3MLGA

2ouf-2x, a designed knotted protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
169
structure length
161
Chain Sequence
NPLDKWNDIIFHASKKLSKKELERLLELLALLETFIEKEDLEEKFESFAKALRIDEELQQKIESRKTDIVIQSMANILSGGNPLDKWNDIIFHASKKLSKKELERLLELLALLETFIEKEDLEEKFESFAKALRIDEELQQKIESRKTDIVIQSMANILSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords 2X chimera of Helicobacter pylori protein HP0242
publication title Structure and folding of a designed knotted protein.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 69
structure length 161
sequence length 169
chains with identical sequence B
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2010-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1980 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3mlgA00
3MLGA
chains in the Genus database with same CATH superfamily
3JRMO 1XZQA 2AVKA 5B1BC 1FAPB 2EPMX 1Y6DA 3POVA 1VLSA 2J7PD 1O5HA 4JTAB 1NZEA 2PBEA 2XM4A 1TKNA 3N2ZB 1QSPA 3C18A 3R7CA 1KTMA 1OQCA 1MMNA 2D4UA 3MYFA 2W4BA 3ZSUA 3FVYA 3SYNA 4BJ5A 5T3TA 1YZCA 3FHDA 4WGYA 4XQ1A 2KGOA 1SF8A 2DYRC 5E3AA 2R05A 4NTFA 1WWPA 3LAYA 3C8GA 3FAJA 4CDVA 5DS4A 3UMKA 2FGYA 2FFHA 1XWJA 4Z9IA 3K1IC 3UNGC 4Q7CA 4QI0A 5EK0A 1FR0A 1H6GA 3SP1A 4XPYA 2Y3BA 4AL1A 1MNDA 4PJMA 2WZLA 2HSQA 4ZLCA 5BQIA 1ORSC 5KYUB 2CGEA 4D4XA 2E87A 5A6BD 5JT4A 2HFIA 1NSGB 5HSWA 4HE8D 3TJ5A 2EINC 2PFDA 3SXMA 3VF0A 5BUOA 1OXKA 3SXKA 1ZU4A 4C3BA 2C04A 3N0TA 3UGPA 4EUKB 4LDQA 4YL3A 1W2WA 2NSFA 4MTFA 4KNVA 2HSBA 3GODA 5L0JA 4EHPA 5E3CA 4FX5A 1YDIA 4JRZA 3TULA 2V26A 1NU7D 3IQ6A 4IARA 2L81A 4H54A 3PCVA 1T01A 3QW1A 3K66A 4MNDA 4MW3A 1AUEA 3EPVA 4JJGA 1HW1A 2LFFA 1IW7F 1TWHA 2P6VA 4A4AA 3S27A 2R7TA 3AJMA 2ETSA 3KKBA 4OIQF 4F4BA 2Y3DA 3ZQVA 3JTLO 1E83A 3HNJA 3QTHA 3RIPA 1EQ1A 2LSEA 1QZXA 1A41A 1APCA 3RQEA 3WHNA 1S7ZA 4CJOA 5KYWA 2BL2A 4YT4A 2CNWA 3U3FA 3I4UA 2H8AA 3F47A 4G7OF 3V5XA 5A69A 1RKEA 3EFOB 3HNLA 2D5RB 1OXBA 3AG3C 3AGTA 4WGZA 3ZDLA 4PR9A 1U6HA 3CSKA 3QVYA 2R7RA 1JAFA 3NMKA 2XL6A 4I1OB 1E85A 2R7OA 4RD9A 4BJ6A 3AG2C 2XLEA 1OCCC 3K33A 5COMA 4G0HA 1M57C 2HS5A 1OCZC 3H2UA 3U3BA 1ORJA 1PCXA 4CS8C 4AL0A 2R7UA 3EGDB 4A2NB 1V54C 4DRHB 3TD7A 1QVXA 1D1BA 2WVOA 2OJQA 2YLDA 2R9RB 3A9CA 2XLMA 1OKKD 3CQZA 4KI2A 4LDKA 1YAUO 1YJGA 1SYQA 2J45A 4G7ZF 1LKXA 2QNLA 3DAFA 4BEJA 2JPUA 1V74B 3AGUA 3JRTA 4JTDB 4Z9JA 2DB4A 3DXJF 3NYJA 4ULVA 4DBQA 3AG1C 3HLZA 4X0RA 4MVSA 1Z6AA 4YWQA 4I44A 5E2QA 3S28A 1LE4A 4MVQA 2A1DD 1YA7O 1HMDA 4BJ1A 4ER9A 2OOCA 5KYNA 2BC5A 3RW0A 3KL4A 3GANA 4Q5SF 1T6UA 4AE4A 5CI9A 3HNIA 5HV9A 2LP4A 1OCOC 2IXPA 3FMSA 3B0UX 3ASNC 4YN0B 2KQ9A 1L3PA 1M2OA 2A0UA 4MQ9F 2Q00A 2RD9A 3JT1A 2XM0A 4MVRA 4U5CE 1F1MA 4I1MA 3W2VA 4CDYA 4L6RA 3NMJA 1G5ZA 4DBRA 2G62A 2Q9AA 1TFOB 3LNRA 4E7SA 4ULWA 3H65A 1TWAA 3EZIA 3RQFA 2YKZA 1A0BA 3TOMA 3L8JA 4FWVA 2A6EF 1T6QA 4YT2A 4NCQA 2L7AA 1MMGA 4YJWA 3RVZA 5KYXA 2IM8A 2CNWD 3GWLA 1NFOA 3M4CA 2NUTA 4CS9C 2BE5F 2YLIA 4U5DE 5KYWB 2IXOA 2OEXA 4ONSA 4PFOA 3L1MA 1SZIA 2QE9A 3T4RA 2EILC 4O6MA 1RKEB 3ITFA 2CCYA 3BRJA 4CJGA 4D4NA 2Z15A 3G4ZA 3SEOA 4EBKA 5L0DA 3S0XA 1ZW3A 3IQTA 2IXNA 1S05A 1G8XA 3GM2A 1KNYA 4HFKB 4JCHA 2YZSA 2IXMA 3U9JA 4N4WA 2I15A 1MQVA 3LS1A 3UR3C 2W9YA 1VYIA 4GYTA 3NYLA 3KMIA 1ZU5A 4EBBA 2VC9A 2H7VC 2KW3C 4LLEA 4DXWA 4BG0A 3U8VA 3NRHA 1LVKA 4E18A 2R7WA 2R7QA 5KYYA 4AK9A 2J8WA 2MWQA 4O79A 1LI7A 1NG1A 2M64A 1I4YA 3EG9B 2GFHA 4MTOA 4O6YA 3RF3A 5B3SC 1R5ID 3NKDA 2RSEB 3W8HA 3VYWA 3TQOA 1Q0FA 2L9JA 1A7VA 1TWCA 1NLXA 4O7GA 1WOLA 4RBNA 3LESA 4EBJA 3FOPA 4BJTA 4DRJB 3PDMP 4GQHA 3Q7LA 1D0YA 1Z5ZA 5D91A 1LI5A 2OCCC 1D0ZA 1CGNA 2PP4A 3EGXA 2YVKA 3T6GB 2ASRA 5A6JA 1H9TA 1A7DA 1JOGA 2OJED 3G4XA 2YRFA 3GEHA 3JZ0A 4O6NA 4P9TA 3GM3A 3TOLA 1BR4A 3ZC4A 4BPMA 4DRIB 5L3QA 5JSLA 4C7OA 4AE4B 2EPNA 2JX0A 2O9XA 2HJMA 3U5SA 3V5YA 4E0IA 5CIVA 4Q4ZF 4W8PA 3O10A 1RCPA 3T6JA 1V4AA 2XRHA 1C02A 1Z23A 4PJLA 2ZXRA 3IPMO 1HE9A 1HY5A 1AEPA 2Y3HA 3HTKC 1LS4A 1LS1A 1TFKB 2QUPA 2XSEA 4PK4A 5D92A 3GORA 2Q7RA 3EH2A 2VB6A 3L0IA 3K7DA 3ABKC 1VMAA 1MMDA 4OD4A 3EQLF 3ZTMA 5L0CA 2GAQA 3M79A 2R02A 2VCBA 3NYMA 1VTMP 5K0IA 3KYJA 2YL0A 1MMAA 5KYXB 1EI7A 256BA 3U2LA 1FNTc 1Z7Qc 2EIKC 2KYHA 2NUTB 2Y3GA 3FOOA 3N24A 2A6HF 3DAGA 3K1IA 2QTVA 3DE9A 1K04A 4OD5A 5JRAA 1WGWA 2KC3A 2WVQA 4IAQA 1NFNA 3W8IA 3Q6MA 5DS6A 5L0HA 4JTCB 1ZZPA 2A69F 4XWJA 3O6XA 3RQGA 4P9FA 2KK1A 1I4ZA 5JP7A 2QY9A 1H9GA 1BDJB 2IYLD 2Q9CA 3BEHA 3C8GD 3DJUB 3ZTZA 1Q0KA 1UFBA 1RXQA 3RYLA 2WZFA 4CS7A 3C8GB 4IB4A 5KYYB 3S84A 1WATA 2HV6A 4QI2A 1BBHA 2PX0A 4JCZA 3IQ5A 3B9QA 3RKOF 1BZ4A 2VCCA 4DVYP 1OCRC 1ZW2A 3B0PA 4XEFA 3B0VC 3W2WA 4RDAA 2OG2A 1QKRA 1J8MF 2PF4E 1EA8A 1OW7A 2GDCA 1TWGA 2YHSA 2ICWG 4MVUA 2MYSA 3V7OA 3E9VA 3CAXA 4JURI 1ZHZA 2Y39A 2DGJA 3EGXB 1NU9C 2NUPA 3LUTB 2G3VA 5IY5C 2H7BA 2J7PA 4FAPB 2ZPAA 2XS1A 2J9VA 4C7OB 2HUJA 2CYDA 4HFFB 1CGOA 3JCUQ 4U5FE 4YT8A 3O39A 3NG1A 2LD6A 2R7SA 3IEEA 3TJ6A 1YLMA 2YQYA 1LE2A 2CW0F 3SXYA 2JD3A 1C17M 4J30B 5BQHA 5EGYA 2AP3A 4K0DA 2XLOA 4IJJA 4KC9A 2W45A 4KNWA 4C3EA 5B3IA 5JVEA 1E84A 3PHF2 2Q4FA 3M4BA 4PFPA 1VB5A 4WJ0A 1Z63A 4CSAC 5KYUA 3EZHA 3OWTA 3KYIA 2B0JA 1M2VA 1R4TA 3ZQYA 4BEMJ 4UDVA 3LJBA 5T3WA 4CIHA 3QW0A 5FZTA 4MW8A 4CS8A 5A6BA 2DI3A 5F5FA 1FMVA 2X51A 2XL4A 3EHNA 1ST6A 3RH3A 4BJ5C 2ZXPA 4XTKA 3SZRA 2F22A 4MVZA 1FFHA 4DJ9A 1J8YF 1I5NA 1AVOB 2J0XA 3B71A 1IZMA 3DI5A 3R2PA 4MTGA 1CPQA 5COGA 1PD1A 3ABLC 3L8IA 3LS0A 1LIHA 1Y4CA 1YVIA 4JVSA 3SXZA 3C7JA 3JYYA 2HZ8A 4U9EA 4YK5A 2J9UA 3FDQA 3ABMC 4LACB 4YL1A 1ZHTA 3HNKA 5BQGA 3I5QA 4CDAA 3W4YA 4OINF 4MVOA 1LM3B 2X0CA 4J32B 3S29A 4NC3A 3ZG1A 2VASA 1FMWA 4KBLA 4CBEA 1LPEA 2TMVP 2NSGA 4NTAA 2A68F 3S9OA 2NG1A 5EHHA 4E0HA 4XLPF 4FESA 1MNEA 1WASA 3ATPA 4ZLDA 1DOVA 5A6KA 4U9DA 2UUIA 5JUAA 3V5ZA 2HMZA 2W4MA 1UG7A 1RJ9A 2ZXWC 1HE1A 4XEVA 3CEXA 1N1CA 5F5HA 2J9BA 4DVZA 2J46A 3FAPB 3X2QC 4ANJA 4EIYA 1FTSA 4U5GA 3KH2A 5CI8A 3UMIA 3U8PA 4E7ZA 3UGOA 3NDBB 3L34A 1OR3A 3X1OA 4G7HF 5FCLA 1RMVA 3EFOA 4E17A 4K7BA 4NQFA 2VCAA 2MHRA 1JPJA 2XLVA 3DMDA 3JSZA 4Z9HA 2CDQA 1VLTA 2NUPB 3RFYA 4DOZA 3FXHA 2YEVA 3A11A 2LFDA 4N6CA 3DM9B 2R03A 3J06A 1M56C 2XLWA 4CIPA 5E33A 2LCHA 4CS9A 1D1AA 1OW8A 1Q0MA 1E86A 3QVZA 4N6HA 2WVNA 3EGDA 3GWNA 3LEVA 1GGQA 1CPRA 3K6BA 2YL1A 4K1OA 1SR2A 2WZGA 1E2XA 3U0CA 4JW1A 1OKKA 2L6FA 3AQBA 3MYIA 5L0IA 2HMQA 3VM6A 1CGME 2XL8A 1ORYA 2XLHA 3MBGA 4JZAA 2GWWA 3DZAA 4OIOF 1M2VB 3LLKA 1T6IA 2Q3TA 3DWWA 2IOQA 4PACA 1L7CA 3C62A 4NTBA 1TQGA 2M4EA 2WL8A 5DQZA 4JJFA 4BJ6C 3OA1A 1VYKA 2YWAA 4LERA 1ZHYA 3LEOA 5F28E 1G4WR 1U0BB 2P0NA 2EIMC 4CSAA 4JC7A 4XEKA 1YYJA 4R32A 3Q7GA 2PX3A 4PJJA 3DM5A 5L0FA 1JR8A 1YYXA 1BR1A 1VOMA 2XXAA 2EPKX 5TJ5E 3DD7A 3K1HA 1Z3IX 5A6AA 3JSEO 3Q6NA 4JKVA 3US6A 2LIGA 3EJNA 2AWCA 4JE9A 2J0WA 2VH3A 3LLIA 4YL0A 3ASOC 1K05A 2R25A 3HKKA 4EWCA 1XZPA 5L0GA 2G3KA 1U89A 2NPUA 2XLDA 3MLGA 2YL3A 3ZWIA 1QPUA 4JEBA 1A7EA 2P61A 4LDRA 2C03A 4W8KA 4I3MA 3LNMB 3T6BA 2B0HA 2EPLX 3VAYA 1RJ9B 2H7OA 3B29A 3ZIBA 5DVWA 1KU2A 2AWYA 1OR2A 1DOWA 3C63A 4YT5A 1ZHXA 4EKWA 2ZXOA 4JEAA 1T5OA 4U5BE 4CX9A 3OEOA 3MFNA 4G78A 3DE8A 3T9OA 3AQCA 2L6HA 3WAQA 5AC4A 2ZD9A 2PNOA 3KPHA 2HKVA 2YLGA 3O55A 3F46A 2R7XA 2UUHA 5DS5A 3EHMA 5JLIA 4H4KC 4QDLA 3DKAA 3GEEA 1JPNA 3U9MA 2LK4A 1ZVZA 5COFA 4XLNF 3VRCA 3WODF 4JIOA 2Y69C 1C03A 3M15A 4U5HA 1PV3A 2J9WA 4N06A 2HV7A 2P1AA 3AG4C 3ECSA 4J7TA 1GM5A 2L6GA 3WG7C 1JRAA 3NMIA 3EG9A 3NKEA 2OQMA 1WN0A 2IBFA 4MVMA 4P6IC 5DLJA 1Q0DA 3IHUA 2AU5A 1BR2A 1TR2A 1HMOA 3PMRA 1M6TA 1SMYF 1GS9A 1ZYRF 4XPXA 3QZCA 3U2MA 1V55C 2XS8A 1ZHWA 2EIJC 4IAOA 2KJGA 2HJ3A 1EKYA 1D1CA 2LQGA 3C8ZA 2I8BA 3I5PA 4GEHA 4C3DA 4OIPF 1PD0A 3GM1A 1O87A 1HW2A 3IQCA 1YZAA 3DJNB 3JYHA 3H2VA 1FFTC 4LLCA 4XPWA 5L3VA 2R7VA 2OU6A 3GEIA 3SNHA 1NBBA 1T9KA 5JS5A 2XXAB 4HEAJ 1VK5A 3G50A 1B68A 3MX3A 2OKUA 3CZ6A 1WTYA 4IGGA 2A0BA 4AX2A 4B6IA 1D0XA 1Q0GA 1K40A 3E70C 2KNHA 2YL7A 4U5EE 2P7VA 5GPGB 1JMWA 4MS2A 3UMHA 1RKCA 5B1AC 5DQTA 2OEVA 2Q9BA 1GQAA 1YARO 2QLAA 5T1DB 1O3UA 4IRUA 2FAPB 2WB7A 4M63A 3AOUA 5AC5A 1QLEC 4IWBA 4NY3A 5AGFA 2GA0A 1QQ3A 3EH1A 2EPOA 3HJCA 4PJNA 2DYSC 3M1CB 3RVYA 2KSFA 4J7YA 4WABA 3ZVRA 4OIRF 1G4US 1OW6A 2V3CC 3TK0A 1H7IA 1YA9A 3QMKA 3S90A
chains in the Genus database with same CATH topology
5B1BC 3POVA 2J7PD 1O5HA 1NZEA 1TKNA 3N2ZB 1MMNA 2W4BA 3ZSUA 3FVYA 3SYNA 4BJ5A 5T3TA 3FHDA 2KGOA 1SF8A 2DYRC 5E3AA 3LAYA 3FAJA 5DS4A 3UMKA 2FGYA 2FFHA 3UNGC 3K1IC 4Q7CA 4QI0A 3SP1A 2Y3BA 1MNDA 4PJMA 2WZLA 5KYUB 2CGEA 2E87A 5HSWA 4HE8D 2EINC 2PFDA 5BUOA 1ZU4A 4C3BA 2C04A 3N0TA 1W2WA 4KNVA 3GODA 5E3CA 4FX5A 2V26A 1NU7D 2L81A 4MNDA 3K66A 3EPVA 4JJGA 1IW7F 1TWHA 2P6VA 3S27A 2R7TA 3KKBA 4OIQF 4F4BA 2Y3DA 3RIPA 2LSEA 1QZXA 1S7ZA 5KYWA 4YT4A 2CNWA 3I4UA 3F47A 4G7OF 3EFOB 2D5RB 3AG3C 3CSKA 2R7RA 4I1OB 2R7OA 4RD9A 4BJ6A 3AG2C 1OCCC 3K33A 4G0HA 1M57C 1OCZC 1PCXA 4CS8C 3EGDB 4A2NB 1V54C 3TD7A 1D1BA 2WVOA 3CQZA 1OKKD 4KI2A 2J45A 4G7ZF 1LKXA 3DAFA 4BEJA 3JRTA 3NYJA 3DXJF 4DBQA 3AG1C 3HLZA 4X0RA 1Z6AA 4YWQA 4I44A 5E2QA 3S28A 2A1DD 4BJ1A 5KYNA 3KL4A 3GANA 4Q5SF 4AE4A 5CI9A 1OCOC 2IXPA 3B0UX 3ASNC 4YN0B 2KQ9A 4MQ9F 1M2OA 3JT1A 4U5CE 4I1MA 3W2VA 4DBRA 2G62A 2Q9AA 3LNRA 4E7SA 4ULWA 3H65A 1TWAA 3EZIA 4FWVA 2A6EF 4YT2A 5KYXA 1MMGA 4YJWA 2CNWD 4CS9C 2NUTA 2BE5F 4U5DE 5KYWB 2IXOA 4PFOA 1SZIA 3T4RA 2EILC 4O6MA 3ITFA 2Z15A 3S0XA 3SEOA 2IXNA 1G8XA 4HFKB 4JCHA 2YZSA 2IXMA 3LS1A 3UR3C 2W9YA 1VYIA 4GYTA 3NYLA 3KMIA 1ZU5A 4EBBA 2H7VC 2KW3C 4LLEA 4BG0A 3NRHA 1LVKA 2R7WA 2R7QA 5KYYA 4AK9A 2MWQA 4O79A 1NG1A 4O6YA 3EG9B 2GFHA 4CSAC 5B3SC 3W8HA 3NKDA 3VYWA 5F5FA 2L9JA 1TWCA 4O7GA 4RBNA 3LESA 4BJTA 3Q7LA 1D0YA 1Z5ZA 5D91A 2OCCC 2PP4A 1D0ZA 3EGXA 4O6NA 2R7UA 3ZC4A 1BR4A 5L3QA 4C7OA 4AE4B 2O9XA 4Q4ZF 3T6JA 2XRHA 1Z23A 4PJLA 2ZXRA 2Y3HA 3HTKC 1LS1A 5D92A 2XSEA 3EH2A 2VB6A 3L0IA 3K7DA 3ABKC 1VMAA 1MMDA 4OD4A 3EQLF 3NYMA 5KYXB 1MMAA 2EIKC 2NUTB 2Y3GA 3N24A 2A6HF 3DAGA 2QTVA 4OD5A 1WGWA 3W8IA 2WVQA 3Q6MA 5DS6A 2A69F 4XWJA 3O6XA 2QY9A 2IYLD 2Q9CA 3DJUB 3RYLA 2WZFA 4CS7A 5KYYB 2HV6A 4QI2A 2PX0A 3B9QA 3RKOF 4DVYP 1OCRC 3B0PA 3B0VC 3W2WA 4RDAA 2OG2A 1J8MF 2PF4E 1TWGA 2YHSA 2MYSA 3V7OA 3E9VA 4JURI 1ZHZA 2Y39A 2DGJA 3EGXB 1NU9C 2NUPA 2G3VA 5IY5C 2H7BA 2J7PA 2ZPAA 2J9VA 4C7OB 4HFFB 3JCUQ 4U5FE 4YT8A 3O39A 3NG1A 2R7SA 3IEEA 2CW0F 2JD3A 4J30B 5EGYA 4K0DA 4C3EA 4IJJA 4KC9A 2W45A 4KNWA 3PHF2 4PFPA 4WJ0A 1Z63A 5KYUA 3EZHA 3OWTA 2B0JA 1M2VA 3LJBA 5T3WA 4CIHA 4CS8A 1FMVA 2X51A 2XL4A 3EHNA 1ST6A 3RH3A 4BJ5C 2ZXPA 4XTKA 3SZRA 1FFHA 1J8YF 2J0XA 1IZMA 1PD1A 3ABLC 3LS0A 3ZG1A 4JVSA 3FDQA 2J9UA 3ABMC 4LACB 1ZHTA 3I5QA 4OINF 4J32B 3S29A 2VASA 1FMWA 4KBLA 4CBEA 2A68F 5EHHA 2NG1A 4XLPF 4FESA 1MNEA 4ZLDA 2W4MA 1RJ9A 2ZXWC 1N1CA 5F5HA 4DVZA 2J46A 3X2QC 4ANJA 4E7ZA 3UGOA 1FTSA 4U5GA 3KH2A 5CI8A 3UMIA 3NDBB 3L34A 3X1OA 4G7HF 5FCLA 3EFOA 4K7BA 3JSZA 1JPJA 3DMDA 2CDQA 2NUPB 3RFYA 4DOZA 2YEVA 3DM9B 1M56C 5E33A 4CS9A 1D1AA 2WVNA 3EGDA 3LEVA 3K6BA 2WZGA 4JW1A 1OKKA 3AQBA 4JZAA 3DZAA 4OIOF 1M2VB 3LLKA 2Q3TA 2IOQA 2M4EA 2WL8A 5DQZA 4JJFA 4BJ6C 3OA1A 1VYKA 4LERA 1ZHYA 2EIMC 4CSAA 3Q7GA 2PX3A 4PJJA 3DM5A 1BR1A 1VOMA 2XXAA 3DD7A 3K1HA 1Z3IX 3Q6NA 3EJNA 4EWCA 2J0WA 2VH3A 3LLIA 3ASOC 2G3KA 3MLGA 2C03A 4W8KA 4I3MA 3T6BA 3ZIBA 3VAYA 1RJ9B 2H7OA 5DVWA 1KU2A 4YT5A 1ZHXA 2ZXOA 4U5BE 3OEOA 3AQCA 3F46A 2R7XA 5DS5A 3EHMA 4H4KC 4QDLA 1JPNA 4XLNF 3WODF 2Y69C 4U5HA 2J9WA 4N06A 2HV7A 3AG4C 3ECSA 3WG7C 3EG9A 3NKEA 4P6IC 5DLJA 1BR2A 1TR2A 3PMRA 1ZYRF 3QZCA 1V55C 1ZHWA 2EIJC 4IAOA 2KJGA 1D1CA 2I8BA 3I5PA 4GEHA 4C3DA 1PD0A 1O87A 3DJNB 3JYHA 1FFTC 4LLCA 2R7VA 5L3VA 3SNHA 2XXAB 4HEAJ 1VK5A 4AX2A 3MX3A 3CZ6A 4B6IA 1D0XA 4U5EE 3E70C 2KNHA 3UMHA 4ZLCA 2P7VA 5DQTA 3UGPA 4OIPF 5B1AC 2Q9BA 5T1DB 4IRUA 2WB7A 4M63A 1QLEC 4IWBA 4NY3A 3EH1A 3HJCA 4PJNA 2DYSC 3M1CB 3ZVRA 4OIRF 2V3CC 1SMYF 4PK4A 3QMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MLG A; 
#chains in the Genus database with same CATH topology
 3JRM O;  1XZQ A;  2AVK A;  5B1B C;  1FAP B;  2EPM X;  1Y6D A;  3POV A;  1VLS A;  2J7P D;  1O5H A;  4JTA B;  1NZE A;  2PBE A;  2XM4 A;  1TKN A;  3N2Z B;  1QSP A;  3C18 A;  3R7C A;  1KTM A;  1OQC A;  1MMN A;  2D4U A;  3MYF A;  2W4B A;  3ZSU A;  3FVY A;  3SYN A;  4BJ5 A;  5T3T A;  1YZC A;  3FHD A;  4WGY A;  4XQ1 A;  2KGO A;  1SF8 A;  2DYR C;  5E3A A;  2R05 A;  4NTF A;  1WWP A;  3LAY A;  3C8G A;  3FAJ A;  4CDV A;  5DS4 A;  3UMK A;  2FGY A;  2FFH A;  1XWJ A;  4Z9I A;  3K1I C;  3UNG C;  4Q7C A;  4QI0 A;  5EK0 A;  1FR0 A;  1H6G A;  3SP1 A;  4XPY A;  2Y3B A;  4AL1 A;  1MND A;  4PJM A;  2WZL A;  2HSQ A;  4ZLC A;  5BQI A;  1ORS C;  5KYU B;  2CGE A;  4D4X A;  2E87 A;  5A6B D;  5JT4 A;  2HFI A;  1NSG B;  5HSW A;  4HE8 D;  3TJ5 A;  2EIN C;  2PFD A;  3SXM A;  3VF0 A;  5BUO A;  1OXK A;  3SXK A;  1ZU4 A;  4C3B A;  2C04 A;  3N0T A;  3UGP A;  4EUK B;  4LDQ A;  4YL3 A;  1W2W A;  2NSF A;  4MTF A;  4KNV A;  2HSB A;  3GOD A;  5L0J A;  4EHP A;  5E3C A;  4FX5 A;  1YDI A;  4JRZ A;  3TUL A;  2V26 A;  1NU7 D;  3IQ6 A;  4IAR A;  2L81 A;  4H54 A;  3PCV A;  1T01 A;  3QW1 A;  3K66 A;  4MND A;  4MW3 A;  1AUE A;  3EPV A;  4JJG A;  1HW1 A;  2LFF A;  1IW7 F;  1TWH A;  2P6V A;  4A4A A;  3S27 A;  2R7T A;  3AJM A;  2ETS A;  3KKB A;  4OIQ F;  4F4B A;  2Y3D A;  3ZQV A;  3JTL O;  1E83 A;  3HNJ A;  3QTH A;  3RIP A;  1EQ1 A;  2LSE A;  1QZX A;  1A41 A;  1APC A;  3RQE A;  3WHN A;  1S7Z A;  4CJO A;  5KYW A;  2BL2 A;  4YT4 A;  2CNW A;  3U3F A;  3I4U A;  2H8A A;  3F47 A;  4G7O F;  3V5X A;  5A69 A;  1RKE A;  3EFO B;  3HNL A;  2D5R B;  1OXB A;  3AG3 C;  3AGT A;  4WGZ A;  3ZDL A;  4PR9 A;  1U6H A;  3CSK A;  3QVY A;  2R7R A;  1JAF A;  3NMK A;  2XL6 A;  4I1O B;  1E85 A;  2R7O A;  4RD9 A;  4BJ6 A;  3AG2 C;  2XLE A;  1OCC C;  3K33 A;  5COM A;  4G0H A;  1M57 C;  2HS5 A;  1OCZ C;  3H2U A;  3U3B A;  1ORJ A;  1PCX A;  4CS8 C;  4AL0 A;  2R7U A;  3EGD B;  4A2N B;  1V54 C;  4DRH B;  3TD7 A;  1QVX A;  1D1B A;  2WVO A;  2OJQ A;  2YLD A;  2R9R B;  3A9C A;  2XLM A;  1OKK D;  3CQZ A;  4KI2 A;  4LDK A;  1YAU O;  1YJG A;  1SYQ A;  2J45 A;  4G7Z F;  1LKX A;  2QNL A;  3DAF A;  4BEJ A;  2JPU A;  1V74 B;  3AGU A;  3JRT A;  4JTD B;  4Z9J A;  2DB4 A;  3DXJ F;  3NYJ A;  4ULV A;  4DBQ A;  3AG1 C;  3HLZ A;  4X0R A;  4MVS A;  1Z6A A;  4YWQ A;  4I44 A;  5E2Q A;  3S28 A;  1LE4 A;  4MVQ A;  2A1D D;  1YA7 O;  1HMD A;  4BJ1 A;  4ER9 A;  2OOC A;  5KYN A;  2BC5 A;  3RW0 A;  3KL4 A;  3GAN A;  4Q5S F;  1T6U A;  4AE4 A;  5CI9 A;  3HNI A;  5HV9 A;  2LP4 A;  1OCO C;  2IXP A;  3FMS A;  3B0U X;  3ASN C;  4YN0 B;  2KQ9 A;  1L3P A;  1M2O A;  2A0U A;  4MQ9 F;  2Q00 A;  2RD9 A;  3JT1 A;  2XM0 A;  4MVR A;  4U5C E;  1F1M A;  4I1M A;  3W2V A;  4CDY A;  4L6R A;  3NMJ A;  1G5Z A;  4DBR A;  2G62 A;  2Q9A A;  1TFO B;  3LNR A;  4E7S A;  4ULW A;  3H65 A;  1TWA A;  3EZI A;  3RQF A;  2YKZ A;  1A0B A;  3TOM A;  3L8J A;  4FWV A;  2A6E F;  1T6Q A;  4YT2 A;  4NCQ A;  2L7A A;  1MMG A;  4YJW A;  3RVZ A;  5KYX A;  2IM8 A;  2CNW D;  3GWL A;  1NFO A;  3M4C A;  2NUT A;  4CS9 C;  2BE5 F;  2YLI A;  4U5D E;  5KYW B;  2IXO A;  2OEX A;  4ONS A;  4PFO A;  3L1M A;  1SZI A;  2QE9 A;  3T4R A;  2EIL C;  4O6M A;  1RKE B;  3ITF A;  2CCY A;  3BRJ A;  4CJG A;  4D4N A;  2Z15 A;  3G4Z A;  3SEO A;  4EBK A;  5L0D A;  3S0X A;  1ZW3 A;  3IQT A;  2IXN A;  1S05 A;  1G8X A;  3GM2 A;  1KNY A;  4HFK B;  4JCH A;  2YZS A;  2IXM A;  3U9J A;  4N4W A;  2I15 A;  1MQV A;  3LS1 A;  3UR3 C;  2W9Y A;  1VYI A;  4GYT A;  3NYL A;  3KMI A;  1ZU5 A;  4EBB A;  2VC9 A;  2H7V C;  2KW3 C;  4LLE A;  4DXW A;  4BG0 A;  3U8V A;  3NRH A;  1LVK A;  4E18 A;  2R7W A;  2R7Q A;  5KYY A;  4AK9 A;  2J8W A;  2MWQ A;  4O79 A;  1LI7 A;  1NG1 A;  2M64 A;  1I4Y A;  3EG9 B;  2GFH A;  4MTO A;  4O6Y A;  3RF3 A;  5B3S C;  1R5I D;  3NKD A;  2RSE B;  3W8H A;  3VYW A;  3TQO A;  1Q0F A;  2L9J A;  1A7V A;  1TWC A;  1NLX A;  4O7G A;  1WOL A;  4RBN A;  3LES A;  4EBJ A;  3FOP A;  4BJT A;  4DRJ B;  3PDM P;  4GQH A;  3Q7L A;  1D0Y A;  1Z5Z A;  5D91 A;  1LI5 A;  2OCC C;  1D0Z A;  1CGN A;  2PP4 A;  3EGX A;  2YVK A;  3T6G B;  2ASR A;  5A6J A;  1H9T A;  1A7D A;  1JOG A;  2OJE D;  3G4X A;  2YRF A;  3GEH A;  3JZ0 A;  4O6N A;  4P9T A;  3GM3 A;  3TOL A;  1BR4 A;  3ZC4 A;  4BPM A;  4DRI B;  5L3Q A;  5JSL A;  4C7O A;  4AE4 B;  2EPN A;  2JX0 A;  2O9X A;  2HJM A;  3U5S A;  3V5Y A;  4E0I A;  5CIV A;  4Q4Z F;  4W8P A;  3O10 A;  1RCP A;  3T6J A;  1V4A A;  2XRH A;  1C02 A;  1Z23 A;  4PJL A;  2ZXR A;  3IPM O;  1HE9 A;  1HY5 A;  1AEP A;  2Y3H A;  3HTK C;  1LS4 A;  1LS1 A;  1TFK B;  2QUP A;  2XSE A;  4PK4 A;  5D92 A;  3GOR A;  2Q7R A;  3EH2 A;  2VB6 A;  3L0I A;  3K7D A;  3ABK C;  1VMA A;  1MMD A;  4OD4 A;  3EQL F;  3ZTM A;  5L0C A;  2GAQ A;  3M79 A;  2R02 A;  2VCB A;  3NYM A;  1VTM P;  5K0I A;  3KYJ A;  2YL0 A;  1MMA A;  5KYX B;  1EI7 A;  256B A;  3U2L A;  1FNT c;  1Z7Q c;  2EIK C;  2KYH A;  2NUT B;  2Y3G A;  3FOO A;  3N24 A;  2A6H F;  3DAG A;  3K1I A;  2QTV A;  3DE9 A;  1K04 A;  4OD5 A;  5JRA A;  1WGW A;  2KC3 A;  2WVQ A;  4IAQ A;  1NFN A;  3W8I A;  3Q6M A;  5DS6 A;  5L0H A;  4JTC B;  1ZZP A;  2A69 F;  4XWJ A;  3O6X A;  3RQG A;  4P9F A;  2KK1 A;  1I4Z A;  5JP7 A;  2QY9 A;  1H9G A;  1BDJ B;  2IYL D;  2Q9C A;  3BEH A;  3C8G D;  3DJU B;  3ZTZ A;  1Q0K A;  1UFB A;  1RXQ A;  3RYL A;  2WZF A;  4CS7 A;  3C8G B;  4IB4 A;  5KYY B;  3S84 A;  1WAT A;  2HV6 A;  4QI2 A;  1BBH A;  2PX0 A;  4JCZ A;  3IQ5 A;  3B9Q A;  3RKO F;  1BZ4 A;  2VCC A;  4DVY P;  1OCR C;  1ZW2 A;  3B0P A;  4XEF A;  3B0V C;  3W2W A;  4RDA A;  2OG2 A;  1QKR A;  1J8M F;  2PF4 E;  1EA8 A;  1OW7 A;  2GDC A;  1TWG A;  2YHS A;  2ICW G;  4MVU A;  2MYS A;  3V7O A;  3E9V A;  3CAX A;  4JUR I;  1ZHZ A;  2Y39 A;  2DGJ A;  3EGX B;  1NU9 C;  2NUP A;  3LUT B;  2G3V A;  5IY5 C;  2H7B A;  2J7P A;  4FAP B;  2ZPA A;  2XS1 A;  2J9V A;  4C7O B;  2HUJ A;  2CYD A;  4HFF B;  1CGO A;  3JCU Q;  4U5F E;  4YT8 A;  3O39 A;  3NG1 A;  2LD6 A;  2R7S A;  3IEE A;  3TJ6 A;  1YLM A;  2YQY A;  1LE2 A;  2CW0 F;  3SXY A;  2JD3 A;  1C17 M;  4J30 B;  5BQH A;  5EGY A;  2AP3 A;  4K0D A;  2XLO A;  4IJJ A;  4KC9 A;  2W45 A;  4KNW A;  4C3E A;  5B3I A;  5JVE A;  1E84 A;  3PHF 2;  2Q4F A;  3M4B A;  4PFP A;  1VB5 A;  4WJ0 A;  1Z63 A;  4CSA C;  5KYU A;  3EZH A;  3OWT A;  3KYI A;  2B0J A;  1M2V A;  1R4T A;  3ZQY A;  4BEM J;  4UDV A;  3LJB A;  5T3W A;  4CIH A;  3QW0 A;  5FZT A;  4MW8 A;  4CS8 A;  5A6B A;  2DI3 A;  5F5F A;  1FMV A;  2X51 A;  2XL4 A;  3EHN A;  1ST6 A;  3RH3 A;  4BJ5 C;  2ZXP A;  4XTK A;  3SZR A;  2F22 A;  4MVZ A;  1FFH A;  4DJ9 A;  1J8Y F;  1I5N A;  1AVO B;  2J0X A;  3B71 A;  1IZM A;  3DI5 A;  3R2P A;  4MTG A;  1CPQ A;  5COG A;  1PD1 A;  3ABL C;  3L8I A;  3LS0 A;  1LIH A;  1Y4C A;  1YVI A;  4JVS A;  3SXZ A;  3C7J A;  3JYY A;  2HZ8 A;  4U9E A;  4YK5 A;  2J9U A;  3FDQ A;  3ABM C;  4LAC B;  4YL1 A;  1ZHT A;  3HNK A;  5BQG A;  3I5Q A;  4CDA A;  3W4Y A;  4OIN F;  4MVO A;  1LM3 B;  2X0C A;  4J32 B;  3S29 A;  4NC3 A;  3ZG1 A;  2VAS A;  1FMW A;  4KBL A;  4CBE A;  1LPE A;  2TMV P;  2NSG A;  4NTA A;  2A68 F;  3S9O A;  2NG1 A;  5EHH A;  4E0H A;  4XLP F;  4FES A;  1MNE A;  1WAS A;  3ATP A;  4ZLD A;  1DOV A;  5A6K A;  4U9D A;  2UUI A;  5JUA A;  3V5Z A;  2HMZ A;  2W4M A;  1UG7 A;  1RJ9 A;  2ZXW C;  1HE1 A;  4XEV A;  3CEX A;  1N1C A;  5F5H A;  2J9B A;  4DVZ A;  2J46 A;  3FAP B;  3X2Q C;  4ANJ A;  4EIY A;  1FTS A;  4U5G A;  3KH2 A;  5CI8 A;  3UMI A;  3U8P A;  4E7Z A;  3UGO A;  3NDB B;  3L34 A;  1OR3 A;  3X1O A;  4G7H F;  5FCL A;  1RMV A;  3EFO A;  4E17 A;  4K7B A;  4NQF A;  2VCA A;  2MHR A;  1JPJ A;  2XLV A;  3DMD A;  3JSZ A;  4Z9H A;  2CDQ A;  1VLT A;  2NUP B;  3RFY A;  4DOZ A;  3FXH A;  2YEV A;  3A11 A;  2LFD A;  4N6C A;  3DM9 B;  2R03 A;  3J06 A;  1M56 C;  2XLW A;  4CIP A;  5E33 A;  2LCH A;  4CS9 A;  1D1A A;  1OW8 A;  1Q0M A;  1E86 A;  3QVZ A;  4N6H A;  2WVN A;  3EGD A;  3GWN A;  3LEV A;  1GGQ A;  1CPR A;  3K6B A;  2YL1 A;  4K1O A;  1SR2 A;  2WZG A;  1E2X A;  3U0C A;  4JW1 A;  1OKK A;  2L6F A;  3AQB A;  3MYI A;  5L0I A;  2HMQ A;  3VM6 A;  1CGM E;  2XL8 A;  1ORY A;  2XLH A;  3MBG A;  4JZA A;  2GWW A;  3DZA A;  4OIO F;  1M2V B;  3LLK A;  1T6I A;  2Q3T A;  3DWW A;  2IOQ A;  4PAC A;  1L7C A;  3C62 A;  4NTB A;  1TQG A;  2M4E A;  2WL8 A;  5DQZ A;  4JJF A;  4BJ6 C;  3OA1 A;  1VYK A;  2YWA A;  4LER A;  1ZHY A;  3LEO A;  5F28 E;  1G4W R;  1U0B B;  2P0N A;  2EIM C;  4CSA A;  4JC7 A;  4XEK A;  1YYJ A;  4R32 A;  3Q7G A;  2PX3 A;  4PJJ A;  3DM5 A;  5L0F A;  1JR8 A;  1YYX A;  1BR1 A;  1VOM A;  2XXA A;  2EPK X;  5TJ5 E;  3DD7 A;  3K1H A;  1Z3I X;  5A6A A;  3JSE O;  3Q6N A;  4JKV A;  3US6 A;  2LIG A;  3EJN A;  2AWC A;  4JE9 A;  2J0W A;  2VH3 A;  3LLI A;  4YL0 A;  3ASO C;  1K05 A;  2R25 A;  3HKK A;  4EWC A;  1XZP A;  5L0G A;  2G3K A;  1U89 A;  2NPU A;  2XLD A;  3MLG A;  2YL3 A;  3ZWI A;  1QPU A;  4JEB A;  1A7E A;  2P61 A;  4LDR A;  2C03 A;  4W8K A;  4I3M A;  3LNM B;  3T6B A;  2B0H A;  2EPL X;  3VAY A;  1RJ9 B;  2H7O A;  3B29 A;  3ZIB A;  5DVW A;  1KU2 A;  2AWY A;  1OR2 A;  1DOW A;  3C63 A;  4YT5 A;  1ZHX A;  4EKW A;  2ZXO A;  4JEA A;  1T5O A;  4U5B E;  4CX9 A;  3OEO A;  3MFN A;  4G78 A;  3DE8 A;  3T9O A;  3AQC A;  2L6H A;  3WAQ A;  5AC4 A;  2ZD9 A;  2PNO A;  3KPH A;  2HKV A;  2YLG A;  3O55 A;  3F46 A;  2R7X A;  2UUH A;  5DS5 A;  3EHM A;  5JLI A;  4H4K C;  4QDL A;  3DKA A;  3GEE A;  1JPN A;  3U9M A;  2LK4 A;  1ZVZ A;  5COF A;  4XLN F;  3VRC A;  3WOD F;  4JIO A;  2Y69 C;  1C03 A;  3M15 A;  4U5H A;  1PV3 A;  2J9W A;  4N06 A;  2HV7 A;  2P1A A;  3AG4 C;  3ECS A;  4J7T A;  1GM5 A;  2L6G A;  3WG7 C;  1JRA A;  3NMI A;  3EG9 A;  3NKE A;  2OQM A;  1WN0 A;  2IBF A;  4MVM A;  4P6I C;  5DLJ A;  1Q0D A;  3IHU A;  2AU5 A;  1BR2 A;  1TR2 A;  1HMO A;  3PMR A;  1M6T A;  1SMY F;  1GS9 A;  1ZYR F;  4XPX A;  3QZC A;  3U2M A;  1V55 C;  2XS8 A;  1ZHW A;  2EIJ C;  4IAO A;  2KJG A;  2HJ3 A;  1EKY A;  1D1C A;  2LQG A;  3C8Z A;  2I8B A;  3I5P A;  4GEH A;  4C3D A;  4OIP F;  1PD0 A;  3GM1 A;  1O87 A;  1HW2 A;  3IQC A;  1YZA A;  3DJN B;  3JYH A;  3H2V A;  1FFT C;  4LLC A;  4XPW A;  5L3V A;  2R7V A;  2OU6 A;  3GEI A;  3SNH A;  1NBB A;  1T9K A;  5JS5 A;  2XXA B;  4HEA J;  1VK5 A;  3G50 A;  1B68 A;  3MX3 A;  2OKU A;  3CZ6 A;  1WTY A;  4IGG A;  2A0B A;  4AX2 A;  4B6I A;  1D0X A;  1Q0G A;  1K40 A;  3E70 C;  2KNH A;  2YL7 A;  4U5E E;  2P7V A;  5GPG B;  1JMW A;  4MS2 A;  3UMH A;  1RKC A;  5B1A C;  5DQT A;  2OEV A;  2Q9B A;  1GQA A;  1YAR O;  2QLA A;  5T1D B;  1O3U A;  4IRU A;  2FAP B;  2WB7 A;  4M63 A;  3AOU A;  5AC5 A;  1QLE C;  4IWB A;  4NY3 A;  5AGF A;  2GA0 A;  1QQ3 A;  3EH1 A;  2EPO A;  3HJC A;  4PJN A;  2DYS C;  3M1C B;  3RVY A;  2KSF A;  4J7Y A;  4WAB A;  3ZVR A;  4OIR F;  1G4U S;  1OW6 A;  2V3C C;  3TK0 A;  1H7I A;  1YA9 A;  3QMK A;  3S90 A; 
#chains in the Genus database with same CATH homology
 5B1B C;  3POV A;  2J7P D;  1O5H A;  1NZE A;  1TKN A;  3N2Z B;  1MMN A;  2W4B A;  3ZSU A;  3FVY A;  3SYN A;  4BJ5 A;  5T3T A;  3FHD A;  2KGO A;  1SF8 A;  2DYR C;  5E3A A;  3LAY A;  3FAJ A;  5DS4 A;  3UMK A;  2FGY A;  2FFH A;  3UNG C;  3K1I C;  4Q7C A;  4QI0 A;  3SP1 A;  2Y3B A;  1MND A;  4PJM A;  2WZL A;  5KYU B;  2CGE A;  2E87 A;  5HSW A;  4HE8 D;  2EIN C;  2PFD A;  5BUO A;  1ZU4 A;  4C3B A;  2C04 A;  3N0T A;  1W2W A;  4KNV A;  3GOD A;  5E3C A;  4FX5 A;  2V26 A;  1NU7 D;  2L81 A;  4MND A;  3K66 A;  3EPV A;  4JJG A;  1IW7 F;  1TWH A;  2P6V A;  3S27 A;  2R7T A;  3KKB A;  4OIQ F;  4F4B A;  2Y3D A;  3RIP A;  2LSE A;  1QZX A;  1S7Z A;  5KYW A;  4YT4 A;  2CNW A;  3I4U A;  3F47 A;  4G7O F;  3EFO B;  2D5R B;  3AG3 C;  3CSK A;  2R7R A;  4I1O B;  2R7O A;  4RD9 A;  4BJ6 A;  3AG2 C;  1OCC C;  3K33 A;  4G0H A;  1M57 C;  1OCZ C;  1PCX A;  4CS8 C;  3EGD B;  4A2N B;  1V54 C;  3TD7 A;  1D1B A;  2WVO A;  3CQZ A;  1OKK D;  4KI2 A;  2J45 A;  4G7Z F;  1LKX A;  3DAF A;  4BEJ A;  3JRT A;  3NYJ A;  3DXJ F;  4DBQ A;  3AG1 C;  3HLZ A;  4X0R A;  1Z6A A;  4YWQ A;  4I44 A;  5E2Q A;  3S28 A;  2A1D D;  4BJ1 A;  5KYN A;  3KL4 A;  3GAN A;  4Q5S F;  4AE4 A;  5CI9 A;  1OCO C;  2IXP A;  3B0U X;  3ASN C;  4YN0 B;  2KQ9 A;  4MQ9 F;  1M2O A;  3JT1 A;  4U5C E;  4I1M A;  3W2V A;  4DBR A;  2G62 A;  2Q9A A;  3LNR A;  4E7S A;  4ULW A;  3H65 A;  1TWA A;  3EZI A;  4FWV A;  2A6E F;  4YT2 A;  5KYX A;  1MMG A;  4YJW A;  2CNW D;  4CS9 C;  2NUT A;  2BE5 F;  4U5D E;  5KYW B;  2IXO A;  4PFO A;  1SZI A;  3T4R A;  2EIL C;  4O6M A;  3ITF A;  2Z15 A;  3S0X A;  3SEO A;  2IXN A;  1G8X A;  4HFK B;  4JCH A;  2YZS A;  2IXM A;  3LS1 A;  3UR3 C;  2W9Y A;  1VYI A;  4GYT A;  3NYL A;  3KMI A;  1ZU5 A;  4EBB A;  2H7V C;  2KW3 C;  4LLE A;  4BG0 A;  3NRH A;  1LVK A;  2R7W A;  2R7Q A;  5KYY A;  4AK9 A;  2MWQ A;  4O79 A;  1NG1 A;  4O6Y A;  3EG9 B;  2GFH A;  4CSA C;  5B3S C;  3W8H A;  3NKD A;  3VYW A;  5F5F A;  2L9J A;  1TWC A;  4O7G A;  4RBN A;  3LES A;  4BJT A;  3Q7L A;  1D0Y A;  1Z5Z A;  5D91 A;  2OCC C;  2PP4 A;  1D0Z A;  3EGX A;  4O6N A;  2R7U A;  3ZC4 A;  1BR4 A;  5L3Q A;  4C7O A;  4AE4 B;  2O9X A;  4Q4Z F;  3T6J A;  2XRH A;  1Z23 A;  4PJL A;  2ZXR A;  2Y3H A;  3HTK C;  1LS1 A;  5D92 A;  2XSE A;  3EH2 A;  2VB6 A;  3L0I A;  3K7D A;  3ABK C;  1VMA A;  1MMD A;  4OD4 A;  3EQL F;  3NYM A;  5KYX B;  1MMA A;  2EIK C;  2NUT B;  2Y3G A;  3N24 A;  2A6H F;  3DAG A;  2QTV A;  4OD5 A;  1WGW A;  3W8I A;  2WVQ A;  3Q6M A;  5DS6 A;  2A69 F;  4XWJ A;  3O6X A;  2QY9 A;  2IYL D;  2Q9C A;  3DJU B;  3RYL A;  2WZF A;  4CS7 A;  5KYY B;  2HV6 A;  4QI2 A;  2PX0 A;  3B9Q A;  3RKO F;  4DVY P;  1OCR C;  3B0P A;  3B0V C;  3W2W A;  4RDA A;  2OG2 A;  1J8M F;  2PF4 E;  1TWG A;  2YHS A;  2MYS A;  3V7O A;  3E9V A;  4JUR I;  1ZHZ A;  2Y39 A;  2DGJ A;  3EGX B;  1NU9 C;  2NUP A;  2G3V A;  5IY5 C;  2H7B A;  2J7P A;  2ZPA A;  2J9V A;  4C7O B;  4HFF B;  3JCU Q;  4U5F E;  4YT8 A;  3O39 A;  3NG1 A;  2R7S A;  3IEE A;  2CW0 F;  2JD3 A;  4J30 B;  5EGY A;  4K0D A;  4C3E A;  4IJJ A;  4KC9 A;  2W45 A;  4KNW A;  3PHF 2;  4PFP A;  4WJ0 A;  1Z63 A;  5KYU A;  3EZH A;  3OWT A;  2B0J A;  1M2V A;  3LJB A;  5T3W A;  4CIH A;  4CS8 A;  1FMV A;  2X51 A;  2XL4 A;  3EHN A;  1ST6 A;  3RH3 A;  4BJ5 C;  2ZXP A;  4XTK A;  3SZR A;  1FFH A;  1J8Y F;  2J0X A;  1IZM A;  1PD1 A;  3ABL C;  3LS0 A;  3ZG1 A;  4JVS A;  3FDQ A;  2J9U A;  3ABM C;  4LAC B;  1ZHT A;  3I5Q A;  4OIN F;  4J32 B;  3S29 A;  2VAS A;  1FMW A;  4KBL A;  4CBE A;  2A68 F;  5EHH A;  2NG1 A;  4XLP F;  4FES A;  1MNE A;  4ZLD A;  2W4M A;  1RJ9 A;  2ZXW C;  1N1C A;  5F5H A;  4DVZ A;  2J46 A;  3X2Q C;  4ANJ A;  4E7Z A;  3UGO A;  1FTS A;  4U5G A;  3KH2 A;  5CI8 A;  3UMI A;  3NDB B;  3L34 A;  3X1O A;  4G7H F;  5FCL A;  3EFO A;  4K7B A;  3JSZ A;  1JPJ A;  3DMD A;  2CDQ A;  2NUP B;  3RFY A;  4DOZ A;  2YEV A;  3DM9 B;  1M56 C;  5E33 A;  4CS9 A;  1D1A A;  2WVN A;  3EGD A;  3LEV A;  3K6B A;  2WZG A;  4JW1 A;  1OKK A;  3AQB A;  4JZA A;  3DZA A;  4OIO F;  1M2V B;  3LLK A;  2Q3T A;  2IOQ A;  2M4E A;  2WL8 A;  5DQZ A;  4JJF A;  4BJ6 C;  3OA1 A;  1VYK A;  4LER A;  1ZHY A;  2EIM C;  4CSA A;  3Q7G A;  2PX3 A;  4PJJ A;  3DM5 A;  1BR1 A;  1VOM A;  2XXA A;  3DD7 A;  3K1H A;  1Z3I X;  3Q6N A;  3EJN A;  4EWC A;  2J0W A;  2VH3 A;  3LLI A;  3ASO C;  2G3K A;  3MLG A;  2C03 A;  4W8K A;  4I3M A;  3T6B A;  3ZIB A;  3VAY A;  1RJ9 B;  2H7O A;  5DVW A;  1KU2 A;  4YT5 A;  1ZHX A;  2ZXO A;  4U5B E;  3OEO A;  3AQC A;  3F46 A;  2R7X A;  5DS5 A;  3EHM A;  4H4K C;  4QDL A;  1JPN A;  4XLN F;  3WOD F;  2Y69 C;  4U5H A;  2J9W A;  4N06 A;  2HV7 A;  3AG4 C;  3ECS A;  3WG7 C;  3EG9 A;  3NKE A;  4P6I C;  5DLJ A;  1BR2 A;  1TR2 A;  3PMR A;  1ZYR F;  3QZC A;  1V55 C;  1ZHW A;  2EIJ C;  4IAO A;  2KJG A;  1D1C A;  2I8B A;  3I5P A;  4GEH A;  4C3D A;  1PD0 A;  1O87 A;  3DJN B;  3JYH A;  1FFT C;  4LLC A;  2R7V A;  5L3V A;  3SNH A;  2XXA B;  4HEA J;  1VK5 A;  4AX2 A;  3MX3 A;  3CZ6 A;  4B6I A;  1D0X A;  4U5E E;  3E70 C;  2KNH A;  3UMH A;  4ZLC A;  2P7V A;  5DQT A;  3UGP A;  4OIP F;  5B1A C;  2Q9B A;  5T1D B;  4IRU A;  2WB7 A;  4M63 A;  1QLE C;  4IWB A;  4NY3 A;  3EH1 A;  3HJC A;  4PJN A;  2DYS C;  3M1C B;  3ZVR A;  4OIR F;  2V3C C;  1SMY F;  4PK4 A;  3QMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...