4PACA

Crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
156
structure length
153
Chain Sequence
b'MEFMDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-containing phosphotransfer protein 2
publication title Crystal structure of AHP2 from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 68
structure length 153
sequence length 156
ec nomenclature
pdb deposition date 2014-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4pacA00
2Q4FA 1SR2A 1YVIA 3US6A 1TQGA 2R25A 3KYJA 4PACA 1WN0A 2LD6A 1FR0A 1OXKA 4EUKB 1I5NA 3KYIA 1C03A 3IQTA 3U3BA 1BDJB 2A0BA 1QSPA 1OXBA 1Y6DA 2OOCA 3MYFA 2LP4A 1A0BA 4G78A 2LCHA 1C02A
chains in the Genus database with same CATH superfamily
2R7TA 1G4US 4C7OA 3OEOA 2JD3A 5F28E 4DJ9A 4U5FE 4CS9A 1OCOC 3EZHA 4G7OF 3U9MA 3T6BA 3PHF2 3MYIA 3VAYA 2XS8A 5DS4A 2H7OA 2WVQA 1O5HA 2CNWD 4ANJA 5KYXA 3DZAA 2IXPA 5KYYA 1D0ZA 3N0TA 4E0IA 4JC7A 2UUHA 3G4XA 1RXQA 2YVKA 1G8XA 2DYSC 3AG4C 1JMWA 4XWJA 2D4UA 4BEMJ 2J9WA 3C8GA 4N06A 4EBKA 5COMA 2ASRA 1NU7D 2KC3A 2A0BA 2HFIA 3KPHA 5DS5A 3GWLA 4X0RA 1A7DA 1Y6DA 3V5XA 1ZHWA 4E18A 3DMDA 5DLJA 4EBBA 4JZAA 3S9OA 1APCA 1JR8A 3ABMC 3GEHA 2PX0A 3DXJF 2QLAA 4LACB 1HW1A 1VB5A 5T3TA 4AL1A 1EKYA 1R4TA 2L6FA 1C17M 2L7AA 3JSZA 5JLIA 3N2ZB 3TOMA 1U0BB 1JPJA 1HMOA 1MQVA 2VB6A 1E86A 2J0XA 2VASA 1KU2A 3FXHA 4ONSA 3RKOF 1S05A 1YA7O 1H7IA 3HJCA 3RQEA 3X1OA 1HMDA 3NYJA 2CCYA 2H7BA 4EIYA 1MNEA 4OD5A 2J0WA 1DOWA 2XS1A 1M57C 4P9TA 3X2QC 3GODA 3TQOA 4BEJA 4HEAJ 5TJ5E 3S84A 3DAFA 5COGA 3NDBB 2M64A 4PFOA 4CDVA 3FAPB 1VLTA 4PJLA 5GPGB 1Q0FA 3KMIA 1LS4A 2LP4A 1R5ID 3H2VA 4G78A 4IWBA 2UUIA 3H2UA 3B0PA 1WATA 2L81A 3EZIA 3GORA 4JTDB 4YL3A 2Q4FA 4DVZA 1SR2A 3QMKA 3AJMA 3QTHA 2Y3HA 4YT5A 3EGDA 4MVRA 1A7EA 4Z9JA 1RKEA 3SZRA 2KQ9A 1SMYF 1TWHA 1LI7A 1K04A 1LI5A 2AVKA 1VYIA 1J8YF 1L3PA 1XZPA 2R02A 4U9EA 1T5OA 3JRTA 3CEXA 4JCHA 5JRAA 4NC3A 4MVSA 1D0XA 2AU5A 3LS1A 5KYWB 2Y39A 4YN0B 3ZVRA 2XXAB 1OQCA 2XSEA 4NY3A 4WABA 3U3BA 2V3CC 1ZU4A 4EKWA 4OIOF 1BR4A 3EGXA 1OXBA 1E85A 3BRJA 1W2WA 2P1AA 3QVZA 3KL4A 4JVSA 5L0CA 1M2VB 1Q0DA 1NZEA 3S27A 4C3EA 2TMVP 1U89A 1B68A 3SYNA 2HMQA 3E9VA 1VOMA 5L0HA 1HE9A 2R7QA 1V54C 3US6A 3WAQA 2WZGA 3ZQYA 1U6HA 3WODF 2Q7RA 2DB4A 3B71A 1ZHTA 2LK4A 4QI2A 1TFKB 3GANA 2R9RB 1MMDA 2HZ8A 1ORYA 3ZSUA 4NTAA 3U2LA 3JCUQ 1FTSA 1N1CA 3LS0A 4JTAB 3ZWIA 1YAUO 3DWWA 1F1MA 3SNHA 2XM0A 3R7CA 4D4XA 3G4ZA 3UMIA 1BR1A 1OCRC 1XZQA 1Z6AA 3QW0A 2OEXA 4J32B 4U5HA 5KYNA 3FOOA 3VF0A 3T6JA 1G5ZA 1LM3B 5A6KA 1BBHA 2LQGA 3V5YA 2LSEA 2RSEB 4A4AA 4Q5SF 1WASA 3SP1A 2OKUA 1MMAA 3V7OA 2MWQA 4CX9A 1YVIA 5BQHA 2P61A 1FAPB 4JURI 1ZVZA 1Z63A 3IEEA 3VM6A 4XLNF 1PV3A 3C18A 3FDQA 1BR2A 1PCXA 3LEOA 4JJGA 5CIVA 4W8PA 3QW1A 1S7ZA 3MFNA 3OA1A 3SEOA 2EIKC 3MLGA 1EQ1A 1A7VA 2L6GA 1MMNA 2R03A 2QY9A 1Q0GA 4XEFA 3AQCA 4XEVA 4IRUA 3V5ZA 3ZTZA 4CDYA 1OKKD 5A6BD 1YYXA 4JE9A 4OIRF 2WVNA 3EHNA 2C03A 2O9XA 3T4RA 2BL2A 1BDJB 1AEPA 2WVOA 2YWAA 2MYSA 3GEEA 3GM2A 1PD0A 3FHDA 3R2PA 2J9UA 3I5QA 4I3MA 3JTLO 3BEHA 1OKKA 4KBLA 2GAQA 3U8VA 2YQYA 4XTKA 4HFFB 4U5CE 4E7SA 2BC5A 1QQ3A 2KYHA 1J8MF 4XEKA 5BQIA 2QNLA 4YT8A 3GM1A 5L0GA 2YHSA 2RD9A 2P7VA 1LKXA 2PP4A 4MTOA 3T6GB 1YZAA 3EFOB 4LDQA 4I44A 1OCCC 2YRFA 2H8AA 4GYTA 1ZW2A 3A11A 2R25A 2OCCC 3AG3C 2ICWG 3C8GD 4PACA 4HE8D 1T01A 3ATPA 3HTKC 3O6XA 5E3CA 3RQFA 1FMWA 2YL0A 2Z15A 1RJ9A 3EPVA 2ZD9A 4DRJB 4N4WA 2R05A 3QVYA 2OU6A 3TJ6A 1D1AA 1JAFA 2YL1A 3K7DA 3POVA 2VCBA 4Q4ZF 1RCPA 3M15A 1M2OA 2HUJA 4C3BA 3HKKA 2EPKX 5E33A 1RMVA 5L0JA 5AC5A 1TR2A 2FGYA 3U8PA 5JS5A 3UGOA 1Q0MA 4KI2A 3IPMO 3JYYA 2R7UA 3J06A 5KYUB 1ZW3A 2KNHA 3AGTA 4I1OB 3DAGA 4KNWA 1OW8A 3CSKA 4U5EE 1NFOA 3O10A 2OEVA 3GWNA 3CQZA 3L1MA 4YJWA 5T1DB 1WOLA 5L3QA 3L34A 4MVUA 3UR3C 1OR2A 4OIPF 2KGOA 4U5GA 2EILC 4EWCA 3T9OA 3S0XA 4J7YA 1LE4A 5JUAA 5F5FA 4CSAC 2EPMX 2XLDA 4JRZA 2G62A 4AL0A 4F4BA 5CI8A 1IZMA 1NU9C 3O55A 2NUTB 4CDAA 2DI3A 5T3WA 5EK0A 2P0NA 1IW7F 2E87A 2KW3C 2R7VA 4PJJA 1DOVA 3E70C 2C04A 1NLXA 3Q6NA 4IJJA 3W2VA 1V4AA 2G3VA 1ZHYA 4JJFA 2G3KA 3B29A 1A0BA 2WL8A 4J7TA 2NSGA 4MVOA 4XPWA 4CS8C 4K0DA 2WZLA 5DS6A 1QKRA 3NKDA 2B0JA 3Q7GA 5B1AC 5JSLA 1LVKA 1ZYRF 4A2NB 5A6AA 3LUTB 5B3IA 3U0CA 2HS5A 4XQ1A 1Z3IX 3LEVA 1O3UA 4JEBA 4NTBA 1GM5A 1OR3A 4CJGA 1H9GA 2A1DD 3AG2C 4MVMA 4EHPA 1CGOA 1CPRA 2IXOA 3EQLF 4AX2A 1EI7A 2CYDA 4GQHA 1LPEA 2Q9BA 2XRHA 4P6IC 1M6TA 2XLVA 4BJ5C 2R7RA 4RBNA 4R32A 3OWTA 2P6VA 1RKCA 4FESA 2W9YA 1SYQA 2VC9A 3TK0A 2R7SA 4YL0A 1ZHXA 2YKZA 1M56C 3C63A 5IY5C 3NYLA 3ITFA 3LAYA 5E3AA 4YT2A 1D1CA 4JEAA 4BJTA 3SXZA 2J7PA 1GGQA 2OJQA 3L0IA 4CS7A 4DVYP 2A69F 2VCCA 2EPOA 4IAQA 2MHRA 4IB4A 3LNRA 1VTMP 2KK1A 3NMIA 4U9DA 3Q7LA 4BPMA 5JP7A 2IYLD 1AUEA 4HFKB 3FOPA 4MVQA 5E2QA 1VYKA 4NQFA 4AE4B 1H6GA 3U5SA 4Z9IA 3EH1A 2NUPB 3FVYA 2EIJC 1HW2A 3K33A 1CGME 1WWPA 2XL8A 4MVZA 4E0HA 2Y3GA 3DJUB 2J45A 1C03A 1L7CA 3ZG1A 2YEVA 4AK9A 3LLKA 1YZCA 5KYWA 5AC4A 2VCAA 4JTCB 2XXAA 1LS1A 4W8KA 2DGJA 2EINC 4MW8A 1LIHA 3RYLA 4PK4A 3F47A 1ORJA 2OJED 3G50A 3S29A 1JPNA 1E83A 4O6YA 4Q7CA 4WGZA 4M63A 5COFA 1M2VA 2QUPA 3ZC4A 4BJ6C 1V74B 3HNKA 3K66A 1K05A 3FMSA 4H54A 5L0IA 1K40A 4PR9A 2R7OA 4FWVA 4RD9A 3B0VC 2R7XA 5A6JA 4FX5A 1T9KA 4LDRA 3EG9B 2Y69C 4BJ1A 1XWJA 2D5RB 4YL1A 3GEIA 2X51A 1NBBA 4CS9C 3ECSA 3EJNA 3W8IA 3LESA 1GS9A 5DVWA 3TULA 3M4CA 4I1MA 2WZFA 4OD4A 1SF8A 3DE8A 4CIPA 3K1IA 2HMZA 4PJMA 4DBRA 3MX3A 4C7OB 1TWCA 3AGUA 2I8BA 4ULVA 2IOQA 2Q00A 4XPYA 1FMVA 3GM3A 2GA0A 5KYXB 3PCVA 5KYYB 1OW7A 2L9JA 2Q9CA 5FZTA 1EA8A 2W45A 2HSQA 2L6HA 2EPLX 2YLGA 4GEHA 256BA 3DD7A 1T6QA 2EPNA 3C8GB 2YLIA 3UNGC 1A41A 1FR0A 3U3FA 3NKEA 2HJMA 4PJNA 4O7GA 3N24A 3RW0A 5L3VA 4IAOA 3Q6MA 3ZQVA 1ZU5A 1QPUA 1ST6A 4N6CA 4FAPB 4CIHA 2GDCA 2OOCA 2CDQA 4QDLA 2KJGA 2ETSA 3L8IA 5EHHA 1CGNA 1E84A 5L0FA 5D91A 2OQMA 2XLEA 2LCHA 2PF4E 1KTMA 3ABKC 3FAJA 4JCZA 1FFTC 2HV7A 2ZXPA 3O39A 1NSGB 3B9QA 4H4KC 1VMAA 2HJ3A 2I15A 3UMHA 5B3SC 5EGYA 1E2XA 2CW0F 2BE5F 1G4WR 3RIPA 4MW3A 1ORSC 1TQGA 1T6IA 2AP3A 2Y3DA 1KNYA 2XLOA 4YK5A 4XLPF 4G7ZF 2LIGA 4ULWA 3EFOA 5D92A 2KSFA 3UGPA 3U9JA 5F5HA 3VYWA 2CNWA 3PDMP 1QVXA 4NTFA 3NYMA 5L0DA 5HV9A 2W4BA 3ABLC 2F22A 1CPQA 4QI0A 2HSBA 5K0IA 2VH3A 4E7ZA 3JSEO 4YWQA 3EGDB 5A69A 3HNLA 3S90A 1RKEB 1FNTc 4K7BA 1Z23A 4L6RA 3ASOC 3K1HA 3WHNA 1C02A 3HNJA 5KYUA 1YDIA 5DQZA 3TOLA 5HSWA 2Y3BA 2IXNA 3LJBA 3W2WA 1ZZPA 2CGEA 3M79A 3HNIA 1MNDA 2NPUA 3M1CB 4ZLCA 4DRIB 5AGFA 2AWCA 4DBQA 2IXMA 2HKVA 1Z7Qc 2XL4A 1JRAA 3DE9A 4PFPA 3EGXB 3DM5A 2FFHA 4JW1A 3TJ5A 4YT4A 1I5NA 1VLSA 2YZSA 4O79A 2R7WA 1WTYA 2YLDA 3DI5A 3IQTA 3KKBA 4D4NA 2NUTA 2QTVA 2XM4A 2ZXRA 1O87A 2PX3A 3M4BA 4G0HA 2Q9AA 2M4EA 3ASNC 2DYRC 1V55C 3RVYA 2GWWA 2A6EF 3SXKA 2XLMA 4LLEA 1AVOB 4MTGA 2J7PD 2YL7A 3RQGA 4WJ0A 1LE2A 5BUOA 4CSAA 2XLWA 3IQ5A 2LFFA 4LDKA 2X0CA 4O6MA 2FAPB 3RH3A 2PFDA 2W4MA 3LLIA 1GQAA 1HY5A 1I4ZA 2EIMC 3I4UA 1NG1A 3U2MA 3B0UX 4LLCA 1SZIA 1YARO 1HE1A 4P9FA 1YYJA 2LFDA 2LD6A 4MNDA 5DQTA 1OXKA 4ER9A 4EUKB 2HV6A 1MMGA 2H7VC 2ZPAA 1BZ4A 3MBGA 2J46A 3DKAA 3EH2A 3K6BA 3IHUA 4KNVA 4CS8A 4MTFA 2J9BA 2YL3A 3KYIA 2JPUA 3I5PA 1TFOB 4U5DE 5JT4A 3HLZA 3C8ZA 4U5BE 1JOGA 2NG1A 3W4YA 4DRHB 1OCZC 1H9TA 2V26A 3AQBA 4LERA 1FFHA 3JT1A 4J30B 3IQCA 3JRMO 2PBEA 2Q3TA 1TWGA 4C3DA 3IQ6A 4RDAA 3K1IC 2XL6A 5BQGA 3UMKA 4IGGA 1NFNA 2J9VA 2AWYA 1YJGA 3AOUA 4NCQA 4BJ5A 1VK5A 4OINF 4WGYA 4K1OA 1TWAA 3NG1A 4Z9HA 2JX0A 1D0YA 3S28A 2J8WA 4UDVA 3AG1C 3L8JA 2IM8A 1WN0A 3RF3A 3C7JA 3SXYA 4B6IA 4XPXA 3DM9B 4IARA 4JIOA 4BG0A 4ZLDA 4CBEA 5CI9A 3KH2A 4AE4A 1QLEC 1UG7A 2OG2A 4MQ9F 2NUPA 2NSFA 4EBJA 4E17A 1Q0KA 3EHMA 2A68F 1TKNA 5FCLA 3RVZA 3NRHA 3WG7C 2IBFA 1D1BA 3ZDLA 5JVEA 1Y4CA 2A6HF 1ZHZA 3NMKA 2ZXWC 2WB7A 4JKVA 1T6UA 2B0HA 1RJ9B 1Z5ZA 2A0UA 3QZCA 1QZXA 2QE9A 2ZXOA 3PMRA 4MS2A 4DXWA 4OIQF 1YLMA 3KYJA 1UFBA 3SXMA 3VRCA 3JYHA 2GFHA 4N6HA 1WGWA 3JZ0A 3LNMB 3TD7A 3F46A 4CJOA 5B1BC 4KC9A 3DJNB 3EG9A 3H65A 3NMJA 2XLHA 2PNOA 3C62A 3RFYA 1I4YA 1QSPA 4DOZA 3ZTMA 3CZ6A 4BJ6A 5A6BA 1PD1A 3A9CA 3CAXA 4O6NA 3W8HA 1OW6A 3MYFA 1YA9A 4G7HF 3ZIBA
chains in the Genus database with same CATH topology
2Q4FA 1SR2A 1YVIA 3US6A 1TQGA 2R25A 3KYJA 4PACA 1WN0A 2LD6A 1FR0A 1OXKA 4EUKB 1I5NA 3KYIA 1C03A 3IQTA 3U3BA 1BDJB 2A0BA 1QSPA 1OXBA 1Y6DA 2OOCA 3MYFA 2LP4A 1A0BA 4G78A 2LCHA 1C02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4F A;  1SR2 A;  1YVI A;  3US6 A;  1TQG A;  2R25 A;  3KYJ A;  4PAC A;  1WN0 A;  2LD6 A;  1FR0 A;  1OXK A;  4EUK B;  1I5N A;  3KYI A;  1C03 A;  3IQT A;  3U3B A;  1BDJ B;  2A0B A;  1QSP A;  1OXB A;  1Y6D A;  2OOC A;  3MYF A;  2LP4 A;  1A0B A;  4G78 A;  2LCH A;  1C02 A; 
#chains in the Genus database with same CATH topology
 2R7T A;  1G4U S;  4C7O A;  3OEO A;  2JD3 A;  5F28 E;  4DJ9 A;  4U5F E;  4CS9 A;  1OCO C;  3EZH A;  4G7O F;  3U9M A;  3T6B A;  3PHF 2;  3MYI A;  3VAY A;  2XS8 A;  5DS4 A;  2H7O A;  2WVQ A;  1O5H A;  2CNW D;  4ANJ A;  5KYX A;  3DZA A;  2IXP A;  5KYY A;  1D0Z A;  3N0T A;  4E0I A;  4JC7 A;  2UUH A;  3G4X A;  1RXQ A;  2YVK A;  1G8X A;  2DYS C;  3AG4 C;  1JMW A;  4XWJ A;  2D4U A;  4BEM J;  2J9W A;  3C8G A;  4N06 A;  4EBK A;  5COM A;  2ASR A;  1NU7 D;  2KC3 A;  2A0B A;  2HFI A;  3KPH A;  5DS5 A;  3GWL A;  4X0R A;  1A7D A;  1Y6D A;  3V5X A;  1ZHW A;  4E18 A;  3DMD A;  5DLJ A;  4EBB A;  4JZA A;  3S9O A;  1APC A;  1JR8 A;  3ABM C;  3GEH A;  2PX0 A;  3DXJ F;  2QLA A;  4LAC B;  1HW1 A;  1VB5 A;  5T3T A;  4AL1 A;  1EKY A;  1R4T A;  2L6F A;  1C17 M;  2L7A A;  3JSZ A;  5JLI A;  3N2Z B;  3TOM A;  1U0B B;  1JPJ A;  1HMO A;  1MQV A;  2VB6 A;  1E86 A;  2J0X A;  2VAS A;  1KU2 A;  3FXH A;  4ONS A;  3RKO F;  1S05 A;  1YA7 O;  1H7I A;  3HJC A;  3RQE A;  3X1O A;  1HMD A;  3NYJ A;  2CCY A;  2H7B A;  4EIY A;  1MNE A;  4OD5 A;  2J0W A;  1DOW A;  2XS1 A;  1M57 C;  4P9T A;  3X2Q C;  3GOD A;  3TQO A;  4BEJ A;  4HEA J;  5TJ5 E;  3S84 A;  3DAF A;  5COG A;  3NDB B;  2M64 A;  4PFO A;  4CDV A;  3FAP B;  1VLT A;  4PJL A;  5GPG B;  1Q0F A;  3KMI A;  1LS4 A;  2LP4 A;  1R5I D;  3H2V A;  4G78 A;  4IWB A;  2UUI A;  3H2U A;  3B0P A;  1WAT A;  2L81 A;  3EZI A;  3GOR A;  4JTD B;  4YL3 A;  2Q4F A;  4DVZ A;  1SR2 A;  3QMK A;  3AJM A;  3QTH A;  2Y3H A;  4YT5 A;  3EGD A;  4MVR A;  1A7E A;  4Z9J A;  1RKE A;  3SZR A;  2KQ9 A;  1SMY F;  1TWH A;  1LI7 A;  1K04 A;  1LI5 A;  2AVK A;  1VYI A;  1J8Y F;  1L3P A;  1XZP A;  2R02 A;  4U9E A;  1T5O A;  3JRT A;  3CEX A;  4JCH A;  5JRA A;  4NC3 A;  4MVS A;  1D0X A;  2AU5 A;  3LS1 A;  5KYW B;  2Y39 A;  4YN0 B;  3ZVR A;  2XXA B;  1OQC A;  2XSE A;  4NY3 A;  4WAB A;  3U3B A;  2V3C C;  1ZU4 A;  4EKW A;  4OIO F;  1BR4 A;  3EGX A;  1OXB A;  1E85 A;  3BRJ A;  1W2W A;  2P1A A;  3QVZ A;  3KL4 A;  4JVS A;  5L0C A;  1M2V B;  1Q0D A;  1NZE A;  3S27 A;  4C3E A;  2TMV P;  1U89 A;  1B68 A;  3SYN A;  2HMQ A;  3E9V A;  1VOM A;  5L0H A;  1HE9 A;  2R7Q A;  1V54 C;  3US6 A;  3WAQ A;  2WZG A;  3ZQY A;  1U6H A;  3WOD F;  2Q7R A;  2DB4 A;  3B71 A;  1ZHT A;  2LK4 A;  4QI2 A;  1TFK B;  3GAN A;  2R9R B;  1MMD A;  2HZ8 A;  1ORY A;  3ZSU A;  4NTA A;  3U2L A;  3JCU Q;  1FTS A;  1N1C A;  3LS0 A;  4JTA B;  3ZWI A;  1YAU O;  3DWW A;  1F1M A;  3SNH A;  2XM0 A;  3R7C A;  4D4X A;  3G4Z A;  3UMI A;  1BR1 A;  1OCR C;  1XZQ A;  1Z6A A;  3QW0 A;  2OEX A;  4J32 B;  4U5H A;  5KYN A;  3FOO A;  3VF0 A;  3T6J A;  1G5Z A;  1LM3 B;  5A6K A;  1BBH A;  2LQG A;  3V5Y A;  2LSE A;  2RSE B;  4A4A A;  4Q5S F;  1WAS A;  3SP1 A;  2OKU A;  1MMA A;  3V7O A;  2MWQ A;  4CX9 A;  1YVI A;  5BQH A;  2P61 A;  1FAP B;  4JUR I;  1ZVZ A;  1Z63 A;  3IEE A;  3VM6 A;  4XLN F;  1PV3 A;  3C18 A;  3FDQ A;  1BR2 A;  1PCX A;  3LEO A;  4JJG A;  5CIV A;  4W8P A;  3QW1 A;  1S7Z A;  3MFN A;  3OA1 A;  3SEO A;  2EIK C;  3MLG A;  1EQ1 A;  1A7V A;  2L6G A;  1MMN A;  2R03 A;  2QY9 A;  1Q0G A;  4XEF A;  3AQC A;  4XEV A;  4IRU A;  3V5Z A;  3ZTZ A;  4CDY A;  1OKK D;  5A6B D;  1YYX A;  4JE9 A;  4OIR F;  2WVN A;  3EHN A;  2C03 A;  2O9X A;  3T4R A;  2BL2 A;  1BDJ B;  1AEP A;  2WVO A;  2YWA A;  2MYS A;  3GEE A;  3GM2 A;  1PD0 A;  3FHD A;  3R2P A;  2J9U A;  3I5Q A;  4I3M A;  3JTL O;  3BEH A;  1OKK A;  4KBL A;  2GAQ A;  3U8V A;  2YQY A;  4XTK A;  4HFF B;  4U5C E;  4E7S A;  2BC5 A;  1QQ3 A;  2KYH A;  1J8M F;  4XEK A;  5BQI A;  2QNL A;  4YT8 A;  3GM1 A;  5L0G A;  2YHS A;  2RD9 A;  2P7V A;  1LKX A;  2PP4 A;  4MTO A;  3T6G B;  1YZA A;  3EFO B;  4LDQ A;  4I44 A;  1OCC C;  2YRF A;  2H8A A;  4GYT A;  1ZW2 A;  3A11 A;  2R25 A;  2OCC C;  3AG3 C;  2ICW G;  3C8G D;  4PAC A;  4HE8 D;  1T01 A;  3ATP A;  3HTK C;  3O6X A;  5E3C A;  3RQF A;  1FMW A;  2YL0 A;  2Z15 A;  1RJ9 A;  3EPV A;  2ZD9 A;  4DRJ B;  4N4W A;  2R05 A;  3QVY A;  2OU6 A;  3TJ6 A;  1D1A A;  1JAF A;  2YL1 A;  3K7D A;  3POV A;  2VCB A;  4Q4Z F;  1RCP A;  3M15 A;  1M2O A;  2HUJ A;  4C3B A;  3HKK A;  2EPK X;  5E33 A;  1RMV A;  5L0J A;  5AC5 A;  1TR2 A;  2FGY A;  3U8P A;  5JS5 A;  3UGO A;  1Q0M A;  4KI2 A;  3IPM O;  3JYY A;  2R7U A;  3J06 A;  5KYU B;  1ZW3 A;  2KNH A;  3AGT A;  4I1O B;  3DAG A;  4KNW A;  1OW8 A;  3CSK A;  4U5E E;  1NFO A;  3O10 A;  2OEV A;  3GWN A;  3CQZ A;  3L1M A;  4YJW A;  5T1D B;  1WOL A;  5L3Q A;  3L34 A;  4MVU A;  3UR3 C;  1OR2 A;  4OIP F;  2KGO A;  4U5G A;  2EIL C;  4EWC A;  3T9O A;  3S0X A;  4J7Y A;  1LE4 A;  5JUA A;  5F5F A;  4CSA C;  2EPM X;  2XLD A;  4JRZ A;  2G62 A;  4AL0 A;  4F4B A;  5CI8 A;  1IZM A;  1NU9 C;  3O55 A;  2NUT B;  4CDA A;  2DI3 A;  5T3W A;  5EK0 A;  2P0N A;  1IW7 F;  2E87 A;  2KW3 C;  2R7V A;  4PJJ A;  1DOV A;  3E70 C;  2C04 A;  1NLX A;  3Q6N A;  4IJJ A;  3W2V A;  1V4A A;  2G3V A;  1ZHY A;  4JJF A;  2G3K A;  3B29 A;  1A0B A;  2WL8 A;  4J7T A;  2NSG A;  4MVO A;  4XPW A;  4CS8 C;  4K0D A;  2WZL A;  5DS6 A;  1QKR A;  3NKD A;  2B0J A;  3Q7G A;  5B1A C;  5JSL A;  1LVK A;  1ZYR F;  4A2N B;  5A6A A;  3LUT B;  5B3I A;  3U0C A;  2HS5 A;  4XQ1 A;  1Z3I X;  3LEV A;  1O3U A;  4JEB A;  4NTB A;  1GM5 A;  1OR3 A;  4CJG A;  1H9G A;  2A1D D;  3AG2 C;  4MVM A;  4EHP A;  1CGO A;  1CPR A;  2IXO A;  3EQL F;  4AX2 A;  1EI7 A;  2CYD A;  4GQH A;  1LPE A;  2Q9B A;  2XRH A;  4P6I C;  1M6T A;  2XLV A;  4BJ5 C;  2R7R A;  4RBN A;  4R32 A;  3OWT A;  2P6V A;  1RKC A;  4FES A;  2W9Y A;  1SYQ A;  2VC9 A;  3TK0 A;  2R7S A;  4YL0 A;  1ZHX A;  2YKZ A;  1M56 C;  3C63 A;  5IY5 C;  3NYL A;  3ITF A;  3LAY A;  5E3A A;  4YT2 A;  1D1C A;  4JEA A;  4BJT A;  3SXZ A;  2J7P A;  1GGQ A;  2OJQ A;  3L0I A;  4CS7 A;  4DVY P;  2A69 F;  2VCC A;  2EPO A;  4IAQ A;  2MHR A;  4IB4 A;  3LNR A;  1VTM P;  2KK1 A;  3NMI A;  4U9D A;  3Q7L A;  4BPM A;  5JP7 A;  2IYL D;  1AUE A;  4HFK B;  3FOP A;  4MVQ A;  5E2Q A;  1VYK A;  4NQF A;  4AE4 B;  1H6G A;  3U5S A;  4Z9I A;  3EH1 A;  2NUP B;  3FVY A;  2EIJ C;  1HW2 A;  3K33 A;  1CGM E;  1WWP A;  2XL8 A;  4MVZ A;  4E0H A;  2Y3G A;  3DJU B;  2J45 A;  1C03 A;  1L7C A;  3ZG1 A;  2YEV A;  4AK9 A;  3LLK A;  1YZC A;  5KYW A;  5AC4 A;  2VCA A;  4JTC B;  2XXA A;  1LS1 A;  4W8K A;  2DGJ A;  2EIN C;  4MW8 A;  1LIH A;  3RYL A;  4PK4 A;  3F47 A;  1ORJ A;  2OJE D;  3G50 A;  3S29 A;  1JPN A;  1E83 A;  4O6Y A;  4Q7C A;  4WGZ A;  4M63 A;  5COF A;  1M2V A;  2QUP A;  3ZC4 A;  4BJ6 C;  1V74 B;  3HNK A;  3K66 A;  1K05 A;  3FMS A;  4H54 A;  5L0I A;  1K40 A;  4PR9 A;  2R7O A;  4FWV A;  4RD9 A;  3B0V C;  2R7X A;  5A6J A;  4FX5 A;  1T9K A;  4LDR A;  3EG9 B;  2Y69 C;  4BJ1 A;  1XWJ A;  2D5R B;  4YL1 A;  3GEI A;  2X51 A;  1NBB A;  4CS9 C;  3ECS A;  3EJN A;  3W8I A;  3LES A;  1GS9 A;  5DVW A;  3TUL A;  3M4C A;  4I1M A;  2WZF A;  4OD4 A;  1SF8 A;  3DE8 A;  4CIP A;  3K1I A;  2HMZ A;  4PJM A;  4DBR A;  3MX3 A;  4C7O B;  1TWC A;  3AGU A;  2I8B A;  4ULV A;  2IOQ A;  2Q00 A;  4XPY A;  1FMV A;  3GM3 A;  2GA0 A;  5KYX B;  3PCV A;  5KYY B;  1OW7 A;  2L9J A;  2Q9C A;  5FZT A;  1EA8 A;  2W45 A;  2HSQ A;  2L6H A;  2EPL X;  2YLG A;  4GEH A;  256B A;  3DD7 A;  1T6Q A;  2EPN A;  3C8G B;  2YLI A;  3UNG C;  1A41 A;  1FR0 A;  3U3F A;  3NKE A;  2HJM A;  4PJN A;  4O7G A;  3N24 A;  3RW0 A;  5L3V A;  4IAO A;  3Q6M A;  3ZQV A;  1ZU5 A;  1QPU A;  1ST6 A;  4N6C A;  4FAP B;  4CIH A;  2GDC A;  2OOC A;  2CDQ A;  4QDL A;  2KJG A;  2ETS A;  3L8I A;  5EHH A;  1CGN A;  1E84 A;  5L0F A;  5D91 A;  2OQM A;  2XLE A;  2LCH A;  2PF4 E;  1KTM A;  3ABK C;  3FAJ A;  4JCZ A;  1FFT C;  2HV7 A;  2ZXP A;  3O39 A;  1NSG B;  3B9Q A;  4H4K C;  1VMA A;  2HJ3 A;  2I15 A;  3UMH A;  5B3S C;  5EGY A;  1E2X A;  2CW0 F;  2BE5 F;  1G4W R;  3RIP A;  4MW3 A;  1ORS C;  1TQG A;  1T6I A;  2AP3 A;  2Y3D A;  1KNY A;  2XLO A;  4YK5 A;  4XLP F;  4G7Z F;  2LIG A;  4ULW A;  3EFO A;  5D92 A;  2KSF A;  3UGP A;  3U9J A;  5F5H A;  3VYW A;  2CNW A;  3PDM P;  1QVX A;  4NTF A;  3NYM A;  5L0D A;  5HV9 A;  2W4B A;  3ABL C;  2F22 A;  1CPQ A;  4QI0 A;  2HSB A;  5K0I A;  2VH3 A;  4E7Z A;  3JSE O;  4YWQ A;  3EGD B;  5A69 A;  3HNL A;  3S90 A;  1RKE B;  1FNT c;  4K7B A;  1Z23 A;  4L6R A;  3ASO C;  3K1H A;  3WHN A;  1C02 A;  3HNJ A;  5KYU A;  1YDI A;  5DQZ A;  3TOL A;  5HSW A;  2Y3B A;  2IXN A;  3LJB A;  3W2W A;  1ZZP A;  2CGE A;  3M79 A;  3HNI A;  1MND A;  2NPU A;  3M1C B;  4ZLC A;  4DRI B;  5AGF A;  2AWC A;  4DBQ A;  2IXM A;  2HKV A;  1Z7Q c;  2XL4 A;  1JRA A;  3DE9 A;  4PFP A;  3EGX B;  3DM5 A;  2FFH A;  4JW1 A;  3TJ5 A;  4YT4 A;  1I5N A;  1VLS A;  2YZS A;  4O79 A;  2R7W A;  1WTY A;  2YLD A;  3DI5 A;  3IQT A;  3KKB A;  4D4N A;  2NUT A;  2QTV A;  2XM4 A;  2ZXR A;  1O87 A;  2PX3 A;  3M4B A;  4G0H A;  2Q9A A;  2M4E A;  3ASN C;  2DYR C;  1V55 C;  3RVY A;  2GWW A;  2A6E F;  3SXK A;  2XLM A;  4LLE A;  1AVO B;  4MTG A;  2J7P D;  2YL7 A;  3RQG A;  4WJ0 A;  1LE2 A;  5BUO A;  4CSA A;  2XLW A;  3IQ5 A;  2LFF A;  4LDK A;  2X0C A;  4O6M A;  2FAP B;  3RH3 A;  2PFD A;  2W4M A;  3LLI A;  1GQA A;  1HY5 A;  1I4Z A;  2EIM C;  3I4U A;  1NG1 A;  3U2M A;  3B0U X;  4LLC A;  1SZI A;  1YAR O;  1HE1 A;  4P9F A;  1YYJ A;  2LFD A;  2LD6 A;  4MND A;  5DQT A;  1OXK A;  4ER9 A;  4EUK B;  2HV6 A;  1MMG A;  2H7V C;  2ZPA A;  1BZ4 A;  3MBG A;  2J46 A;  3DKA A;  3EH2 A;  3K6B A;  3IHU A;  4KNV A;  4CS8 A;  4MTF A;  2J9B A;  2YL3 A;  3KYI A;  2JPU A;  3I5P A;  1TFO B;  4U5D E;  5JT4 A;  3HLZ A;  3C8Z A;  4U5B E;  1JOG A;  2NG1 A;  3W4Y A;  4DRH B;  1OCZ C;  1H9T A;  2V26 A;  3AQB A;  4LER A;  1FFH A;  3JT1 A;  4J30 B;  3IQC A;  3JRM O;  2PBE A;  2Q3T A;  1TWG A;  4C3D A;  3IQ6 A;  4RDA A;  3K1I C;  2XL6 A;  5BQG A;  3UMK A;  4IGG A;  1NFN A;  2J9V A;  2AWY A;  1YJG A;  3AOU A;  4NCQ A;  4BJ5 A;  1VK5 A;  4OIN F;  4WGY A;  4K1O A;  1TWA A;  3NG1 A;  4Z9H A;  2JX0 A;  1D0Y A;  3S28 A;  2J8W A;  4UDV A;  3AG1 C;  3L8J A;  2IM8 A;  1WN0 A;  3RF3 A;  3C7J A;  3SXY A;  4B6I A;  4XPX A;  3DM9 B;  4IAR A;  4JIO A;  4BG0 A;  4ZLD A;  4CBE A;  5CI9 A;  3KH2 A;  4AE4 A;  1QLE C;  1UG7 A;  2OG2 A;  4MQ9 F;  2NUP A;  2NSF A;  4EBJ A;  4E17 A;  1Q0K A;  3EHM A;  2A68 F;  1TKN A;  5FCL A;  3RVZ A;  3NRH A;  3WG7 C;  2IBF A;  1D1B A;  3ZDL A;  5JVE A;  1Y4C A;  2A6H F;  1ZHZ A;  3NMK A;  2ZXW C;  2WB7 A;  4JKV A;  1T6U A;  2B0H A;  1RJ9 B;  1Z5Z A;  2A0U A;  3QZC A;  1QZX A;  2QE9 A;  2ZXO A;  3PMR A;  4MS2 A;  4DXW A;  4OIQ F;  1YLM A;  3KYJ A;  1UFB A;  3SXM A;  3VRC A;  3JYH A;  2GFH A;  4N6H A;  1WGW A;  3JZ0 A;  3LNM B;  3TD7 A;  3F46 A;  4CJO A;  5B1B C;  4KC9 A;  3DJN B;  3EG9 A;  3H65 A;  3NMJ A;  2XLH A;  2PNO A;  3C62 A;  3RFY A;  1I4Y A;  1QSP A;  4DOZ A;  3ZTM A;  3CZ6 A;  4BJ6 A;  5A6B A;  1PD1 A;  3A9C A;  3CAX A;  4O6N A;  3W8H A;  1OW6 A;  3MYF A;  1YA9 A;  4G7H F;  3ZIB A; 
#chains in the Genus database with same CATH homology
 2Q4F A;  1SR2 A;  1YVI A;  3US6 A;  1TQG A;  2R25 A;  3KYJ A;  4PAC A;  1WN0 A;  2LD6 A;  1FR0 A;  1OXK A;  4EUK B;  1I5N A;  3KYI A;  1C03 A;  3IQT A;  3U3B A;  1BDJ B;  2A0B A;  1QSP A;  1OXB A;  1Y6D A;  2OOC A;  3MYF A;  2LP4 A;  1A0B A;  4G78 A;  2LCH A;  1C02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...