3GANA

Crystal structure of gene product from arabidopsis thaliana at3g22680 with bound suramin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
113
Chain Sequence
SLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein At3g22680
publication title Crystal structure of gene product from Arabidopsis thaliana At3g22680 with bound suramin
rcsb
source organism Arabidopsis thaliana
total genus 38
structure length 113
sequence length 119
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ganA00
2Q3TA 1VK5A 3GANA
chains in the Genus database with same CATH superfamily
3IPMO 4OIPF 1VOMA 3NMIA 4YN0B 4M63A 1A7EA 2O9XA 4GYTA 3CEXA 4JTCB 3CAXA 1FR0A 2HV6A 4CBEA 3F47A 1MNDA 1FFHA 1QSPA 1OCOC 1TWCA 2JPUA 2Q3TA 3AGUA 1JPJA 3JRMO 3DAGA 3L1MA 4FESA 4PACA 3U8PA 1UFBA 1LKXA 4XLPF 3TOMA 3B9QA 3GODA 2OOCA 3EZHA 3R2PA 2J9UA 4G7OF 2YL3A 1H9GA 2C03A 3JZ0A 3L34A 1H9TA 2RSEB 5KYUB 2EPNA 1Y6DA 3GM2A 4JC7A 2AWYA 1TWHA 3AOUA 3EJNA 3K1HA 1Q0FA 4BJ5C 1T6IA 3DJUB 3JYYA 2X0CA 3ZIBA 2LSEA 1CPRA 4WJ0A 3W2VA 3S90A 1C02A 2Y39A 3QTHA 4ZLDA 1MMGA 4ONSA 2J0XA 2WB7A 1D1CA 3AG1C 4IAOA 4YWQA 2XLWA 1NLXA 3G4XA 1A7VA 2P61A 4XPYA 1EQ1A 3S27A 3IHUA 1BR4A 3LAYA 3LUTB 5AGFA 3TQOA 1YA9A 1VTMP 2J9WA 4U5FE 2C04A 4O6NA 2R7QA 5E2QA 2HSBA 5KYNA 1LI7A 3NYMA 4L6RA 2HV7A 4XPWA 1I5NA 1Q0KA 2HSQA 3FOOA 4JVSA 2IYLD 1OCZC 4P6IC 2YLDA 2G3KA 2IXMA 3SXZA 1WN0A 4U5HA 2IXNA 1OW7A 1XZQA 5JSLA 1APCA 3K66A 4XQ1A 3SEOA 3T9OA 1RJ9A 3DAFA 4P9FA 1R4TA 4JCZA 1M2VB 4JRZA 2NUTB 4U5BE 2QTVA 1JOGA 5KYYB 4JW1A 3EH2A 2GDCA 1PCXA 2CW0F 2P0NA 2I8BA 3DM9B 4U9EA 4E18A 5KYUA 1Z6AA 3UMIA 1ZW2A 1Y4CA 4LDRA 5JLIA 4EHPA 2L9JA 1WOLA 4IGGA 3B29A 4LDKA 5L0IA 3NRHA 1OKKD 1OR3A 4AL0A 4XEKA 3PHF2 3DI5A 4CDVA 3VRCA 1TR2A 3FXHA 2XM0A 4U9DA 1A41A 1O87A 4Z9HA 4A4AA 2DB4A 4FAPB 4J7TA 1PV3A 4YT5A 5EK0A 4DRIB 1BBHA 1QVXA 2LD6A 2VH3A 4X0RA 1NFOA 1ZU5A 2P6VA 3SP1A 2NSFA 1YZAA 4EKWA 4D4XA 2A6EF 3RF3A 1EKYA 3U0CA 2UUIA 1OR2A 5L3VA 2Q7RA 2EINC 4ER9A 3LLIA 1M57C 2OCCC 3J06A 5L3QA 3RIPA 2YHSA 1L3PA 3NG1A 5HSWA 2D5RB 2LK4A 2YL7A 3L0IA 4BPMA 3KYIA 3UMHA 3ASOC 3ZSUA 1M2VA 3I5PA 3OEOA 5EHHA 1HY5A 2A68F 2NUTA 2XM4A 1NU7D 1HE1A 1SYQA 5KYYA 1VMAA 2H7VC 3IQ5A 3NYJA 2WZFA 1KU2A 1U89A 4Q7CA 2R7VA 4E0IA 4JCHA 3T6JA 5T3TA 1D1AA 5FCLA 3OWTA 2HKVA 4DRJB 3ABKC 1LI5A 3S0XA 2KNHA 3W8IA 5COFA 4MVQA 4MVMA 2YEVA 2PF4E 3O6XA 2NSGA 3GANA 3JSEO 4IARA 3ZC4A 4C3EA 5L0FA 3C62A 1E85A 4XTKA 2XS8A 1R5ID 1S7ZA 4Z9JA 1JPNA 2ZD9A 1OW8A 1FMVA 2F22A 3G4ZA 3HJCA 4EBKA 1QQ3A 4C3BA 1U6HA 2LFDA 3ATPA 4YL0A 2LFFA 2W4BA 4K0DA 3AJMA 2YLGA 4J7YA 1HW2A 4KC9A 2XLMA 5E3CA 2WZLA 1C03A 2EPLX 3KKBA 2GAQA 4MVZA 1T01A 1YVIA 3SXMA 3S84A 1F1MA 5D92A 1A7DA 3KYJA 3AG3C 3A9CA 2YVKA 3ASNC 2J9VA 2YL1A 4DVZA 4DOZA 1ZZPA 1BZ4A 4PJMA 1G8XA 1Q0MA 3W8HA 1GGQA 3O39A 4EUKB 2H8AA 4NC3A 2XLDA 3LEOA 5F28E 1FAPB 4G7ZF 3BRJA 4KNVA 1T5OA 3U2MA 2R7XA 4IJJA 3ZTMA 2HFIA 1T6UA 1OCRC 4AE4B 1H6GA 5EGYA 2AVKA 2R05A 1QPUA 3SXYA 3LJBA 1FTSA 1O5HA 1G5ZA 1LE4A 1QZXA 1OXKA 3EHNA 2R9RB 4JZAA 3WG7C 2P1AA 3LLKA 2YLIA 3U9MA 4WGZA 2XSEA 1RJ9B 2DGJA 2HJ3A 5E3AA 4OIOF 2L6HA 4LLEA 5KYXB 4I1MA 3ABMC 2OEXA 2A69F 2EPOA 2YRFA 4RBNA 4FWVA 4PK4A 1CGOA 1NU9C 3LS1A 3TOLA 2LIGA 1VLSA 3EG9A 4U5GA 1Z3IX 2VC9A 4G0HA 1D0YA 2OKUA 2PX0A 2Q9CA 3QVYA 4Q5SF 2G3VA 2ZXPA 4GQHA 4H54A 4HEAJ 3FOPA 4D4NA 3SZRA 4BJ1A 2MWQA 2ZPAA 2FFHA 2GWWA 3F46A 3UMKA 4O7GA 2ICWG 4AE4A 4EBJA 1LPEA 5DLJA 2KGOA 1PD1A 4DJ9A 5DS6A 1SF8A 256BA 3U5SA 4K1OA 2KJGA 2CDQA 3WAQA 3ZG1A 2XL8A 3V5YA 2J7PA 4LLCA 5KYXA 4QDLA 2ZXOA 1TWGA 3DM5A 4E7SA 4N6CA 1J8YF 3AGTA 4N6HA 4CS8C 1AUEA 3K33A 1NBBA 3M4CA 2MHRA 2XS1A 3HNJA 2R7OA 3C8GB 3JTLO 2J0WA 2XL4A 2DYRC 3T6GB 3JRTA 5L0DA 4LERA 2ZXWC 3FMSA 5DS4A 3E70C 3TK0A 2XL6A 2VCBA 3ZQVA 4IB4A 1JR8A 2B0JA 3DD7A 5L0JA 3TULA 3LEVA 1K05A 3L8IA 5AC5A 3HNLA 1ZHTA 2VCAA 2Y3GA 1Q0GA 2R7WA 2CNWA 4MTOA 4XPXA 2OQMA 1GM5A 3SYNA 4CS8A 3Q7GA 3IQCA 1LM3B 3C7JA 3U3BA 2A0UA 5A6BA 3RVYA 5L0GA 4I44A 3S28A 2E87A 1W2WA 2XLOA 4W8PA 3ZQYA 2IXPA 5JT4A 2R7UA 2XRHA 2PNOA 4WABA 3GWLA 3IQ6A 3B0PA 2Q00A 3OA1A 3JT1A 3KPHA 4ANJA 2V3CC 3ZDLA 4J32B 4G7HF 5A69A 3GM1A 4YL3A 4H4KC 4BEMJ 3A11A 2EILC 5L0HA 2A6HF 3EZIA 3WODF 3AQBA 3V5ZA 3HNKA 2L7AA 4HFFB 2W9YA 3RW0A 3KH2A 5DS5A 2UUHA 4HFKB 4MQ9F 4CS9C 1D0ZA 3MYIA 1UG7A 5B1AC 4CX9A 3JCUQ 3MYFA 2VASA 3C8GA 4JEBA 3KMIA 3S29A 3DXJF 4JTAB 3W2WA 3RFYA 3U9JA 5JRAA 1A0BA 1H7IA 3GORA 4NTAA 3PCVA 2JD3A 3T4RA 2QE9A 1TFKB 3NYLA 3Q6MA 3X2QC 5JVEA 4PJLA 1CGNA 4MW3A 1E83A 4JURI 3DWWA 4CDAA 1CPQA 3C8ZA 4ZLCA 1M56C 4KNWA 3RVZA 4DBQA 4Q4ZF 2CGEA 4YJWA 2PFDA 4MTGA 3NDBB 2R7TA 3VM6A 4DVYP 3ECSA 1OXBA 1IZMA 3BEHA 3ZTZA 4CS9A 3IEEA 3ITFA 4EIYA 3JSZA 4N06A 1TKNA 2X51A 4IWBA 3U8VA 5BUOA 3G50A 5COMA 5GPGB 4F4BA 1N1CA 1E86A 3HTKC 4CSAC 2IXOA 5A6KA 3EG9B 1MMAA 3JYHA 4GEHA 2HZ8A 1GQAA 3UR3C 1BDJB 5CIVA 2L6GA 3L8JA 3QVZA 1MMDA 1I4ZA 3SNHA 1B68A 3M79A 4NQFA 4CS7A 3GEEA 3GEHA 2I15A 3U2LA 2NUPB 4A2NB 3K7DA 1VYIA 3PMRA 2TMVP 1EA8A 3EQLF 3M1CB 3IQTA 4W8KA 4R32A 3HNIA 1V74B 2AWCA 3AG2C 2ASRA 1HMOA 1MNEA 1LVKA 1OCCC 1V54C 5D91A 2PBEA 1G4US 1YA7O 1T6QA 1ZHWA 2HS5A 2V26A 5B1BC 3LNMB 4LDQA 4KI2A 1U0BB 2WL8A 1SR2A 2LCHA 1PD0A 3LNRA 4CSAA 1FMWA 4IRUA 2LP4A 4NTFA 1V4AA 2HUJA 2DYSC 3LESA 4CJOA 1RMVA 1BR1A 3NKEA 4AK9A 5JUAA 1YLMA 2PP4A 4U5DE 4O79A 5T1DB 2Y69C 2ZXRA 4KBLA 1C17M 3DJNB 1I4YA 1E2XA 1FFTC 3I5QA 4JKVA 4RDAA 5F5HA 2XXAA 4QI0A 4O6YA 3S9OA 1RCPA 2WVOA 2XLEA 3TJ5A 4BJ6C 4OIQF 5FZTA 2Y3DA 2XLHA 3GEIA 3CZ6A 1QLEC 1BR2A 1FNTc 2W45A 3DE9A 1EI7A 1OQCA 2RD9A 1ORYA 3Q7LA 3MLGA 2M64A 3ZWIA 1YJGA 3POVA 2EPKX 4HE8D 2JX0A 2NUPA 1O3UA 4MW8A 3UGPA 1YDIA 4RD9A 1WTYA 2A0BA 2D4UA 1J8MF 4MVOA 5CI8A 5T3WA 3T6BA 1WWPA 1OKKA 2KK1A 3QW0A 3VAYA 3VYWA 4BJ6A 4CIHA 3RQGA 1JRAA 4YT4A 1VLTA 3H2VA 2IOQA 2P7VA 4MVSA 4XEFA 2Q9BA 1V55C 2M4EA 4PR9A 1KNYA 1RKCA 2J45A 1HMDA 3EGXA 2AP3A 2QLAA 3FAJA 3KL4A 3O55A 4B6IA 2EIJC 4C7OB 4MS2A 3HLZA 3B0UX 2J46A 4Z9IA 5B3SC 4DXWA 1DOVA 1RKEA 1ZW3A 2FGYA 1YYJA 1AVOB 1T9KA 2QUPA 1TFOB 1Z7Qc 4CDYA 2ETSA 1RXQA 4AX2A 4CIPA 3HKKA 2CCYA 4PFPA 4JEAA 3EHMA 4BEJA 1SMYF 4I1OB 1WATA 1NG1A 5E33A 1VYKA 4BJTA 1JMWA 4OD4A 2BE5F 3R7CA 4JIOA 3H65A 3PDMP 5CI9A 2CYDA 5IY5C 4C3DA 1ZYRF 2BL2A 2YZSA 1GS9A 2J8WA 1YARO 4PJNA 2KSFA 4BG0A 4J30B 4O6MA 3N24A 3B71A 3RKOF 1ZU4A 2WVQA 4DRHB 1CGME 1D1BA 1TQGA 4OINF 3DMDA 4OIRF 2DI3A 5JS5A 1MQVA 5HV9A 3I4UA 3MFNA 2GA0A 3CQZA 1ORJA 1E84A 2OJED 2IBFA 3N2ZB 2R02A 5KYWB 1LIHA 4MVUA 4YT8A 1ZHZA 1Z5ZA 3GWNA 3B0VC 4AL1A 3QMKA 3TD7A 4QI2A 4E7ZA 4PFOA 2YQYA 3CSKA 1IW7F 3Q6NA 5K0IA 5L0CA 3UGOA 4C7OA 4UDVA 4LACB 4JJFA 5TJ5E 2Z15A 5DQZA 3X1OA 1DOWA 2YWAA 3K1IC 2KQ9A 3EGDB 3NMJA 1Z23A 2FAPB 2EIKC 4EBBA 5A6JA 2R7RA 3C63A 4XLNF 5DQTA 4XWJA 2EIMC 4BJ5A 3VF0A 2XLVA 3H2UA 3RYLA 2HMZA 1TWAA 3MBGA 3E9VA 1Z63A 2L81A 5JP7A 3RQEA 1YYXA 2W4MA 3EH1A 3LS0A 1G4WR 3NKDA 3UNGC 5BQIA 1L7CA 2OG2A 2IM8A 1XWJA 2J7PD 4G78A 2Q4FA 1ZHXA 4NY3A 4MTFA 1KTMA 2R25A 2Q9AA 2NPUA 5F5FA 2WVNA 4YT2A 2B0HA 1HW1A 4N4WA 4WGYA 1JAFA 1K04A 1QKRA 1OW6A 1ST6A 2QY9A 3K1IA 2HJMA 4E0HA 3TJ6A 1VK5A 3FDQA 2OJQA 4JTDB 4MNDA 3C18A 5COGA 2XXAB 4K7BA 3N0TA 3EFOB 3RQFA 5AC4A 1S05A 2HMQA 2KW3C 2WZGA 3QW1A 1XZPA 1YAUO 3ZVRA 3DKAA 2LQGA 2OU6A 4MVRA 3GM3A 5KYWA 1AEPA 1LE2A 2PX3A 3ABLC 4E17A 3SXKA 3WHNA 5A6AA 2BC5A 1SZIA 2L6FA 1M2OA 2Y3BA 3V7OA 2H7BA 4JJGA 1HE9A 1M6TA 3FVYA 2CNWD 2MYSA 4ULVA 2YL0A 4YK5A 3NMKA 3O10A 4FX5A 1LS1A 1Q0DA 4I3MA 4U5CE 3M15A 4NTBA 2AU5A 3EGDA 4XEVA 4OD5A 5A6BD 2G62A 1MMNA 1ZHYA 2VCCA 5BQHA 3AQCA 4U5EE 3RH3A 1K40A 1NFNA 3MX3A 5DVWA 5B3IA 2GFHA 1WGWA 2KC3A 3U3FA 4ULWA 2QNLA 2H7OA 3V5XA 2KYHA 2R03A 1WASA 3US6A 3W4YA 4P9TA 4DBRA 3EGXB 2EPMX 3K6BA 2Y3HA 2YKZA 3QZCA 1NSGB 4JE9A 3AG4C 1ZVZA 1VB5A 3DZAA 1ORSC 4IAQA 2A1DD 1D0XA 4YL1A 2OEVA 1NZEA 3DE8A 3EPVA 1RKEB 2NG1A 4PJJA 4EWCA 2R7SA 3C8GD 3FAPB 3FHDA 3EFOA 1LS4A 2J9BA 4NCQA 4CJGA 1YZCA 5BQGA 2VB6A 3M4BA
chains in the Genus database with same CATH topology
4OIPF 1VOMA 4YN0B 4M63A 4GYTA 2O9XA 2HV6A 4CBEA 3F47A 1MNDA 1FFHA 2Q3TA 1OCOC 1TWCA 1JPJA 4FESA 3DAGA 1LKXA 4XLPF 3B9QA 3GODA 3EZHA 4G7OF 2J9UA 3L34A 2C03A 5KYUB 1TWHA 3EJNA 3K1HA 4BJ5C 3ZIBA 3DJUB 2LSEA 4WJ0A 3W2VA 2Y39A 4ZLDA 1MMGA 2J0XA 2WB7A 1D1CA 3AG1C 4IAOA 4YWQA 3S27A 1BR4A 3LAYA 2J9WA 4U5FE 2C04A 4O6NA 2R7QA 5E2QA 5KYNA 3NYMA 2HV7A 4JVSA 4ULWA 4BJ5A 2IYLD 1OCZC 4P6IC 2G3KA 2IXMA 4U5HA 2IXNA 3SEOA 3K66A 1RJ9A 3DAFA 1M2VB 2NUTB 4U5BE 2QTVA 5KYYB 4JW1A 3EH2A 1PCXA 2CW0F 2I8BA 3DM9B 5KYUA 1Z6AA 3UMIA 2L9JA 3NRHA 1OKKD 3PHF2 1TR2A 1O87A 4YT5A 2VH3A 4X0RA 1ZU5A 2P6VA 3SP1A 2A6EF 5L3VA 2EINC 3LLIA 1M57C 2OCCC 5L3QA 3RIPA 2YHSA 3NG1A 5HSWA 2D5RB 3L0IA 3UMHA 3ASOC 3ZSUA 1M2VA 3I5PA 3OEOA 5EHHA 2A68F 2NUTA 1NU7D 5KYYA 1VMAA 2H7VC 3NYJA 2WZFA 1KU2A 4Q7CA 2R7VA 4JCHA 3T6JA 5T3TA 1D1AA 5FCLA 3OWTA 3ABKC 3S0XA 2KNHA 3W8IA 3ZC4A 2YEVA 2PF4E 3O6XA 3GANA 4C3EA 4XTKA 1S7ZA 1JPNA 1FMVA 3HJCA 4C3BA 2W4BA 4K0DA 4KC9A 5E3CA 2WZLA 3KKBA 5D92A 3AG3C 3ASNC 2J9VA 4DVZA 4DOZA 4PJMA 1G8XA 3W8HA 3O39A 4G7ZF 4KNVA 2R7XA 4IJJA 4AE4B 1OCRC 5EGYA 3LJBA 1FTSA 1O5HA 1QZXA 3WG7C 3EHNA 4JZAA 3LLKA 2XSEA 1RJ9B 2DGJA 5E3AA 4OIOF 4LLEA 5KYXB 4I1MA 3ABMC 2A69F 4RBNA 4FWVA 4PK4A 3LS1A 1NU9C 4U5GA 3EG9A 1Z3IX 4G0HA 1D0YA 2PX0A 2Q9CA 4Q5SF 2G3VA 2ZXPA 4HEAJ 3SZRA 4BJ1A 2MWQA 2ZPAA 2FFHA 3F46A 3UMKA 4O7GA 4AE4A 5DLJA 2KGOA 1PD1A 5DS6A 1SF8A 2KJGA 2CDQA 3ZG1A 2J7PA 4LLCA 5KYXA 4QDLA 2ZXOA 1TWGA 3DM5A 4E7SA 1J8YF 4CS8C 3K33A 2R7OA 2J0WA 2XL4A 2DYRC 3JRTA 4LERA 2ZXWC 5DS4A 3E70C 2B0JA 3DD7A 3LEVA 1ZHTA 2Y3GA 2R7WA 2CNWA 3SYNA 4CS8A 3Q7GA 4I44A 3S28A 2E87A 1W2WA 2IXPA 2XRHA 3B0PA 3OA1A 3JT1A 4ANJA 2V3CC 4J32B 4G7HF 4H4KC 2EILC 2A6HF 3EZIA 3WODF 3AQBA 4HFFB 2W9YA 5DS5A 3KH2A 4HFKB 4MQ9F 4CS9C 1D0ZA 5B1AC 3JCUQ 2VASA 3KMIA 3S29A 3DXJF 3W2WA 3RFYA 2JD3A 3T4RA 3Q6MA 3NYLA 3X2QC 4PJLA 4JURI 4ZLCA 1M56C 4KNWA 4DBQA 4Q4ZF 2CGEA 4YJWA 2PFDA 2R7TA 3NDBB 4DVYP 3ECSA 1IZMA 4CS9A 3IEEA 3ITFA 3JSZA 4N06A 1TKNA 2X51A 4IWBA 5BUOA 4F4BA 1N1CA 3HTKC 4CSAC 2IXOA 3EG9B 1MMAA 3JYHA 4GEHA 3UR3C 1MMDA 3SNHA 4CS7A 2R7UA 4A2NB 2NUPB 3K7DA 1VYIA 3PMRA 3EQLF 3M1CB 4W8KA 3AG2C 5D91A 1MNEA 1LVKA 1OCCC 1V54C 5B1BC 2V26A 1ZHWA 4KI2A 2WL8A 1PD0A 3LNRA 4CSAA 1FMWA 4IRUA 2DYSC 3LESA 1BR1A 3NKEA 4AK9A 2PP4A 4U5DE 4O79A 5T1DB 2Y69C 2ZXRA 4KBLA 3DJNB 1FFTC 3I5QA 4RDAA 5F5HA 2XXAA 4QI0A 4O6YA 2WVOA 4BJ6C 4OIQF 2Y3DA 3CZ6A 1QLEC 1BR2A 2W45A 3Q7LA 3MLGA 3POVA 4HE8D 2NUPA 3UGPA 4RD9A 1J8MF 5CI8A 5T3WA 3T6BA 3VAYA 1OKKA 4BJ6A 3VYWA 4CIHA 4YT4A 2IOQA 2P7VA 2Q9BA 1V55C 2M4EA 2J45A 3EGXA 3KL4A 3FAJA 4B6IA 4C7OB 2EIJC 3HLZA 3B0UX 2J46A 5B3SC 2FGYA 4AX2A 4PFPA 3EHMA 4BEJA 1SMYF 4I1OB 1NG1A 5E33A 1VYKA 4BJTA 4OD4A 2BE5F 3H65A 5CI9A 5IY5C 4C3DA 1ZYRF 2YZSA 4PJNA 4BG0A 4J30B 4O6MA 3N24A 3RKOF 1ZU4A 2WVQA 1D1BA 4OINF 3DMDA 4OIRF 3I4UA 3CQZA 5KYWB 3N2ZB 4YT8A 1ZHZA 1Z5ZA 3B0VC 4QI2A 3QMKA 3TD7A 4E7ZA 4PFOA 3UGOA 3CSKA 1IW7F 3Q6NA 4C7OA 4LACB 4JJFA 2Z15A 5DQZA 3X1OA 3K1IC 2KQ9A 3EGDB 1Z23A 2EIKC 4EBBA 2R7RA 4XLNF 5DQTA 4XWJA 2EIMC 1Z63A 3RYLA 1TWAA 3E9VA 2L81A 3UNGC 2W4MA 3EH1A 3LS0A 3NKDA 2OG2A 4NY3A 2J7PD 1ZHXA 2Q9AA 5F5FA 2WVNA 4YT2A 2QY9A 1ST6A 3FDQA 1VK5A 4MNDA 2XXAB 4K7BA 3N0TA 3EFOB 2KW3C 2WZGA 3ZVRA 5KYWA 3ABLC 2PX3A 1SZIA 1M2OA 2Y3BA 3V7OA 2H7BA 4JJGA 3FVYA 2CNWD 2MYSA 4FX5A 1LS1A 4I3MA 4U5CE 3EGDA 4OD5A 2G62A 1MMNA 1ZHYA 3AQCA 4U5EE 3RH3A 3MX3A 5DVWA 2GFHA 1WGWA 2H7OA 4DBRA 3EGXB 3K6BA 2Y3HA 3QZCA 3AG4C 3DZAA 2A1DD 1D0XA 4EWCA 1NZEA 3EPVA 4PJJA 2NG1A 2R7SA 3FHDA 3EFOA 2VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3T A;  1VK5 A;  3GAN A; 
#chains in the Genus database with same CATH topology
 3IPM O;  4OIP F;  1VOM A;  3NMI A;  4YN0 B;  4M63 A;  1A7E A;  2O9X A;  4GYT A;  3CEX A;  4JTC B;  3CAX A;  1FR0 A;  2HV6 A;  4CBE A;  3F47 A;  1MND A;  1FFH A;  1QSP A;  1OCO C;  1TWC A;  2JPU A;  2Q3T A;  3AGU A;  1JPJ A;  3JRM O;  3DAG A;  3L1M A;  4FES A;  4PAC A;  3U8P A;  1UFB A;  1LKX A;  4XLP F;  3TOM A;  3B9Q A;  3GOD A;  2OOC A;  3EZH A;  3R2P A;  2J9U A;  4G7O F;  2YL3 A;  1H9G A;  2C03 A;  3JZ0 A;  3L34 A;  1H9T A;  2RSE B;  5KYU B;  2EPN A;  1Y6D A;  3GM2 A;  4JC7 A;  2AWY A;  1TWH A;  3AOU A;  3EJN A;  3K1H A;  1Q0F A;  4BJ5 C;  1T6I A;  3DJU B;  3JYY A;  2X0C A;  3ZIB A;  2LSE A;  1CPR A;  4WJ0 A;  3W2V A;  3S90 A;  1C02 A;  2Y39 A;  3QTH A;  4ZLD A;  1MMG A;  4ONS A;  2J0X A;  2WB7 A;  1D1C A;  3AG1 C;  4IAO A;  4YWQ A;  2XLW A;  1NLX A;  3G4X A;  1A7V A;  2P61 A;  4XPY A;  1EQ1 A;  3S27 A;  3IHU A;  1BR4 A;  3LAY A;  3LUT B;  5AGF A;  3TQO A;  1YA9 A;  1VTM P;  2J9W A;  4U5F E;  2C04 A;  4O6N A;  2R7Q A;  5E2Q A;  2HSB A;  5KYN A;  1LI7 A;  3NYM A;  4L6R A;  2HV7 A;  4XPW A;  1I5N A;  1Q0K A;  2HSQ A;  3FOO A;  4JVS A;  2IYL D;  1OCZ C;  4P6I C;  2YLD A;  2G3K A;  2IXM A;  3SXZ A;  1WN0 A;  4U5H A;  2IXN A;  1OW7 A;  1XZQ A;  5JSL A;  1APC A;  3K66 A;  4XQ1 A;  3SEO A;  3T9O A;  1RJ9 A;  3DAF A;  4P9F A;  1R4T A;  4JCZ A;  1M2V B;  4JRZ A;  2NUT B;  4U5B E;  2QTV A;  1JOG A;  5KYY B;  4JW1 A;  3EH2 A;  2GDC A;  1PCX A;  2CW0 F;  2P0N A;  2I8B A;  3DM9 B;  4U9E A;  4E18 A;  5KYU A;  1Z6A A;  3UMI A;  1ZW2 A;  1Y4C A;  4LDR A;  5JLI A;  4EHP A;  2L9J A;  1WOL A;  4IGG A;  3B29 A;  4LDK A;  5L0I A;  3NRH A;  1OKK D;  1OR3 A;  4AL0 A;  4XEK A;  3PHF 2;  3DI5 A;  4CDV A;  3VRC A;  1TR2 A;  3FXH A;  2XM0 A;  4U9D A;  1A41 A;  1O87 A;  4Z9H A;  4A4A A;  2DB4 A;  4FAP B;  4J7T A;  1PV3 A;  4YT5 A;  5EK0 A;  4DRI B;  1BBH A;  1QVX A;  2LD6 A;  2VH3 A;  4X0R A;  1NFO A;  1ZU5 A;  2P6V A;  3SP1 A;  2NSF A;  1YZA A;  4EKW A;  4D4X A;  2A6E F;  3RF3 A;  1EKY A;  3U0C A;  2UUI A;  1OR2 A;  5L3V A;  2Q7R A;  2EIN C;  4ER9 A;  3LLI A;  1M57 C;  2OCC C;  3J06 A;  5L3Q A;  3RIP A;  2YHS A;  1L3P A;  3NG1 A;  5HSW A;  2D5R B;  2LK4 A;  2YL7 A;  3L0I A;  4BPM A;  3KYI A;  3UMH A;  3ASO C;  3ZSU A;  1M2V A;  3I5P A;  3OEO A;  5EHH A;  1HY5 A;  2A68 F;  2NUT A;  2XM4 A;  1NU7 D;  1HE1 A;  1SYQ A;  5KYY A;  1VMA A;  2H7V C;  3IQ5 A;  3NYJ A;  2WZF A;  1KU2 A;  1U89 A;  4Q7C A;  2R7V A;  4E0I A;  4JCH A;  3T6J A;  5T3T A;  1D1A A;  5FCL A;  3OWT A;  2HKV A;  4DRJ B;  3ABK C;  1LI5 A;  3S0X A;  2KNH A;  3W8I A;  5COF A;  4MVQ A;  4MVM A;  2YEV A;  2PF4 E;  3O6X A;  2NSG A;  3GAN A;  3JSE O;  4IAR A;  3ZC4 A;  4C3E A;  5L0F A;  3C62 A;  1E85 A;  4XTK A;  2XS8 A;  1R5I D;  1S7Z A;  4Z9J A;  1JPN A;  2ZD9 A;  1OW8 A;  1FMV A;  2F22 A;  3G4Z A;  3HJC A;  4EBK A;  1QQ3 A;  4C3B A;  1U6H A;  2LFD A;  3ATP A;  4YL0 A;  2LFF A;  2W4B A;  4K0D A;  3AJM A;  2YLG A;  4J7Y A;  1HW2 A;  4KC9 A;  2XLM A;  5E3C A;  2WZL A;  1C03 A;  2EPL X;  3KKB A;  2GAQ A;  4MVZ A;  1T01 A;  1YVI A;  3SXM A;  3S84 A;  1F1M A;  5D92 A;  1A7D A;  3KYJ A;  3AG3 C;  3A9C A;  2YVK A;  3ASN C;  2J9V A;  2YL1 A;  4DVZ A;  4DOZ A;  1ZZP A;  1BZ4 A;  4PJM A;  1G8X A;  1Q0M A;  3W8H A;  1GGQ A;  3O39 A;  4EUK B;  2H8A A;  4NC3 A;  2XLD A;  3LEO A;  5F28 E;  1FAP B;  4G7Z F;  3BRJ A;  4KNV A;  1T5O A;  3U2M A;  2R7X A;  4IJJ A;  3ZTM A;  2HFI A;  1T6U A;  1OCR C;  4AE4 B;  1H6G A;  5EGY A;  2AVK A;  2R05 A;  1QPU A;  3SXY A;  3LJB A;  1FTS A;  1O5H A;  1G5Z A;  1LE4 A;  1QZX A;  1OXK A;  3EHN A;  2R9R B;  4JZA A;  3WG7 C;  2P1A A;  3LLK A;  2YLI A;  3U9M A;  4WGZ A;  2XSE A;  1RJ9 B;  2DGJ A;  2HJ3 A;  5E3A A;  4OIO F;  2L6H A;  4LLE A;  5KYX B;  4I1M A;  3ABM C;  2OEX A;  2A69 F;  2EPO A;  2YRF A;  4RBN A;  4FWV A;  4PK4 A;  1CGO A;  1NU9 C;  3LS1 A;  3TOL A;  2LIG A;  1VLS A;  3EG9 A;  4U5G A;  1Z3I X;  2VC9 A;  4G0H A;  1D0Y A;  2OKU A;  2PX0 A;  2Q9C A;  3QVY A;  4Q5S F;  2G3V A;  2ZXP A;  4GQH A;  4H54 A;  4HEA J;  3FOP A;  4D4N A;  3SZR A;  4BJ1 A;  2MWQ A;  2ZPA A;  2FFH A;  2GWW A;  3F46 A;  3UMK A;  4O7G A;  2ICW G;  4AE4 A;  4EBJ A;  1LPE A;  5DLJ A;  2KGO A;  1PD1 A;  4DJ9 A;  5DS6 A;  1SF8 A;  256B A;  3U5S A;  4K1O A;  2KJG A;  2CDQ A;  3WAQ A;  3ZG1 A;  2XL8 A;  3V5Y A;  2J7P A;  4LLC A;  5KYX A;  4QDL A;  2ZXO A;  1TWG A;  3DM5 A;  4E7S A;  4N6C A;  1J8Y F;  3AGT A;  4N6H A;  4CS8 C;  1AUE A;  3K33 A;  1NBB A;  3M4C A;  2MHR A;  2XS1 A;  3HNJ A;  2R7O A;  3C8G B;  3JTL O;  2J0W A;  2XL4 A;  2DYR C;  3T6G B;  3JRT A;  5L0D A;  4LER A;  2ZXW C;  3FMS A;  5DS4 A;  3E70 C;  3TK0 A;  2XL6 A;  2VCB A;  3ZQV A;  4IB4 A;  1JR8 A;  2B0J A;  3DD7 A;  5L0J A;  3TUL A;  3LEV A;  1K05 A;  3L8I A;  5AC5 A;  3HNL A;  1ZHT A;  2VCA A;  2Y3G A;  1Q0G A;  2R7W A;  2CNW A;  4MTO A;  4XPX A;  2OQM A;  1GM5 A;  3SYN A;  4CS8 A;  3Q7G A;  3IQC A;  1LM3 B;  3C7J A;  3U3B A;  2A0U A;  5A6B A;  3RVY A;  5L0G A;  4I44 A;  3S28 A;  2E87 A;  1W2W A;  2XLO A;  4W8P A;  3ZQY A;  2IXP A;  5JT4 A;  2R7U A;  2XRH A;  2PNO A;  4WAB A;  3GWL A;  3IQ6 A;  3B0P A;  2Q00 A;  3OA1 A;  3JT1 A;  3KPH A;  4ANJ A;  2V3C C;  3ZDL A;  4J32 B;  4G7H F;  5A69 A;  3GM1 A;  4YL3 A;  4H4K C;  4BEM J;  3A11 A;  2EIL C;  5L0H A;  2A6H F;  3EZI A;  3WOD F;  3AQB A;  3V5Z A;  3HNK A;  2L7A A;  4HFF B;  2W9Y A;  3RW0 A;  3KH2 A;  5DS5 A;  2UUH A;  4HFK B;  4MQ9 F;  4CS9 C;  1D0Z A;  3MYI A;  1UG7 A;  5B1A C;  4CX9 A;  3JCU Q;  3MYF A;  2VAS A;  3C8G A;  4JEB A;  3KMI A;  3S29 A;  3DXJ F;  4JTA B;  3W2W A;  3RFY A;  3U9J A;  5JRA A;  1A0B A;  1H7I A;  3GOR A;  4NTA A;  3PCV A;  2JD3 A;  3T4R A;  2QE9 A;  1TFK B;  3NYL A;  3Q6M A;  3X2Q C;  5JVE A;  4PJL A;  1CGN A;  4MW3 A;  1E83 A;  4JUR I;  3DWW A;  4CDA A;  1CPQ A;  3C8Z A;  4ZLC A;  1M56 C;  4KNW A;  3RVZ A;  4DBQ A;  4Q4Z F;  2CGE A;  4YJW A;  2PFD A;  4MTG A;  3NDB B;  2R7T A;  3VM6 A;  4DVY P;  3ECS A;  1OXB A;  1IZM A;  3BEH A;  3ZTZ A;  4CS9 A;  3IEE A;  3ITF A;  4EIY A;  3JSZ A;  4N06 A;  1TKN A;  2X51 A;  4IWB A;  3U8V A;  5BUO A;  3G50 A;  5COM A;  5GPG B;  4F4B A;  1N1C A;  1E86 A;  3HTK C;  4CSA C;  2IXO A;  5A6K A;  3EG9 B;  1MMA A;  3JYH A;  4GEH A;  2HZ8 A;  1GQA A;  3UR3 C;  1BDJ B;  5CIV A;  2L6G A;  3L8J A;  3QVZ A;  1MMD A;  1I4Z A;  3SNH A;  1B68 A;  3M79 A;  4NQF A;  4CS7 A;  3GEE A;  3GEH A;  2I15 A;  3U2L A;  2NUP B;  4A2N B;  3K7D A;  1VYI A;  3PMR A;  2TMV P;  1EA8 A;  3EQL F;  3M1C B;  3IQT A;  4W8K A;  4R32 A;  3HNI A;  1V74 B;  2AWC A;  3AG2 C;  2ASR A;  1HMO A;  1MNE A;  1LVK A;  1OCC C;  1V54 C;  5D91 A;  2PBE A;  1G4U S;  1YA7 O;  1T6Q A;  1ZHW A;  2HS5 A;  2V26 A;  5B1B C;  3LNM B;  4LDQ A;  4KI2 A;  1U0B B;  2WL8 A;  1SR2 A;  2LCH A;  1PD0 A;  3LNR A;  4CSA A;  1FMW A;  4IRU A;  2LP4 A;  4NTF A;  1V4A A;  2HUJ A;  2DYS C;  3LES A;  4CJO A;  1RMV A;  1BR1 A;  3NKE A;  4AK9 A;  5JUA A;  1YLM A;  2PP4 A;  4U5D E;  4O79 A;  5T1D B;  2Y69 C;  2ZXR A;  4KBL A;  1C17 M;  3DJN B;  1I4Y A;  1E2X A;  1FFT C;  3I5Q A;  4JKV A;  4RDA A;  5F5H A;  2XXA A;  4QI0 A;  4O6Y A;  3S9O A;  1RCP A;  2WVO A;  2XLE A;  3TJ5 A;  4BJ6 C;  4OIQ F;  5FZT A;  2Y3D A;  2XLH A;  3GEI A;  3CZ6 A;  1QLE C;  1BR2 A;  1FNT c;  2W45 A;  3DE9 A;  1EI7 A;  1OQC A;  2RD9 A;  1ORY A;  3Q7L A;  3MLG A;  2M64 A;  3ZWI A;  1YJG A;  3POV A;  2EPK X;  4HE8 D;  2JX0 A;  2NUP A;  1O3U A;  4MW8 A;  3UGP A;  1YDI A;  4RD9 A;  1WTY A;  2A0B A;  2D4U A;  1J8M F;  4MVO A;  5CI8 A;  5T3W A;  3T6B A;  1WWP A;  1OKK A;  2KK1 A;  3QW0 A;  3VAY A;  3VYW A;  4BJ6 A;  4CIH A;  3RQG A;  1JRA A;  4YT4 A;  1VLT A;  3H2V A;  2IOQ A;  2P7V A;  4MVS A;  4XEF A;  2Q9B A;  1V55 C;  2M4E A;  4PR9 A;  1KNY A;  1RKC A;  2J45 A;  1HMD A;  3EGX A;  2AP3 A;  2QLA A;  3FAJ A;  3KL4 A;  3O55 A;  4B6I A;  2EIJ C;  4C7O B;  4MS2 A;  3HLZ A;  3B0U X;  2J46 A;  4Z9I A;  5B3S C;  4DXW A;  1DOV A;  1RKE A;  1ZW3 A;  2FGY A;  1YYJ A;  1AVO B;  1T9K A;  2QUP A;  1TFO B;  1Z7Q c;  4CDY A;  2ETS A;  1RXQ A;  4AX2 A;  4CIP A;  3HKK A;  2CCY A;  4PFP A;  4JEA A;  3EHM A;  4BEJ A;  1SMY F;  4I1O B;  1WAT A;  1NG1 A;  5E33 A;  1VYK A;  4BJT A;  1JMW A;  4OD4 A;  2BE5 F;  3R7C A;  4JIO A;  3H65 A;  3PDM P;  5CI9 A;  2CYD A;  5IY5 C;  4C3D A;  1ZYR F;  2BL2 A;  2YZS A;  1GS9 A;  2J8W A;  1YAR O;  4PJN A;  2KSF A;  4BG0 A;  4J30 B;  4O6M A;  3N24 A;  3B71 A;  3RKO F;  1ZU4 A;  2WVQ A;  4DRH B;  1CGM E;  1D1B A;  1TQG A;  4OIN F;  3DMD A;  4OIR F;  2DI3 A;  5JS5 A;  1MQV A;  5HV9 A;  3I4U A;  3MFN A;  2GA0 A;  3CQZ A;  1ORJ A;  1E84 A;  2OJE D;  2IBF A;  3N2Z B;  2R02 A;  5KYW B;  1LIH A;  4MVU A;  4YT8 A;  1ZHZ A;  1Z5Z A;  3GWN A;  3B0V C;  4AL1 A;  3QMK A;  3TD7 A;  4QI2 A;  4E7Z A;  4PFO A;  2YQY A;  3CSK A;  1IW7 F;  3Q6N A;  5K0I A;  5L0C A;  3UGO A;  4C7O A;  4UDV A;  4LAC B;  4JJF A;  5TJ5 E;  2Z15 A;  5DQZ A;  3X1O A;  1DOW A;  2YWA A;  3K1I C;  2KQ9 A;  3EGD B;  3NMJ A;  1Z23 A;  2FAP B;  2EIK C;  4EBB A;  5A6J A;  2R7R A;  3C63 A;  4XLN F;  5DQT A;  4XWJ A;  2EIM C;  4BJ5 A;  3VF0 A;  2XLV A;  3H2U A;  3RYL A;  2HMZ A;  1TWA A;  3MBG A;  3E9V A;  1Z63 A;  2L81 A;  5JP7 A;  3RQE A;  1YYX A;  2W4M A;  3EH1 A;  3LS0 A;  1G4W R;  3NKD A;  3UNG C;  5BQI A;  1L7C A;  2OG2 A;  2IM8 A;  1XWJ A;  2J7P D;  4G78 A;  2Q4F A;  1ZHX A;  4NY3 A;  4MTF A;  1KTM A;  2R25 A;  2Q9A A;  2NPU A;  5F5F A;  2WVN A;  4YT2 A;  2B0H A;  1HW1 A;  4N4W A;  4WGY A;  1JAF A;  1K04 A;  1QKR A;  1OW6 A;  1ST6 A;  2QY9 A;  3K1I A;  2HJM A;  4E0H A;  3TJ6 A;  1VK5 A;  3FDQ A;  2OJQ A;  4JTD B;  4MND A;  3C18 A;  5COG A;  2XXA B;  4K7B A;  3N0T A;  3EFO B;  3RQF A;  5AC4 A;  1S05 A;  2HMQ A;  2KW3 C;  2WZG A;  3QW1 A;  1XZP A;  1YAU O;  3ZVR A;  3DKA A;  2LQG A;  2OU6 A;  4MVR A;  3GM3 A;  5KYW A;  1AEP A;  1LE2 A;  2PX3 A;  3ABL C;  4E17 A;  3SXK A;  3WHN A;  5A6A A;  2BC5 A;  1SZI A;  2L6F A;  1M2O A;  2Y3B A;  3V7O A;  2H7B A;  4JJG A;  1HE9 A;  1M6T A;  3FVY A;  2CNW D;  2MYS A;  4ULV A;  2YL0 A;  4YK5 A;  3NMK A;  3O10 A;  4FX5 A;  1LS1 A;  1Q0D A;  4I3M A;  4U5C E;  3M15 A;  4NTB A;  2AU5 A;  3EGD A;  4XEV A;  4OD5 A;  5A6B D;  2G62 A;  1MMN A;  1ZHY A;  2VCC A;  5BQH A;  3AQC A;  4U5E E;  3RH3 A;  1K40 A;  1NFN A;  3MX3 A;  5DVW A;  5B3I A;  2GFH A;  1WGW A;  2KC3 A;  3U3F A;  4ULW A;  2QNL A;  2H7O A;  3V5X A;  2KYH A;  2R03 A;  1WAS A;  3US6 A;  3W4Y A;  4P9T A;  4DBR A;  3EGX B;  2EPM X;  3K6B A;  2Y3H A;  2YKZ A;  3QZC A;  1NSG B;  4JE9 A;  3AG4 C;  1ZVZ A;  1VB5 A;  3DZA A;  1ORS C;  4IAQ A;  2A1D D;  1D0X A;  4YL1 A;  2OEV A;  1NZE A;  3DE8 A;  3EPV A;  1RKE B;  2NG1 A;  4PJJ A;  4EWC A;  2R7S A;  3C8G D;  3FAP B;  3FHD A;  3EFO A;  1LS4 A;  2J9B A;  4NCQ A;  4CJG A;  1YZC A;  5BQG A;  2VB6 A;  3M4B A; 
#chains in the Genus database with same CATH homology
 4OIP F;  1VOM A;  4YN0 B;  4M63 A;  4GYT A;  2O9X A;  2HV6 A;  4CBE A;  3F47 A;  1MND A;  1FFH A;  2Q3T A;  1OCO C;  1TWC A;  1JPJ A;  4FES A;  3DAG A;  1LKX A;  4XLP F;  3B9Q A;  3GOD A;  3EZH A;  4G7O F;  2J9U A;  3L34 A;  2C03 A;  5KYU B;  1TWH A;  3EJN A;  3K1H A;  4BJ5 C;  3ZIB A;  3DJU B;  2LSE A;  4WJ0 A;  3W2V A;  2Y39 A;  4ZLD A;  1MMG A;  2J0X A;  2WB7 A;  1D1C A;  3AG1 C;  4IAO A;  4YWQ A;  3S27 A;  1BR4 A;  3LAY A;  2J9W A;  4U5F E;  2C04 A;  4O6N A;  2R7Q A;  5E2Q A;  5KYN A;  3NYM A;  2HV7 A;  4JVS A;  4ULW A;  4BJ5 A;  2IYL D;  1OCZ C;  4P6I C;  2G3K A;  2IXM A;  4U5H A;  2IXN A;  3SEO A;  3K66 A;  1RJ9 A;  3DAF A;  1M2V B;  2NUT B;  4U5B E;  2QTV A;  5KYY B;  4JW1 A;  3EH2 A;  1PCX A;  2CW0 F;  2I8B A;  3DM9 B;  5KYU A;  1Z6A A;  3UMI A;  2L9J A;  3NRH A;  1OKK D;  3PHF 2;  1TR2 A;  1O87 A;  4YT5 A;  2VH3 A;  4X0R A;  1ZU5 A;  2P6V A;  3SP1 A;  2A6E F;  5L3V A;  2EIN C;  3LLI A;  1M57 C;  2OCC C;  5L3Q A;  3RIP A;  2YHS A;  3NG1 A;  5HSW A;  2D5R B;  3L0I A;  3UMH A;  3ASO C;  3ZSU A;  1M2V A;  3I5P A;  3OEO A;  5EHH A;  2A68 F;  2NUT A;  1NU7 D;  5KYY A;  1VMA A;  2H7V C;  3NYJ A;  2WZF A;  1KU2 A;  4Q7C A;  2R7V A;  4JCH A;  3T6J A;  5T3T A;  1D1A A;  5FCL A;  3OWT A;  3ABK C;  3S0X A;  2KNH A;  3W8I A;  3ZC4 A;  2YEV A;  2PF4 E;  3O6X A;  3GAN A;  4C3E A;  4XTK A;  1S7Z A;  1JPN A;  1FMV A;  3HJC A;  4C3B A;  2W4B A;  4K0D A;  4KC9 A;  5E3C A;  2WZL A;  3KKB A;  5D92 A;  3AG3 C;  3ASN C;  2J9V A;  4DVZ A;  4DOZ A;  4PJM A;  1G8X A;  3W8H A;  3O39 A;  4G7Z F;  4KNV A;  2R7X A;  4IJJ A;  4AE4 B;  1OCR C;  5EGY A;  3LJB A;  1FTS A;  1O5H A;  1QZX A;  3WG7 C;  3EHN A;  4JZA A;  3LLK A;  2XSE A;  1RJ9 B;  2DGJ A;  5E3A A;  4OIO F;  4LLE A;  5KYX B;  4I1M A;  3ABM C;  2A69 F;  4RBN A;  4FWV A;  4PK4 A;  3LS1 A;  1NU9 C;  4U5G A;  3EG9 A;  1Z3I X;  4G0H A;  1D0Y A;  2PX0 A;  2Q9C A;  4Q5S F;  2G3V A;  2ZXP A;  4HEA J;  3SZR A;  4BJ1 A;  2MWQ A;  2ZPA A;  2FFH A;  3F46 A;  3UMK A;  4O7G A;  4AE4 A;  5DLJ A;  2KGO A;  1PD1 A;  5DS6 A;  1SF8 A;  2KJG A;  2CDQ A;  3ZG1 A;  2J7P A;  4LLC A;  5KYX A;  4QDL A;  2ZXO A;  1TWG A;  3DM5 A;  4E7S A;  1J8Y F;  4CS8 C;  3K33 A;  2R7O A;  2J0W A;  2XL4 A;  2DYR C;  3JRT A;  4LER A;  2ZXW C;  5DS4 A;  3E70 C;  2B0J A;  3DD7 A;  3LEV A;  1ZHT A;  2Y3G A;  2R7W A;  2CNW A;  3SYN A;  4CS8 A;  3Q7G A;  4I44 A;  3S28 A;  2E87 A;  1W2W A;  2IXP A;  2XRH A;  3B0P A;  3OA1 A;  3JT1 A;  4ANJ A;  2V3C C;  4J32 B;  4G7H F;  4H4K C;  2EIL C;  2A6H F;  3EZI A;  3WOD F;  3AQB A;  4HFF B;  2W9Y A;  5DS5 A;  3KH2 A;  4HFK B;  4MQ9 F;  4CS9 C;  1D0Z A;  5B1A C;  3JCU Q;  2VAS A;  3KMI A;  3S29 A;  3DXJ F;  3W2W A;  3RFY A;  2JD3 A;  3T4R A;  3Q6M A;  3NYL A;  3X2Q C;  4PJL A;  4JUR I;  4ZLC A;  1M56 C;  4KNW A;  4DBQ A;  4Q4Z F;  2CGE A;  4YJW A;  2PFD A;  2R7T A;  3NDB B;  4DVY P;  3ECS A;  1IZM A;  4CS9 A;  3IEE A;  3ITF A;  3JSZ A;  4N06 A;  1TKN A;  2X51 A;  4IWB A;  5BUO A;  4F4B A;  1N1C A;  3HTK C;  4CSA C;  2IXO A;  3EG9 B;  1MMA A;  3JYH A;  4GEH A;  3UR3 C;  1MMD A;  3SNH A;  4CS7 A;  2R7U A;  4A2N B;  2NUP B;  3K7D A;  1VYI A;  3PMR A;  3EQL F;  3M1C B;  4W8K A;  3AG2 C;  5D91 A;  1MNE A;  1LVK A;  1OCC C;  1V54 C;  5B1B C;  2V26 A;  1ZHW A;  4KI2 A;  2WL8 A;  1PD0 A;  3LNR A;  4CSA A;  1FMW A;  4IRU A;  2DYS C;  3LES A;  1BR1 A;  3NKE A;  4AK9 A;  2PP4 A;  4U5D E;  4O79 A;  5T1D B;  2Y69 C;  2ZXR A;  4KBL A;  3DJN B;  1FFT C;  3I5Q A;  4RDA A;  5F5H A;  2XXA A;  4QI0 A;  4O6Y A;  2WVO A;  4BJ6 C;  4OIQ F;  2Y3D A;  3CZ6 A;  1QLE C;  1BR2 A;  2W45 A;  3Q7L A;  3MLG A;  3POV A;  4HE8 D;  2NUP A;  3UGP A;  4RD9 A;  1J8M F;  5CI8 A;  5T3W A;  3T6B A;  3VAY A;  1OKK A;  4BJ6 A;  3VYW A;  4CIH A;  4YT4 A;  2IOQ A;  2P7V A;  2Q9B A;  1V55 C;  2M4E A;  2J45 A;  3EGX A;  3KL4 A;  3FAJ A;  4B6I A;  4C7O B;  2EIJ C;  3HLZ A;  3B0U X;  2J46 A;  5B3S C;  2FGY A;  4AX2 A;  4PFP A;  3EHM A;  4BEJ A;  1SMY F;  4I1O B;  1NG1 A;  5E33 A;  1VYK A;  4BJT A;  4OD4 A;  2BE5 F;  3H65 A;  5CI9 A;  5IY5 C;  4C3D A;  1ZYR F;  2YZS A;  4PJN A;  4BG0 A;  4J30 B;  4O6M A;  3N24 A;  3RKO F;  1ZU4 A;  2WVQ A;  1D1B A;  4OIN F;  3DMD A;  4OIR F;  3I4U A;  3CQZ A;  5KYW B;  3N2Z B;  4YT8 A;  1ZHZ A;  1Z5Z A;  3B0V C;  4QI2 A;  3QMK A;  3TD7 A;  4E7Z A;  4PFO A;  3UGO A;  3CSK A;  1IW7 F;  3Q6N A;  4C7O A;  4LAC B;  4JJF A;  2Z15 A;  5DQZ A;  3X1O A;  3K1I C;  2KQ9 A;  3EGD B;  1Z23 A;  2EIK C;  4EBB A;  2R7R A;  4XLN F;  5DQT A;  4XWJ A;  2EIM C;  1Z63 A;  3RYL A;  1TWA A;  3E9V A;  2L81 A;  3UNG C;  2W4M A;  3EH1 A;  3LS0 A;  3NKD A;  2OG2 A;  4NY3 A;  2J7P D;  1ZHX A;  2Q9A A;  5F5F A;  2WVN A;  4YT2 A;  2QY9 A;  1ST6 A;  3FDQ A;  1VK5 A;  4MND A;  2XXA B;  4K7B A;  3N0T A;  3EFO B;  2KW3 C;  2WZG A;  3ZVR A;  5KYW A;  3ABL C;  2PX3 A;  1SZI A;  1M2O A;  2Y3B A;  3V7O A;  2H7B A;  4JJG A;  3FVY A;  2CNW D;  2MYS A;  4FX5 A;  1LS1 A;  4I3M A;  4U5C E;  3EGD A;  4OD5 A;  2G62 A;  1MMN A;  1ZHY A;  3AQC A;  4U5E E;  3RH3 A;  3MX3 A;  5DVW A;  2GFH A;  1WGW A;  2H7O A;  4DBR A;  3EGX B;  3K6B A;  2Y3H A;  3QZC A;  3AG4 C;  3DZA A;  2A1D D;  1D0X A;  4EWC A;  1NZE A;  3EPV A;  4PJJ A;  2NG1 A;  2R7S A;  3FHD A;  3EFO A;  2VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...