4U9DA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, ab3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9dA00
3ZQVA 1NBBA 1EKYA 2J9BA 1YYJA 5JP7A 2XLMA 2XL6A 4EIYA 2J8WA 4WGYA 1E86A 1S05A 1E83A 1YYXA 3C63A 4JE9A 1M6TA 1BBHA 4WGZA 3QVZA 3QW0A 3NMIA 2XL8A 2XLDA 2YLDA 4JEBA 4JEAA 1CGOA 1YZAA 1CPQA 3M15A 2QLAA 5JS5A 2XLHA 3L1MA 2CCYA 3C62A 5JVEA 2YL0A 3HNLA 3NMKA 1GQAA 4L6RA 1E85A 3TOMA 3NMJA 4U9EA 1LM3B 2YLGA 5JUAA 2YL7A 2YLIA 1QPUA 4CDAA 3ZQYA 5JRAA 4CJOA 1APCA 4ULVA 2BC5A 3QVYA 3IQ5A 3ZWIA 1YZCA 1MQVA 2XLEA 4D4XA 3ZTZA 2XM0A 1QQ3A 4CJGA 5B3IA 1A7VA 2YL1A 4CDVA 5JSLA 4JKVA 3FOOA 3ZTMA 4ER9A 1JAFA 3FOPA 1E84A 2XLWA 4N4WA 3DE8A 4U9DA 4NC3A 2XM4A 4D4NA 2XLOA 3M4BA 4IARA 3M4CA 256BA 2XLVA 3TOLA 5AGFA 5JLIA 3M79A 4CIPA 3HNJA 3VRCA 1RCPA 4CDYA 4IAQA 4CX9A 3DE9A 3U8PA 1CGNA 2YL3A 5JT4A 1CPRA 4IB4A 3QW1A 3HNKA 3HNIA 3IQ6A 2YKZA 4N6HA
chains in the Genus database with same CATH superfamily
2EIJC 1EI7A 1YVIA 3F47A 1UFBA 2DGJA 2EIMC 3Q6MA 4MQ9F 3ZQVA 2IXPA 4FWVA 4O6NA 1VB5A 1Z5ZA 1TWGA 2DYSC 3NKDA 3UMHA 1GGQA 4BEMJ 3AGTA 1PD1A 1YYJA 2Y69C 3PMRA 3AOUA 3FMSA 1M2VA 2KC3A 4YT5A 2XLMA 1TWAA 4U5FE 2OCCC 3SYNA 4MTGA 2NUPA 3RIPA 3EQLF 2RD9A 1FAPB 4C7OB 2R7XA 3LEOA 3GEHA 3LJBA 4U5HA 2B0JA 3U3BA 1BR1A 1S05A 1E83A 3C63A 2XSEA 3ZC4A 2TMVP 1YA9A 4Q7CA 1M6TA 4MVMA 2MWQA 4MVUA 2BL2A 2ZXOA 4WJ0A 3V5YA 3QW0A 4JVSA 2XLDA 2YLDA 1O3UA 2J0WA 2QE9A 3K33A 2P7VA 5COFA 3X1OA 4YL3A 4YL1A 4C3DA 4Q5SF 3PDMP 1A7EA 2HMQA 1BR4A 3I4UA 1MMGA 2NSGA 3C8ZA 2D4UA 1XWJA 3IEEA 4E0IA 2PNOA 1F1MA 2L6GA 2R7VA 3ATPA 1M2OA 2HJ3A 1TKNA 4LDKA 3ECSA 2XLHA 2L6FA 4XPYA 5D91A 2EPKX 1N1CA 3C8GB 3S84A 3RFYA 1G4US 4LERA 4KBLA 1ZW2A 4U5EE 3RH3A 3AG1C 3KMIA 3U0CA 1OCCC 1OXBA 1NG1A 3L34A 1LI7A 3TOMA 4CS7A 1AEPA 1XZPA 1S7ZA 3ABLC 3NMJA 1D1AA 4PACA 2GWWA 4U9EA 3TQOA 4AL1A 1VTMP 1KU2A 4IRUA 2PFDA 3AGUA 1HMOA 2YLIA 2NSFA 4W8PA 2CNWD 4P9FA 1Q0FA 2NUTA 2J9VA 2ZXPA 5JRAA 2V3CC 4NCQA 1FFHA 3ITFA 1G5ZA 3JRTA 3DMDA 1FTSA 5COMA 3UGPA 3EFOA 3KPHA 3ZWIA 4G7ZF 4JIOA 1ZU4A 2MHRA 4JJGA 1LS1A 4D4XA 3H2VA 4EBKA 4CIHA 2XM0A 2OEXA 1M57C 3UNGC 1Y4CA 2Q9BA 3RQEA 2OOCA 2W4MA 2H7OA 3O39A 3ZTMA 4IAOA 3EG9A 3SXKA 1JAFA 1SZIA 1Q0DA 3V5ZA 5E33A 2WVQA 3I5PA 2XLWA 4NY3A 5L0GA 2LQGA 1LE4A 3US6A 4FX5A 2HS5A 5CI8A 4LLCA 3WHNA 2Y3GA 1H6GA 5BQIA 2VB6A 1FMVA 2W4BA 4XEFA 5A6BD 2IXOA 2J0XA 1OW8A 2Q9AA 3JCUQ 3X2QC 4AE4A 5L0JA 4I44A 2XLOA 4XLPF 4P6IC 4IARA 1YA7O 5FCLA 2C03A 2IBFA 4CSAC 4MW8A 2OG2A 2AU5A 1RXQA 1ZHXA 4WABA 4AK9A 1HW2A 2JX0A 1SF8A 3IQTA 4O79A 3GM3A 1J8MF 3ABMC 3UR3C 5A6KA 3VRCA 1U0BB 1A41A 1CGME 3LAYA 4FESA 1ZVZA 1MMAA 2HJMA 2HUJA 2GAQA 2ICWG 2OJQA 4F4BA 5AC4A 5IY5C 4MS2A 1RKEA 3U8PA 5KYWB 4J30B 4ONSA 5T3WA 4EBBA 4JURI 4ZLCA 3MYIA 2KW3C 4E17A 1NSGB 2KJGA 1V55C 1Z6AA 4H4KC 4I3MA 4IJJA 4BJ6A 1JPNA 1OQCA 3IPMO 3CAXA 1MNEA 1ZHWA 4PFPA 4BG0A 1WTYA 1V74B 2J9BA 3JZ0A 4U5DE 3RVYA 1EA8A 2KK1A 3UMKA 5CIVA 2EIKC 3GEIA 4MVQA 5DS5A 3ASNC 2XXAB 2XL6A 1RKCA 1T9KA 1L7CA 1LPEA 4GEHA 2J8WA 3S29A 4EIYA 5KYYA 5AC5A 4WGYA 1EKYA 3WODF 4KNVA 3I5QA 1I4YA 4DBQA 3W8HA 2LFDA 1WWPA 1HE1A 1OKKA 1YJGA 1KTMA 4HFKB 2W9YA 2WVNA 4GQHA 5L0FA 3NYLA 2X0CA 3CQZA 3JSZA 3C7JA 4NTAA 2ASRA 3KYJA 1NZEA 4DXWA 2GA0A 1NLXA 2A6HF 2QNLA 3W2VA 4JEBA 4JEAA 3ZSUA 2Q00A 5DQTA 3M1CB 2R7SA 3WAQA 1IW7F 2IXMA 1KNYA 3B9QA 4EKWA 2QLAA 3DI5A 1ZU5A 2J7PA 1T5OA 2VCAA 4HFFB 2XS8A 3S28A 5B1AC 2CCYA 5BQGA 3VM6A 1NU7D 3T9OA 5L0DA 2YL0A 1WN0A 2HZ8A 3NMKA 4N6CA 3J06A 1GQAA 2P61A 4JJFA 1OR2A 3TD7A 1QLEC 2A1DD 2F22A 1OCOC 2R25A 3CSKA 2GDCA 3AG2C 2H8AA 5JUAA 1YAUO 2PBEA 4PJJA 5L3VA 2Q4FA 1QPUA 4AL0A 2LK4A 3T6BA 5KYXB 3JYHA 4AX2A 4CJOA 2P0NA 4K1OA 1Z23A 2WL8A 3SXYA 3F46A 4E7ZA 3B0VC 3LLIA 5B1BC 1I5NA 2G62A 2BC5A 3RF3A 4C7OA 5KYUB 3EH2A 4ULWA 2EILC 1LVKA 1T6QA 3PHF2 3K66A 1C03A 1Y6DA 3SZRA 5BUOA 1BR2A 1K40A 5B3IA 2QTVA 3N0TA 2AWCA 4NQFA 4U5CE 1H7IA 1HY5A 2VC9A 2WB7A 1ZZPA 5B3SC 4PFOA 1NU9C 1TR2A 3A11A 1TWHA 4XEVA 3SNHA 3U5SA 4ER9A 4EWCA 1R5ID 1V54C 2VASA 2HKVA 3RQGA 3TK0A 3GM1A 2QY9A 4HE8D 1E84A 3EHNA 2ZD9A 3DM9B 5E3CA 1L3PA 1AVOB 1OCRC 3R2PA 2R7UA 4MNDA 4YL0A 3OWTA 3DAGA 3FAPB 3SXMA 3W8IA 4U9DA 2XRHA 4NC3A 3DJUB 2XM4A 1Z7Qc 5DS4A 5L0CA 1OW7A 3HKKA 3AQCA 3H65A 4MTFA 5A6AA 2HFIA 1QKRA 4RD9A 2YQYA 4D4NA 4Z9JA 3EGDB 3M4CA 4YT8A 2EPNA 3C8GA 4J7TA 3HLZA 2XLVA 2YHSA 2LIGA 1WASA 1JMWA 3M79A 2IM8A 2LCHA 3EH1A 2FGYA 3B0UX 4NTFA 2O9XA 4QDLA 1U6HA 1YARO 4O7GA 1FNTc 3JT1A 3G4XA 4IAQA 4CX9A 1RJ9B 1PCXA 1T01A 2X51A 3B0PA 4OINF 1G8XA 2LP4A 4QI2A 1PV3A 1J8YF 1MMDA 2YL3A 1CPRA 1VYIA 3LS0A 4NTBA 3CZ6A 4XWJA 1MNDA 4UDVA 1ZHTA 3QW1A 2OJED 3K6BA 3HNKA 1T6IA 2PX3A 4N6HA 1H9TA 1ORJA 4JCHA 3O55A 3EGXB 3LUTB 4XPWA 4OIRF 4XLNF 2R7QA 3K1IC 3OA1A 1NBBA 4LDQA 4DRHB 4YT4A 4KI2A 4JC7A 2VCBA 3G4ZA 3DWWA 1D0YA 1XZQA 4R32A 5F5FA 3FAJA 3Q7LA 5JP7A 4I1OB 4RBNA 2HSBA 3HJCA 2P6VA 2G3VA 2VH3A 1K04A 4CSAA 3R7CA 3W2WA 4U5BE 1M56C 2A68F 1A7DA 2J45A 4DVYP 2ZXWC 4GYTA 2PF4E 2QUPA 4A2NB 1YYXA 1H9GA 1ZHZA 2OEVA 2AP3A 1BBHA 4WGZA 1VMAA 2R9RB 3KYIA 4XPXA 3LEVA 2WZGA 5GPGB 1ZHYA 2XL8A 3GWNA 5A69A 2A6EF 4XEKA 1Q0KA 4JZAA 3V7OA 2J46A 2Y3HA 3DD7A 4BJ5C 1CGOA 1A0BA 1YZAA 2PX0A 2VCCA 2XL4A 3ZVRA 3GORA 3POVA 1CPQA 5COGA 3SEOA 5EGYA 2KSFA 3K1HA 1Q0MA 4O6YA 2CYDA 3MX3A 5BQHA 5JS5A 5KYWA 2R7RA 2A0UA 1ZW3A 1DOWA 2L9JA 5FZTA 2CDQA 2DB4A 3ABKC 3VYWA 4CS8C 1SMYF 4J7YA 4P9TA 1D0ZA 4N06A 3B29A 3BRJA 2EINC 4OIOF 3DJNB 4C3EA 5A6JA 2YZSA 3NRHA 4C3BA 4KNWA 2YVKA 1B68A 2L81A 3H2UA 1LM3B 2B0HA 2L7AA 3GM2A 2YL7A 2NG1A 3DM5A 3GEEA 3IQCA 4G78A 4FAPB 1LS4A 1LI5A 3GODA 2XXAA 3L8JA 4Z9IA 5CI9A 2GFHA 3ASOC 3LESA 3EJNA 4Z9HA 2R7OA 4G0HA 4BJ1A 4DRIB 3IQ5A 2UUHA 2KNHA 2PP4A 1YZCA 2UUIA 1VLSA 1MQVA 4I1MA 4CS9C 3NKEA 3U3FA 4BJTA 4ZLDA 1K05A 1WOLA 2CNWA 4PJNA 3FVYA 2OKUA 1A7VA 4CDVA 3KH2A 5T3TA 1QSPA 3PCVA 1D0XA 4JKVA 3FOOA 4K0DA 4OD5A 1NFNA 2Q3TA 3EZHA 1GM5A 2ZPAA 3DAFA 3HTKC 3U2LA 2E87A 3FHDA 1M2VB 1VYKA 2BE5F 3QMKA 4JW1A 3T6JA 1TFOB 2C04A 2Y3DA 3DE8A 3AG3C 2NUPB 2I8BA 3MLGA 3NG1A 4IWBA 3L0IA 3RKOF 2HMZA 3JRMO 1JOGA 1U89A 4PJMA 1BDJB 1UG7A 3QZCA 3JSEO 3M4BA 3GWLA 3TULA 3VF0A 1FMWA 2DI3A 2AVKA 3NYJA 5T1DB 1JR8A 2FFHA 4EBJA 2LSEA 5AGFA 5EHHA 1Z3IX 3Q7GA 1VLTA 4CIPA 3O10A 2WZLA 3HNJA 4CBEA 1MMNA 5A6BA 2JPUA 1WATA 1RCPA 4OD4A 5KYXA 2AWYA 3SP1A 3DE9A 2DYRC 2Q7RA 3VAYA 3AQBA 3ZIBA 3S90A 5DS6A 2J9UA 2J9WA 1CGNA 5KYUA 4G7HF 2A69F 2IOQA 4IB4A 3LS1A 3UMIA 1R4TA 1QVXA 2I15A 3DXJF 3MBGA 3HNIA 3IQ6A 2YKZA 1V4AA 1RMVA 4YK5A 2ETSA 1YDIA 1ORYA 4KC9A 5F28E 3S27A 1TQGA 1TFKB 3U9JA 4J32B 1JPJA 4W8KA 2YEVA 5K0IA 2FAPB 3JTLO 5TJ5E 3O6XA 3V5XA 1OKKD 1QZXA 2KYHA 1HMDA 3MYFA 4DRJB 3L8IA 5HV9A 5L0HA 3LNMB 3SXZA 5D92A 2NUTB 1ZYRF 2HSQA 4YN0B 3RVZA 3LNRA 5L0IA 3KL4A 2H7VC 4ANJA 2LFFA 1E2XA 3K7DA 1NFOA 3EPVA 1IZMA 3EFOB 1E86A 3QTHA 4RDAA 1VOMA 2OQMA 3EGDA 4JE9A 4G7OF 1FR0A 1Z63A 3GANA 2R03A 1Q0GA 3G50A 3QVZA 5DLJA 4DJ9A 5DQZA 4X0RA 2J7PD 3NMIA 2YWAA 4JRZA 4YJWA 3EZIA 3EG9B 4Q4ZF 2R7WA 2R02A 2IXNA 3NYMA 3AG4C 4MVOA 3U9MA 1HE9A 4A4AA 1RJ9A 4BEJA 4PR9A 2Y3BA 3M15A 4XTKA 4H54A 3TJ6A 2CW0F 1LIHA 2V26A 2R7TA 1HW1A 3RQFA 3RW0A 1WGWA 3S0XA 3K1IA 5F5HA 2Z15A 3JYYA 3L1MA 4AE4B 4JCZA 3S9OA 3C18A 2L6HA 3C62A 5JVEA 3HNLA 1G4WR 1LE2A 3DZAA 4XQ1A 4EHPA 3NDBB 3E9VA 3EGXA 2Q9CA 4L6RA 4MW3A 4O6MA 5L3QA 1C17M 1E85A 3Q6NA 3A9CA 2OU6A 4OIPF 5E2QA 2YLGA 4E7SA 4LACB 1JRAA 2P1AA 3OEOA 3RYLA 3MFNA 3U2MA 3T6GB 4CDAA 3ZQYA 2CGEA 1YLMA 4DVZA 2H7BA 1APCA 1DOVA 3KKBA 4K7BA 5KYNA 1AUEA 4ULVA 3W4YA 4B6IA 1RKEB 4MVRA 3QVYA 4MTOA 2WVOA 1ST6A 3ZDLA 2WZFA 1GS9A 2ZXRA 2XLEA 2MYSA 2EPLX 3IHUA 3ZTZA 2M64A 4BJ5A 4JTCB 1QQ3A 1C02A 4CJGA 2HV7A 2YL1A 5JSLA 3N2ZB 1ORSC 1TWCA 3N24A 3EHMA 2EPMX 2KGOA 2RSEB 4BJ6C 1FFTC 3FOPA 4LLEA 3C8GD 4MVZA 3FDQA 4N4WA 3BEHA 2R05A 4CS8A 3DKAA 2XS1A 4QI0A 1SR2A 2IYLD 5KYYB 4IGGA 5E3AA 3ZG1A 2G3KA 2JD3A 4DOZA 4U5GA 4LDRA 3CEXA 2D5RB 1W2WA 3TJ5A 1SYQA 4OIQF 3WG7C 1I4ZA 2EPOA 1OW6A 2NPUA 256BA 4M63A 1OCZC 3T4RA 2KQ9A 1O5HA 3TOLA 1BZ4A 4E0HA 4BPMA 1VK5A 2M4EA 4HEAJ 2W45A 4JTDB 5JLIA 4PK4A 3E70C 4YWQA 1EQ1A 5HSWA 2LD6A 3AJMA 1D1BA 1O87A 4CDYA 3B71A 1OR3A 2A0BA 5DVWA 3U8VA 4CS9A 4DBRA 2Y39A 1LKXA 4EUKB 4YT2A 1D1CA 4PJLA 1OXKA 1PD0A 5JT4A 2HV6A 3FXHA 4E18A 3UGOA 5EK0A 4JTAB 1T6UA 2YRFA 3LLKA 4MVSA
chains in the Genus database with same CATH topology
3ZQVA 1NBBA 1EKYA 2J9BA 1YYJA 5JP7A 2XLMA 2XL6A 4EIYA 2J8WA 4WGYA 1E86A 1S05A 1E83A 1YYXA 3C63A 4JE9A 1M6TA 1BBHA 4WGZA 3QVZA 3QW0A 3NMIA 2XL8A 2XLDA 2YLDA 4JEBA 4JEAA 1CGOA 1YZAA 1CPQA 3M15A 2QLAA 5JS5A 2XLHA 3L1MA 2CCYA 3C62A 5JVEA 2YL0A 3HNLA 3NMKA 1GQAA 4L6RA 1E85A 3TOMA 3NMJA 4U9EA 1LM3B 2YLGA 5JUAA 2YL7A 2YLIA 1QPUA 4CDAA 3ZQYA 5JRAA 4CJOA 1APCA 4ULVA 2BC5A 3QVYA 3IQ5A 3ZWIA 1YZCA 1MQVA 2XLEA 4D4XA 3ZTZA 2XM0A 1QQ3A 4CJGA 5B3IA 1A7VA 2YL1A 4CDVA 5JSLA 4JKVA 3FOOA 3ZTMA 4ER9A 1JAFA 3FOPA 1E84A 2XLWA 4N4WA 3DE8A 4U9DA 4NC3A 2XM4A 4D4NA 2XLOA 3M4BA 4IARA 3M4CA 256BA 2XLVA 3TOLA 5AGFA 5JLIA 3M79A 4CIPA 3HNJA 3VRCA 1RCPA 4CDYA 4IAQA 4CX9A 3DE9A 3U8PA 1CGNA 2YL3A 5JT4A 1CPRA 4IB4A 3QW1A 3HNKA 3HNIA 3IQ6A 2YKZA 4N6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQV A;  1NBB A;  1EKY A;  2J9B A;  1YYJ A;  5JP7 A;  2XLM A;  2XL6 A;  4EIY A;  2J8W A;  4WGY A;  1E86 A;  1S05 A;  1E83 A;  1YYX A;  3C63 A;  4JE9 A;  1M6T A;  1BBH A;  4WGZ A;  3QVZ A;  3QW0 A;  3NMI A;  2XL8 A;  2XLD A;  2YLD A;  4JEB A;  4JEA A;  1CGO A;  1YZA A;  1CPQ A;  3M15 A;  2QLA A;  5JS5 A;  2XLH A;  3L1M A;  2CCY A;  3C62 A;  5JVE A;  2YL0 A;  3HNL A;  3NMK A;  1GQA A;  4L6R A;  1E85 A;  3TOM A;  3NMJ A;  4U9E A;  1LM3 B;  2YLG A;  5JUA A;  2YL7 A;  2YLI A;  1QPU A;  4CDA A;  3ZQY A;  5JRA A;  4CJO A;  1APC A;  4ULV A;  2BC5 A;  3QVY A;  3IQ5 A;  3ZWI A;  1YZC A;  1MQV A;  2XLE A;  4D4X A;  3ZTZ A;  2XM0 A;  1QQ3 A;  4CJG A;  5B3I A;  1A7V A;  2YL1 A;  4CDV A;  5JSL A;  4JKV A;  3FOO A;  3ZTM A;  4ER9 A;  1JAF A;  3FOP A;  1E84 A;  2XLW A;  4N4W A;  3DE8 A;  4U9D A;  4NC3 A;  2XM4 A;  4D4N A;  2XLO A;  3M4B A;  4IAR A;  3M4C A;  256B A;  2XLV A;  3TOL A;  5AGF A;  5JLI A;  3M79 A;  4CIP A;  3HNJ A;  3VRC A;  1RCP A;  4CDY A;  4IAQ A;  4CX9 A;  3DE9 A;  3U8P A;  1CGN A;  2YL3 A;  5JT4 A;  1CPR A;  4IB4 A;  3QW1 A;  3HNK A;  3HNI A;  3IQ6 A;  2YKZ A;  4N6H A; 
#chains in the Genus database with same CATH topology
 2EIJ C;  1EI7 A;  1YVI A;  3F47 A;  1UFB A;  2DGJ A;  2EIM C;  3Q6M A;  4MQ9 F;  3ZQV A;  2IXP A;  4FWV A;  4O6N A;  1VB5 A;  1Z5Z A;  1TWG A;  2DYS C;  3NKD A;  3UMH A;  1GGQ A;  4BEM J;  3AGT A;  1PD1 A;  1YYJ A;  2Y69 C;  3PMR A;  3AOU A;  3FMS A;  1M2V A;  2KC3 A;  4YT5 A;  2XLM A;  1TWA A;  4U5F E;  2OCC C;  3SYN A;  4MTG A;  2NUP A;  3RIP A;  3EQL F;  2RD9 A;  1FAP B;  4C7O B;  2R7X A;  3LEO A;  3GEH A;  3LJB A;  4U5H A;  2B0J A;  3U3B A;  1BR1 A;  1S05 A;  1E83 A;  3C63 A;  2XSE A;  3ZC4 A;  2TMV P;  1YA9 A;  4Q7C A;  1M6T A;  4MVM A;  2MWQ A;  4MVU A;  2BL2 A;  2ZXO A;  4WJ0 A;  3V5Y A;  3QW0 A;  4JVS A;  2XLD A;  2YLD A;  1O3U A;  2J0W A;  2QE9 A;  3K33 A;  2P7V A;  5COF A;  3X1O A;  4YL3 A;  4YL1 A;  4C3D A;  4Q5S F;  3PDM P;  1A7E A;  2HMQ A;  1BR4 A;  3I4U A;  1MMG A;  2NSG A;  3C8Z A;  2D4U A;  1XWJ A;  3IEE A;  4E0I A;  2PNO A;  1F1M A;  2L6G A;  2R7V A;  3ATP A;  1M2O A;  2HJ3 A;  1TKN A;  4LDK A;  3ECS A;  2XLH A;  2L6F A;  4XPY A;  5D91 A;  2EPK X;  1N1C A;  3C8G B;  3S84 A;  3RFY A;  1G4U S;  4LER A;  4KBL A;  1ZW2 A;  4U5E E;  3RH3 A;  3AG1 C;  3KMI A;  3U0C A;  1OCC C;  1OXB A;  1NG1 A;  3L34 A;  1LI7 A;  3TOM A;  4CS7 A;  1AEP A;  1XZP A;  1S7Z A;  3ABL C;  3NMJ A;  1D1A A;  4PAC A;  2GWW A;  4U9E A;  3TQO A;  4AL1 A;  1VTM P;  1KU2 A;  4IRU A;  2PFD A;  3AGU A;  1HMO A;  2YLI A;  2NSF A;  4W8P A;  2CNW D;  4P9F A;  1Q0F A;  2NUT A;  2J9V A;  2ZXP A;  5JRA A;  2V3C C;  4NCQ A;  1FFH A;  3ITF A;  1G5Z A;  3JRT A;  3DMD A;  1FTS A;  5COM A;  3UGP A;  3EFO A;  3KPH A;  3ZWI A;  4G7Z F;  4JIO A;  1ZU4 A;  2MHR A;  4JJG A;  1LS1 A;  4D4X A;  3H2V A;  4EBK A;  4CIH A;  2XM0 A;  2OEX A;  1M57 C;  3UNG C;  1Y4C A;  2Q9B A;  3RQE A;  2OOC A;  2W4M A;  2H7O A;  3O39 A;  3ZTM A;  4IAO A;  3EG9 A;  3SXK A;  1JAF A;  1SZI A;  1Q0D A;  3V5Z A;  5E33 A;  2WVQ A;  3I5P A;  2XLW A;  4NY3 A;  5L0G A;  2LQG A;  1LE4 A;  3US6 A;  4FX5 A;  2HS5 A;  5CI8 A;  4LLC A;  3WHN A;  2Y3G A;  1H6G A;  5BQI A;  2VB6 A;  1FMV A;  2W4B A;  4XEF A;  5A6B D;  2IXO A;  2J0X A;  1OW8 A;  2Q9A A;  3JCU Q;  3X2Q C;  4AE4 A;  5L0J A;  4I44 A;  2XLO A;  4XLP F;  4P6I C;  4IAR A;  1YA7 O;  5FCL A;  2C03 A;  2IBF A;  4CSA C;  4MW8 A;  2OG2 A;  2AU5 A;  1RXQ A;  1ZHX A;  4WAB A;  4AK9 A;  1HW2 A;  2JX0 A;  1SF8 A;  3IQT A;  4O79 A;  3GM3 A;  1J8M F;  3ABM C;  3UR3 C;  5A6K A;  3VRC A;  1U0B B;  1A41 A;  1CGM E;  3LAY A;  4FES A;  1ZVZ A;  1MMA A;  2HJM A;  2HUJ A;  2GAQ A;  2ICW G;  2OJQ A;  4F4B A;  5AC4 A;  5IY5 C;  4MS2 A;  1RKE A;  3U8P A;  5KYW B;  4J30 B;  4ONS A;  5T3W A;  4EBB A;  4JUR I;  4ZLC A;  3MYI A;  2KW3 C;  4E17 A;  1NSG B;  2KJG A;  1V55 C;  1Z6A A;  4H4K C;  4I3M A;  4IJJ A;  4BJ6 A;  1JPN A;  1OQC A;  3IPM O;  3CAX A;  1MNE A;  1ZHW A;  4PFP A;  4BG0 A;  1WTY A;  1V74 B;  2J9B A;  3JZ0 A;  4U5D E;  3RVY A;  1EA8 A;  2KK1 A;  3UMK A;  5CIV A;  2EIK C;  3GEI A;  4MVQ A;  5DS5 A;  3ASN C;  2XXA B;  2XL6 A;  1RKC A;  1T9K A;  1L7C A;  1LPE A;  4GEH A;  2J8W A;  3S29 A;  4EIY A;  5KYY A;  5AC5 A;  4WGY A;  1EKY A;  3WOD F;  4KNV A;  3I5Q A;  1I4Y A;  4DBQ A;  3W8H A;  2LFD A;  1WWP A;  1HE1 A;  1OKK A;  1YJG A;  1KTM A;  4HFK B;  2W9Y A;  2WVN A;  4GQH A;  5L0F A;  3NYL A;  2X0C A;  3CQZ A;  3JSZ A;  3C7J A;  4NTA A;  2ASR A;  3KYJ A;  1NZE A;  4DXW A;  2GA0 A;  1NLX A;  2A6H F;  2QNL A;  3W2V A;  4JEB A;  4JEA A;  3ZSU A;  2Q00 A;  5DQT A;  3M1C B;  2R7S A;  3WAQ A;  1IW7 F;  2IXM A;  1KNY A;  3B9Q A;  4EKW A;  2QLA A;  3DI5 A;  1ZU5 A;  2J7P A;  1T5O A;  2VCA A;  4HFF B;  2XS8 A;  3S28 A;  5B1A C;  2CCY A;  5BQG A;  3VM6 A;  1NU7 D;  3T9O A;  5L0D A;  2YL0 A;  1WN0 A;  2HZ8 A;  3NMK A;  4N6C A;  3J06 A;  1GQA A;  2P61 A;  4JJF A;  1OR2 A;  3TD7 A;  1QLE C;  2A1D D;  2F22 A;  1OCO C;  2R25 A;  3CSK A;  2GDC A;  3AG2 C;  2H8A A;  5JUA A;  1YAU O;  2PBE A;  4PJJ A;  5L3V A;  2Q4F A;  1QPU A;  4AL0 A;  2LK4 A;  3T6B A;  5KYX B;  3JYH A;  4AX2 A;  4CJO A;  2P0N A;  4K1O A;  1Z23 A;  2WL8 A;  3SXY A;  3F46 A;  4E7Z A;  3B0V C;  3LLI A;  5B1B C;  1I5N A;  2G62 A;  2BC5 A;  3RF3 A;  4C7O A;  5KYU B;  3EH2 A;  4ULW A;  2EIL C;  1LVK A;  1T6Q A;  3PHF 2;  3K66 A;  1C03 A;  1Y6D A;  3SZR A;  5BUO A;  1BR2 A;  1K40 A;  5B3I A;  2QTV A;  3N0T A;  2AWC A;  4NQF A;  4U5C E;  1H7I A;  1HY5 A;  2VC9 A;  2WB7 A;  1ZZP A;  5B3S C;  4PFO A;  1NU9 C;  1TR2 A;  3A11 A;  1TWH A;  4XEV A;  3SNH A;  3U5S A;  4ER9 A;  4EWC A;  1R5I D;  1V54 C;  2VAS A;  2HKV A;  3RQG A;  3TK0 A;  3GM1 A;  2QY9 A;  4HE8 D;  1E84 A;  3EHN A;  2ZD9 A;  3DM9 B;  5E3C A;  1L3P A;  1AVO B;  1OCR C;  3R2P A;  2R7U A;  4MND A;  4YL0 A;  3OWT A;  3DAG A;  3FAP B;  3SXM A;  3W8I A;  4U9D A;  2XRH A;  4NC3 A;  3DJU B;  2XM4 A;  1Z7Q c;  5DS4 A;  5L0C A;  1OW7 A;  3HKK A;  3AQC A;  3H65 A;  4MTF A;  5A6A A;  2HFI A;  1QKR A;  4RD9 A;  2YQY A;  4D4N A;  4Z9J A;  3EGD B;  3M4C A;  4YT8 A;  2EPN A;  3C8G A;  4J7T A;  3HLZ A;  2XLV A;  2YHS A;  2LIG A;  1WAS A;  1JMW A;  3M79 A;  2IM8 A;  2LCH A;  3EH1 A;  2FGY A;  3B0U X;  4NTF A;  2O9X A;  4QDL A;  1U6H A;  1YAR O;  4O7G A;  1FNT c;  3JT1 A;  3G4X A;  4IAQ A;  4CX9 A;  1RJ9 B;  1PCX A;  1T01 A;  2X51 A;  3B0P A;  4OIN F;  1G8X A;  2LP4 A;  4QI2 A;  1PV3 A;  1J8Y F;  1MMD A;  2YL3 A;  1CPR A;  1VYI A;  3LS0 A;  4NTB A;  3CZ6 A;  4XWJ A;  1MND A;  4UDV A;  1ZHT A;  3QW1 A;  2OJE D;  3K6B A;  3HNK A;  1T6I A;  2PX3 A;  4N6H A;  1H9T A;  1ORJ A;  4JCH A;  3O55 A;  3EGX B;  3LUT B;  4XPW A;  4OIR F;  4XLN F;  2R7Q A;  3K1I C;  3OA1 A;  1NBB A;  4LDQ A;  4DRH B;  4YT4 A;  4KI2 A;  4JC7 A;  2VCB A;  3G4Z A;  3DWW A;  1D0Y A;  1XZQ A;  4R32 A;  5F5F A;  3FAJ A;  3Q7L A;  5JP7 A;  4I1O B;  4RBN A;  2HSB A;  3HJC A;  2P6V A;  2G3V A;  2VH3 A;  1K04 A;  4CSA A;  3R7C A;  3W2W A;  4U5B E;  1M56 C;  2A68 F;  1A7D A;  2J45 A;  4DVY P;  2ZXW C;  4GYT A;  2PF4 E;  2QUP A;  4A2N B;  1YYX A;  1H9G A;  1ZHZ A;  2OEV A;  2AP3 A;  1BBH A;  4WGZ A;  1VMA A;  2R9R B;  3KYI A;  4XPX A;  3LEV A;  2WZG A;  5GPG B;  1ZHY A;  2XL8 A;  3GWN A;  5A69 A;  2A6E F;  4XEK A;  1Q0K A;  4JZA A;  3V7O A;  2J46 A;  2Y3H A;  3DD7 A;  4BJ5 C;  1CGO A;  1A0B A;  1YZA A;  2PX0 A;  2VCC A;  2XL4 A;  3ZVR A;  3GOR A;  3POV A;  1CPQ A;  5COG A;  3SEO A;  5EGY A;  2KSF A;  3K1H A;  1Q0M A;  4O6Y A;  2CYD A;  3MX3 A;  5BQH A;  5JS5 A;  5KYW A;  2R7R A;  2A0U A;  1ZW3 A;  1DOW A;  2L9J A;  5FZT A;  2CDQ A;  2DB4 A;  3ABK C;  3VYW A;  4CS8 C;  1SMY F;  4J7Y A;  4P9T A;  1D0Z A;  4N06 A;  3B29 A;  3BRJ A;  2EIN C;  4OIO F;  3DJN B;  4C3E A;  5A6J A;  2YZS A;  3NRH A;  4C3B A;  4KNW A;  2YVK A;  1B68 A;  2L81 A;  3H2U A;  1LM3 B;  2B0H A;  2L7A A;  3GM2 A;  2YL7 A;  2NG1 A;  3DM5 A;  3GEE A;  3IQC A;  4G78 A;  4FAP B;  1LS4 A;  1LI5 A;  3GOD A;  2XXA A;  3L8J A;  4Z9I A;  5CI9 A;  2GFH A;  3ASO C;  3LES A;  3EJN A;  4Z9H A;  2R7O A;  4G0H A;  4BJ1 A;  4DRI B;  3IQ5 A;  2UUH A;  2KNH A;  2PP4 A;  1YZC A;  2UUI A;  1VLS A;  1MQV A;  4I1M A;  4CS9 C;  3NKE A;  3U3F A;  4BJT A;  4ZLD A;  1K05 A;  1WOL A;  2CNW A;  4PJN A;  3FVY A;  2OKU A;  1A7V A;  4CDV A;  3KH2 A;  5T3T A;  1QSP A;  3PCV A;  1D0X A;  4JKV A;  3FOO A;  4K0D A;  4OD5 A;  1NFN A;  2Q3T A;  3EZH A;  1GM5 A;  2ZPA A;  3DAF A;  3HTK C;  3U2L A;  2E87 A;  3FHD A;  1M2V B;  1VYK A;  2BE5 F;  3QMK A;  4JW1 A;  3T6J A;  1TFO B;  2C04 A;  2Y3D A;  3DE8 A;  3AG3 C;  2NUP B;  2I8B A;  3MLG A;  3NG1 A;  4IWB A;  3L0I A;  3RKO F;  2HMZ A;  3JRM O;  1JOG A;  1U89 A;  4PJM A;  1BDJ B;  1UG7 A;  3QZC A;  3JSE O;  3M4B A;  3GWL A;  3TUL A;  3VF0 A;  1FMW A;  2DI3 A;  2AVK A;  3NYJ A;  5T1D B;  1JR8 A;  2FFH A;  4EBJ A;  2LSE A;  5AGF A;  5EHH A;  1Z3I X;  3Q7G A;  1VLT A;  4CIP A;  3O10 A;  2WZL A;  3HNJ A;  4CBE A;  1MMN A;  5A6B A;  2JPU A;  1WAT A;  1RCP A;  4OD4 A;  5KYX A;  2AWY A;  3SP1 A;  3DE9 A;  2DYR C;  2Q7R A;  3VAY A;  3AQB A;  3ZIB A;  3S90 A;  5DS6 A;  2J9U A;  2J9W A;  1CGN A;  5KYU A;  4G7H F;  2A69 F;  2IOQ A;  4IB4 A;  3LS1 A;  3UMI A;  1R4T A;  1QVX A;  2I15 A;  3DXJ F;  3MBG A;  3HNI A;  3IQ6 A;  2YKZ A;  1V4A A;  1RMV A;  4YK5 A;  2ETS A;  1YDI A;  1ORY A;  4KC9 A;  5F28 E;  3S27 A;  1TQG A;  1TFK B;  3U9J A;  4J32 B;  1JPJ A;  4W8K A;  2YEV A;  5K0I A;  2FAP B;  3JTL O;  5TJ5 E;  3O6X A;  3V5X A;  1OKK D;  1QZX A;  2KYH A;  1HMD A;  3MYF A;  4DRJ B;  3L8I A;  5HV9 A;  5L0H A;  3LNM B;  3SXZ A;  5D92 A;  2NUT B;  1ZYR F;  2HSQ A;  4YN0 B;  3RVZ A;  3LNR A;  5L0I A;  3KL4 A;  2H7V C;  4ANJ A;  2LFF A;  1E2X A;  3K7D A;  1NFO A;  3EPV A;  1IZM A;  3EFO B;  1E86 A;  3QTH A;  4RDA A;  1VOM A;  2OQM A;  3EGD A;  4JE9 A;  4G7O F;  1FR0 A;  1Z63 A;  3GAN A;  2R03 A;  1Q0G A;  3G50 A;  3QVZ A;  5DLJ A;  4DJ9 A;  5DQZ A;  4X0R A;  2J7P D;  3NMI A;  2YWA A;  4JRZ A;  4YJW A;  3EZI A;  3EG9 B;  4Q4Z F;  2R7W A;  2R02 A;  2IXN A;  3NYM A;  3AG4 C;  4MVO A;  3U9M A;  1HE9 A;  4A4A A;  1RJ9 A;  4BEJ A;  4PR9 A;  2Y3B A;  3M15 A;  4XTK A;  4H54 A;  3TJ6 A;  2CW0 F;  1LIH A;  2V26 A;  2R7T A;  1HW1 A;  3RQF A;  3RW0 A;  1WGW A;  3S0X A;  3K1I A;  5F5H A;  2Z15 A;  3JYY A;  3L1M A;  4AE4 B;  4JCZ A;  3S9O A;  3C18 A;  2L6H A;  3C62 A;  5JVE A;  3HNL A;  1G4W R;  1LE2 A;  3DZA A;  4XQ1 A;  4EHP A;  3NDB B;  3E9V A;  3EGX A;  2Q9C A;  4L6R A;  4MW3 A;  4O6M A;  5L3Q A;  1C17 M;  1E85 A;  3Q6N A;  3A9C A;  2OU6 A;  4OIP F;  5E2Q A;  2YLG A;  4E7S A;  4LAC B;  1JRA A;  2P1A A;  3OEO A;  3RYL A;  3MFN A;  3U2M A;  3T6G B;  4CDA A;  3ZQY A;  2CGE A;  1YLM A;  4DVZ A;  2H7B A;  1APC A;  1DOV A;  3KKB A;  4K7B A;  5KYN A;  1AUE A;  4ULV A;  3W4Y A;  4B6I A;  1RKE B;  4MVR A;  3QVY A;  4MTO A;  2WVO A;  1ST6 A;  3ZDL A;  2WZF A;  1GS9 A;  2ZXR A;  2XLE A;  2MYS A;  2EPL X;  3IHU A;  3ZTZ A;  2M64 A;  4BJ5 A;  4JTC B;  1QQ3 A;  1C02 A;  4CJG A;  2HV7 A;  2YL1 A;  5JSL A;  3N2Z B;  1ORS C;  1TWC A;  3N24 A;  3EHM A;  2EPM X;  2KGO A;  2RSE B;  4BJ6 C;  1FFT C;  3FOP A;  4LLE A;  3C8G D;  4MVZ A;  3FDQ A;  4N4W A;  3BEH A;  2R05 A;  4CS8 A;  3DKA A;  2XS1 A;  4QI0 A;  1SR2 A;  2IYL D;  5KYY B;  4IGG A;  5E3A A;  3ZG1 A;  2G3K A;  2JD3 A;  4DOZ A;  4U5G A;  4LDR A;  3CEX A;  2D5R B;  1W2W A;  3TJ5 A;  1SYQ A;  4OIQ F;  3WG7 C;  1I4Z A;  2EPO A;  1OW6 A;  2NPU A;  256B A;  4M63 A;  1OCZ C;  3T4R A;  2KQ9 A;  1O5H A;  3TOL A;  1BZ4 A;  4E0H A;  4BPM A;  1VK5 A;  2M4E A;  4HEA J;  2W45 A;  4JTD B;  5JLI A;  4PK4 A;  3E70 C;  4YWQ A;  1EQ1 A;  5HSW A;  2LD6 A;  3AJM A;  1D1B A;  1O87 A;  4CDY A;  3B71 A;  1OR3 A;  2A0B A;  5DVW A;  3U8V A;  4CS9 A;  4DBR A;  2Y39 A;  1LKX A;  4EUK B;  4YT2 A;  1D1C A;  4PJL A;  1OXK A;  1PD0 A;  5JT4 A;  2HV6 A;  3FXH A;  4E18 A;  3UGO A;  5EK0 A;  4JTA B;  1T6U A;  2YRF A;  3LLK A;  4MVS A; 
#chains in the Genus database with same CATH homology
 3ZQV A;  1NBB A;  1EKY A;  2J9B A;  1YYJ A;  5JP7 A;  2XLM A;  2XL6 A;  4EIY A;  2J8W A;  4WGY A;  1E86 A;  1S05 A;  1E83 A;  1YYX A;  3C63 A;  4JE9 A;  1M6T A;  1BBH A;  4WGZ A;  3QVZ A;  3QW0 A;  3NMI A;  2XL8 A;  2XLD A;  2YLD A;  4JEB A;  4JEA A;  1CGO A;  1YZA A;  1CPQ A;  3M15 A;  2QLA A;  5JS5 A;  2XLH A;  3L1M A;  2CCY A;  3C62 A;  5JVE A;  2YL0 A;  3HNL A;  3NMK A;  1GQA A;  4L6R A;  1E85 A;  3TOM A;  3NMJ A;  4U9E A;  1LM3 B;  2YLG A;  5JUA A;  2YL7 A;  2YLI A;  1QPU A;  4CDA A;  3ZQY A;  5JRA A;  4CJO A;  1APC A;  4ULV A;  2BC5 A;  3QVY A;  3IQ5 A;  3ZWI A;  1YZC A;  1MQV A;  2XLE A;  4D4X A;  3ZTZ A;  2XM0 A;  1QQ3 A;  4CJG A;  5B3I A;  1A7V A;  2YL1 A;  4CDV A;  5JSL A;  4JKV A;  3FOO A;  3ZTM A;  4ER9 A;  1JAF A;  3FOP A;  1E84 A;  2XLW A;  4N4W A;  3DE8 A;  4U9D A;  4NC3 A;  2XM4 A;  4D4N A;  2XLO A;  3M4B A;  4IAR A;  3M4C A;  256B A;  2XLV A;  3TOL A;  5AGF A;  5JLI A;  3M79 A;  4CIP A;  3HNJ A;  3VRC A;  1RCP A;  4CDY A;  4IAQ A;  4CX9 A;  3DE9 A;  3U8P A;  1CGN A;  2YL3 A;  5JT4 A;  1CPR A;  4IB4 A;  3QW1 A;  3HNK A;  3HNI A;  3IQ6 A;  2YKZ A;  4N6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...