4U9DA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, ab3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A designed supramolecular protein assembly with in vivo enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9dA00
1E84A 3DE8A 3QVYA 4CDVA 3NMJA 5JS5A 2YL3A 1YYXA 5JLIA 1CPRA 2XLEA 1QQ3A 3HNLA 1APCA 2XM0A 2XL6A 4IB4A 2XLWA 3M15A 3L1MA 2J8WA 1JAFA 1RCPA 5JVEA 4N6HA 4L6RA 3ZQYA 2XLHA 1MQVA 3ZQVA 2YLDA 5B3IA 2YL1A 3QW0A 3NMKA 2XM4A 1BBHA 5JUAA 2QLAA 5JT4A 4JKVA 2YLGA 2YLIA 3U8PA 2XLOA 1NBBA 2BC5A 1LM3B 4JE9A 4IAQA 4JEBA 3ZWIA 1CGNA 3C62A 3IQ6A 3FOPA 4EIYA 5AGFA 4D4NA 4U9DA 1QPUA 4ULVA 4WGZA 4D4XA 4ER9A 4CDYA 4WGYA 1S05A 5JP7A 5JSLA 3DE9A 3HNKA 2XL8A 3IQ5A 1A7VA 256BA 3M4CA 1YYJA 3TOLA 3HNJA 3TOMA 4IARA 1E83A 2YKZA 2CCYA 2YL7A 4CJOA 3M4BA 4CIPA 2XLVA 4CX9A 1EKYA 5JRAA 3QVZA 3ZTZA 3M79A 3NMIA 2XLDA 3ZTMA 2J9BA 1YZCA 2YL0A 4U9EA 1CGOA 3FOOA 4CDAA 4N4WA 1GQAA 1M6TA 1E86A 3C63A 4CJGA 3QW1A 4JEAA 1YZAA 3HNIA 1E85A 4NC3A 3VRCA 1CPQA 2XLMA
chains in the Genus database with same CATH superfamily
1I4YA 2DYSC 3FMSA 1WN0A 2WL8A 4OIQF 3QVYA 4CDVA 2HJMA 4AK9A 4MW8A 4G7OF 2LSEA 3V5ZA 3W8IA 1HY5A 4CSAC 2YL3A 4CS9A 3WHNA 1FMVA 3S90A 4N06A 5K0IA 3CAXA 2E87A 4P9TA 1G5ZA 1ZHXA 2KGOA 5L0CA 5DLJA 4RDAA 3J06A 2XM0A 1GGQA 3GODA 2XLWA 4U5FE 2J45A 5KYNA 1RCPA 4ONSA 3KPHA 4I44A 4YT8A 4Z9IA 3EGDB 3EGDA 5CIVA 3EZHA 2KNHA 3C8GD 4PJLA 3FHDA 1QVXA 3Q6NA 3ECSA 3I5PA 4NTBA 3ZQVA 1VLTA 2R9RB 1TR2A 2WVOA 3IHUA 1AVOB 4PJJA 2HV6A 3ABMC 3NMKA 1Z7Qc 3T6GB 2H7VC 1TWHA 1MNDA 2XM4A 4GEHA 3M1CB 4NCQA 2HJ3A 1OCOC 2J9WA 3K33A 3S28A 2QLAA 3UMKA 4AX2A 3HJCA 4EBJA 4OIOF 2TMVP 2EILC 3AJMA 2EIMC 4OD5A 2R7TA 2YLGA 3VYWA 2OCCC 3B29A 3S84A 3FAJA 3FDQA 1LPEA 2XSEA 3ATPA 3K1IA 1WOLA 1WWPA 1ZU4A 4O6NA 3V7OA 3NG1A 2MWQA 2X0CA 3ABLC 1LE4A 1MMDA 2JD3A 5KYUA 4LLEA 4DVYP 1BR1A 5KYUB 1GS9A 4I1MA 2A0BA 2HMZA 3ZWIA 4MTFA 1QSPA 2Q00A 2LFFA 3FOPA 3LNRA 4U5EE 3G4XA 3DAFA 1O5HA 3TK0A 4EIYA 4D4NA 1QZXA 2XRHA 4U5GA 4C3DA 4BPMA 5COGA 1QPUA 1TWGA 1IW7F 4ULVA 4D4XA 1UG7A 4P6IC 1PV3A 1YVIA 2PX3A 1A41A 1ZZPA 4H4KC 1LIHA 1HMOA 4PK4A 4AL0A 1XZPA 4YK5A 1YYJA 3B0VC 3TOLA 3UGPA 3AQBA 2EIKC 3RH3A 5HSWA 2Y3HA 3PMRA 3A9CA 2UUHA 2OOCA 3U3FA 2NSGA 5DVWA 1Z23A 2IOQA 3M4BA 1E83A 1KTMA 1M57C 4JRZA 4CX9A 2AP3A 2I8BA 5L0GA 4ULWA 1KNYA 2DI3A 4JJFA 2H7BA 4EWCA 2B0JA 1VYKA 2HFIA 3EFOB 3C8ZA 1Y6DA 1TWAA 3NMIA 1FMWA 1Q0DA 2XLDA 3ZTMA 2C04A 2J9BA 4DOZA 3K1IC 1SMYF 1WASA 3FXHA 3LNMB 4KNWA 2OQMA 2ETSA 1LE2A 1YDIA 3DMDA 1GQAA 1EQ1A 3OA1A 1SYQA 1E86A 3W8HA 2QNLA 5L3QA 5F5FA 1ZW3A 1RMVA 3CSKA 1Q0MA 1YZAA 3RQEA 1OCCC 2IM8A 3C8GA 3C8GB 1RJ9B 1RJ9A 2R05A 3DI5A 2ZXWC 4FX5A 1A0BA 2R7UA 2EPNA 4U5DE 2OJQA 4PJMA 3JSZA 4PACA 3U0CA 4EKWA 2B0HA 2GA0A 4YWQA 3VRCA 4Q4ZF 1VTMP 1ORJA 3LLKA 2L6HA 5T3WA 4YL1A 4JCZA 4DRHB 1OKKA 2DGJA 2YEVA 4XLPF 2P0NA 4YN0B 4E7ZA 1B68A 2Q9AA 3MYIA 4I3MA 5A6AA 4DVZA 1OR2A 2QE9A 3N0TA 5E2QA 4JVSA 5E3AA 5DQTA 5A6BA 2IXPA 1QKRA 5JS5A 2GAQA 3PHF2 2GFHA 3H2UA 3ABKC 3W2VA 5JLIA 2XLEA 3HNLA 1QQ3A 3GWLA 4CBEA 3EFOA 4IB4A 1JOGA 3K66A 4YJWA 2GDCA 2G3KA 2HS5A 1ORSC 2R25A 4EHPA 2J8WA 4R32A 3LLIA 1H9TA 4P9FA 3JYYA 5DQZA 3MBGA 1LVKA 1Z6AA 3U2LA 4UDVA 3RQGA 5A6KA 1K40A 3GEIA 2NG1A 1U0BB 4QI2A 4L6RA 1AEPA 4M63A 3ZQYA 3VM6A 5EGYA 4QDLA 5L0DA 2XXAB 2XXAA 5B3IA 3B9QA 2YL1A 4HFKB 1WGWA 3KKBA 2CNWD 3QW0A 1H7IA 1Y4CA 2LFDA 3JZ0A 4IAOA 1JPJA 4J7TA 3UMHA 2LQGA 5F5HA 3F47A 4RD9A 3LEVA 3KL4A 1SF8A 1T6QA 2KC3A 1J8MF 1TKNA 1KU2A 2J46A 2KSFA 4G0HA 4NTAA 2A68F 2CNWA 2KW3C 4MTGA 4YT5A 3SP1A 1BDJB 1C17M 2L6GA 5AC4A 5JT4A 2NSFA 1VB5A 4BEMJ 1NZEA 5T1DB 1VMAA 5KYWA 5KYWB 2J0WA 1XWJA 4IJJA 2ASRA 4LACB 3WODF 3S9OA 4NTFA 1YAUO 1T5OA 2HSQA 1PD1A 4LLCA 4MVUA 4YL0A 3S27A 3X1OA 3VAYA 4C7OA 2BC5A 4C7OB 1K04A 2AWYA 1U6HA 3WG7C 4BJ6C 2D5RB 2IXOA 3JYHA 3CEXA 3JT1A 1H9GA 3DWWA 3I4UA 1D1CA 2R02A 2Y39A 4GYTA 4WGZA 4HFFB 4ER9A 3DAGA 4WGYA 4FESA 4MW3A 4XEVA 4XWJA 4CDYA 4HE8D 3E9VA 5JP7A 3GEHA 1WATA 2CGEA 1SR2A 1EI7A 1VYIA 2VCCA 1ST6A 1JR8A 2WZLA 3IQ5A 4O7GA 1ZU5A 3G4ZA 1OW8A 1RKCA 4Z9JA 4DJ9A 2W4MA 2JX0A 4CJOA 1BR4A 4IARA 3TOMA 2R7XA 3U2MA 5DS4A 3NDBB 4U5BE 1OKKD 3DJUB 5DS5A 2AU5A 3JCUQ 1N1CA 5B1BC 3RIPA 3B0UX 5JRAA 1MMGA 3SXMA 1G8XA 1NLXA 1V74B 3QVZA 3SNHA 2YHSA 4Q5SF 1AUEA 1FFTC 2HV7A 4EBKA 4MVZA 3T9OA 1YZCA 1CGOA 3U9JA 2JPUA 4JIOA 2ZPAA 1Z3IX 3H65A 1FTSA 3GM3A 1LI7A 2MYSA 1XZQA 3ZVRA 4XLNF 1M6TA 4AE4B 3L8JA 3RYLA 1Z5ZA 4AE4A 4CJGA 1S7ZA 3DD7A 4DBQA 2XS1A 3JTLO 3I5QA 1NFNA 3SXYA 2A6EF 2OJED 3RFYA 2ZXPA 1RKEA 1RKEB 1PD0A 2X51A 1CGME 5KYYA 5KYYB 3V5XA 3EH1A 2L81A 2WB7A 4CS8C 1T9KA 1I5NA 3QMKA 2LD6A 2ZXOA 3X2QC 4BJTA 4E17A 4ZLCA 2IXNA 2V3CC 3IPMO 5BQGA 2HKVA 3BRJA 2XLMA 1M2VA 1M2VB 4LDQA 5L0IA 4O6MA 2PF4E 1OXBA 4FWVA 3EGXA 3EGXB 2W45A 4O79A 3NMJA 4G7HF 1JMWA 3EPVA 2IBFA 3GWNA 4OD4A 4IWBA 4J7YA 4EUKB 3TJ5A 1UFBA 3B71A 2I15A 3KH2A 4RBNA 2PBEA 5L0JA 3EJNA 3S29A 3WAQA 3U5SA 4E18A 1YA7O 3IQTA 3NYLA 1E2XA 3OWTA 3DZAA 1SZIA 1HW2A 2CDQA 3IEEA 4LDRA 1LS1A 1VK5A 1WTYA 3GM1A 2HUJA 5EK0A 4OINF 4KC9A 3SEOA 2R7QA 4JJGA 4NY3A 1NU7D 1PCXA 1MNEA 1ZHTA 1K05A 2H7OA 3C18A 4I1OB 4LDKA 3RKOF 3U3BA 4MVRA 2YLDA 4XPXA 2VCBA 1R5ID 1HE1A 3U9MA 4MVOA 5E3CA 1HMDA 1A7EA 2G62A 4CS8A 1BBHA 2GWWA 2J0XA 1D0ZA 4AL1A 4JTCB 1IZMA 4O6YA 4YT2A 5HV9A 1T01A 4HEAJ 5T3TA 2Q9BA 4FAPB 5E33A 5IY5C 3POVA 5CI8A 5A6BD 1I4ZA 2EIJC 3NYMA 4U5HA 3T6JA 3UNGC 2R7SA 3LUTB 4K0DA 2YLIA 3KYIA 2XL4A 1FAPB 4MVMA 2LIGA 2XLOA 1HW1A 3RW0A 1M56C 3GM2A 1VLSA 2AWCA 2WZGA 4JE9A 1O3UA 4JEBA 3CQZA 3K6BA 4JTAB 3W2WA 2ZXRA 3K1HA 2MHRA 3MFNA 2KYHA 2KQ9A 2R7OA 1V4AA 5DS6A 3S0XA 1YLMA 2J9VA 4WABA 5FCLA 2VCAA 4GQHA 2KK1A 1JRAA 1Q0FA 2NUTB 2P7VA 3N2ZB 4W8KA 2NUTA 2LP4A 2HMQA 3KYJA 4Z9HA 3ZDLA 1TFKB 4J30B 3EHNA 2WZFA 3EH2A 1A7DA 1S05A 4Q7CA 3PDMP 3L8IA 3UGOA 1YJGA 4JW1A 3DE9A 2OG2A 5BQHA 4JC7A 4PJNA 2J7PD 2FAPB 2XL8A 1A7VA 256BA 1G4US 2IXMA 3M4CA 2BL2A 2EPKX 3DJNB 3HNJA 4BJ6A 2P1AA 2KJGA 1L3PA 4MS2A 4CIPA 4WJ0A 1OR3A 5AC5A 1H6GA 2VH3A 4F4BA 1JPNA 5L0HA 4DXWA 2Q4FA 2L9JA 2Y3BA 3M79A 5A69A 2DB4A 2J9UA 3AGUA 3LESA 3AG3C 1MMNA 2L6FA 2WVNA 3NKDA 2YL0A 3MYFA 3NKEA 4E7SA 3SZRA 2A69F 3N24A 3T6BA 3O6XA 2H8AA 1DOVA 2W4BA 4CDAA 1T6UA 2G3VA 2QY9A 4BEJA 2NUPB 2LCHA 2NUPA 4JZAA 4MVQA 4K7BA 2LK4A 2A0UA 2RSEB 4MVSA 5CI9A 4CSAA 4JEAA 2R03A 3BEHA 4LERA 3LEOA 1FFHA 3E70C 3SXKA 4EBBA 1NFOA 3IQCA 3VF0A 2P61A 2HSBA 1G4WR 2NPUA 3LAYA 4PFOA 4ANJA 2YQYA 2CYDA 2Y3DA 2PX0A 1F1MA 3L34A 2Y69C 3DM9B 3Q7LA 1NU9C 1TFOB 1HE9A 3V5YA 2AVKA 2PP4A 5GPGB 4YT4A 4IRUA 3HTKC 1DOWA 1VOMA 3DE8A 5L3VA 1E84A 1D1AA 1MMAA 1FR0A 2OEXA 2FGYA 1OW7A 1ZVZA 2PFDA 1OW6A 3AG1C 3O55A 4K1OA 3B0PA 3RF3A 3ZG1A 4DRJB 4E0HA 1YYXA 2VB6A 3US6A 1LKXA 1CPRA 3CZ6A 1APCA 3R2PA 3FVYA 3JSEO 4JCHA 2VC9A 2XL6A 3LS0A 1C03A 1OCRC 4E0IA 1OCZC 3O39A 3MLGA 3M15A 4U5CE 3T4RA 2EPMX 3L1MA 1O87A 4H54A 2YVKA 3U8VA 1JAFA 4BJ1A 2XS8A 1M2OA 1TQGA 4BJ5C 1OXKA 4N6CA 3SXZA 5JVEA 1BZ4A 3FAPB 2OU6A 3JRMO 4OIPF 4N6HA 5BUOA 4XTKA 1ZHYA 3QTHA 3RQFA 1LS4A 1J8YF 1MQVA 2XLHA 2Q7RA 2C03A 3KMIA 4JTDB 4XPYA 4A2NB 4B6IA 1C02A 4CS7A 4MQ9F 3ASNC 3UR3C 2J7PA 1YA9A 2IYLD 3GANA 3JRTA 4BG0A 2ICWG 3K7DA 4CIHA 2R7WA 5JUAA 5KYXA 5KYXB 2D4UA 4W8PA 4JKVA 4MNDA 1U89A 3Q6MA 5A6JA 1QLEC 2A6HF 3ZIBA 5B3SC 3F46A 1LI5A 4C3EA 3EQLF 2OKUA 3GEEA 3GORA 4X0RA 5D91A 5B1AC 3L0IA 5TJ5E 3U8PA 1NBBA 2M64A 4CS9C 1LM3B 4PFPA 3C7JA 1D0XA 1OQCA 4IAQA 4NQFA 3RVYA 2R7VA 3DM5A 2R7RA 3ZSUA 4G7ZF 1CGNA 3AQCA 2RD9A 3C62A 3IQ6A 3PCVA 4KNVA 3TULA 3QZCA 5AGFA 2A1DD 3HLZA 3DKAA 4U9DA 2L7AA 4DRIB 2DYRC 2ZD9A 4PR9A 5JSLA 1GM5A 1NSGB 3HKKA 3LS1A 3G50A 4OIRF 2Y3GA 4IGGA 1T6IA 2YZSA 4A4AA 2F22A 2P6VA 4KI2A 2EINC 2UUIA 3NRHA 5COFA 5D92A 3HNKA 3AOUA 3TJ6A 2QUPA 3UMIA 3W4YA 3Q7GA 4KBLA 2OEVA 2EPLX 3NYJA 4ZLDA 3EG9B 1Q0KA 3EG9A 3LJBA 1D0YA 1NG1A 2CCYA 2HZ8A 2Q9CA 1V55C 2YL7A 2YKZA 2YRFA 1ZYRF 2YWAA 3A11A 2XLVA 1ZW2A 4C3BA 1EKYA 2WVQA 1Z63A 2M4EA 3ZTZA 1D1BA 1FNTc 3ASOC 3AG2C 1ZHWA 4XEFA 3EHMA 3AGTA 1Q0GA 3H2VA 4QI0A 2QTVA 2FFHA 2VASA 5L0FA 4JURI 1BR2A 4U9EA 4MTOA 3DXJF 3FOOA 4BJ5A 4XPWA 3R7CA 1RXQA 3MX3A 4N4WA 3ZC4A 4XEKA 2W9YA 4J32B 4G78A 1L7CA 2CW0F 5FZTA 3C63A 2Q3TA 1TWCA 4YL3A 3AG4C 1ORYA 1R4TA 3ITFA 3QW1A 1YARO 5F28E 3RVZA 2PNOA 3OEOA 3O10A 3TD7A 3SYNA 3HNIA 1E85A 3TQOA 4NC3A 5BQIA 4XQ1A 2Z15A 5EHHA 1EA8A 2O9XA 4DBRA 1ZHZA 1W2WA 3EZIA 2BE5F 2EPOA 5COMA 2V26A 1CPQA 1V54C
chains in the Genus database with same CATH topology
1E84A 3DE8A 3QVYA 4CDVA 3NMJA 5JS5A 2YL3A 1YYXA 5JLIA 1CPRA 2XLEA 1QQ3A 3HNLA 1APCA 2XM0A 2XL6A 4IB4A 2XLWA 3M15A 3L1MA 2J8WA 1JAFA 1RCPA 5JVEA 4N6HA 4L6RA 3ZQYA 2XLHA 1MQVA 3ZQVA 2YLDA 5B3IA 2YL1A 3QW0A 3NMKA 2XM4A 1BBHA 5JUAA 2QLAA 5JT4A 4JKVA 2YLGA 2YLIA 3U8PA 2XLOA 1NBBA 2BC5A 1LM3B 4JE9A 4IAQA 4JEBA 3ZWIA 1CGNA 3C62A 3IQ6A 3FOPA 4EIYA 5AGFA 4D4NA 4U9DA 1QPUA 4ULVA 4WGZA 4D4XA 4ER9A 4CDYA 4WGYA 1S05A 5JP7A 5JSLA 3DE9A 3HNKA 2XL8A 3IQ5A 1A7VA 256BA 3M4CA 1YYJA 3TOLA 3HNJA 3TOMA 4IARA 1E83A 2YKZA 2CCYA 2YL7A 4CJOA 3M4BA 4CIPA 2XLVA 4CX9A 1EKYA 5JRAA 3QVZA 3ZTZA 3M79A 3NMIA 2XLDA 3ZTMA 2J9BA 1YZCA 2YL0A 4U9EA 1CGOA 3FOOA 4CDAA 4N4WA 1GQAA 1M6TA 1E86A 3C63A 4CJGA 3QW1A 4JEAA 1YZAA 3HNIA 1E85A 4NC3A 3VRCA 1CPQA 2XLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E84 A;  3DE8 A;  3QVY A;  4CDV A;  3NMJ A;  5JS5 A;  2YL3 A;  1YYX A;  5JLI A;  1CPR A;  2XLE A;  1QQ3 A;  3HNL A;  1APC A;  2XM0 A;  2XL6 A;  4IB4 A;  2XLW A;  3M15 A;  3L1M A;  2J8W A;  1JAF A;  1RCP A;  5JVE A;  4N6H A;  4L6R A;  3ZQY A;  2XLH A;  1MQV A;  3ZQV A;  2YLD A;  5B3I A;  2YL1 A;  3QW0 A;  3NMK A;  2XM4 A;  1BBH A;  5JUA A;  2QLA A;  5JT4 A;  4JKV A;  2YLG A;  2YLI A;  3U8P A;  2XLO A;  1NBB A;  2BC5 A;  1LM3 B;  4JE9 A;  4IAQ A;  4JEB A;  3ZWI A;  1CGN A;  3C62 A;  3IQ6 A;  3FOP A;  4EIY A;  5AGF A;  4D4N A;  4U9D A;  1QPU A;  4ULV A;  4WGZ A;  4D4X A;  4ER9 A;  4CDY A;  4WGY A;  1S05 A;  5JP7 A;  5JSL A;  3DE9 A;  3HNK A;  2XL8 A;  3IQ5 A;  1A7V A;  256B A;  3M4C A;  1YYJ A;  3TOL A;  3HNJ A;  3TOM A;  4IAR A;  1E83 A;  2YKZ A;  2CCY A;  2YL7 A;  4CJO A;  3M4B A;  4CIP A;  2XLV A;  4CX9 A;  1EKY A;  5JRA A;  3QVZ A;  3ZTZ A;  3M79 A;  3NMI A;  2XLD A;  3ZTM A;  2J9B A;  1YZC A;  2YL0 A;  4U9E A;  1CGO A;  3FOO A;  4CDA A;  4N4W A;  1GQA A;  1M6T A;  1E86 A;  3C63 A;  4CJG A;  3QW1 A;  4JEA A;  1YZA A;  3HNI A;  1E85 A;  4NC3 A;  3VRC A;  1CPQ A;  2XLM A; 
#chains in the Genus database with same CATH topology
 1I4Y A;  2DYS C;  3FMS A;  1WN0 A;  2WL8 A;  4OIQ F;  3QVY A;  4CDV A;  2HJM A;  4AK9 A;  4MW8 A;  4G7O F;  2LSE A;  3V5Z A;  3W8I A;  1HY5 A;  4CSA C;  2YL3 A;  4CS9 A;  3WHN A;  1FMV A;  3S90 A;  4N06 A;  5K0I A;  3CAX A;  2E87 A;  4P9T A;  1G5Z A;  1ZHX A;  2KGO A;  5L0C A;  5DLJ A;  4RDA A;  3J06 A;  2XM0 A;  1GGQ A;  3GOD A;  2XLW A;  4U5F E;  2J45 A;  5KYN A;  1RCP A;  4ONS A;  3KPH A;  4I44 A;  4YT8 A;  4Z9I A;  3EGD B;  3EGD A;  5CIV A;  3EZH A;  2KNH A;  3C8G D;  4PJL A;  3FHD A;  1QVX A;  3Q6N A;  3ECS A;  3I5P A;  4NTB A;  3ZQV A;  1VLT A;  2R9R B;  1TR2 A;  2WVO A;  3IHU A;  1AVO B;  4PJJ A;  2HV6 A;  3ABM C;  3NMK A;  1Z7Q c;  3T6G B;  2H7V C;  1TWH A;  1MND A;  2XM4 A;  4GEH A;  3M1C B;  4NCQ A;  2HJ3 A;  1OCO C;  2J9W A;  3K33 A;  3S28 A;  2QLA A;  3UMK A;  4AX2 A;  3HJC A;  4EBJ A;  4OIO F;  2TMV P;  2EIL C;  3AJM A;  2EIM C;  4OD5 A;  2R7T A;  2YLG A;  3VYW A;  2OCC C;  3B29 A;  3S84 A;  3FAJ A;  3FDQ A;  1LPE A;  2XSE A;  3ATP A;  3K1I A;  1WOL A;  1WWP A;  1ZU4 A;  4O6N A;  3V7O A;  3NG1 A;  2MWQ A;  2X0C A;  3ABL C;  1LE4 A;  1MMD A;  2JD3 A;  5KYU A;  4LLE A;  4DVY P;  1BR1 A;  5KYU B;  1GS9 A;  4I1M A;  2A0B A;  2HMZ A;  3ZWI A;  4MTF A;  1QSP A;  2Q00 A;  2LFF A;  3FOP A;  3LNR A;  4U5E E;  3G4X A;  3DAF A;  1O5H A;  3TK0 A;  4EIY A;  4D4N A;  1QZX A;  2XRH A;  4U5G A;  4C3D A;  4BPM A;  5COG A;  1QPU A;  1TWG A;  1IW7 F;  4ULV A;  4D4X A;  1UG7 A;  4P6I C;  1PV3 A;  1YVI A;  2PX3 A;  1A41 A;  1ZZP A;  4H4K C;  1LIH A;  1HMO A;  4PK4 A;  4AL0 A;  1XZP A;  4YK5 A;  1YYJ A;  3B0V C;  3TOL A;  3UGP A;  3AQB A;  2EIK C;  3RH3 A;  5HSW A;  2Y3H A;  3PMR A;  3A9C A;  2UUH A;  2OOC A;  3U3F A;  2NSG A;  5DVW A;  1Z23 A;  2IOQ A;  3M4B A;  1E83 A;  1KTM A;  1M57 C;  4JRZ A;  4CX9 A;  2AP3 A;  2I8B A;  5L0G A;  4ULW A;  1KNY A;  2DI3 A;  4JJF A;  2H7B A;  4EWC A;  2B0J A;  1VYK A;  2HFI A;  3EFO B;  3C8Z A;  1Y6D A;  1TWA A;  3NMI A;  1FMW A;  1Q0D A;  2XLD A;  3ZTM A;  2C04 A;  2J9B A;  4DOZ A;  3K1I C;  1SMY F;  1WAS A;  3FXH A;  3LNM B;  4KNW A;  2OQM A;  2ETS A;  1LE2 A;  1YDI A;  3DMD A;  1GQA A;  1EQ1 A;  3OA1 A;  1SYQ A;  1E86 A;  3W8H A;  2QNL A;  5L3Q A;  5F5F A;  1ZW3 A;  1RMV A;  3CSK A;  1Q0M A;  1YZA A;  3RQE A;  1OCC C;  2IM8 A;  3C8G A;  3C8G B;  1RJ9 B;  1RJ9 A;  2R05 A;  3DI5 A;  2ZXW C;  4FX5 A;  1A0B A;  2R7U A;  2EPN A;  4U5D E;  2OJQ A;  4PJM A;  3JSZ A;  4PAC A;  3U0C A;  4EKW A;  2B0H A;  2GA0 A;  4YWQ A;  3VRC A;  4Q4Z F;  1VTM P;  1ORJ A;  3LLK A;  2L6H A;  5T3W A;  4YL1 A;  4JCZ A;  4DRH B;  1OKK A;  2DGJ A;  2YEV A;  4XLP F;  2P0N A;  4YN0 B;  4E7Z A;  1B68 A;  2Q9A A;  3MYI A;  4I3M A;  5A6A A;  4DVZ A;  1OR2 A;  2QE9 A;  3N0T A;  5E2Q A;  4JVS A;  5E3A A;  5DQT A;  5A6B A;  2IXP A;  1QKR A;  5JS5 A;  2GAQ A;  3PHF 2;  2GFH A;  3H2U A;  3ABK C;  3W2V A;  5JLI A;  2XLE A;  3HNL A;  1QQ3 A;  3GWL A;  4CBE A;  3EFO A;  4IB4 A;  1JOG A;  3K66 A;  4YJW A;  2GDC A;  2G3K A;  2HS5 A;  1ORS C;  2R25 A;  4EHP A;  2J8W A;  4R32 A;  3LLI A;  1H9T A;  4P9F A;  3JYY A;  5DQZ A;  3MBG A;  1LVK A;  1Z6A A;  3U2L A;  4UDV A;  3RQG A;  5A6K A;  1K40 A;  3GEI A;  2NG1 A;  1U0B B;  4QI2 A;  4L6R A;  1AEP A;  4M63 A;  3ZQY A;  3VM6 A;  5EGY A;  4QDL A;  5L0D A;  2XXA B;  2XXA A;  5B3I A;  3B9Q A;  2YL1 A;  4HFK B;  1WGW A;  3KKB A;  2CNW D;  3QW0 A;  1H7I A;  1Y4C A;  2LFD A;  3JZ0 A;  4IAO A;  1JPJ A;  4J7T A;  3UMH A;  2LQG A;  5F5H A;  3F47 A;  4RD9 A;  3LEV A;  3KL4 A;  1SF8 A;  1T6Q A;  2KC3 A;  1J8M F;  1TKN A;  1KU2 A;  2J46 A;  2KSF A;  4G0H A;  4NTA A;  2A68 F;  2CNW A;  2KW3 C;  4MTG A;  4YT5 A;  3SP1 A;  1BDJ B;  1C17 M;  2L6G A;  5AC4 A;  5JT4 A;  2NSF A;  1VB5 A;  4BEM J;  1NZE A;  5T1D B;  1VMA A;  5KYW A;  5KYW B;  2J0W A;  1XWJ A;  4IJJ A;  2ASR A;  4LAC B;  3WOD F;  3S9O A;  4NTF A;  1YAU O;  1T5O A;  2HSQ A;  1PD1 A;  4LLC A;  4MVU A;  4YL0 A;  3S27 A;  3X1O A;  3VAY A;  4C7O A;  2BC5 A;  4C7O B;  1K04 A;  2AWY A;  1U6H A;  3WG7 C;  4BJ6 C;  2D5R B;  2IXO A;  3JYH A;  3CEX A;  3JT1 A;  1H9G A;  3DWW A;  3I4U A;  1D1C A;  2R02 A;  2Y39 A;  4GYT A;  4WGZ A;  4HFF B;  4ER9 A;  3DAG A;  4WGY A;  4FES A;  4MW3 A;  4XEV A;  4XWJ A;  4CDY A;  4HE8 D;  3E9V A;  5JP7 A;  3GEH A;  1WAT A;  2CGE A;  1SR2 A;  1EI7 A;  1VYI A;  2VCC A;  1ST6 A;  1JR8 A;  2WZL A;  3IQ5 A;  4O7G A;  1ZU5 A;  3G4Z A;  1OW8 A;  1RKC A;  4Z9J A;  4DJ9 A;  2W4M A;  2JX0 A;  4CJO A;  1BR4 A;  4IAR A;  3TOM A;  2R7X A;  3U2M A;  5DS4 A;  3NDB B;  4U5B E;  1OKK D;  3DJU B;  5DS5 A;  2AU5 A;  3JCU Q;  1N1C A;  5B1B C;  3RIP A;  3B0U X;  5JRA A;  1MMG A;  3SXM A;  1G8X A;  1NLX A;  1V74 B;  3QVZ A;  3SNH A;  2YHS A;  4Q5S F;  1AUE A;  1FFT C;  2HV7 A;  4EBK A;  4MVZ A;  3T9O A;  1YZC A;  1CGO A;  3U9J A;  2JPU A;  4JIO A;  2ZPA A;  1Z3I X;  3H65 A;  1FTS A;  3GM3 A;  1LI7 A;  2MYS A;  1XZQ A;  3ZVR A;  4XLN F;  1M6T A;  4AE4 B;  3L8J A;  3RYL A;  1Z5Z A;  4AE4 A;  4CJG A;  1S7Z A;  3DD7 A;  4DBQ A;  2XS1 A;  3JTL O;  3I5Q A;  1NFN A;  3SXY A;  2A6E F;  2OJE D;  3RFY A;  2ZXP A;  1RKE A;  1RKE B;  1PD0 A;  2X51 A;  1CGM E;  5KYY A;  5KYY B;  3V5X A;  3EH1 A;  2L81 A;  2WB7 A;  4CS8 C;  1T9K A;  1I5N A;  3QMK A;  2LD6 A;  2ZXO A;  3X2Q C;  4BJT A;  4E17 A;  4ZLC A;  2IXN A;  2V3C C;  3IPM O;  5BQG A;  2HKV A;  3BRJ A;  2XLM A;  1M2V A;  1M2V B;  4LDQ A;  5L0I A;  4O6M A;  2PF4 E;  1OXB A;  4FWV A;  3EGX A;  3EGX B;  2W45 A;  4O79 A;  3NMJ A;  4G7H F;  1JMW A;  3EPV A;  2IBF A;  3GWN A;  4OD4 A;  4IWB A;  4J7Y A;  4EUK B;  3TJ5 A;  1UFB A;  3B71 A;  2I15 A;  3KH2 A;  4RBN A;  2PBE A;  5L0J A;  3EJN A;  3S29 A;  3WAQ A;  3U5S A;  4E18 A;  1YA7 O;  3IQT A;  3NYL A;  1E2X A;  3OWT A;  3DZA A;  1SZI A;  1HW2 A;  2CDQ A;  3IEE A;  4LDR A;  1LS1 A;  1VK5 A;  1WTY A;  3GM1 A;  2HUJ A;  5EK0 A;  4OIN F;  4KC9 A;  3SEO A;  2R7Q A;  4JJG A;  4NY3 A;  1NU7 D;  1PCX A;  1MNE A;  1ZHT A;  1K05 A;  2H7O A;  3C18 A;  4I1O B;  4LDK A;  3RKO F;  3U3B A;  4MVR A;  2YLD A;  4XPX A;  2VCB A;  1R5I D;  1HE1 A;  3U9M A;  4MVO A;  5E3C A;  1HMD A;  1A7E A;  2G62 A;  4CS8 A;  1BBH A;  2GWW A;  2J0X A;  1D0Z A;  4AL1 A;  4JTC B;  1IZM A;  4O6Y A;  4YT2 A;  5HV9 A;  1T01 A;  4HEA J;  5T3T A;  2Q9B A;  4FAP B;  5E33 A;  5IY5 C;  3POV A;  5CI8 A;  5A6B D;  1I4Z A;  2EIJ C;  3NYM A;  4U5H A;  3T6J A;  3UNG C;  2R7S A;  3LUT B;  4K0D A;  2YLI A;  3KYI A;  2XL4 A;  1FAP B;  4MVM A;  2LIG A;  2XLO A;  1HW1 A;  3RW0 A;  1M56 C;  3GM2 A;  1VLS A;  2AWC A;  2WZG A;  4JE9 A;  1O3U A;  4JEB A;  3CQZ A;  3K6B A;  4JTA B;  3W2W A;  2ZXR A;  3K1H A;  2MHR A;  3MFN A;  2KYH A;  2KQ9 A;  2R7O A;  1V4A A;  5DS6 A;  3S0X A;  1YLM A;  2J9V A;  4WAB A;  5FCL A;  2VCA A;  4GQH A;  2KK1 A;  1JRA A;  1Q0F A;  2NUT B;  2P7V A;  3N2Z B;  4W8K A;  2NUT A;  2LP4 A;  2HMQ A;  3KYJ A;  4Z9H A;  3ZDL A;  1TFK B;  4J30 B;  3EHN A;  2WZF A;  3EH2 A;  1A7D A;  1S05 A;  4Q7C A;  3PDM P;  3L8I A;  3UGO A;  1YJG A;  4JW1 A;  3DE9 A;  2OG2 A;  5BQH A;  4JC7 A;  4PJN A;  2J7P D;  2FAP B;  2XL8 A;  1A7V A;  256B A;  1G4U S;  2IXM A;  3M4C A;  2BL2 A;  2EPK X;  3DJN B;  3HNJ A;  4BJ6 A;  2P1A A;  2KJG A;  1L3P A;  4MS2 A;  4CIP A;  4WJ0 A;  1OR3 A;  5AC5 A;  1H6G A;  2VH3 A;  4F4B A;  1JPN A;  5L0H A;  4DXW A;  2Q4F A;  2L9J A;  2Y3B A;  3M79 A;  5A69 A;  2DB4 A;  2J9U A;  3AGU A;  3LES A;  3AG3 C;  1MMN A;  2L6F A;  2WVN A;  3NKD A;  2YL0 A;  3MYF A;  3NKE A;  4E7S A;  3SZR A;  2A69 F;  3N24 A;  3T6B A;  3O6X A;  2H8A A;  1DOV A;  2W4B A;  4CDA A;  1T6U A;  2G3V A;  2QY9 A;  4BEJ A;  2NUP B;  2LCH A;  2NUP A;  4JZA A;  4MVQ A;  4K7B A;  2LK4 A;  2A0U A;  2RSE B;  4MVS A;  5CI9 A;  4CSA A;  4JEA A;  2R03 A;  3BEH A;  4LER A;  3LEO A;  1FFH A;  3E70 C;  3SXK A;  4EBB A;  1NFO A;  3IQC A;  3VF0 A;  2P61 A;  2HSB A;  1G4W R;  2NPU A;  3LAY A;  4PFO A;  4ANJ A;  2YQY A;  2CYD A;  2Y3D A;  2PX0 A;  1F1M A;  3L34 A;  2Y69 C;  3DM9 B;  3Q7L A;  1NU9 C;  1TFO B;  1HE9 A;  3V5Y A;  2AVK A;  2PP4 A;  5GPG B;  4YT4 A;  4IRU A;  3HTK C;  1DOW A;  1VOM A;  3DE8 A;  5L3V A;  1E84 A;  1D1A A;  1MMA A;  1FR0 A;  2OEX A;  2FGY A;  1OW7 A;  1ZVZ A;  2PFD A;  1OW6 A;  3AG1 C;  3O55 A;  4K1O A;  3B0P A;  3RF3 A;  3ZG1 A;  4DRJ B;  4E0H A;  1YYX A;  2VB6 A;  3US6 A;  1LKX A;  1CPR A;  3CZ6 A;  1APC A;  3R2P A;  3FVY A;  3JSE O;  4JCH A;  2VC9 A;  2XL6 A;  3LS0 A;  1C03 A;  1OCR C;  4E0I A;  1OCZ C;  3O39 A;  3MLG A;  3M15 A;  4U5C E;  3T4R A;  2EPM X;  3L1M A;  1O87 A;  4H54 A;  2YVK A;  3U8V A;  1JAF A;  4BJ1 A;  2XS8 A;  1M2O A;  1TQG A;  4BJ5 C;  1OXK A;  4N6C A;  3SXZ A;  5JVE A;  1BZ4 A;  3FAP B;  2OU6 A;  3JRM O;  4OIP F;  4N6H A;  5BUO A;  4XTK A;  1ZHY A;  3QTH A;  3RQF A;  1LS4 A;  1J8Y F;  1MQV A;  2XLH A;  2Q7R A;  2C03 A;  3KMI A;  4JTD B;  4XPY A;  4A2N B;  4B6I A;  1C02 A;  4CS7 A;  4MQ9 F;  3ASN C;  3UR3 C;  2J7P A;  1YA9 A;  2IYL D;  3GAN A;  3JRT A;  4BG0 A;  2ICW G;  3K7D A;  4CIH A;  2R7W A;  5JUA A;  5KYX A;  5KYX B;  2D4U A;  4W8P A;  4JKV A;  4MND A;  1U89 A;  3Q6M A;  5A6J A;  1QLE C;  2A6H F;  3ZIB A;  5B3S C;  3F46 A;  1LI5 A;  4C3E A;  3EQL F;  2OKU A;  3GEE A;  3GOR A;  4X0R A;  5D91 A;  5B1A C;  3L0I A;  5TJ5 E;  3U8P A;  1NBB A;  2M64 A;  4CS9 C;  1LM3 B;  4PFP A;  3C7J A;  1D0X A;  1OQC A;  4IAQ A;  4NQF A;  3RVY A;  2R7V A;  3DM5 A;  2R7R A;  3ZSU A;  4G7Z F;  1CGN A;  3AQC A;  2RD9 A;  3C62 A;  3IQ6 A;  3PCV A;  4KNV A;  3TUL A;  3QZC A;  5AGF A;  2A1D D;  3HLZ A;  3DKA A;  4U9D A;  2L7A A;  4DRI B;  2DYR C;  2ZD9 A;  4PR9 A;  5JSL A;  1GM5 A;  1NSG B;  3HKK A;  3LS1 A;  3G50 A;  4OIR F;  2Y3G A;  4IGG A;  1T6I A;  2YZS A;  4A4A A;  2F22 A;  2P6V A;  4KI2 A;  2EIN C;  2UUI A;  3NRH A;  5COF A;  5D92 A;  3HNK A;  3AOU A;  3TJ6 A;  2QUP A;  3UMI A;  3W4Y A;  3Q7G A;  4KBL A;  2OEV A;  2EPL X;  3NYJ A;  4ZLD A;  3EG9 B;  1Q0K A;  3EG9 A;  3LJB A;  1D0Y A;  1NG1 A;  2CCY A;  2HZ8 A;  2Q9C A;  1V55 C;  2YL7 A;  2YKZ A;  2YRF A;  1ZYR F;  2YWA A;  3A11 A;  2XLV A;  1ZW2 A;  4C3B A;  1EKY A;  2WVQ A;  1Z63 A;  2M4E A;  3ZTZ A;  1D1B A;  1FNT c;  3ASO C;  3AG2 C;  1ZHW A;  4XEF A;  3EHM A;  3AGT A;  1Q0G A;  3H2V A;  4QI0 A;  2QTV A;  2FFH A;  2VAS A;  5L0F A;  4JUR I;  1BR2 A;  4U9E A;  4MTO A;  3DXJ F;  3FOO A;  4BJ5 A;  4XPW A;  3R7C A;  1RXQ A;  3MX3 A;  4N4W A;  3ZC4 A;  4XEK A;  2W9Y A;  4J32 B;  4G78 A;  1L7C A;  2CW0 F;  5FZT A;  3C63 A;  2Q3T A;  1TWC A;  4YL3 A;  3AG4 C;  1ORY A;  1R4T A;  3ITF A;  3QW1 A;  1YAR O;  5F28 E;  3RVZ A;  2PNO A;  3OEO A;  3O10 A;  3TD7 A;  3SYN A;  3HNI A;  1E85 A;  3TQO A;  4NC3 A;  5BQI A;  4XQ1 A;  2Z15 A;  5EHH A;  1EA8 A;  2O9X A;  4DBR A;  1ZHZ A;  1W2W A;  3EZI A;  2BE5 F;  2EPO A;  5COM A;  2V26 A;  1CPQ A;  1V54 C; 
#chains in the Genus database with same CATH homology
 1E84 A;  3DE8 A;  3QVY A;  4CDV A;  3NMJ A;  5JS5 A;  2YL3 A;  1YYX A;  5JLI A;  1CPR A;  2XLE A;  1QQ3 A;  3HNL A;  1APC A;  2XM0 A;  2XL6 A;  4IB4 A;  2XLW A;  3M15 A;  3L1M A;  2J8W A;  1JAF A;  1RCP A;  5JVE A;  4N6H A;  4L6R A;  3ZQY A;  2XLH A;  1MQV A;  3ZQV A;  2YLD A;  5B3I A;  2YL1 A;  3QW0 A;  3NMK A;  2XM4 A;  1BBH A;  5JUA A;  2QLA A;  5JT4 A;  4JKV A;  2YLG A;  2YLI A;  3U8P A;  2XLO A;  1NBB A;  2BC5 A;  1LM3 B;  4JE9 A;  4IAQ A;  4JEB A;  3ZWI A;  1CGN A;  3C62 A;  3IQ6 A;  3FOP A;  4EIY A;  5AGF A;  4D4N A;  4U9D A;  1QPU A;  4ULV A;  4WGZ A;  4D4X A;  4ER9 A;  4CDY A;  4WGY A;  1S05 A;  5JP7 A;  5JSL A;  3DE9 A;  3HNK A;  2XL8 A;  3IQ5 A;  1A7V A;  256B A;  3M4C A;  1YYJ A;  3TOL A;  3HNJ A;  3TOM A;  4IAR A;  1E83 A;  2YKZ A;  2CCY A;  2YL7 A;  4CJO A;  3M4B A;  4CIP A;  2XLV A;  4CX9 A;  1EKY A;  5JRA A;  3QVZ A;  3ZTZ A;  3M79 A;  3NMI A;  2XLD A;  3ZTM A;  2J9B A;  1YZC A;  2YL0 A;  4U9E A;  1CGO A;  3FOO A;  4CDA A;  4N4W A;  1GQA A;  1M6T A;  1E86 A;  3C63 A;  4CJG A;  3QW1 A;  4JEA A;  1YZA A;  3HNI A;  1E85 A;  4NC3 A;  3VRC A;  1CPQ A;  2XLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...