3GANA

Crystal structure of gene product from arabidopsis thaliana at3g22680 with bound suramin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
113
Chain Sequence
SLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At3g22680
publication title Crystal structure of gene product from Arabidopsis thaliana At3g22680 with bound suramin
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 38
structure length 113
sequence length 119
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ganA00
2Q3TA 3GANA 1VK5A
chains in the Genus database with same CATH superfamily
4IB4A 2C04A 1VLTA 3RIPA 1BBHA 1SMYF 4FAPB 4ONSA 5AC4A 2X0CA 3K1IA 2AWYA 4IAQA 2PP4A 4E0HA 4K1OA 4C3DA 4DVZA 2J9BA 3HLZA 4MVRA 1FMVA 1OCOC 3O55A 2YEVA 4XEVA 1D0XA 1KNYA 2IYLD 2J7PA 4H54A 4AL1A 1ZHYA 1O3UA 3C62A 3EJNA 3NRHA 3G50A 1QZXA 3KYJA 2ZXWC 1OXBA 1T01A 2KQ9A 3EQLF 4H4KC 3TK0A 4BJ6C 4ZLDA 4N6CA 4ULWA 2ZPAA 3SXZA 4HEAJ 3RYLA 1MMDA 4LDQA 3VAYA 2R7WA 1TWGA 4U5DE 4MVMA 4JZAA 2XL4A 4NTAA 4EWCA 4U9EA 3M79A 2O9XA 1LI5A 5DQZA 4NTBA 3KPHA 4CSAA 3IEEA 2XL8A 4RDAA 2YVKA 2R7QA 3ZQYA 4ULVA 1BR2A 3S84A 2YL0A 4W8PA 2QUPA 1O87A 4O6NA 3DE9A 2OU6A 4BJ5A 1L3PA 3QW0A 1JAFA 3U3FA 4EHPA 2G3KA 2IBFA 5JS5A 1R5ID 4KNVA 3MYIA 2HKVA 5DS5A 1EKYA 3H65A 1KTMA 3EHNA 3PMRA 4JRZA 2P61A 4YT4A 4MVOA 3TOMA 3T4RA 5JLIA 5DS4A 2VB6A 1ZHTA 3G4ZA 1C17M 3GODA 1FTSA 5EK0A 1E83A 4BEJA 2HV6A 4I1OB 3M4CA 1TQGA 2Q00A 3QMKA 4XLNF 2DYSC 4C7OB 4G7HF 3ABMC 2L6FA 3CZ6A 1V74B 2L7AA 2OJED 3S90A 1ZHZA 3IQTA 3MX3A 4DXWA 4U5GA 4CIPA 2L81A 2QLAA 4JKVA 4WABA 1TR2A 3OEOA 4RD9A 2EPKX 1FFTC 4C7OA 1H6GA 2J45A 3M4BA 2L6HA 4A2NB 5T3TA 2R7XA 3HNKA 2WL8A 1Y6DA 1LPEA 2AP3A 2HJMA 2Q9BA 3T6GB 3KKBA 4EIYA 1WATA 1LS4A 2KK1A 3LNMB 1WN0A 1AVOB 4MTFA 4N06A 3IQ6A 2L6GA 3EG9A 3F47A 2J9WA 2L9JA 5L0FA 2W4BA 3LEVA 4E7SA 2XXAB 3DKAA 2B0JA 2LP4A 2H8AA 4PACA 3TJ5A 4D4NA 4B6IA 2I15A 3K1IC 4IJJA 3PHF2 1OW8A 1JMWA 2XXAA 3ZTMA 4CIHA 4P9TA 1BZ4A 3S27A 4E17A 2X51A 4JC7A 2ASRA 4CS9C 5DQTA 4IAOA 1A7DA 4P6IC 5BUOA 2H7VC 2M64A 2W4MA 4YT8A 3RVZA 1GS9A 3CSKA 5A6AA 2HMQA 4NQFA 4UDVA 2P0NA 4XPXA 2EIKC 5E3CA 3LLKA 3R2PA 4YK5A 3W2VA 4W8KA 4J30B 4NY3A 4XEFA 1FNTc 3FXHA 1PD0A 1MMNA 3DM9B 3CQZA 3NMJA 3U2MA 2F22A 3I5QA 5AGFA 1SZIA 4CSAC 2YL7A 5COFA 1I5NA 1NG1A 1I4YA 4I1MA 3L8JA 3U8VA 3JZ0A 4R32A 4RBNA 4QI0A 4OIPF 1WGWA 2J46A 3NYJA 1LE2A 5COGA 1BR1A 5E2QA 1Q0FA 3RVYA 1CGOA 3ZWIA 4JE9A 3C7JA 1TKNA 2WZFA 1I4ZA 4DRIB 1D0ZA 3JTLO 4OIQF 1FFHA 1M6TA 2VH3A 3W4YA 1WWPA 3HNIA 1OKKA 3KH2A 4JW1A 4WGZA 3C8GA 1OKKD 4K0DA 1M57C 2Q4FA 3SZRA 2NUTB 2P7VA 3LLIA 4YN0B 4JTCB 3US6A 2GFHA 3U2LA 1J8YF 1HW2A 2VASA 2KJGA 3AJMA 2R7RA 1MQVA 4BJTA 1LE4A 3SNHA 4AK9A 2EPMX 1QPUA 2ZXOA 4CBEA 2H7OA 5COMA 2VC9A 2NUTA 3M15A 4U5EE 5JRAA 4CJGA 3MBGA 1E85A 2YL3A 1Z6AA 1IZMA 1Z63A 1LVKA 1FAPB 2CNWA 1TWCA 2NUPB 4CS9A 2IXMA 4NCQA 5AC5A 3L1MA 4N6HA 2CNWD 1PCXA 2CCYA 3CAXA 2EINC 3KMIA 3FOPA 2GWWA 1NU7D 3AQBA 3K7DA 3NKDA 3FHDA 3ABKC 4GYTA 3RKOF 2B0HA 1TFOB 3LUTB 3PCVA 1YAUO 3N0TA 5D92A 4KNWA 4NTFA 4JIOA 3GM2A 2XLDA 3BRJA 4IARA 2DYRC 3OA1A 5L0IA 4YT2A 1Q0DA 3DWWA 2J8WA 2WVOA 3DZAA 3ECSA 4K7BA 3L34A 2XL6A 1VYIA 2J9UA 2MYSA 4AL0A 4PJMA 3AG3C 3UMHA 1AUEA 2QE9A 2XLMA 2CGEA 3B0PA 3U0CA 2OQMA 2IM8A 4ZLCA 1D1BA 3W8IA 1JR8A 3LS0A 1TWAA 3M1CB 5B1BC 5BQHA 3VM6A 2E87A 4PFPA 3LJBA 3T6BA 4Z9JA 1ST6A 2BC5A 3ZIBA 3LNRA 3U3BA 2J9VA 4EBKA 1MNEA 1T6UA 5KYXB 3NMIA 1NZEA 2A6HF 1M2OA 3NYLA 1EQ1A 3TULA 3IHUA 4YJWA 4N4WA 3U8PA 2MWQA 3WAQA 3WODF 1A41A 4E7ZA 2PNOA 2AVKA 3B0UX 1ORYA 1EI7A 5CI9A 1NFOA 4A4AA 1H9GA 2YHSA 3LAYA 3SXKA 3X2QC 3SXMA 3O10A 2CDQA 3TQOA 2LQGA 3GM3A 4Z9IA 4MNDA 1NFNA 1OW6A 3X1OA 2R7VA 2R05A 3LEOA 1VB5A 3ZVRA 1LIHA 1APCA 2A69F 3ABLC 1OCZC 2R9RB 3ATPA 2R25A 3N24A 2C03A 1S7ZA 2Z15A 2YKZA 5DS6A 2PBEA 3ASNC 1HMDA 5JUAA 2OJQA 4JJFA 4CJOA 3KYIA 3DE8A 4U9DA 1Z7Qc 1WASA 3F46A 1CGME 4GEHA 1SF8A 1OR3A 1KU2A 2OCCC 5IY5C 5T1DB 2BL2A 4J7YA 3EGDB 3T6JA 3FAJA 1LI7A 4MVZA 3FDQA 5KYYB 4U5CE 3JRMO 2LFDA 4I44A 3Q6NA 3K66A 3JYYA 3OWTA 2KGOA 3A9CA 1V4AA 2AWCA 1QVXA 1CPQA 1VMAA 3C18A 3EGDA 3Q6MA 3RQFA 1AEPA 1K40A 3IPMO 1IW7F 2WZGA 4JURI 1E84A 1XWJA 2J0XA 3SEOA 5KYYA 2Y39A 3WHNA 3GEHA 3QVZA 1BDJB 3TOLA 2NSGA 4YT5A 2D4UA 4KI2A 4CX9A 1EA8A 3EPVA 4XWJA 1FMWA 1M2VB 3JSZA 5HSWA 1VTMP 1JPNA 2GDCA 3SYNA 3ZDLA 2HV7A 1QLEC 2FGYA 4MTGA 1V54C 3VF0A 1YJGA 256BA 2JPUA 1G4US 3ZG1A 1PV3A 4MW8A 4YL1A 2A0UA 3I5PA 3HKKA 2LFFA 1VK5A 2R02A 2XRHA 2HSQA 5B3SC 4OINF 3EHMA 4D4XA 1GM5A 1HE1A 2OKUA 3EGXB 3K1HA 2R7TA 3WG7C 2IXNA 3JT1A 2A0BA 5E33A 4HFKB 4QI2A 1Q0GA 2Q3TA 5EGYA 4FESA 1K04A 4BJ1A 1MMAA 3EGXA 4LACB 3SXYA 2RD9A 1G8XA 1ZVZA 4XPYA 3U9JA 4NC3A 2RSEB 4OD5A 1CGNA 3AG1C 3B71A 3JSEO 3Q7GA 1VLSA 1YA9A 4Z9HA 5BQGA 1Q0KA 1YARO 1Z23A 2ETSA 3KL4A 4YL0A 4M63A 2ICWG 5KYWB 1Z5ZA 2WVQA 1SYQA 1HW1A 4JCHA 2YZSA 3UR3C 1N1CA 1U89A 2R7UA 4YWQA 2P6VA 1A7EA 1V55C 2UUIA 4EBBA 4CDAA 4X0RA 3MFNA 4DRHB 4DOZA 5A6BA 1FR0A 1NBBA 3N2ZB 5JVEA 1D1CA 3QW1A 5A6BD 2Y3GA 3RH3A 1D1AA 4E18A 4DRJB 3AG2C 4JEAA 4Q4ZF 2EPNA 4P9FA 5DLJA 1U0BB 2KNHA 3FAPB 3NMKA 4G7ZF 1Q0MA 1DOWA 4ER9A 4CDYA 2YL1A 1ZU5A 2Y3BA 2WVNA 4Q7CA 3RFYA 2Q9CA 1OQCA 4MQ9F 1RXQA 4XQ1A 2OEXA 4CS8C 5FCLA 3FVYA 2YQYA 2EPOA 3EZHA 4U5HA 5L0HA 4FWVA 1Z3IX 1OR2A 2XS1A 1G5ZA 2CW0F 3JRTA 1RKCA 2HSBA 1H9TA 4G7OF 2Y3DA 4DBQA 4J7TA 5BQIA 3NYMA 1CPRA 3B29A 4O6YA 3ZSUA 1YYXA 2NUPA 3HNLA 4G78A 2R03A 3RQGA 2ZD9A 3T9OA 3MYFA 4JJGA 3R7CA 4U5FE 3W8HA 4O79A 4DVYP 2CYDA 5F5FA 4EKWA 2ZXPA 4DBRA 3LS1A 3AOUA 4U5BE 1ZW3A 2PF4E 1D0YA 1W2WA 1ZZPA 2V26A 2W9YA 4C3EA 2IOQA 5KYUB 2VCCA 4MVUA 3HNJA 1VYKA 2HJ3A 5JP7A 2J7PD 1L7CA 5CI8A 5T3WA 4PJNA 3PDMP 3BEHA 1LS1A 4LERA 5JSLA 5KYUA 3ZC4A 4ANJA 1QKRA 1J8MF 2YLDA 2VCAA 3HJCA 3J06A 1NLXA 3DJUB 4OIRF 1JPJA 2OG2A 1XZQA 1YA7O 2WZLA 3JCUQ 1NU9C 2HS5A 2NG1A 4J32B 5E3AA 3UMIA 4BEMJ 3H2UA 5L3QA 3L8IA 2XLWA 1A0BA 3B9QA 2Y69C 1ZW2A 2FAPB 3C8ZA 1JOGA 4JTDB 4KBLA 1OCRC 4O6MA 2NSFA 2XLVA 1G4WR 2BE5F 4JTAB 3GORA 4O7GA 3SP1A 2HUJA 4MVSA 3V5XA 4DJ9A 4E0IA 3DJNB 3IQCA 4IGGA 3U9MA 5L3VA 5KYXA 3NKEA 1WOLA 5K0IA 3O39A 2Y3HA 3L0IA 2PX0A 1HE9A 3ZTZA 2XLOA 1ORJA 3A11A 5KYNA 4GQHA 3ITFA 1UG7A 2G62A 2IXOA 2HMZA 3V5ZA 3DMDA 3GEIA 3H2VA 5A6JA 3B0VC 5D91A 3S0XA 3K6BA 3UGOA 3IQ5A 1PD1A 4G0HA 1OCCC 4CS8A 3GWNA 2VCBA 3MLGA 3ZQVA 3DM5A 5HV9A 4XTKA 2PX3A 4BG0A 4F4BA 3DAFA 3TD7A 5L0DA 2QY9A 1JRAA 1M56C 1YDIA 2HFIA 2XM4A 3K33A 2YLGA 1C02A 1R4TA 3DAGA 1RKEB 3E9VA 3UNGC 2Q9AA 3GEEA 1E2XA 2ZXRA 2A68F 5GPGB 2MHRA 3Q7LA 3O6XA 2Q7RA 1F1MA 2TMVP 2KC3A 5F5HA 3EZIA 1RKEA 1QQ3A 2OOCA 3DI5A 1BR4A 4JEBA 5FZTA 2NPUA 2YWAA 2EIMC 4PJLA 2I8BA 3EG9B 4LDKA 4PFOA 2FFHA 3QTHA 5CIVA 1B68A 1VOMA 3U5SA 3G4XA 4BJ6A 1A7VA 4XLPF 1T5OA 1T6QA 4IWBA 5TJ5E 3NDBB 1TFKB 4PK4A 2EIJC 1LKXA 4CDVA 5DVWA 3RF3A 3AQCA 5L0GA 3UGPA 1S05A 2IXPA 4EUKB 3NG1A 3CEXA 2M4EA 4HFFB 1OW7A 1RCPA 1TWHA 1XZPA 5A69A 2XLHA 1SR2A 3FOOA 3V7OA 2LCHA 3RQEA 4I3MA 4EBJA 2J0WA 2KW3C 2YRFA 2YLIA 1YZAA 4MVQA 1UFBA 1YLMA 3EH2A 4Q5SF 1RJ9B 4OD4A 1M2VA 2LD6A 1GQAA 3AG4C 4PR9A 1WTYA 4CS7A 4MTOA 5EHHA 1MNDA 1U6HA 1YZCA 1ZHWA 2XS8A 2OEVA 2GA0A 2KSFA 3C63A 4JCZA 5F28E 3S29A 2GAQA 4MW3A 2XSEA 1QSPA 3RW0A 1ZU4A 1DOVA 2JX0A 4LLCA 1ORSC 2R7OA 2JD3A 1RJ9A 2KYHA 4PJJA 2A1DD 4FX5A 1T9KA 4LDRA 2D5RB 3GWLA 4OIOF 3LESA 1C03A 3DD7A 3QVYA 5JT4A 3W2WA 3S28A 4AE4B 5L0CA 2XLEA 4BPMA 3FMSA 3ASOC 1HY5A 2PFDA 4WJ0A 4YL3A 2AU5A 3HTKC 2LSEA 3GM1A 3I4UA 3DXJF 2P1AA 3JYHA 4C3BA 3EFOB 3VYWA 4IRUA 2QNLA 1K05A 1YVIA 2EILC 4AE4A 2LIGA 1MMGA 1ZHXA 3E70C 4QDLA 2R7SA 4L6RA 3VRCA 4BJ5C 3TJ6A 5L0JA 1OXKA 3EFOA 1T6IA 4LLEA 5KYWA 1Y4CA 2W45A 4WGYA 1RMVA 1GGQA 2G3VA 5A6KA 1LM3B 3C8GB 2H7BA 4XEKA 5B1AC 4XPWA 1H7IA 1NSGB 2DGJA 1YYJA 3UMKA 4KC9A 3S9OA 5B3IA 2UUHA 3V5YA 4HE8D 3QZCA 1O5HA 2HZ8A 3POVA 1HMOA 2QTVA 2XM0A 2WB7A 2EPLX 4AX2A 1ZYRF 4MS2A 3AGTA 3EH1A 3GANA 3C8GD 2A6EF 1E86A 3AGUA 2LK4A 2DI3A 4JVSA 2V3CC 2DB4A
chains in the Genus database with same CATH topology
2C04A 3RIPA 1SMYF 2PP4A 4C3DA 4DVZA 3HLZA 1FMVA 1OCOC 2YEVA 1D0XA 2IYLD 2J7PA 1ZHYA 3EJNA 3NRHA 1QZXA 2ZXWC 3EQLF 2KQ9A 4H4KC 4BJ6C 4ZLDA 4ULWA 2ZPAA 4HEAJ 3RYLA 1MMDA 3VAYA 2R7WA 1TWGA 4U5DE 4JZAA 2XL4A 4EWCA 2O9XA 5DQZA 4CSAA 3IEEA 4RDAA 2R7QA 1BR2A 1O87A 4O6NA 4BJ5A 2G3KA 4KNVA 5DS5A 3H65A 3EHNA 3PMRA 4YT4A 3T4RA 5DS4A 2VB6A 1ZHTA 3GODA 1FTSA 4BEJA 2HV6A 4I1OB 4C7OB 3QMKA 4XLNF 2DYSC 4G7HF 3ABMC 3CZ6A 1ZHZA 3MX3A 4U5GA 2L81A 1TR2A 3OEOA 4RD9A 1FFTC 4C7OA 2J45A 4A2NB 5T3TA 2R7XA 2WL8A 2Q9BA 3KKBA 4N06A 3EG9A 3F47A 2J9WA 2L9JA 2W4BA 3LEVA 4E7SA 2XXAB 2B0JA 3K1IC 4IJJA 3PHF2 2XXAA 4CIHA 3S27A 2X51A 4CS9C 5DQTA 4IAOA 4P6IC 5BUOA 2H7VC 2W4MA 4YT8A 3CSKA 2EIKC 5E3CA 3LLKA 3W2VA 4W8KA 4J30B 4NY3A 1PD0A 1MMNA 3DM9B 3CQZA 4CSAC 3I5QA 1SZIA 1NG1A 4I1MA 4RBNA 4QI0A 4OIPF 1WGWA 2J46A 3NYJA 1BR1A 5E2QA 1TKNA 2WZFA 4OIQF 1D0ZA 1FFHA 2VH3A 1OKKA 3KH2A 4JW1A 1OKKD 4K0DA 1M57C 3SZRA 2NUTB 2P7VA 3LLIA 4YN0B 2GFHA 1J8YF 2VASA 2KJGA 2R7RA 4BJTA 3SNHA 4AK9A 2ZXOA 4CBEA 2H7OA 2NUTA 4U5EE 1Z6AA 1IZMA 1Z63A 1LVKA 2CNWA 1TWCA 2NUPB 4CS9A 2IXMA 2CNWD 1PCXA 2EINC 3KMIA 1NU7D 3AQBA 3K7DA 3NKDA 3FHDA 3ABKC 4GYTA 3RKOF 3N0TA 5D92A 4KNWA 2DYRC 3OA1A 4YT2A 2WVOA 3DZAA 3ECSA 4K7BA 3L34A 1VYIA 2J9UA 2MYSA 4PJMA 3AG3C 3UMHA 2CGEA 3B0PA 4ZLCA 1D1BA 3W8IA 3LS0A 1TWAA 3M1CB 5B1BC 2E87A 4PFPA 3LJBA 3T6BA 3ZIBA 1ST6A 3LNRA 2J9VA 1MNEA 5KYXB 1NZEA 2A6HF 1M2OA 3NYLA 4YJWA 4E7ZA 2MWQA 3WODF 3B0UX 5CI9A 2YHSA 3LAYA 3X2QC 2CDQA 4MNDA 3X1OA 2R7VA 3ZVRA 2A69F 3ABLC 1OCZC 3N24A 2C03A 1S7ZA 2Z15A 5DS6A 3ASNC 4JJFA 3F46A 4GEHA 1SF8A 2OCCC 1KU2A 5IY5C 5T1DB 3EGDB 3T6JA 3FAJA 3FDQA 5KYYB 4U5CE 4I44A 3Q6NA 3K66A 3OWTA 2KGOA 3Q6MA 1VMAA 3EGDA 4JURI 1IW7F 2WZGA 2J0XA 3SEOA 5KYYA 2Y39A 4YT5A 4KI2A 3EPVA 4XWJA 1FMWA 1M2VB 3JSZA 5HSWA 1JPNA 3SYNA 2HV7A 1QLEC 2FGYA 1V54C 3ZG1A 3I5PA 1VK5A 2XRHA 4OINF 3EHMA 3EGXB 3K1HA 2R7TA 3WG7C 2IXNA 3JT1A 5E33A 4HFKB 4QI2A 2Q3TA 5EGYA 4FESA 4BJ1A 1MMAA 3EGXA 4LACB 1G8XA 4OD5A 4B6IA 5B3SC 3AG1C 3Q7GA 1Z23A 3KL4A 5KYWB 4M63A 1Z5ZA 2WVQA 4JCHA 2YZSA 3UR3C 1N1CA 2R7UA 4YWQA 2P6VA 1V55C 4EBBA 4DOZA 4X0RA 3N2ZB 1D1CA 2Y3GA 3RH3A 1D1AA 3AG2C 4Q4ZF 5DLJA 2KNHA 4G7ZF 1ZU5A 2Y3BA 2WVNA 4Q7CA 3RFYA 2Q9CA 4MQ9F 5FCLA 4CS8C 3FVYA 3EZHA 4U5HA 4FWVA 1Z3IX 2CW0F 3JRTA 4G7OF 2Y3DA 4DBQA 3NYMA 4O6YA 3ZSUA 2NUPA 4JJGA 4U5FE 3W8HA 4O79A 4DVYP 5F5FA 2ZXPA 4DBRA 3LS1A 4U5BE 2PF4E 1D0YA 1W2WA 2V26A 2W9YA 4C3EA 5KYUB 2IOQA 1VYKA 2J7PD 5CI8A 5T3WA 4PJNA 1LS1A 4LERA 5KYUA 3ZC4A 3HJCA 1J8MF 3DJUB 4OIRF 1JPJA 2OG2A 3JCUQ 2WZLA 3UMIA 1NU9C 2NG1A 5E3AA 4J32B 5L3QA 3B9QA 2Y69C 4KBLA 1OCRC 4O6MA 2BE5F 4O7GA 3SP1A 3DJNB 5L3VA 5KYXA 3NKEA 3O39A 2Y3HA 3L0IA 2PX0A 5KYNA 3ITFA 2G62A 2IXOA 3DMDA 3B0VC 5D91A 3S0XA 3K6BA 3UGOA 1PD1A 4G0HA 1OCCC 4CS8A 3MLGA 3DM5A 4XTKA 2PX3A 4BG0A 4F4BA 3DAFA 3TD7A 2QY9A 1M56C 3K33A 3E9VA 3DAGA 3UNGC 2Q9AA 2ZXRA 2A68F 3Q7LA 3O6XA 5F5HA 3EZIA 1BR4A 2EIMC 4PJLA 2I8BA 3EG9B 4PFOA 2FFHA 1VOMA 4BJ6A 4XLPF 4IWBA 3NDBB 4PK4A 2EIJC 1LKXA 5DVWA 3UGPA 3AQCA 2IXPA 3NG1A 4HFFB 2M4EA 1TWHA 3V7OA 4I3MA 2J0WA 2KW3C 4Q5SF 3EH2A 1RJ9B 4OD4A 1M2VA 3AG4C 4CS7A 5EHHA 1MNDA 1ZHWA 3S29A 4ANJA 3W2WA 2XSEA 1ZU4A 4LLCA 2R7OA 2JD3A 1RJ9A 4PJJA 2A1DD 4FX5A 2D5RB 4OIOF 3LESA 3DD7A 3S28A 4AE4B 3ASOC 2PFDA 4WJ0A 3HTKC 2LSEA 3JYHA 3I4UA 3DXJF 4C3BA 3EFOB 3VYWA 4IRUA 2EILC 4AE4A 1MMGA 1ZHXA 3E70C 4QDLA 2R7SA 4BJ5C 3EFOA 4LLEA 5KYWA 2W45A 2G3VA 2H7BA 5B1AC 2DGJA 3UMKA 4KC9A 4HE8D 3QZCA 1O5HA 3POVA 2QTVA 2WB7A 4AX2A 1ZYRF 3EH1A 3GANA 2A6EF 2V3CC 4JVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3T A;  3GAN A;  1VK5 A; 
#chains in the Genus database with same CATH topology
 4IB4 A;  2C04 A;  1VLT A;  3RIP A;  1BBH A;  1SMY F;  4FAP B;  4ONS A;  5AC4 A;  2X0C A;  3K1I A;  2AWY A;  4IAQ A;  2PP4 A;  4E0H A;  4K1O A;  4C3D A;  4DVZ A;  2J9B A;  3HLZ A;  4MVR A;  1FMV A;  1OCO C;  3O55 A;  2YEV A;  4XEV A;  1D0X A;  1KNY A;  2IYL D;  2J7P A;  4H54 A;  4AL1 A;  1ZHY A;  1O3U A;  3C62 A;  3EJN A;  3NRH A;  3G50 A;  1QZX A;  3KYJ A;  2ZXW C;  1OXB A;  1T01 A;  2KQ9 A;  3EQL F;  4H4K C;  3TK0 A;  4BJ6 C;  4ZLD A;  4N6C A;  4ULW A;  2ZPA A;  3SXZ A;  4HEA J;  3RYL A;  1MMD A;  4LDQ A;  3VAY A;  2R7W A;  1TWG A;  4U5D E;  4MVM A;  4JZA A;  2XL4 A;  4NTA A;  4EWC A;  4U9E A;  3M79 A;  2O9X A;  1LI5 A;  5DQZ A;  4NTB A;  3KPH A;  4CSA A;  3IEE A;  2XL8 A;  4RDA A;  2YVK A;  2R7Q A;  3ZQY A;  4ULV A;  1BR2 A;  3S84 A;  2YL0 A;  4W8P A;  2QUP A;  1O87 A;  4O6N A;  3DE9 A;  2OU6 A;  4BJ5 A;  1L3P A;  3QW0 A;  1JAF A;  3U3F A;  4EHP A;  2G3K A;  2IBF A;  5JS5 A;  1R5I D;  4KNV A;  3MYI A;  2HKV A;  5DS5 A;  1EKY A;  3H65 A;  1KTM A;  3EHN A;  3PMR A;  4JRZ A;  2P61 A;  4YT4 A;  4MVO A;  3TOM A;  3T4R A;  5JLI A;  5DS4 A;  2VB6 A;  1ZHT A;  3G4Z A;  1C17 M;  3GOD A;  1FTS A;  5EK0 A;  1E83 A;  4BEJ A;  2HV6 A;  4I1O B;  3M4C A;  1TQG A;  2Q00 A;  3QMK A;  4XLN F;  2DYS C;  4C7O B;  4G7H F;  3ABM C;  2L6F A;  3CZ6 A;  1V74 B;  2L7A A;  2OJE D;  3S90 A;  1ZHZ A;  3IQT A;  3MX3 A;  4DXW A;  4U5G A;  4CIP A;  2L81 A;  2QLA A;  4JKV A;  4WAB A;  1TR2 A;  3OEO A;  4RD9 A;  2EPK X;  1FFT C;  4C7O A;  1H6G A;  2J45 A;  3M4B A;  2L6H A;  4A2N B;  5T3T A;  2R7X A;  3HNK A;  2WL8 A;  1Y6D A;  1LPE A;  2AP3 A;  2HJM A;  2Q9B A;  3T6G B;  3KKB A;  4EIY A;  1WAT A;  1LS4 A;  2KK1 A;  3LNM B;  1WN0 A;  1AVO B;  4MTF A;  4N06 A;  3IQ6 A;  2L6G A;  3EG9 A;  3F47 A;  2J9W A;  2L9J A;  5L0F A;  2W4B A;  3LEV A;  4E7S A;  2XXA B;  3DKA A;  2B0J A;  2LP4 A;  2H8A A;  4PAC A;  3TJ5 A;  4D4N A;  4B6I A;  2I15 A;  3K1I C;  4IJJ A;  3PHF 2;  1OW8 A;  1JMW A;  2XXA A;  3ZTM A;  4CIH A;  4P9T A;  1BZ4 A;  3S27 A;  4E17 A;  2X51 A;  4JC7 A;  2ASR A;  4CS9 C;  5DQT A;  4IAO A;  1A7D A;  4P6I C;  5BUO A;  2H7V C;  2M64 A;  2W4M A;  4YT8 A;  3RVZ A;  1GS9 A;  3CSK A;  5A6A A;  2HMQ A;  4NQF A;  4UDV A;  2P0N A;  4XPX A;  2EIK C;  5E3C A;  3LLK A;  3R2P A;  4YK5 A;  3W2V A;  4W8K A;  4J30 B;  4NY3 A;  4XEF A;  1FNT c;  3FXH A;  1PD0 A;  1MMN A;  3DM9 B;  3CQZ A;  3NMJ A;  3U2M A;  2F22 A;  3I5Q A;  5AGF A;  1SZI A;  4CSA C;  2YL7 A;  5COF A;  1I5N A;  1NG1 A;  1I4Y A;  4I1M A;  3L8J A;  3U8V A;  3JZ0 A;  4R32 A;  4RBN A;  4QI0 A;  4OIP F;  1WGW A;  2J46 A;  3NYJ A;  1LE2 A;  5COG A;  1BR1 A;  5E2Q A;  1Q0F A;  3RVY A;  1CGO A;  3ZWI A;  4JE9 A;  3C7J A;  1TKN A;  2WZF A;  1I4Z A;  4DRI B;  1D0Z A;  3JTL O;  4OIQ F;  1FFH A;  1M6T A;  2VH3 A;  3W4Y A;  1WWP A;  3HNI A;  1OKK A;  3KH2 A;  4JW1 A;  4WGZ A;  3C8G A;  1OKK D;  4K0D A;  1M57 C;  2Q4F A;  3SZR A;  2NUT B;  2P7V A;  3LLI A;  4YN0 B;  4JTC B;  3US6 A;  2GFH A;  3U2L A;  1J8Y F;  1HW2 A;  2VAS A;  2KJG A;  3AJM A;  2R7R A;  1MQV A;  4BJT A;  1LE4 A;  3SNH A;  4AK9 A;  2EPM X;  1QPU A;  2ZXO A;  4CBE A;  2H7O A;  5COM A;  2VC9 A;  2NUT A;  3M15 A;  4U5E E;  5JRA A;  4CJG A;  3MBG A;  1E85 A;  2YL3 A;  1Z6A A;  1IZM A;  1Z63 A;  1LVK A;  1FAP B;  2CNW A;  1TWC A;  2NUP B;  4CS9 A;  2IXM A;  4NCQ A;  5AC5 A;  3L1M A;  4N6H A;  2CNW D;  1PCX A;  2CCY A;  3CAX A;  2EIN C;  3KMI A;  3FOP A;  2GWW A;  1NU7 D;  3AQB A;  3K7D A;  3NKD A;  3FHD A;  3ABK C;  4GYT A;  3RKO F;  2B0H A;  1TFO B;  3LUT B;  3PCV A;  1YAU O;  3N0T A;  5D92 A;  4KNW A;  4NTF A;  4JIO A;  3GM2 A;  2XLD A;  3BRJ A;  4IAR A;  2DYR C;  3OA1 A;  5L0I A;  4YT2 A;  1Q0D A;  3DWW A;  2J8W A;  2WVO A;  3DZA A;  3ECS A;  4K7B A;  3L34 A;  2XL6 A;  1VYI A;  2J9U A;  2MYS A;  4AL0 A;  4PJM A;  3AG3 C;  3UMH A;  1AUE A;  2QE9 A;  2XLM A;  2CGE A;  3B0P A;  3U0C A;  2OQM A;  2IM8 A;  4ZLC A;  1D1B A;  3W8I A;  1JR8 A;  3LS0 A;  1TWA A;  3M1C B;  5B1B C;  5BQH A;  3VM6 A;  2E87 A;  4PFP A;  3LJB A;  3T6B A;  4Z9J A;  1ST6 A;  2BC5 A;  3ZIB A;  3LNR A;  3U3B A;  2J9V A;  4EBK A;  1MNE A;  1T6U A;  5KYX B;  3NMI A;  1NZE A;  2A6H F;  1M2O A;  3NYL A;  1EQ1 A;  3TUL A;  3IHU A;  4YJW A;  4N4W A;  3U8P A;  2MWQ A;  3WAQ A;  3WOD F;  1A41 A;  4E7Z A;  2PNO A;  2AVK A;  3B0U X;  1ORY A;  1EI7 A;  5CI9 A;  1NFO A;  4A4A A;  1H9G A;  2YHS A;  3LAY A;  3SXK A;  3X2Q C;  3SXM A;  3O10 A;  2CDQ A;  3TQO A;  2LQG A;  3GM3 A;  4Z9I A;  4MND A;  1NFN A;  1OW6 A;  3X1O A;  2R7V A;  2R05 A;  3LEO A;  1VB5 A;  3ZVR A;  1LIH A;  1APC A;  2A69 F;  3ABL C;  1OCZ C;  2R9R B;  3ATP A;  2R25 A;  3N24 A;  2C03 A;  1S7Z A;  2Z15 A;  2YKZ A;  5DS6 A;  2PBE A;  3ASN C;  1HMD A;  5JUA A;  2OJQ A;  4JJF A;  4CJO A;  3KYI A;  3DE8 A;  4U9D A;  1Z7Q c;  1WAS A;  3F46 A;  1CGM E;  4GEH A;  1SF8 A;  1OR3 A;  1KU2 A;  2OCC C;  5IY5 C;  5T1D B;  2BL2 A;  4J7Y A;  3EGD B;  3T6J A;  3FAJ A;  1LI7 A;  4MVZ A;  3FDQ A;  5KYY B;  4U5C E;  3JRM O;  2LFD A;  4I44 A;  3Q6N A;  3K66 A;  3JYY A;  3OWT A;  2KGO A;  3A9C A;  1V4A A;  2AWC A;  1QVX A;  1CPQ A;  1VMA A;  3C18 A;  3EGD A;  3Q6M A;  3RQF A;  1AEP A;  1K40 A;  3IPM O;  1IW7 F;  2WZG A;  4JUR I;  1E84 A;  1XWJ A;  2J0X A;  3SEO A;  5KYY A;  2Y39 A;  3WHN A;  3GEH A;  3QVZ A;  1BDJ B;  3TOL A;  2NSG A;  4YT5 A;  2D4U A;  4KI2 A;  4CX9 A;  1EA8 A;  3EPV A;  4XWJ A;  1FMW A;  1M2V B;  3JSZ A;  5HSW A;  1VTM P;  1JPN A;  2GDC A;  3SYN A;  3ZDL A;  2HV7 A;  1QLE C;  2FGY A;  4MTG A;  1V54 C;  3VF0 A;  1YJG A;  256B A;  2JPU A;  1G4U S;  3ZG1 A;  1PV3 A;  4MW8 A;  4YL1 A;  2A0U A;  3I5P A;  3HKK A;  2LFF A;  1VK5 A;  2R02 A;  2XRH A;  2HSQ A;  5B3S C;  4OIN F;  3EHM A;  4D4X A;  1GM5 A;  1HE1 A;  2OKU A;  3EGX B;  3K1H A;  2R7T A;  3WG7 C;  2IXN A;  3JT1 A;  2A0B A;  5E33 A;  4HFK B;  4QI2 A;  1Q0G A;  2Q3T A;  5EGY A;  4FES A;  1K04 A;  4BJ1 A;  1MMA A;  3EGX A;  4LAC B;  3SXY A;  2RD9 A;  1G8X A;  1ZVZ A;  4XPY A;  3U9J A;  4NC3 A;  2RSE B;  4OD5 A;  1CGN A;  3AG1 C;  3B71 A;  3JSE O;  3Q7G A;  1VLS A;  1YA9 A;  4Z9H A;  5BQG A;  1Q0K A;  1YAR O;  1Z23 A;  2ETS A;  3KL4 A;  4YL0 A;  4M63 A;  2ICW G;  5KYW B;  1Z5Z A;  2WVQ A;  1SYQ A;  1HW1 A;  4JCH A;  2YZS A;  3UR3 C;  1N1C A;  1U89 A;  2R7U A;  4YWQ A;  2P6V A;  1A7E A;  1V55 C;  2UUI A;  4EBB A;  4CDA A;  4X0R A;  3MFN A;  4DRH B;  4DOZ A;  5A6B A;  1FR0 A;  1NBB A;  3N2Z B;  5JVE A;  1D1C A;  3QW1 A;  5A6B D;  2Y3G A;  3RH3 A;  1D1A A;  4E18 A;  4DRJ B;  3AG2 C;  4JEA A;  4Q4Z F;  2EPN A;  4P9F A;  5DLJ A;  1U0B B;  2KNH A;  3FAP B;  3NMK A;  4G7Z F;  1Q0M A;  1DOW A;  4ER9 A;  4CDY A;  2YL1 A;  1ZU5 A;  2Y3B A;  2WVN A;  4Q7C A;  3RFY A;  2Q9C A;  1OQC A;  4MQ9 F;  1RXQ A;  4XQ1 A;  2OEX A;  4CS8 C;  5FCL A;  3FVY A;  2YQY A;  2EPO A;  3EZH A;  4U5H A;  5L0H A;  4FWV A;  1Z3I X;  1OR2 A;  2XS1 A;  1G5Z A;  2CW0 F;  3JRT A;  1RKC A;  2HSB A;  1H9T A;  4G7O F;  2Y3D A;  4DBQ A;  4J7T A;  5BQI A;  3NYM A;  1CPR A;  3B29 A;  4O6Y A;  3ZSU A;  1YYX A;  2NUP A;  3HNL A;  4G78 A;  2R03 A;  3RQG A;  2ZD9 A;  3T9O A;  3MYF A;  4JJG A;  3R7C A;  4U5F E;  3W8H A;  4O79 A;  4DVY P;  2CYD A;  5F5F A;  4EKW A;  2ZXP A;  4DBR A;  3LS1 A;  3AOU A;  4U5B E;  1ZW3 A;  2PF4 E;  1D0Y A;  1W2W A;  1ZZP A;  2V26 A;  2W9Y A;  4C3E A;  2IOQ A;  5KYU B;  2VCC A;  4MVU A;  3HNJ A;  1VYK A;  2HJ3 A;  5JP7 A;  2J7P D;  1L7C A;  5CI8 A;  5T3W A;  4PJN A;  3PDM P;  3BEH A;  1LS1 A;  4LER A;  5JSL A;  5KYU A;  3ZC4 A;  4ANJ A;  1QKR A;  1J8M F;  2YLD A;  2VCA A;  3HJC A;  3J06 A;  1NLX A;  3DJU B;  4OIR F;  1JPJ A;  2OG2 A;  1XZQ A;  1YA7 O;  2WZL A;  3JCU Q;  1NU9 C;  2HS5 A;  2NG1 A;  4J32 B;  5E3A A;  3UMI A;  4BEM J;  3H2U A;  5L3Q A;  3L8I A;  2XLW A;  1A0B A;  3B9Q A;  2Y69 C;  1ZW2 A;  2FAP B;  3C8Z A;  1JOG A;  4JTD B;  4KBL A;  1OCR C;  4O6M A;  2NSF A;  2XLV A;  1G4W R;  2BE5 F;  4JTA B;  3GOR A;  4O7G A;  3SP1 A;  2HUJ A;  4MVS A;  3V5X A;  4DJ9 A;  4E0I A;  3DJN B;  3IQC A;  4IGG A;  3U9M A;  5L3V A;  5KYX A;  3NKE A;  1WOL A;  5K0I A;  3O39 A;  2Y3H A;  3L0I A;  2PX0 A;  1HE9 A;  3ZTZ A;  2XLO A;  1ORJ A;  3A11 A;  5KYN A;  4GQH A;  3ITF A;  1UG7 A;  2G62 A;  2IXO A;  2HMZ A;  3V5Z A;  3DMD A;  3GEI A;  3H2V A;  5A6J A;  3B0V C;  5D91 A;  3S0X A;  3K6B A;  3UGO A;  3IQ5 A;  1PD1 A;  4G0H A;  1OCC C;  4CS8 A;  3GWN A;  2VCB A;  3MLG A;  3ZQV A;  3DM5 A;  5HV9 A;  4XTK A;  2PX3 A;  4BG0 A;  4F4B A;  3DAF A;  3TD7 A;  5L0D A;  2QY9 A;  1JRA A;  1M56 C;  1YDI A;  2HFI A;  2XM4 A;  3K33 A;  2YLG A;  1C02 A;  1R4T A;  3DAG A;  1RKE B;  3E9V A;  3UNG C;  2Q9A A;  3GEE A;  1E2X A;  2ZXR A;  2A68 F;  5GPG B;  2MHR A;  3Q7L A;  3O6X A;  2Q7R A;  1F1M A;  2TMV P;  2KC3 A;  5F5H A;  3EZI A;  1RKE A;  1QQ3 A;  2OOC A;  3DI5 A;  1BR4 A;  4JEB A;  5FZT A;  2NPU A;  2YWA A;  2EIM C;  4PJL A;  2I8B A;  3EG9 B;  4LDK A;  4PFO A;  2FFH A;  3QTH A;  5CIV A;  1B68 A;  1VOM A;  3U5S A;  3G4X A;  4BJ6 A;  1A7V A;  4XLP F;  1T5O A;  1T6Q A;  4IWB A;  5TJ5 E;  3NDB B;  1TFK B;  4PK4 A;  2EIJ C;  1LKX A;  4CDV A;  5DVW A;  3RF3 A;  3AQC A;  5L0G A;  3UGP A;  1S05 A;  2IXP A;  4EUK B;  3NG1 A;  3CEX A;  2M4E A;  4HFF B;  1OW7 A;  1RCP A;  1TWH A;  1XZP A;  5A69 A;  2XLH A;  1SR2 A;  3FOO A;  3V7O A;  2LCH A;  3RQE A;  4I3M A;  4EBJ A;  2J0W A;  2KW3 C;  2YRF A;  2YLI A;  1YZA A;  4MVQ A;  1UFB A;  1YLM A;  3EH2 A;  4Q5S F;  1RJ9 B;  4OD4 A;  1M2V A;  2LD6 A;  1GQA A;  3AG4 C;  4PR9 A;  1WTY A;  4CS7 A;  4MTO A;  5EHH A;  1MND A;  1U6H A;  1YZC A;  1ZHW A;  2XS8 A;  2OEV A;  2GA0 A;  2KSF A;  3C63 A;  4JCZ A;  5F28 E;  3S29 A;  2GAQ A;  4MW3 A;  2XSE A;  1QSP A;  3RW0 A;  1ZU4 A;  1DOV A;  2JX0 A;  4LLC A;  1ORS C;  2R7O A;  2JD3 A;  1RJ9 A;  2KYH A;  4PJJ A;  2A1D D;  4FX5 A;  1T9K A;  4LDR A;  2D5R B;  3GWL A;  4OIO F;  3LES A;  1C03 A;  3DD7 A;  3QVY A;  5JT4 A;  3W2W A;  3S28 A;  4AE4 B;  5L0C A;  2XLE A;  4BPM A;  3FMS A;  3ASO C;  1HY5 A;  2PFD A;  4WJ0 A;  4YL3 A;  2AU5 A;  3HTK C;  2LSE A;  3GM1 A;  3I4U A;  3DXJ F;  2P1A A;  3JYH A;  4C3B A;  3EFO B;  3VYW A;  4IRU A;  2QNL A;  1K05 A;  1YVI A;  2EIL C;  4AE4 A;  2LIG A;  1MMG A;  1ZHX A;  3E70 C;  4QDL A;  2R7S A;  4L6R A;  3VRC A;  4BJ5 C;  3TJ6 A;  5L0J A;  1OXK A;  3EFO A;  1T6I A;  4LLE A;  5KYW A;  1Y4C A;  2W45 A;  4WGY A;  1RMV A;  1GGQ A;  2G3V A;  5A6K A;  1LM3 B;  3C8G B;  2H7B A;  4XEK A;  5B1A C;  4XPW A;  1H7I A;  1NSG B;  2DGJ A;  1YYJ A;  3UMK A;  4KC9 A;  3S9O A;  5B3I A;  2UUH A;  3V5Y A;  4HE8 D;  3QZC A;  1O5H A;  2HZ8 A;  3POV A;  1HMO A;  2QTV A;  2XM0 A;  2WB7 A;  2EPL X;  4AX2 A;  1ZYR F;  4MS2 A;  3AGT A;  3EH1 A;  3GAN A;  3C8G D;  2A6E F;  1E86 A;  3AGU A;  2LK4 A;  2DI3 A;  4JVS A;  2V3C C;  2DB4 A; 
#chains in the Genus database with same CATH homology
 2C04 A;  3RIP A;  1SMY F;  2PP4 A;  4C3D A;  4DVZ A;  3HLZ A;  1FMV A;  1OCO C;  2YEV A;  1D0X A;  2IYL D;  2J7P A;  1ZHY A;  3EJN A;  3NRH A;  1QZX A;  2ZXW C;  3EQL F;  2KQ9 A;  4H4K C;  4BJ6 C;  4ZLD A;  4ULW A;  2ZPA A;  4HEA J;  3RYL A;  1MMD A;  3VAY A;  2R7W A;  1TWG A;  4U5D E;  4JZA A;  2XL4 A;  4EWC A;  2O9X A;  5DQZ A;  4CSA A;  3IEE A;  4RDA A;  2R7Q A;  1BR2 A;  1O87 A;  4O6N A;  4BJ5 A;  2G3K A;  4KNV A;  5DS5 A;  3H65 A;  3EHN A;  3PMR A;  4YT4 A;  3T4R A;  5DS4 A;  2VB6 A;  1ZHT A;  3GOD A;  1FTS A;  4BEJ A;  2HV6 A;  4I1O B;  4C7O B;  3QMK A;  4XLN F;  2DYS C;  4G7H F;  3ABM C;  3CZ6 A;  1ZHZ A;  3MX3 A;  4U5G A;  2L81 A;  1TR2 A;  3OEO A;  4RD9 A;  1FFT C;  4C7O A;  2J45 A;  4A2N B;  5T3T A;  2R7X A;  2WL8 A;  2Q9B A;  3KKB A;  4N06 A;  3EG9 A;  3F47 A;  2J9W A;  2L9J A;  2W4B A;  3LEV A;  4E7S A;  2XXA B;  2B0J A;  3K1I C;  4IJJ A;  3PHF 2;  2XXA A;  4CIH A;  3S27 A;  2X51 A;  4CS9 C;  5DQT A;  4IAO A;  4P6I C;  5BUO A;  2H7V C;  2W4M A;  4YT8 A;  3CSK A;  2EIK C;  5E3C A;  3LLK A;  3W2V A;  4W8K A;  4J30 B;  4NY3 A;  1PD0 A;  1MMN A;  3DM9 B;  3CQZ A;  4CSA C;  3I5Q A;  1SZI A;  1NG1 A;  4I1M A;  4RBN A;  4QI0 A;  4OIP F;  1WGW A;  2J46 A;  3NYJ A;  1BR1 A;  5E2Q A;  1TKN A;  2WZF A;  4OIQ F;  1D0Z A;  1FFH A;  2VH3 A;  1OKK A;  3KH2 A;  4JW1 A;  1OKK D;  4K0D A;  1M57 C;  3SZR A;  2NUT B;  2P7V A;  3LLI A;  4YN0 B;  2GFH A;  1J8Y F;  2VAS A;  2KJG A;  2R7R A;  4BJT A;  3SNH A;  4AK9 A;  2ZXO A;  4CBE A;  2H7O A;  2NUT A;  4U5E E;  1Z6A A;  1IZM A;  1Z63 A;  1LVK A;  2CNW A;  1TWC A;  2NUP B;  4CS9 A;  2IXM A;  2CNW D;  1PCX A;  2EIN C;  3KMI A;  1NU7 D;  3AQB A;  3K7D A;  3NKD A;  3FHD A;  3ABK C;  4GYT A;  3RKO F;  3N0T A;  5D92 A;  4KNW A;  2DYR C;  3OA1 A;  4YT2 A;  2WVO A;  3DZA A;  3ECS A;  4K7B A;  3L34 A;  1VYI A;  2J9U A;  2MYS A;  4PJM A;  3AG3 C;  3UMH A;  2CGE A;  3B0P A;  4ZLC A;  1D1B A;  3W8I A;  3LS0 A;  1TWA A;  3M1C B;  5B1B C;  2E87 A;  4PFP A;  3LJB A;  3T6B A;  3ZIB A;  1ST6 A;  3LNR A;  2J9V A;  1MNE A;  5KYX B;  1NZE A;  2A6H F;  1M2O A;  3NYL A;  4YJW A;  4E7Z A;  2MWQ A;  3WOD F;  3B0U X;  5CI9 A;  2YHS A;  3LAY A;  3X2Q C;  2CDQ A;  4MND A;  3X1O A;  2R7V A;  3ZVR A;  2A69 F;  3ABL C;  1OCZ C;  3N24 A;  2C03 A;  1S7Z A;  2Z15 A;  5DS6 A;  3ASN C;  4JJF A;  3F46 A;  4GEH A;  1SF8 A;  2OCC C;  1KU2 A;  5IY5 C;  5T1D B;  3EGD B;  3T6J A;  3FAJ A;  3FDQ A;  5KYY B;  4U5C E;  4I44 A;  3Q6N A;  3K66 A;  3OWT A;  2KGO A;  3Q6M A;  1VMA A;  3EGD A;  4JUR I;  1IW7 F;  2WZG A;  2J0X A;  3SEO A;  5KYY A;  2Y39 A;  4YT5 A;  4KI2 A;  3EPV A;  4XWJ A;  1FMW A;  1M2V B;  3JSZ A;  5HSW A;  1JPN A;  3SYN A;  2HV7 A;  1QLE C;  2FGY A;  1V54 C;  3ZG1 A;  3I5P A;  1VK5 A;  2XRH A;  4OIN F;  3EHM A;  3EGX B;  3K1H A;  2R7T A;  3WG7 C;  2IXN A;  3JT1 A;  5E33 A;  4HFK B;  4QI2 A;  2Q3T A;  5EGY A;  4FES A;  4BJ1 A;  1MMA A;  3EGX A;  4LAC B;  1G8X A;  4OD5 A;  4B6I A;  5B3S C;  3AG1 C;  3Q7G A;  1Z23 A;  3KL4 A;  5KYW B;  4M63 A;  1Z5Z A;  2WVQ A;  4JCH A;  2YZS A;  3UR3 C;  1N1C A;  2R7U A;  4YWQ A;  2P6V A;  1V55 C;  4EBB A;  4DOZ A;  4X0R A;  3N2Z B;  1D1C A;  2Y3G A;  3RH3 A;  1D1A A;  3AG2 C;  4Q4Z F;  5DLJ A;  2KNH A;  4G7Z F;  1ZU5 A;  2Y3B A;  2WVN A;  4Q7C A;  3RFY A;  2Q9C A;  4MQ9 F;  5FCL A;  4CS8 C;  3FVY A;  3EZH A;  4U5H A;  4FWV A;  1Z3I X;  2CW0 F;  3JRT A;  4G7O F;  2Y3D A;  4DBQ A;  3NYM A;  4O6Y A;  3ZSU A;  2NUP A;  4JJG A;  4U5F E;  3W8H A;  4O79 A;  4DVY P;  5F5F A;  2ZXP A;  4DBR A;  3LS1 A;  4U5B E;  2PF4 E;  1D0Y A;  1W2W A;  2V26 A;  2W9Y A;  4C3E A;  5KYU B;  2IOQ A;  1VYK A;  2J7P D;  5CI8 A;  5T3W A;  4PJN A;  1LS1 A;  4LER A;  5KYU A;  3ZC4 A;  3HJC A;  1J8M F;  3DJU B;  4OIR F;  1JPJ A;  2OG2 A;  3JCU Q;  2WZL A;  3UMI A;  1NU9 C;  2NG1 A;  5E3A A;  4J32 B;  5L3Q A;  3B9Q A;  2Y69 C;  4KBL A;  1OCR C;  4O6M A;  2BE5 F;  4O7G A;  3SP1 A;  3DJN B;  5L3V A;  5KYX A;  3NKE A;  3O39 A;  2Y3H A;  3L0I A;  2PX0 A;  5KYN A;  3ITF A;  2G62 A;  2IXO A;  3DMD A;  3B0V C;  5D91 A;  3S0X A;  3K6B A;  3UGO A;  1PD1 A;  4G0H A;  1OCC C;  4CS8 A;  3MLG A;  3DM5 A;  4XTK A;  2PX3 A;  4BG0 A;  4F4B A;  3DAF A;  3TD7 A;  2QY9 A;  1M56 C;  3K33 A;  3E9V A;  3DAG A;  3UNG C;  2Q9A A;  2ZXR A;  2A68 F;  3Q7L A;  3O6X A;  5F5H A;  3EZI A;  1BR4 A;  2EIM C;  4PJL A;  2I8B A;  3EG9 B;  4PFO A;  2FFH A;  1VOM A;  4BJ6 A;  4XLP F;  4IWB A;  3NDB B;  4PK4 A;  2EIJ C;  1LKX A;  5DVW A;  3UGP A;  3AQC A;  2IXP A;  3NG1 A;  4HFF B;  2M4E A;  1TWH A;  3V7O A;  4I3M A;  2J0W A;  2KW3 C;  4Q5S F;  3EH2 A;  1RJ9 B;  4OD4 A;  1M2V A;  3AG4 C;  4CS7 A;  5EHH A;  1MND A;  1ZHW A;  3S29 A;  4ANJ A;  3W2W A;  2XSE A;  1ZU4 A;  4LLC A;  2R7O A;  2JD3 A;  1RJ9 A;  4PJJ A;  2A1D D;  4FX5 A;  2D5R B;  4OIO F;  3LES A;  3DD7 A;  3S28 A;  4AE4 B;  3ASO C;  2PFD A;  4WJ0 A;  3HTK C;  2LSE A;  3JYH A;  3I4U A;  3DXJ F;  4C3B A;  3EFO B;  3VYW A;  4IRU A;  2EIL C;  4AE4 A;  1MMG A;  1ZHX A;  3E70 C;  4QDL A;  2R7S A;  4BJ5 C;  3EFO A;  4LLE A;  5KYW A;  2W45 A;  2G3V A;  2H7B A;  5B1A C;  2DGJ A;  3UMK A;  4KC9 A;  4HE8 D;  3QZC A;  1O5H A;  3POV A;  2QTV A;  2WB7 A;  4AX2 A;  1ZYR F;  3EH1 A;  3GAN A;  2A6E F;  2V3C C;  4JVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...