4U9DA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, ab3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9dA00
3IQ6A 1S05A 4IAQA 4JEBA 1APCA 3HNKA 4NC3A 2YLDA 4WGYA 3TOMA 3M15A 1E86A 2YLGA 1RCPA 4ULVA 3FOOA 2YKZA 2J9BA 2YL0A 2YLIA 3C62A 2J8WA 5JUAA 3ZQVA 1EKYA 3L1MA 256BA 4CX9A 1QPUA 5AGFA 1GQAA 4CDVA 4D4NA 3HNIA 4CJOA 4IB4A 4CJGA 5JRAA 2XL8A 3M4CA 2XM0A 2YL1A 5JSLA 3C63A 3VRCA 4CDYA 5JP7A 2BC5A 5B3IA 3M79A 1YYJA 5JLIA 1E83A 1YZAA 1NBBA 3IQ5A 2XLDA 4EIYA 4JKVA 3NMJA 2XLMA 3M4BA 3U8PA 1A7VA 5JVEA 2YL7A 2XLEA 3HNLA 4JEAA 3ZTZA 1E85A 4N6HA 1QQ3A 3HNJA 2XLVA 3ZWIA 3QVZA 4CDAA 3NMKA 2QLAA 3DE8A 4L6RA 3QW0A 5JS5A 1YZCA 2XL6A 2XLWA 1BBHA 4D4XA 3DE9A 3ZQYA 1E84A 2XLOA 1CPQA 2YL3A 4CIPA 3QVYA 2CCYA 3FOPA 1YYXA 5JT4A 1JAFA 1M6TA 3ZTMA 2XM4A 1CGOA 4IARA 3QW1A 3TOLA 4JE9A 4ER9A 4U9DA 4N4WA 1CPRA 1MQVA 2XLHA 4WGZA 3NMIA 4U9EA 1LM3B 1CGNA
chains in the Genus database with same CATH superfamily
4MNDA 3GEIA 3S90A 3ABMC 5K0IA 1UFBA 1TFKB 3SEOA 2OU6A 1D0XA 3IQ6A 2Y3HA 1TR2A 3HTKC 3KPHA 1YLMA 1S05A 1LI5A 2O9XA 1APCA 4X0RA 3AG3C 1JMWA 4I1MA 4AL1A 1E86A 3AOUA 5FCLA 1ZU5A 5DS4A 2NUTA 3QMKA 4MVZA 5A6JA 3DAFA 1NFOA 3U2MA 1ZHXA 1J8YF 2A6HF 2YVKA 3EGXB 3KYJA 3Q7GA 4JZAA 1QVXA 3S9OA 2XRHA 3ATPA 5DS5A 1HW2A 1AUEA 2QNLA 3S84A 1FMVA 1SMYF 4I44A 2WZLA 3L1MA 1T5OA 2Y3BA 256BA 1BR4A 4Q5SF 4CX9A 3AJMA 3KKBA 5COFA 3GWLA 5L0HA 4I3MA 2WZFA 4EBBA 4KBLA 1MMGA 2H8AA 4E7ZA 2OOCA 4IWBA 1WASA 3TQOA 2OJQA 2VC9A 1Z7Qc 3VYWA 2F22A 3C8GB 1YVIA 4MVMA 2W9YA 2XM0A 3NKDA 3ZC4A 3C63A 3VRCA 3IHUA 1RKCA 4BJ5A 1JOGA 1LVKA 5B1AC 5B3IA 1OR3A 3EGXA 2EPLX 4XEKA 3K1IC 3E9VA 3GWNA 1QLEC 3N24A 4Z9JA 3DMDA 1MNEA 2BL2A 2Q3TA 1E83A 1LI7A 1NBBA 3IQ5A 4RDAA 4JC7A 4YT8A 3MYFA 5A6BA 1OCCC 2L6FA 3ZSUA 4G78A 4W8PA 1OXKA 2EIMC 2LP4A 1RJ9B 5F28E 3TK0A 1BDJB 4E17A 4MVUA 3AQCA 5T3WA 3NMJA 4KNVA 2UUHA 2OEVA 1Y4CA 3C8GA 2QTVA 4JTCB 4LLEA 3U0CA 5GPGB 3ABKC 3Q7LA 2NSGA 2CDQA 3K33A 3EZIA 2I8BA 3DM9B 2R05A 2EIJC 3IQCA 2RD9A 2R7QA 4N6HA 3EH2A 1KU2A 3SXYA 3HNJA 4P9TA 4YT2A 2NSFA 5L0CA 3RH3A 2R7RA 1A41A 3ZWIA 1VYKA 3ZIBA 2B0JA 4WABA 2Y3GA 1WOLA 3ITFA 3NMKA 2VCCA 2VASA 2YWAA 3JT1A 4GQHA 2IYLD 1RJ9A 3NKEA 1RXQA 4NTFA 1PD1A 1YZCA 4LDKA 2CNWD 1D1CA 2ASRA 1L7CA 1SR2A 2KJGA 4YL0A 5COGA 3FAPB 3RQEA 4EKWA 2OKUA 2M64A 3ZG1A 3V5ZA 1C17M 4D4XA 4OIRF 3ZQYA 4DRIB 2XSEA 1CPQA 5HSWA 2KNHA 1AVOB 3JSZA 4JJFA 4PJJA 2C03A 3T4RA 5EGYA 5L3QA 3EZHA 2IXPA 3QVYA 4ONSA 3U2LA 4XPWA 2LQGA 1Q0FA 2R25A 4NTAA 3FOPA 1YYXA 2VCBA 3BEHA 2AU5A 4A4AA 3A9CA 3WODF 2OCCC 3TULA 4AE4B 1ZZPA 2WB7A 3DD7A 3Q6NA 4EBJA 4ZLDA 1G8XA 2AWYA 1T01A 4LLCA 3NYLA 4JIOA 4PJMA 4RD9A 4MS2A 4U9DA 4E18A 2JX0A 3Q6MA 5E3AA 3C18A 1NSGB 2AP3A 3LS1A 1C03A 3DJNB 1J8MF 3U3FA 2P0NA 2EPKX 3M1CB 2HZ8A 4I1OB 5B1BC 2FAPB 4CS8A 1FNTc 1OR2A 1WN0A 1PD0A 2A69F 1Q0DA 1KNYA 3HKKA 4F4BA 4IRUA 3DWWA 3FHDA 4J7YA 2OQMA 2YLDA 1A7EA 2OG2A 1ZW2A 2WVQA 2V26A 3M15A 4HFKB 2YLGA 3GM1A 3K7DA 4U5HA 3U9JA 1YA9A 2DB4A 2LFFA 4AE4A 3O6XA 1A7DA 1YARO 3B0PA 4G7HF 1FR0A 1O87A 3UGOA 2ZXPA 3F47A 3QTHA 3C7JA 2MYSA 4PACA 3B9QA 4DOZA 3EHNA 4FX5A 3DXJF 3ZQVA 4RBNA 5E3CA 5IY5C 3OEOA 1WATA 3RF3A 5AGFA 2IXNA 3G50A 2KSFA 2H7OA 3L8IA 3H65A 2GDCA 4J30B 1XZQA 5EK0A 4MTGA 2NPUA 4D4NA 4WJ0A 1PV3A 4IGGA 3FVYA 1LS1A 4CJGA 3AG2C 5JRAA 1HY5A 1V55C 2CNWA 4PFPA 3EFOB 3M4CA 3AG1C 4PJLA 3RFYA 4BJ6C 4LDRA 3K1HA 2YL1A 3GORA 3I5QA 3RQFA 1E2XA 3JRMO 5JP7A 2YQYA 3R7CA 3FAJA 3GM3A 3U3BA 5AC4A 2ZXRA 5CI8A 4DXWA 3ECSA 1L3PA 3PHF2 2R7UA 4HE8D 1VLSA 1M56C 2C04A 2GFHA 3LNMB 4H4KC 4OD4A 5JLIA 1T6IA 3T6BA 3ABLC 3VAYA 1TWCA 1FMWA 3T9OA 3U8VA 1YZAA 3CQZA 3J06A 4Z9IA 1D0YA 1LIHA 1YJGA 4JKVA 4U5FE 1KTMA 5BQIA 4ANJA 1OW7A 4XQ1A 4O6MA 1ZYRF 3CEXA 1Q0GA 1ZHYA 3L0IA 1HE1A 1JPJA 1R5ID 4YL1A 3T6JA 2QE9A 3EFOA 3B0UX 3SZRA 2CYDA 5EHHA 2NUPB 2HSBA 2LSEA 2DGJA 4N6CA 2PFDA 4IAOA 2IM8A 2V3CC 4CS9C 1SF8A 1ST6A 2HJMA 2XLEA 1ORJA 3PMRA 2EPMX 5L0FA 1E85A 4A2NB 1MMDA 2G62A 5E33A 3TJ6A 3PCVA 1RKEB 3V7OA 5BQHA 2XLVA 1RMVA 4DBRA 1A0BA 3MBGA 1U89A 1M57C 3X1OA 1D0ZA 1Z63A 1QKRA 4MVOA 5KYYB 1T9KA 1VLTA 1SZIA 3L8JA 4JVSA 1Z5ZA 2J9WA 3B0VC 4U5EE 2J9VA 4L6RA 2CGEA 4E0HA 3CZ6A 4O79A 4HEAJ 2LK4A 3T6GB 5T3TA 4CSAA 3JSEO 4G7ZF 4JJGA 2NUPA 4IJJA 3W2VA 2Y69C 1ZHWA 2KYHA 2WVOA 3F46A 4LACB 4OINF 5KYUB 3KH2A 4Q4ZF 1DOVA 2R7TA 4JRZA 3SP1A 1H9TA 4U5DE 4MW8A 3UGPA 1ZW3A 1RKEA 2M4EA 3V5YA 3FXHA 1T6QA 3HLZA 3MFNA 3ZDLA 1YAUO 2IBFA 2J0XA 1M6TA 5KYYA 2HV7A 3GEHA 2WVNA 1NG1A 3NRHA 4NCQA 3B71A 5DVWA 3TOLA 1LE4A 2Q9CA 2A68F 2L9JA 4XWJA 4BJ6A 4DRHB 4ER9A 1I4ZA 3S28A 2HS5A 1MQVA 2JD3A 2PNOA 4U9EA 3POVA 1LM3B 1Z3IX 1NZEA 4JURI 1JR8A 2EIKC 1BR2A 1HMOA 5COMA 1CGNA 2R7XA 5KYUA 1GGQA 1T6UA 2R7VA 1LKXA 4CS7A 3NYMA 3TOMA 3ASNC 2W4MA 4AX2A 1PCXA 4XPYA 2IXMA 5DS6A 3MX3A 2LD6A 4K7BA 2ZPAA 4JEBA 4IAQA 3JTLO 1OKKD 4ULWA 3EGDB 4NC3A 4XEVA 5D91A 5BUOA 2AWCA 2EILC 3LUTB 1GM5A 3WG7C 5TJ5E 1K40A 2R7WA 1JPNA 3KMIA 2R7OA 3FOOA 3PDMP 4MVRA 1OW8A 2J9BA 3V5XA 1TKNA 1LS4A 2YL0A 2YLIA 4MTOA 2J8WA 2BE5F 5JUAA 1I4YA 1EKYA 3N2ZB 5L3VA 1NFNA 2WL8A 3TD7A 1QPUA 4PR9A 4R32A 2EINC 2Y39A 2NG1A 3R2PA 4BPMA 3JYYA 1NU7D 5B3SC 4CDVA 2HSQA 3HNIA 3K1IA 4O7GA 1YDIA 1ZHZA 2IXOA 4KNWA 2J7PD 2W4BA 1WGWA 3JYHA 3EGDA 1ZU4A 4O6YA 4LERA 4P6IC 4HFFB 3SXMA 4E0IA 2KGOA 2GAQA 3CAXA 5JSLA 1H6GA 1O3UA 2RSEB 5FZTA 3SXKA 1FAPB 3L34A 1I5NA 1FTSA 2A0UA 2Z15A 3KYIA 4EWCA 4CBEA 1U0BB 2J0WA 1U6HA 2E87A 4W8KA 3K6BA 4JW1A 4C3EA 4LDQA 5F5FA 4G0HA 3LS0A 3ASOC 4YJWA 2PP4A 2PX3A 3EQLF 3GANA 3IEEA 1NLXA 3OWTA 3LNRA 2XLDA 4JCHA 3SYNA 4KI2A 4OIOF 3QZCA 4QDLA 4BJ5C 3LLKA 3EJNA 3IQTA 3VM6A 4E7SA 1OCOC 3FDQA 2G3KA 3NDBB 4MTFA 2XL4A 3VF0A 1M2VB 3SXZA 1R4TA 5F5HA 3NYJA 2HMQA 5CI9A 2GWWA 3GEEA 4YN0B 5L0DA 2FGYA 2W45A 3U8PA 4O6NA 1A7VA 2ETSA 2XS8A 3DJUB 1VTMP 3AG4C 1BR1A 1OCZC 1OXBA 1DOWA 2A0BA 2YL7A 3HNLA 2UUIA 2X0CA 3ZTZA 1QZXA 1WTYA 4B6IA 2EPNA 4PK4A 4MQ9F 1QQ3A 2PX0A 2L7AA 5A6BD 1OKKA 2LIGA 3AGUA 4M63A 1MMAA 1EQ1A 2HKVA 3QVZA 2QUPA 3ZVRA 4CDAA 3HJCA 3EG9B 4YT4A 4J32B 4MVSA 5KYNA 3B29A 2D4UA 1ZHTA 3BRJA 2JPUA 3X2QC 3DE8A 2XXAB 3LEVA 2HUJA 2I15A 3QW0A 1M2VA 1S7ZA 2P61A 2XLWA 1BBHA 2ICWG 2J45A 2XS1A 3MLGA 3MYIA 4K1OA 2R7SA 3O55A 1D1BA 1ZVZA 3CSKA 5L0JA 1N1CA 3I4UA 3A11A 4YK5A 3C8ZA 5A6AA 3RYLA 1VOMA 3U5SA 1HW1A 5BQGA 4NQFA 3KL4A 3DAGA 2G3VA 4C7OB 2J7PA 5JT4A 4U5BE 1MNDA 1C02A 2LCHA 4XEFA 2H7VC 1CGOA 2R9RB 2DYRC 5E2QA 2OJED 4XLNF 3EG9A 1ORSC 3RVYA 2YHSA 2KW3C 2P1AA 4YWQA 4JE9A 3LLIA 2L6GA 3SNHA 3WHNA 2XXAA 1CPRA 4OD5A 3GODA 2ZXOA 1TWAA 2YZSA 2ZD9A 3RW0A 2HV6A 1SYQA 1FFHA 2L6HA 2PF4E 1Q0KA 4EHPA 3AQBA 3H2VA 4ZLCA 3K66A 1HE9A 1QSPA 2HFIA 2DYSC 2YEVA 4XLPF 4C7OA 4DVYP 4QI2A 3TJ5A 3HNKA 5JVEA 3G4ZA 4WGYA 2EPOA 2J9UA 1ORYA 1RCPA 4PJNA 4ULVA 3NG1A 1WWPA 3LEOA 4QI0A 3FMSA 4CS8C 3UMIA 2YKZA 3EH1A 5DQZA 2Q00A 1AEPA 4NY3A 3JCUQ 1K04A 2X51A 3C62A 2Q7RA 1XWJA 2YRFA 3E70C 3IPMO 3N0TA 4AL0A 4FAPB 5DLJA 4Q7CA 2Q9AA 1OCRC 5A69A 3LAYA 1GQAA 4U5CE 1FFTC 1Y6DA 2P6VA 3RQGA 4DRJB 1EI7A 5KYXB 2R03A 4CJOA 2H7BA 4IB4A 4N06A 2Y3DA 2XL8A 3RVZA 4J7TA 3DZAA 5HV9A 2KC3A 3UMKA 4BEMJ 1HMDA 4C3DA 1CGME 1Z23A 3GM2A 1XZPA 3UR3C 4CDYA 3RKOF 3LESA 2D5RB 3O10A 1TFOB 4GYTA 2BC5A 5KYWB 1M2OA 4P9FA 4G7OF 1K05A 3M79A 4YT5A 1YYJA 4Z9HA 4BG0A 3S27A 4DBQA 2CW0F 4FWVA 2A6EF 2HMZA 2DI3A 4XPXA 3US6A 2AVKA 1H7IA 1F1MA 4AK9A 2KK1A 1JRAA 4EIYA 1YA7O 4CS9A 2HJ3A 3I5PA 5KYXA 2VB6A 3W4YA 4PFOA 2J46A 5L0GA 3RIPA 2TMVP 2FFHA 2GA0A 4DVZA 1OQCA 2XLMA 3DM5A 4NTBA 3W2WA 3M4BA 3WAQA 5A6KA 1VMAA 4H54A 2A1DD 4C3BA 3W8IA 3S0XA 1D1AA 4MVQA 4JEAA 4EUKB 5KYWA 4MW3A 4XTKA 4JTAB 1G4WR 4OIQF 2R02A 3AGTA 2KQ9A 3EPVA 2MHRA 1OW6A 3DKAA 1EA8A 4UDVA 1G4US 2OEXA 4FESA 1TWGA 4DJ9A 1Q0MA 1UG7A 4EBKA 5D92A 4OIPF 4BJ1A 1GS9A 5T1DB 2QLAA 1B68A 1O5HA 3H2UA 2IOQA 3OA1A 5JS5A 2XL6A 4BEJA 3S29A 4CIHA 1W2WA 2ZXWC 3G4XA 3O39A 1TQGA 2VCAA 3DE9A 2MWQA 1E84A 2XLOA 1VK5A 2YL3A 4CIPA 5CIVA 4YL3A 2B0HA 2PBEA 2QY9A 3EHMA 4JCZA 2CCYA 1V54C 1JAFA 3ZTMA 4CSAC 2LFDA 1H9GA 2Q4FA 2VH3A 2XM4A 1V4AA 4K0DA 3UNGC 3U9MA 2WZGA 1IW7F 1IZMA 1LE2A 1VB5A 3QW1A 2NUTB 4IARA 1NU9C 1LPEA 2Q9BA 3JRTA 1V74B 4U5GA 4JTDB 1BZ4A 5L0IA 2L81A 1G5ZA 1Z6AA 3W8HA 4N4WA 5DQTA 3UMHA 2XLHA 4WGZA 1TWHA 3NMIA 4KC9A 4BJTA 1MMNA 3LJBA 3C8GD 5AC5A 4GEHA 2P7VA 3JZ0A 3DI5A 1VYIA
chains in the Genus database with same CATH topology
3IQ6A 1S05A 4IAQA 4JEBA 1APCA 3HNKA 4NC3A 2YLDA 4WGYA 3TOMA 3M15A 1E86A 2YLGA 1RCPA 4ULVA 3FOOA 2YKZA 2J9BA 2YL0A 2YLIA 3C62A 2J8WA 5JUAA 3ZQVA 1EKYA 3L1MA 256BA 4CX9A 1QPUA 5AGFA 1GQAA 4CDVA 4D4NA 3HNIA 4CJOA 4IB4A 4CJGA 5JRAA 2XL8A 3M4CA 2XM0A 2YL1A 5JSLA 3C63A 3VRCA 4CDYA 5JP7A 2BC5A 5B3IA 3M79A 1YYJA 5JLIA 1E83A 1YZAA 1NBBA 3IQ5A 2XLDA 4EIYA 4JKVA 3NMJA 2XLMA 3M4BA 3U8PA 1A7VA 5JVEA 2YL7A 2XLEA 3HNLA 4JEAA 3ZTZA 1E85A 4N6HA 1QQ3A 3HNJA 2XLVA 3ZWIA 3QVZA 4CDAA 3NMKA 2QLAA 3DE8A 4L6RA 3QW0A 5JS5A 1YZCA 2XL6A 2XLWA 1BBHA 4D4XA 3DE9A 3ZQYA 1E84A 2XLOA 1CPQA 2YL3A 4CIPA 3QVYA 2CCYA 3FOPA 1YYXA 5JT4A 1JAFA 1M6TA 3ZTMA 2XM4A 1CGOA 4IARA 3QW1A 3TOLA 4JE9A 4ER9A 4U9DA 4N4WA 1CPRA 1MQVA 2XLHA 4WGZA 3NMIA 4U9EA 1LM3B 1CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ6 A;  1S05 A;  4IAQ A;  4JEB A;  1APC A;  3HNK A;  4NC3 A;  2YLD A;  4WGY A;  3TOM A;  3M15 A;  1E86 A;  2YLG A;  1RCP A;  4ULV A;  3FOO A;  2YKZ A;  2J9B A;  2YL0 A;  2YLI A;  3C62 A;  2J8W A;  5JUA A;  3ZQV A;  1EKY A;  3L1M A;  256B A;  4CX9 A;  1QPU A;  5AGF A;  1GQA A;  4CDV A;  4D4N A;  3HNI A;  4CJO A;  4IB4 A;  4CJG A;  5JRA A;  2XL8 A;  3M4C A;  2XM0 A;  2YL1 A;  5JSL A;  3C63 A;  3VRC A;  4CDY A;  5JP7 A;  2BC5 A;  5B3I A;  3M79 A;  1YYJ A;  5JLI A;  1E83 A;  1YZA A;  1NBB A;  3IQ5 A;  2XLD A;  4EIY A;  4JKV A;  3NMJ A;  2XLM A;  3M4B A;  3U8P A;  1A7V A;  5JVE A;  2YL7 A;  2XLE A;  3HNL A;  4JEA A;  3ZTZ A;  1E85 A;  4N6H A;  1QQ3 A;  3HNJ A;  2XLV A;  3ZWI A;  3QVZ A;  4CDA A;  3NMK A;  2QLA A;  3DE8 A;  4L6R A;  3QW0 A;  5JS5 A;  1YZC A;  2XL6 A;  2XLW A;  1BBH A;  4D4X A;  3DE9 A;  3ZQY A;  1E84 A;  2XLO A;  1CPQ A;  2YL3 A;  4CIP A;  3QVY A;  2CCY A;  3FOP A;  1YYX A;  5JT4 A;  1JAF A;  1M6T A;  3ZTM A;  2XM4 A;  1CGO A;  4IAR A;  3QW1 A;  3TOL A;  4JE9 A;  4ER9 A;  4U9D A;  4N4W A;  1CPR A;  1MQV A;  2XLH A;  4WGZ A;  3NMI A;  4U9E A;  1LM3 B;  1CGN A; 
#chains in the Genus database with same CATH topology
 4MND A;  3GEI A;  3S90 A;  3ABM C;  5K0I A;  1UFB A;  1TFK B;  3SEO A;  2OU6 A;  1D0X A;  3IQ6 A;  2Y3H A;  1TR2 A;  3HTK C;  3KPH A;  1YLM A;  1S05 A;  1LI5 A;  2O9X A;  1APC A;  4X0R A;  3AG3 C;  1JMW A;  4I1M A;  4AL1 A;  1E86 A;  3AOU A;  5FCL A;  1ZU5 A;  5DS4 A;  2NUT A;  3QMK A;  4MVZ A;  5A6J A;  3DAF A;  1NFO A;  3U2M A;  1ZHX A;  1J8Y F;  2A6H F;  2YVK A;  3EGX B;  3KYJ A;  3Q7G A;  4JZA A;  1QVX A;  3S9O A;  2XRH A;  3ATP A;  5DS5 A;  1HW2 A;  1AUE A;  2QNL A;  3S84 A;  1FMV A;  1SMY F;  4I44 A;  2WZL A;  3L1M A;  1T5O A;  2Y3B A;  256B A;  1BR4 A;  4Q5S F;  4CX9 A;  3AJM A;  3KKB A;  5COF A;  3GWL A;  5L0H A;  4I3M A;  2WZF A;  4EBB A;  4KBL A;  1MMG A;  2H8A A;  4E7Z A;  2OOC A;  4IWB A;  1WAS A;  3TQO A;  2OJQ A;  2VC9 A;  1Z7Q c;  3VYW A;  2F22 A;  3C8G B;  1YVI A;  4MVM A;  2W9Y A;  2XM0 A;  3NKD A;  3ZC4 A;  3C63 A;  3VRC A;  3IHU A;  1RKC A;  4BJ5 A;  1JOG A;  1LVK A;  5B1A C;  5B3I A;  1OR3 A;  3EGX A;  2EPL X;  4XEK A;  3K1I C;  3E9V A;  3GWN A;  1QLE C;  3N24 A;  4Z9J A;  3DMD A;  1MNE A;  2BL2 A;  2Q3T A;  1E83 A;  1LI7 A;  1NBB A;  3IQ5 A;  4RDA A;  4JC7 A;  4YT8 A;  3MYF A;  5A6B A;  1OCC C;  2L6F A;  3ZSU A;  4G78 A;  4W8P A;  1OXK A;  2EIM C;  2LP4 A;  1RJ9 B;  5F28 E;  3TK0 A;  1BDJ B;  4E17 A;  4MVU A;  3AQC A;  5T3W A;  3NMJ A;  4KNV A;  2UUH A;  2OEV A;  1Y4C A;  3C8G A;  2QTV A;  4JTC B;  4LLE A;  3U0C A;  5GPG B;  3ABK C;  3Q7L A;  2NSG A;  2CDQ A;  3K33 A;  3EZI A;  2I8B A;  3DM9 B;  2R05 A;  2EIJ C;  3IQC A;  2RD9 A;  2R7Q A;  4N6H A;  3EH2 A;  1KU2 A;  3SXY A;  3HNJ A;  4P9T A;  4YT2 A;  2NSF A;  5L0C A;  3RH3 A;  2R7R A;  1A41 A;  3ZWI A;  1VYK A;  3ZIB A;  2B0J A;  4WAB A;  2Y3G A;  1WOL A;  3ITF A;  3NMK A;  2VCC A;  2VAS A;  2YWA A;  3JT1 A;  4GQH A;  2IYL D;  1RJ9 A;  3NKE A;  1RXQ A;  4NTF A;  1PD1 A;  1YZC A;  4LDK A;  2CNW D;  1D1C A;  2ASR A;  1L7C A;  1SR2 A;  2KJG A;  4YL0 A;  5COG A;  3FAP B;  3RQE A;  4EKW A;  2OKU A;  2M64 A;  3ZG1 A;  3V5Z A;  1C17 M;  4D4X A;  4OIR F;  3ZQY A;  4DRI B;  2XSE A;  1CPQ A;  5HSW A;  2KNH A;  1AVO B;  3JSZ A;  4JJF A;  4PJJ A;  2C03 A;  3T4R A;  5EGY A;  5L3Q A;  3EZH A;  2IXP A;  3QVY A;  4ONS A;  3U2L A;  4XPW A;  2LQG A;  1Q0F A;  2R25 A;  4NTA A;  3FOP A;  1YYX A;  2VCB A;  3BEH A;  2AU5 A;  4A4A A;  3A9C A;  3WOD F;  2OCC C;  3TUL A;  4AE4 B;  1ZZP A;  2WB7 A;  3DD7 A;  3Q6N A;  4EBJ A;  4ZLD A;  1G8X A;  2AWY A;  1T01 A;  4LLC A;  3NYL A;  4JIO A;  4PJM A;  4RD9 A;  4MS2 A;  4U9D A;  4E18 A;  2JX0 A;  3Q6M A;  5E3A A;  3C18 A;  1NSG B;  2AP3 A;  3LS1 A;  1C03 A;  3DJN B;  1J8M F;  3U3F A;  2P0N A;  2EPK X;  3M1C B;  2HZ8 A;  4I1O B;  5B1B C;  2FAP B;  4CS8 A;  1FNT c;  1OR2 A;  1WN0 A;  1PD0 A;  2A69 F;  1Q0D A;  1KNY A;  3HKK A;  4F4B A;  4IRU A;  3DWW A;  3FHD A;  4J7Y A;  2OQM A;  2YLD A;  1A7E A;  2OG2 A;  1ZW2 A;  2WVQ A;  2V26 A;  3M15 A;  4HFK B;  2YLG A;  3GM1 A;  3K7D A;  4U5H A;  3U9J A;  1YA9 A;  2DB4 A;  2LFF A;  4AE4 A;  3O6X A;  1A7D A;  1YAR O;  3B0P A;  4G7H F;  1FR0 A;  1O87 A;  3UGO A;  2ZXP A;  3F47 A;  3QTH A;  3C7J A;  2MYS A;  4PAC A;  3B9Q A;  4DOZ A;  3EHN A;  4FX5 A;  3DXJ F;  3ZQV A;  4RBN A;  5E3C A;  5IY5 C;  3OEO A;  1WAT A;  3RF3 A;  5AGF A;  2IXN A;  3G50 A;  2KSF A;  2H7O A;  3L8I A;  3H65 A;  2GDC A;  4J30 B;  1XZQ A;  5EK0 A;  4MTG A;  2NPU A;  4D4N A;  4WJ0 A;  1PV3 A;  4IGG A;  3FVY A;  1LS1 A;  4CJG A;  3AG2 C;  5JRA A;  1HY5 A;  1V55 C;  2CNW A;  4PFP A;  3EFO B;  3M4C A;  3AG1 C;  4PJL A;  3RFY A;  4BJ6 C;  4LDR A;  3K1H A;  2YL1 A;  3GOR A;  3I5Q A;  3RQF A;  1E2X A;  3JRM O;  5JP7 A;  2YQY A;  3R7C A;  3FAJ A;  3GM3 A;  3U3B A;  5AC4 A;  2ZXR A;  5CI8 A;  4DXW A;  3ECS A;  1L3P A;  3PHF 2;  2R7U A;  4HE8 D;  1VLS A;  1M56 C;  2C04 A;  2GFH A;  3LNM B;  4H4K C;  4OD4 A;  5JLI A;  1T6I A;  3T6B A;  3ABL C;  3VAY A;  1TWC A;  1FMW A;  3T9O A;  3U8V A;  1YZA A;  3CQZ A;  3J06 A;  4Z9I A;  1D0Y A;  1LIH A;  1YJG A;  4JKV A;  4U5F E;  1KTM A;  5BQI A;  4ANJ A;  1OW7 A;  4XQ1 A;  4O6M A;  1ZYR F;  3CEX A;  1Q0G A;  1ZHY A;  3L0I A;  1HE1 A;  1JPJ A;  1R5I D;  4YL1 A;  3T6J A;  2QE9 A;  3EFO A;  3B0U X;  3SZR A;  2CYD A;  5EHH A;  2NUP B;  2HSB A;  2LSE A;  2DGJ A;  4N6C A;  2PFD A;  4IAO A;  2IM8 A;  2V3C C;  4CS9 C;  1SF8 A;  1ST6 A;  2HJM A;  2XLE A;  1ORJ A;  3PMR A;  2EPM X;  5L0F A;  1E85 A;  4A2N B;  1MMD A;  2G62 A;  5E33 A;  3TJ6 A;  3PCV A;  1RKE B;  3V7O A;  5BQH A;  2XLV A;  1RMV A;  4DBR A;  1A0B A;  3MBG A;  1U89 A;  1M57 C;  3X1O A;  1D0Z A;  1Z63 A;  1QKR A;  4MVO A;  5KYY B;  1T9K A;  1VLT A;  1SZI A;  3L8J A;  4JVS A;  1Z5Z A;  2J9W A;  3B0V C;  4U5E E;  2J9V A;  4L6R A;  2CGE A;  4E0H A;  3CZ6 A;  4O79 A;  4HEA J;  2LK4 A;  3T6G B;  5T3T A;  4CSA A;  3JSE O;  4G7Z F;  4JJG A;  2NUP A;  4IJJ A;  3W2V A;  2Y69 C;  1ZHW A;  2KYH A;  2WVO A;  3F46 A;  4LAC B;  4OIN F;  5KYU B;  3KH2 A;  4Q4Z F;  1DOV A;  2R7T A;  4JRZ A;  3SP1 A;  1H9T A;  4U5D E;  4MW8 A;  3UGP A;  1ZW3 A;  1RKE A;  2M4E A;  3V5Y A;  3FXH A;  1T6Q A;  3HLZ A;  3MFN A;  3ZDL A;  1YAU O;  2IBF A;  2J0X A;  1M6T A;  5KYY A;  2HV7 A;  3GEH A;  2WVN A;  1NG1 A;  3NRH A;  4NCQ A;  3B71 A;  5DVW A;  3TOL A;  1LE4 A;  2Q9C A;  2A68 F;  2L9J A;  4XWJ A;  4BJ6 A;  4DRH B;  4ER9 A;  1I4Z A;  3S28 A;  2HS5 A;  1MQV A;  2JD3 A;  2PNO A;  4U9E A;  3POV A;  1LM3 B;  1Z3I X;  1NZE A;  4JUR I;  1JR8 A;  2EIK C;  1BR2 A;  1HMO A;  5COM A;  1CGN A;  2R7X A;  5KYU A;  1GGQ A;  1T6U A;  2R7V A;  1LKX A;  4CS7 A;  3NYM A;  3TOM A;  3ASN C;  2W4M A;  4AX2 A;  1PCX A;  4XPY A;  2IXM A;  5DS6 A;  3MX3 A;  2LD6 A;  4K7B A;  2ZPA A;  4JEB A;  4IAQ A;  3JTL O;  1OKK D;  4ULW A;  3EGD B;  4NC3 A;  4XEV A;  5D91 A;  5BUO A;  2AWC A;  2EIL C;  3LUT B;  1GM5 A;  3WG7 C;  5TJ5 E;  1K40 A;  2R7W A;  1JPN A;  3KMI A;  2R7O A;  3FOO A;  3PDM P;  4MVR A;  1OW8 A;  2J9B A;  3V5X A;  1TKN A;  1LS4 A;  2YL0 A;  2YLI A;  4MTO A;  2J8W A;  2BE5 F;  5JUA A;  1I4Y A;  1EKY A;  3N2Z B;  5L3V A;  1NFN A;  2WL8 A;  3TD7 A;  1QPU A;  4PR9 A;  4R32 A;  2EIN C;  2Y39 A;  2NG1 A;  3R2P A;  4BPM A;  3JYY A;  1NU7 D;  5B3S C;  4CDV A;  2HSQ A;  3HNI A;  3K1I A;  4O7G A;  1YDI A;  1ZHZ A;  2IXO A;  4KNW A;  2J7P D;  2W4B A;  1WGW A;  3JYH A;  3EGD A;  1ZU4 A;  4O6Y A;  4LER A;  4P6I C;  4HFF B;  3SXM A;  4E0I A;  2KGO A;  2GAQ A;  3CAX A;  5JSL A;  1H6G A;  1O3U A;  2RSE B;  5FZT A;  3SXK A;  1FAP B;  3L34 A;  1I5N A;  1FTS A;  2A0U A;  2Z15 A;  3KYI A;  4EWC A;  4CBE A;  1U0B B;  2J0W A;  1U6H A;  2E87 A;  4W8K A;  3K6B A;  4JW1 A;  4C3E A;  4LDQ A;  5F5F A;  4G0H A;  3LS0 A;  3ASO C;  4YJW A;  2PP4 A;  2PX3 A;  3EQL F;  3GAN A;  3IEE A;  1NLX A;  3OWT A;  3LNR A;  2XLD A;  4JCH A;  3SYN A;  4KI2 A;  4OIO F;  3QZC A;  4QDL A;  4BJ5 C;  3LLK A;  3EJN A;  3IQT A;  3VM6 A;  4E7S A;  1OCO C;  3FDQ A;  2G3K A;  3NDB B;  4MTF A;  2XL4 A;  3VF0 A;  1M2V B;  3SXZ A;  1R4T A;  5F5H A;  3NYJ A;  2HMQ A;  5CI9 A;  2GWW A;  3GEE A;  4YN0 B;  5L0D A;  2FGY A;  2W45 A;  3U8P A;  4O6N A;  1A7V A;  2ETS A;  2XS8 A;  3DJU B;  1VTM P;  3AG4 C;  1BR1 A;  1OCZ C;  1OXB A;  1DOW A;  2A0B A;  2YL7 A;  3HNL A;  2UUI A;  2X0C A;  3ZTZ A;  1QZX A;  1WTY A;  4B6I A;  2EPN A;  4PK4 A;  4MQ9 F;  1QQ3 A;  2PX0 A;  2L7A A;  5A6B D;  1OKK A;  2LIG A;  3AGU A;  4M63 A;  1MMA A;  1EQ1 A;  2HKV A;  3QVZ A;  2QUP A;  3ZVR A;  4CDA A;  3HJC A;  3EG9 B;  4YT4 A;  4J32 B;  4MVS A;  5KYN A;  3B29 A;  2D4U A;  1ZHT A;  3BRJ A;  2JPU A;  3X2Q C;  3DE8 A;  2XXA B;  3LEV A;  2HUJ A;  2I15 A;  3QW0 A;  1M2V A;  1S7Z A;  2P61 A;  2XLW A;  1BBH A;  2ICW G;  2J45 A;  2XS1 A;  3MLG A;  3MYI A;  4K1O A;  2R7S A;  3O55 A;  1D1B A;  1ZVZ A;  3CSK A;  5L0J A;  1N1C A;  3I4U A;  3A11 A;  4YK5 A;  3C8Z A;  5A6A A;  3RYL A;  1VOM A;  3U5S A;  1HW1 A;  5BQG A;  4NQF A;  3KL4 A;  3DAG A;  2G3V A;  4C7O B;  2J7P A;  5JT4 A;  4U5B E;  1MND A;  1C02 A;  2LCH A;  4XEF A;  2H7V C;  1CGO A;  2R9R B;  2DYR C;  5E2Q A;  2OJE D;  4XLN F;  3EG9 A;  1ORS C;  3RVY A;  2YHS A;  2KW3 C;  2P1A A;  4YWQ A;  4JE9 A;  3LLI A;  2L6G A;  3SNH A;  3WHN A;  2XXA A;  1CPR A;  4OD5 A;  3GOD A;  2ZXO A;  1TWA A;  2YZS A;  2ZD9 A;  3RW0 A;  2HV6 A;  1SYQ A;  1FFH A;  2L6H A;  2PF4 E;  1Q0K A;  4EHP A;  3AQB A;  3H2V A;  4ZLC A;  3K66 A;  1HE9 A;  1QSP A;  2HFI A;  2DYS C;  2YEV A;  4XLP F;  4C7O A;  4DVY P;  4QI2 A;  3TJ5 A;  3HNK A;  5JVE A;  3G4Z A;  4WGY A;  2EPO A;  2J9U A;  1ORY A;  1RCP A;  4PJN A;  4ULV A;  3NG1 A;  1WWP A;  3LEO A;  4QI0 A;  3FMS A;  4CS8 C;  3UMI A;  2YKZ A;  3EH1 A;  5DQZ A;  2Q00 A;  1AEP A;  4NY3 A;  3JCU Q;  1K04 A;  2X51 A;  3C62 A;  2Q7R A;  1XWJ A;  2YRF A;  3E70 C;  3IPM O;  3N0T A;  4AL0 A;  4FAP B;  5DLJ A;  4Q7C A;  2Q9A A;  1OCR C;  5A69 A;  3LAY A;  1GQA A;  4U5C E;  1FFT C;  1Y6D A;  2P6V A;  3RQG A;  4DRJ B;  1EI7 A;  5KYX B;  2R03 A;  4CJO A;  2H7B A;  4IB4 A;  4N06 A;  2Y3D A;  2XL8 A;  3RVZ A;  4J7T A;  3DZA A;  5HV9 A;  2KC3 A;  3UMK A;  4BEM J;  1HMD A;  4C3D A;  1CGM E;  1Z23 A;  3GM2 A;  1XZP A;  3UR3 C;  4CDY A;  3RKO F;  3LES A;  2D5R B;  3O10 A;  1TFO B;  4GYT A;  2BC5 A;  5KYW B;  1M2O A;  4P9F A;  4G7O F;  1K05 A;  3M79 A;  4YT5 A;  1YYJ A;  4Z9H A;  4BG0 A;  3S27 A;  4DBQ A;  2CW0 F;  4FWV A;  2A6E F;  2HMZ A;  2DI3 A;  4XPX A;  3US6 A;  2AVK A;  1H7I A;  1F1M A;  4AK9 A;  2KK1 A;  1JRA A;  4EIY A;  1YA7 O;  4CS9 A;  2HJ3 A;  3I5P A;  5KYX A;  2VB6 A;  3W4Y A;  4PFO A;  2J46 A;  5L0G A;  3RIP A;  2TMV P;  2FFH A;  2GA0 A;  4DVZ A;  1OQC A;  2XLM A;  3DM5 A;  4NTB A;  3W2W A;  3M4B A;  3WAQ A;  5A6K A;  1VMA A;  4H54 A;  2A1D D;  4C3B A;  3W8I A;  3S0X A;  1D1A A;  4MVQ A;  4JEA A;  4EUK B;  5KYW A;  4MW3 A;  4XTK A;  4JTA B;  1G4W R;  4OIQ F;  2R02 A;  3AGT A;  2KQ9 A;  3EPV A;  2MHR A;  1OW6 A;  3DKA A;  1EA8 A;  4UDV A;  1G4U S;  2OEX A;  4FES A;  1TWG A;  4DJ9 A;  1Q0M A;  1UG7 A;  4EBK A;  5D92 A;  4OIP F;  4BJ1 A;  1GS9 A;  5T1D B;  2QLA A;  1B68 A;  1O5H A;  3H2U A;  2IOQ A;  3OA1 A;  5JS5 A;  2XL6 A;  4BEJ A;  3S29 A;  4CIH A;  1W2W A;  2ZXW C;  3G4X A;  3O39 A;  1TQG A;  2VCA A;  3DE9 A;  2MWQ A;  1E84 A;  2XLO A;  1VK5 A;  2YL3 A;  4CIP A;  5CIV A;  4YL3 A;  2B0H A;  2PBE A;  2QY9 A;  3EHM A;  4JCZ A;  2CCY A;  1V54 C;  1JAF A;  3ZTM A;  4CSA C;  2LFD A;  1H9G A;  2Q4F A;  2VH3 A;  2XM4 A;  1V4A A;  4K0D A;  3UNG C;  3U9M A;  2WZG A;  1IW7 F;  1IZM A;  1LE2 A;  1VB5 A;  3QW1 A;  2NUT B;  4IAR A;  1NU9 C;  1LPE A;  2Q9B A;  3JRT A;  1V74 B;  4U5G A;  4JTD B;  1BZ4 A;  5L0I A;  2L81 A;  1G5Z A;  1Z6A A;  3W8H A;  4N4W A;  5DQT A;  3UMH A;  2XLH A;  4WGZ A;  1TWH A;  3NMI A;  4KC9 A;  4BJT A;  1MMN A;  3LJB A;  3C8G D;  5AC5 A;  4GEH A;  2P7V A;  3JZ0 A;  3DI5 A;  1VYI A; 
#chains in the Genus database with same CATH homology
 3IQ6 A;  1S05 A;  4IAQ A;  4JEB A;  1APC A;  3HNK A;  4NC3 A;  2YLD A;  4WGY A;  3TOM A;  3M15 A;  1E86 A;  2YLG A;  1RCP A;  4ULV A;  3FOO A;  2YKZ A;  2J9B A;  2YL0 A;  2YLI A;  3C62 A;  2J8W A;  5JUA A;  3ZQV A;  1EKY A;  3L1M A;  256B A;  4CX9 A;  1QPU A;  5AGF A;  1GQA A;  4CDV A;  4D4N A;  3HNI A;  4CJO A;  4IB4 A;  4CJG A;  5JRA A;  2XL8 A;  3M4C A;  2XM0 A;  2YL1 A;  5JSL A;  3C63 A;  3VRC A;  4CDY A;  5JP7 A;  2BC5 A;  5B3I A;  3M79 A;  1YYJ A;  5JLI A;  1E83 A;  1YZA A;  1NBB A;  3IQ5 A;  2XLD A;  4EIY A;  4JKV A;  3NMJ A;  2XLM A;  3M4B A;  3U8P A;  1A7V A;  5JVE A;  2YL7 A;  2XLE A;  3HNL A;  4JEA A;  3ZTZ A;  1E85 A;  4N6H A;  1QQ3 A;  3HNJ A;  2XLV A;  3ZWI A;  3QVZ A;  4CDA A;  3NMK A;  2QLA A;  3DE8 A;  4L6R A;  3QW0 A;  5JS5 A;  1YZC A;  2XL6 A;  2XLW A;  1BBH A;  4D4X A;  3DE9 A;  3ZQY A;  1E84 A;  2XLO A;  1CPQ A;  2YL3 A;  4CIP A;  3QVY A;  2CCY A;  3FOP A;  1YYX A;  5JT4 A;  1JAF A;  1M6T A;  3ZTM A;  2XM4 A;  1CGO A;  4IAR A;  3QW1 A;  3TOL A;  4JE9 A;  4ER9 A;  4U9D A;  4N4W A;  1CPR A;  1MQV A;  2XLH A;  4WGZ A;  3NMI A;  4U9E A;  1LM3 B;  1CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...