA 1SR2A 4PACA 1OXBA 3IQTA 3KYIA 1A0BA 1WN0A 1C02A 3US6A 1QSPA 2LP4A 1C03A 1YVIA 1FR0A 1Y6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDJ B;  2R25 A;  3MYF A;  3U3B A;  1I5N A;  4EUK B;  2OOC A;  1OXK A;  3KYJ A;  2LD6 A;  4G78 A;  2LCH A;  2Q4F A;  1TQG A;  2A0B A;  1SR2 A;  4PAC A;  1OXB A;  3IQT A;  3KYI A;  1A0B A;  1WN0 A;  1C02 A;  3US6 A;  1QSP A;  2LP4 A;  1C03 A;  1YVI A;  1FR0 A;  1Y6D A; 
#chains in the Genus database with same CATH topology
 4DVY P;  3IQC A;  3LES A;  4X0R A;  2PFD A;  3KH2 A;  2YQY A;  2QY9 A;  3Q7G A;  4XTK A;  3SXZ A;  5A6B D;  4OIP F;  3M4C A;  2R7V A;  1LM3 B;  2HMQ A;  1RKC A;  3HKK A;  3ZQY A;  2Y3H A;  4OD5 A;  5JP7 A;  1A7V A;  4HE8 D;  4YL1 A;  4XEF A;  5KYY B;  3Q6N A;  3IEE A;  3C8G D;  4DOZ A;  5KYN A;  2P6V A;  1A41 A;  4CSA C;  1LPE A;  3U9M A;  3ZQV A;  2OJE D;  3AJM A;  3S29 A;  4C7O B;  1QPU A;  1NG1 A;  3AQC A;  5EGY A;  2J7P A;  2DB4 A;  5L0H A;  3LS1 A;  2YL3 A;  2HJ3 A;  2IXO A;  1VYK A;  1JRA A;  3EGX A;  1W2W A;  2IXM A;  2J0W A;  2O9X A;  1TWA A;  2R7O A;  3RFY A;  4DRJ B;  3JTL O;  3NDB B;  2BL2 A;  3UMH A;  4YL3 A;  2XLW A;  5JUA A;  5EHH A;  1CGM E;  4U5C E;  3NYJ A;  2F22 A;  2EPK X;  5L0J A;  1M2V B;  1WOL A;  1Z3I X;  2YZS A;  1NU7 D;  3CZ6 A;  1B68 A;  3B0V C;  1ZVZ A;  2Q9C A;  2J9V A;  5KYY A;  3PHF 2;  1XWJ A;  3W8H A;  3FDQ A;  3W2W A;  4C7O A;  4P6I C;  5L3V A;  1CGN A;  1AVO B;  4YN0 B;  4K7B A;  3UGO A;  4LLE A;  3VF0 A;  2E87 A;  3CSK A;  4NTA A;  2XLM A;  5E33 A;  4OIN F;  1RXQ A;  3Q7L A;  2GA0 A;  2P7V A;  5HSW A;  3S90 A;  4J32 B;  1C17 M;  2R9R B;  3B0U X;  1OCO C;  1ZW3 A;  1QSP A;  1C03 A;  1NFN A;  4MQ9 F;  4WJ0 A;  5A6B A;  2A69 F;  3JRT A;  4WGY A;  5A69 A;  1M2V A;  2EIJ C;  1H9G A;  2Q7R A;  1Q0K A;  4AK9 A;  1VMA A;  4CS8 A;  3C8G A;  2QE9 A;  1MNE A;  4O6N A;  3X1O A;  3DE8 A;  1VK5 A;  3JSZ A;  1U0B B;  1Z5Z A;  5DLJ A;  1JAF A;  2V26 A;  4XPX A;  2J0X A;  2W4M A;  4RD9 A;  1RMV A;  3JYH A;  1RKE A;  3C63 A;  4U9E A;  5BUO A;  4M63 A;  4CIP A;  2PBE A;  5B3S C;  3HNJ A;  2G62 A;  4N06 A;  1Z23 A;  2YL1 A;  3TOM A;  3FVY A;  4I3M A;  5JS5 A;  5A6J A;  4LDQ A;  1OQC A;  3OWT A;  1WN0 A;  4HFF B;  1FTS A;  1G4W R;  3L34 A;  1O5H A;  3O10 A;  4N6H A;  1YAR O;  2M4E A;  4U5B E;  1J8M F;  4JUR I;  4JJF A;  1JPN A;  256B A;  3ITF A;  3N24 A;  4O6M A;  1F1M A;  1KNY A;  2H7B A;  4AE4 B;  4AL0 A;  3S84 A;  4IRU A;  2XRH A;  2L9J A;  4JTA B;  3EFO A;  4CJG A;  4LAC B;  1WGW A;  5COF A;  2GFH A;  1YA7 O;  4OD4 A;  2KK1 A;  5E3C A;  4E18 A;  2R25 A;  1FMV A;  2XS1 A;  3LAY A;  3QVY A;  2Y39 A;  5F5F A;  3K1I A;  4BEJ A;  3QVZ A;  4BEM J;  4GQH A;  2ZXR A;  1SMY F;  1FMW A;  3OA1 A;  4LDK A;  3EZH A;  2NG1 A;  4FX5 A;  4JE9 A;  1MMN A;  2MWQ A;  2J9W A;  3EG9 B;  3KYJ A;  4MW3 A;  2WL8 A;  1JOG A;  3QW0 A;  3W8I A;  2FFH A;  1YA9 A;  1ZW2 A;  1ZHY A;  2EPM X;  1A7D A;  3ZWI A;  4U5E E;  2Q9B A;  2QUP A;  4F4B A;  3UR3 C;  3V5X A;  3ZTZ A;  4KNW A;  1LS4 A;  2BC5 A;  2XM4 A;  3DI5 A;  4XPW A;  2J9U A;  2OKU A;  3X2Q C;  3IQ5 A;  4AE4 A;  1ZHT A;  1APC A;  3K1H A;  2KGO A;  1D0X A;  2J7P D;  2YVK A;  1OR3 A;  4JEA A;  1EI7 A;  5DS5 A;  5KYU B;  3DKA A;  2A6E F;  4UDV A;  1EQ1 A;  2H7O A;  2B0J A;  2EPL X;  1L7C A;  5JT4 A;  5L0C A;  3B9Q A;  2R7Q A;  1D0Z A;  2KYH A;  4I1M A;  1E2X A;  3U8V A;  1CGO A;  1EA8 A;  4NC3 A;  2DI3 A;  4GYT A;  2XL6 A;  2B0H A;  1E85 A;  2OEV A;  3EG9 A;  3NYM A;  4LDR A;  1GQA A;  2OEX A;  5L0F A;  5GPG B;  1M57 C;  3UMK A;  1T6I A;  3AG1 C;  2XXA B;  4ULV A;  1RJ9 A;  3IQT A;  3OEO A;  5E2Q A;  4IAR A;  3RVY A;  1GS9 A;  4CDY A;  4FAP B;  4XLP F;  4K1O A;  1O3U A;  2V3C C;  4BG0 A;  1IZM A;  3O39 A;  4ER9 A;  5K0I A;  3O6X A;  3U0C A;  2ZXP A;  4G0H A;  2HSQ A;  4J7Y A;  2IM8 A;  3AG2 C;  4CS8 C;  2R7T A;  3S9O A;  1OW6 A;  3NKD A;  4XEK A;  4EWC A;  2EPN A;  1YYX A;  1O87 A;  4E0I A;  2LFF A;  2CDQ A;  5JSL A;  2QTV A;  2GAQ A;  3U9J A;  2I15 A;  2W9Y A;  4YT4 A;  4EBK A;  2Y3B A;  1HE1 A;  1I4Y A;  4P9T A;  3JYY A;  3CQZ A;  4MW8 A;  3SNH A;  1H9T A;  2HFI A;  2VCA A;  3C18 A;  4IGG A;  2IOQ A;  4IB4 A;  2XL4 A;  1OCR C;  2XS8 A;  5COG A;  1VLT A;  2KJG A;  4PR9 A;  1V55 C;  1YLM A;  4CDA A;  3U5S A;  2FAP B;  4DBQ A;  3HNI A;  3DMD A;  2ZXO A;  3TOL A;  3V5Z A;  5T3W A;  1JMW A;  4AX2 A;  2C03 A;  4ULW A;  1LI5 A;  3ZTM A;  3R7C A;  2CW0 F;  2YL0 A;  1VB5 A;  1T6U A;  4NTF A;  4AL1 A;  2HS5 A;  3T6J A;  4XEV A;  3TUL A;  2NUT B;  4JTD B;  3L0I A;  2PP4 A;  3K1I C;  2NSF A;  1NU9 C;  5FZT A;  3SXM A;  5F5H A;  5KYW B;  2JX0 A;  4W8K A;  4U5H A;  3TJ6 A;  4MVQ A;  3A11 A;  3K66 A;  1D0Y A;  2JPU A;  2R7X A;  2XSE A;  4DRH B;  3M79 A;  1LVK A;  1V74 B;  3DAF A;  4BPM A;  4H54 A;  4ZLD A;  2WVO A;  1MMG A;  4JZA A;  2CGE A;  3M4B A;  4NCQ A;  2YLG A;  1UFB A;  5D91 A;  2YL7 A;  3JCU Q;  1OXB A;  4MVR A;  1T9K A;  1ZZP A;  3DD7 A;  1Q0M A;  3QMK A;  3JRM O;  3TJ5 A;  2PF4 E;  3HNK A;  2P61 A;  4Q5S F;  1K40 A;  1OR2 A;  3LNM B;  4KNV A;  2NUT A;  3JT1 A;  2KNH A;  3FHD A;  1ZHW A;  3FOO A;  3EHM A;  4GEH A;  3SP1 A;  3SXY A;  2EPO A;  4PK4 A;  4U9D A;  3ZG1 A;  4MS2 A;  4BJ6 C;  4PJL A;  4XPY A;  2R05 A;  3SEO A;  1Z63 A;  1M56 C;  2OU6 A;  1BR1 A;  2MHR A;  3G4X A;  2RSE B;  2VCC A;  3BEH A;  1OXK A;  2M64 A;  3G4Z A;  3KKB A;  3SYN A;  1JPJ A;  5CI9 A;  3K7D A;  5DQZ A;  1TFK B;  3GOD A;  2D5R B;  4PAC A;  1QLE C;  3WOD F;  1SYQ A;  1ZHX A;  3GM1 A;  1XZP A;  3IHU A;  2VCB A;  3WHN A;  4A4A A;  5DS4 A;  4IAQ A;  1BR2 A;  2RD9 A;  3EHN A;  2LP4 A;  5JVE A;  3AOU A;  2HZ8 A;  2EIK C;  3AGU A;  3T6B A;  4G7H F;  2LFD A;  3U8P A;  1Y6D A;  4JVS A;  2HMZ A;  4L6R A;  4E7S A;  1GM5 A;  4LER A;  5AGF A;  3AQB A;  2A68 F;  1YJG A;  3I5Q A;  4NQF A;  4LLC A;  1WTY A;  3I5P A;  4BJ5 A;  2ASR A;  2AU5 A;  2HV6 A;  2YLI A;  4WGZ A;  4B6I A;  4CIH A;  2J46 A;  4IAO A;  1HW1 A;  2WVN A;  2X51 A;  5T1D B;  4EHP A;  1CPR A;  2G3K A;  3MX3 A;  2DYS C;  3RIP A;  2L7A A;  5CI8 A;  3NG1 A;  2XLH A;  4JJG A;  1NFO A;  3B0P A;  3DAG A;  3S28 A;  2Q4F A;  3EPV A;  2YLD A;  2C04 A;  1G4U S;  3GAN A;  3KMI A;  2VC9 A;  4NTB A;  3T9O A;  4YWQ A;  1FNT c;  2HSB A;  1S05 A;  2ICW G;  3KYI A;  3H65 A;  1ORS C;  4JIO A;  3A9C A;  3ZSU A;  1Z7Q c;  2X0C A;  4BJ1 A;  3EQL F;  1H7I A;  1C02 A;  1D1B A;  4E0H A;  1MMD A;  4ONS A;  2CNW A;  3DZA A;  2R7U A;  4XWJ A;  3FOP A;  3VRC A;  3GWL A;  3SXK A;  3JZ0 A;  1UG7 A;  1WAS A;  3HLZ A;  4W8P A;  2EIL C;  1BDJ B;  4MTG A;  2NUP B;  2ZPA A;  3U3B A;  4U5G A;  2IXN A;  2KSF A;  4C3D A;  3N0T A;  4XQ1 A;  1D1C A;  4O7G A;  4ZLC A;  1TWC A;  1HY5 A;  2EIM C;  1QZX A;  2WZL A;  3EZI A;  1OKK A;  4PFO A;  2R02 A;  3UMI A;  3L8J A;  2IYL D;  2OQM A;  2QLA A;  4NY3 A;  1TFO B;  1YZA A;  4G7Z F;  4MTF A;  4ANJ A;  3L8I A;  1PCX A;  3S27 A;  3GM3 A;  3FXH A;  5CIV A;  4DVZ A;  4OIR F;  5HV9 A;  3K6B A;  2OCC C;  1KU2 A;  2Y69 C;  3H2U A;  3HTK C;  4JTC B;  4DXW A;  3RQF A;  2LK4 A;  5L0D A;  1SF8 A;  2JD3 A;  3KL4 A;  4I44 A;  3DJU B;  1BR4 A;  1CPQ A;  1G5Z A;  2DYR C;  5KYU A;  4CS9 A;  1KTM A;  3EH2 A;  2KQ9 A;  3N2Z B;  1T6Q A;  2I8B A;  5BQH A;  4MVZ A;  1Z6A A;  2Y3G A;  4YJW A;  3B71 A;  3TD7 A;  4N6C A;  2DGJ A;  3ATP A;  3GEH A;  4KBL A;  1U6H A;  2Q9A A;  4H4K C;  5F28 E;  4BJT A;  1AEP A;  3WAQ A;  1HMO A;  2ETS A;  3DE9 A;  5JLI A;  2R7R A;  1SZI A;  4XLN F;  3EJN A;  1JR8 A;  3GEI A;  1ZHZ A;  5B1A C;  3V7O A;  3GOR A;  2H8A A;  4JC7 A;  3TK0 A;  2IBF A;  2A0B A;  4C3B A;  2VH3 A;  2QNL A;  4YK5 A;  2XXA A;  2Z15 A;  4C3E A;  4CS7 A;  3RQG A;  3SZR A;  2J45 A;  4Q4Z F;  2LIG A;  3PCV A;  2BE5 F;  3DJN B;  1NBB A;  2PNO A;  3WG7 C;  4FES A;  2R7W A;  4BJ5 C;  4N4W A;  3RYL A;  3VYW A;  3T6G B;  2XLO A;  4QDL A;  3E70 C;  2R7S A;  2WB7 A;  2L81 A;  4CBE A;  2IXP A;  1LIH A;  2TMV P;  5D92 A;  2HKV A;  3H2V A;  3GEE A;  3NRH A;  3DM5 A;  1K05 A;  1QQ3 A;  4JRZ A;  3VAY A;  1LS1 A;  1R5I D;  4QI2 A;  3NYL A;  4CDV A;  1FFT C;  4YT8 A;  4A2N B;  1OCC C;  3EGD B;  3CEX A;  2NSG A;  3PMR A;  4IJJ A;  1OW8 A;  3J06 A;  4G78 A;  2LD6 A;  3VM6 A;  3LUT B;  1L3P A;  1H6G A;  4RBN A;  3RH3 A;  1SR2 A;  4JCZ A;  4P9F A;  1BBH A;  4JEB A;  2J9B A;  5DVW A;  3C62 A;  3FMS A;  2YKZ A;  3NMI A;  4RDA A;  2ZD9 A;  3RF3 A;  1LE4 A;  3ASO C;  1VOM A;  5DQT A;  4E7Z A;  2P0N A;  3LLI A;  2YEV A;  1WWP A;  3MBG A;  4YT2 A;  2D4U A;  3ABM C;  1M2O A;  1V54 C;  3BRJ A;  2LSE A;  4DRI B;  5KYX B;  1Q0G A;  1Y4C A;  1N1C A;  1NSG B;  1MND A;  5KYW A;  2A6H F;  1S7Z A;  1LE2 A;  1PD0 A;  3UNG C;  1VTM P;  1Q0D A;  1LI7 A;  3E9V A;  1FAP B;  4PJJ A;  5COM A;  4Z9I A;  2YHS A;  5E3A A;  2UUI A;  1U89 A;  3C8G B;  2Q00 A;  3LEV A;  3ZIB A;  2CNW D;  3W4Y A;  3EGD A;  3ZVR A;  2UUH A;  2OOC A;  3ASN C;  2ZXW C;  3RVZ A;  3O55 A;  3Q6M A;  4Z9J A;  1RKE B;  1HE9 A;  1PD1 A;  3U2M A;  1OW7 A;  4J30 B;  1I4Z A;  2LCH A;  3AG3 C;  3DM9 B;  4QI0 A;  1TQG A;  2WZG A;  2R03 A;  1A7E A;  3G50 A;  3PDM P;  1OKK D;  4CS9 C;  1R4T A;  5BQI A;  3C8Z A;  4JCH A;  4MTO A;  5FCL A;  3GWN A;  3HNL A;  3FAP B;  5EK0 A;  4EKW A;  3LS0 A;  1YDI A;  4PJM A;  5KYX A;  1HW2 A;  4OIO F;  5JRA A;  2EIN C;  1E84 A;  1VYI A;  2VB6 A;  3ZC4 A;  4MVS A;  3EFO B;  1TWH A;  3RQE A;  3UGP A;  3T4R A;  4KC9 A;  2HUJ A;  2W4B A;  3LJB A;  4MND A;  4O6Y A;  4E17 A;  2L6H A;  2YRF A;  1NZE A;  3GM2 A;  4HEA J;  4YL0 A;  4CJO A;  4WAB A;  1GGQ A;  4Q7C A;  1MQV A;  4DBR A;  1Q0F A;  1ZU5 A;  4D4N A;  1LKX A;  3QTH A;  1TR2 A;  2L6F A;  3QZC A;  4EBB A;  4CSA A;  3ABK C;  2AWC A;  2MYS A;  4JKV A;  2WVQ A;  5TJ5 E;  1A0B A;  3S0X A;  2W45 A;  3EH1 A;  3MYI A;  1ORY A;  1DOV A;  1NLX A;  5B1B C;  3AGT A;  2XM0 A;  2Q3T A;  4DJ9 A;  4G7O F;  4O79 A;  4EIY A;  2VAS A;  1ZU4 A;  2GDC A;  4OIQ F;  4JW1 A;  5AC5 A;  1ST6 A;  2PX3 A;  4MVM A;  2OJQ A;  4PJN A;  2G3V A;  1TKN A;  1QKR A;  1E83 A;  2XLE A;  2PX0 A;  2AP3 A;  3R2P A;  3LEO A;  3TQO A;  1J8Y F;  3IQ6 A;  1E86 A;  3DWW A;  1M6T A;  4MVU A;  2XLV A;  3L1M A;  5BQG A;  3M1C B;  5IY5 C;  2XLD A;  3AG4 C;  3IPM O;  3W2V A;  1OCZ C;  3LLK A;  1ORJ A;  5DS6 A;  3B29 A;  2KW3 C;  3FAJ A;  1T01 A;  2FGY A;  1RJ9 B;  3NMJ A;  3M15 A;  3V5Y A;  1EKY A;  2NPU A;  2GWW A;  4D4X A;  3C7J A;  5A6K A;  1DOW A;  2XL8 A;  1T5O A;  1IW7 F;  3JSE O;  1FFH A;  1RCP A;  1G8X A;  4R32 A;  2YWA A;  3DXJ F;  1HMD A;  5L0G A;  2H7V C;  2Y3D A;  3MLG A;  1YYJ A;  5B3I A;  2HJM A;  4HFK B;  1WAT A;  4PFP A;  3F47 A;  2OG2 A;  2NUP A;  3MYF A;  3HJC A;  4U5D E;  2A0U A;  4J7T A;  2L6G A;  5A6A A;  4MVO A;  1I5N A;  2CYD A;  1ZYR F;  2J8W A;  1YAU O;  2A1D D;  3I4U A;  4EUK B;  1AUE A;  5AC4 A;  3LNR A;  1YZC A;  3F46 A;  2CCY A;  1K04 A;  3MFN A;  2AWY A;  3U2L A;  4BJ6 A;  3ECS A;  1MMA A;  3CAX A;  1BZ4 A;  2WZF A;  3QW1 A;  5L0I A;  5L3Q A;  3K33 A;  1QVX A;  1XZQ A;  4KI2 A;  4K0D A;  4FWV A;  3RW0 A;  2HV7 A;  4U5F E;  5T3T A;  4CX9 A;  2KC3 A;  4YT5 A;  3US6 A;  4IWB A;  3RKO F;  1VLS A;  1YVI A;  3KPH A;  3EGX B;  1D1A A;  4I1O B;  2LQG A;  1FR0 A;  4Z9H A;  2P1A A;  1TWG A;  2AVK A;  1V4A A;  1PV3 A;  3NKE A;  3NMK A;  4EBJ A;  3POV A;  3U3F A;  3ZDL A;  3ABL C; 
#chains in the Genus database with same CATH homology
 1BDJ B;  2R25 A;  3MYF A;  3U3B A;  1I5N A;  4EUK B;  2OOC A;  1OXK A;  3KYJ A;  2LD6 A;  4G78 A;  2LCH A;  2Q4F A;  1TQG A;  2A0B A;  1SR2 A;  4PAC A;  1OXB A;  3IQT A;  3KYI A;  1A0B A;  1WN0 A;  1C02 A;  3US6 A;  1QSP A;  2LP4 A;  1C03 A;  1YVI A;  1FR0 A;  1Y6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...