4U9DA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, ab3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9dA00
3L1MA 2J9BA 4CDYA 1YYJA 1YYXA 3M4BA 2BC5A 1E86A 5B3IA 2YKZA 1QPUA 3C62A 1E84A 3HNLA 2YL0A 3IQ6A 4CX9A 3HNKA 3VRCA 2XLWA 5JS5A 5JP7A 4CJGA 4CIPA 2YL1A 1CGNA 1YZAA 3QW0A 5JVEA 4D4XA 1A7VA 2YLDA 3NMIA 4EIYA 3DE8A 1E83A 3ZTZA 5JT4A 3C63A 3M15A 3HNIA 3QVYA 3NMJA 2XLMA 1CPQA 1GQAA 2J8WA 3FOPA 3QW1A 4U9EA 1S05A 3QVZA 256BA 3ZQYA 1JAFA 2YL7A 1EKYA 2YLIA 1APCA 3TOLA 3U8PA 2XLDA 3TOMA 2CCYA 2XLVA 3M79A 4JE9A 1M6TA 3ZTMA 4JEAA 4CDAA 2XM4A 1CPRA 5JUAA 2XL8A 2XLEA 3DE9A 1CGOA 2YL3A 4NC3A 1RCPA 4CJOA 1NBBA 4ULVA 3ZQVA 1YZCA 4L6RA 5JSLA 3IQ5A 2XM0A 4JKVA 4IB4A 4JEBA 1QQ3A 5JLIA 2XLHA 1BBHA 4N4WA 4IARA 3M4CA 4U9DA 4WGYA 5JRAA 1E85A 3NMKA 4IAQA 4N6HA 3HNJA 4WGZA 5AGFA 4CDVA 4D4NA 1LM3B 1MQVA 4ER9A 2QLAA 2XL6A 2XLOA 3FOOA 2YLGA 3ZWIA
chains in the Genus database with same CATH superfamily
3US6A 4IJJA 1OR2A 4MVSA 2LFDA 5L3VA 2Q7RA 1T5OA 1NFNA 1NSGB 1D1BA 4BG0A 2W4MA 4NQFA 4Z9IA 3LEVA 2WVOA 3IPMO 4P9FA 1NU9C 1E86A 3K33A 3EHMA 4PJNA 1OCOC 2YKZA 4LACB 3MYIA 4NTBA 5A6JA 3C62A 1M57C 1TWAA 1Z3IX 4MTOA 3T6GB 5EGYA 2L9JA 4MVQA 3I5QA 4BJ1A 3JRTA 4YN0B 3T6JA 3HNLA 1FTSA 5KYUA 4JJFA 3IQ6A 4CX9A 2UUHA 4C3DA 2P1AA 1T9KA 4U5EE 3AG3C 4CJGA 4CIPA 2GA0A 1ZHTA 2R7XA 1H9GA 3EGDA 4JJGA 1R5ID 4E18A 1A7EA 2BE5F 1RKEB 4NCQA 2Q4FA 1YA9A 4CSAC 1QVXA 2ETSA 4MVZA 4QI0A 5D92A 1G4WR 4WABA 4DOZA 3S29A 3KPHA 3HJCA 3JT1A 2HV6A 2R7RA 2XXAA 3MFNA 3K66A 4I44A 1M2VB 2KQ9A 4CSAA 2NPUA 4JCZA 4JTDB 3KMIA 1PCXA 3HNIA 3DJNB 2KW3C 2OKUA 2HKVA 4E0HA 4EKWA 3C8GD 2HSBA 2Y39A 1OW8A 4KI2A 3DJUB 1OXBA 4U9EA 4JCHA 3QTHA 2DGJA 3KKBA 2L6GA 4J7YA 3T4RA 1E2XA 3ZQYA 3O39A 1FMWA 2W9YA 1FFTC 3PCVA 4Q4ZF 3Q6MA 3JRMO 3V5YA 4U5HA 1SMYF 1JAFA 3U8PA 1T6IA 3LESA 3U9JA 2XLDA 4BPMA 3EPVA 1M2OA 2Y3DA 2YHSA 3M79A 2AVKA 4P9TA 5E3AA 5A6AA 3DAGA 3C18A 2R9RB 4RD9A 1RKEA 2QNLA 3ZTMA 3NRHA 4JEAA 1VYIA 4OIOF 4MNDA 5KYNA 4O79A 1HW2A 4DRHB 3RVYA 4C3BA 4YWQA 3DKAA 2DYSC 2Y3GA 3K6BA 1TWGA 1ZW2A 1O3UA 2IBFA 3JZ0A 1PD1A 3GWLA 4O7GA 3RQGA 3LAYA 4DVZA 3S90A 3A11A 3DM5A 1LE4A 3TK0A 3EFOB 5DS6A 2XRHA 3H2UA 4H4KC 2Y69C 3C8GB 4LERA 5JSLA 2Z15A 2OU6A 2Q00A 4HEAJ 3FVYA 4CS8A 5GPGB 2WZGA 5L0GA 2FAPB 2YVKA 3GEIA 1OW6A 2QTVA 4K0DA 3CAXA 1BR4A 2A1DD 3RF3A 3J06A 2R7OA 1VTMP 2HJMA 5DQTA 4O6NA 4B6IA 2YQYA 4A4AA 2XLHA 5L0CA 3X2QC 2PF4E 4G7ZF 3AGUA 1YAUO 3M4CA 4WGYA 2R03A 5A69A 1E85A 4AE4B 1HY5A 2AP3A 2P0NA 2WL8A 3MBGA 3NMKA 1EQ1A 4YT2A 1DOWA 1LS1A 4OIPF 1IW7F 3WAQA 4E17A 3W8IA 1LM3B 1U89A 3DWWA 4KNVA 2M4EA 3RW0A 4Q5SF 4MQ9F 2GDCA 3W2WA 2KSFA 1TWCA 2A6EF 3JSEO 1VYKA 3NYLA 2EPKX 1NG1A 1NZEA 4MW8A 3ZG1A 2J9VA 4XEVA 2Q3TA 2JD3A 5CI8A 5BUOA 3SP1A 2WVNA 2LIGA 4ULWA 4G7OF 4OIRF 2IOQA 1TR2A 2FGYA 5HV9A 4HFKB 2R7SA 1YYJA 2CYDA 4J30B 3C8GA 5COFA 4BEJA 2R7VA 3M4BA 2LK4A 3GANA 4YT4A 3EHNA 3F47A 2BC5A 3DD7A 1O5HA 3LUTB 4IAOA 1BDJB 5F28E 3ABLC 2F22A 2L6FA 1QPUA 3BRJA 4GEHA 2CNWA 5EK0A 5KYUB 4JTAB 1OXKA 5AC5A 2PX3A 1H7IA 2CW0F 3F46A 5TJ5E 5A6KA 4CBEA 4BJ5C 3EH1A 3VAYA 3UMKA 1GS9A 3L34A 3ZDLA 1HW1A 1K05A 2OJED 2XLWA 3C8ZA 5JS5A 3HTKC 5JP7A 3SXKA 3RFYA 2YL1A 3NKDA 1ORJA 2NSGA 3O55A 3FAJA 2EIMC 3JYHA 3K7DA 2HZ8A 5BQHA 2RSEB 2XXAB 4NTFA 2OCCC 5AC4A 2AWYA 2BL2A 1ZHWA 2GWWA 2YLDA 3OWTA 4PFPA 1VMAA 4O6YA 1ZHYA 2B0JA 1Q0DA 3DZAA 3N0TA 2D5RB 4EWCA 1E83A 1K40A 3LNMB 4G0HA 3G50A 2R7TA 1D1AA 3M1CB 3L8IA 2ZXWC 3K1HA 1M56C 2ICWG 4LDRA 3ZSUA 2A68F 4DJ9A 2ZXOA 3U0CA 2V26A 2R7QA 3U2LA 1KTMA 4OIQF 2XLMA 5DQZA 1RJ9A 5B3SC 4MW3A 3SXYA 3ECSA 3GM2A 4DVYP 3QW1A 4OINF 4MS2A 2ZXPA 3S84A 2V3CC 2CGEA 3ZC4A 1MMAA 1APCA 2WB7A 3MLGA 4O6MA 1SR2A 3LNRA 3L8JA 4G7HF 1Z23A 3VM6A 2HMQA 1M6TA 4XQ1A 1VLTA 3W4YA 4DXWA 2XM4A 2YWAA 1SYQA 1HMDA 2LP4A 4E7SA 4YT5A 4PJJA 2A6HF 4FAPB 2XS8A 1FMVA 4I1OB 2YEVA 1NU7D 2M64A 4NC3A 1RCPA 2VASA 3NG1A 3RVZA 2HUJA 2HJ3A 4CS9A 1NBBA 3LS1A 3NKEA 4ULVA 3RQEA 3HKKA 1G4US 4L6RA 1QZXA 1A7DA 1UG7A 1JOGA 1YJGA 2KC3A 2W4BA 2IYLD 2XM0A 3IQCA 4KBLA 3CSKA 4W8PA 3ABKC 4GYTA 2HMZA 1O87A 3RIPA 2QUPA 1PD0A 1KU2A 2DB4A 3AOUA 3GEEA 3B0UX 2XSEA 1S7ZA 1XWJA 1NLXA 1I4YA 2CNWD 2IXOA 1QQ3A 2VCCA 3N24A 4MVUA 3X1OA 2OG2A 1LPEA 2EIJC 3EZIA 4IARA 4LLCA 4U9DA 4ZLDA 4BEMJ 2PX0A 1XZPA 4NTAA 4W8KA 3AQCA 1W2WA 1ZU5A 1HE1A 4R32A 4YL3A 5T3TA 1LE2A 2L6HA 3ASNC 4CDVA 2HS5A 1A0BA 4CS8C 4MTFA 1MQVA 5KYYB 4ER9A 2LQGA 2QLAA 2XL6A 1GGQA 2XLOA 3Q6NA 5HSWA 3DMDA 3SZRA 3FOOA 3GORA 1YVIA 5L0IA 3FAPB 2TMVP 3SEOA 2G3KA 3FMSA 1BR1A 3DAFA 3MYFA 1YLMA 3DXJF 3AG2C 3JYYA 3LJBA 1QLEC 3C7JA 3O10A 4H54A 5D91A 5EHHA 3AJMA 3FXHA 2MYSA 3LS0A 3NYMA 4MVMA 5DS4A 2H8AA 1BZ4A 1C03A 2NUPB 1Q0GA 1EA8A 3WG7C 3GM3A 2EIKC 4ONSA 4ANJA 5IY5C 2NUTA 5F5HA 3B0VC 1U6HA 1HE9A 2FFHA 2H7VC 4JC7A 4YL0A 4Z9HA 3NYJA 3RH3A 3SXZA 5E2QA 5KYXB 4WJ0A 4JZAA 1VB5A 1RMVA 3CQZA 1YDIA 4BJ5A 2O9XA 3EGXB 2NSFA 4NY3A 2MWQA 4KNWA 1Z63A 2PP4A 2VB6A 2KGOA 2YL0A 1ORSC 2WVQA 3VRCA 4J32B 1I4ZA 3OA1A 4YL1A 3UMHA 3W2VA 3JCUQ 4BJ6A 4C3EA 2UUIA 5KYYA 4GQHA 1D0XA 5A6BD 1WATA 3CZ6A 4XEKA 2QE9A 4EBBA 4E7ZA 5FCLA 1U0BB 1YZAA 4HE8D 2VC9A 4Q7CA 5L0JA 3QW0A 4AK9A 5JVEA 4QI2A 4EBJA 4D4XA 3LLKA 3KH2A 1CGME 4K7BA 2J46A 4E0IA 1SF8A 3UR3C 2Y3HA 1QKRA 3NMIA 2ZXRA 2NUPA 1H6GA 1LIHA 3ZTZA 2Q9BA 2A0UA 4N6CA 2PBEA 5CI9A 1RJ9B 3EH2A 2X0CA 5KYXA 2DI3A 2C03A 4KC9A 1TFOB 2E87A 3NMJA 4DBQA 5KYWB 3NDBB 3CEXA 1WGWA 3E70C 5E33A 1WTYA 3MX3A 4LDKA 1HMOA 3EGXA 1S05A 4PFOA 3QVZA 4FX5A 2OEXA 1MMDA 2WZFA 2MHRA 3H65A 4FWVA 1PV3A 4K1OA 5B1AC 3S27A 3U9MA 4JRZA 1AVOB 1H9TA 4C7OA 2YL7A 3V5XA 1TQGA 3TOLA 3S28A 2L81A 4HFFB 3TOMA 2CCYA 1SZIA 2LD6A 2G62A 1FNTc 3BEHA 4PJLA 2YZSA 3U8VA 2LCHA 4IRUA 4JE9A 4QDLA 4U5CE 1Q0FA 1FR0A 3SXMA 1V74B 4CDAA 3K1IC 2ASRA 2HFIA 3B9QA 1T6UA 1ZHZA 2I8BA 4YK5A 2JPUA 4XLPF 3O6XA 2OEVA 2PNOA 3DE9A 4RDAA 2YL3A 3TULA 2EILC 1MNDA 1ST6A 3TD7A 2LFFA 3N2ZB 1YARO 3B0PA 3AG4C 3K1IA 4PACA 2PFDA 3TJ6A 3ZQVA 1OKKD 3ZVRA 1JMWA 3DI5A 2J0WA 2AU5A 3TJ5A 2EPLX 2VH3A 2D4UA 3U2MA 2LSEA 1V54C 2VCBA 3AG1C 2KK1A 3L0IA 3UNGC 5KYWA 4J7TA 1AUEA 1T6QA 2H7BA 2B0HA 3UGOA 1ZW3A 4MTGA 3SNHA 5L0DA 3LEOA 4EUKB 3PDMP 1UFBA 5BQGA 3R7CA 4CIHA 5A6BA 4U5FE 4CS9C 1VLSA 1D0ZA 3JTLO 4XPYA 3GEHA 4DRIB 3RYLA 3QZCA 3HNJA 1RKCA 4I1MA 4WGZA 4AX2A 4D4NA 4OD5A 5F5FA 3JSZA 5COMA 2G3VA 1FFHA 2KYHA 3IQTA 1TWHA 3GWNA 4ZLCA 5L0FA 3EZHA 1OQCA 3EG9A 4IWBA 2IXMA 1WN0A 1XZQA 2P6VA 5T3WA 2KNHA 3IEEA 3IHUA 2NG1A 2KJGA 1ZZPA 4N06A 1KNYA 3ZWIA 5CIVA 3UGPA 4JIOA 5T1DB 3L1MA 2J9BA 1WOLA 2EPOA 2NUTB 2VCAA 1Z5ZA 1JPNA 3KYIA 2XS1A 4XPXA 4EBKA 2R7WA 1JR8A 4CDYA 1C17M 1YYXA 4IGGA 2IXNA 3RQFA 3G4XA 2ZD9A 3S9OA 4PK4A 4F4BA 5B3IA 1WASA 2QY9A 4DBRA 3GM1A 1MNEA 3FDQA 3KYJA 1OCZC 1I5NA 3AQBA 3LLIA 1AEPA 3U3FA 1E84A 1K04A 1Q0KA 4JURI 4X0RA 5DVWA 3S0XA 4A2NB 3HNKA 3H2VA 1JPJA 1NFOA 3ITFA 3R2PA 1Y6DA 5COGA 1G8XA 3Q7LA 4AL1A 2J0XA 4EHPA 3T6BA 4U5DE 2HSQA 3GODA 1DOVA 1CGNA 1B68A 2EPMX 1OW7A 3TQOA 3PHF2 3ABMC 2EINC 1VK5A 1WWPA 1TFKB 4P6IC 4JVSA 2J7PD 1F1MA 1D1CA 2Q9CA 3OEOA 1A7VA 1OKKA 3EQLF 4RBNA 5E3CA 2X51A 3UMIA 2J9UA 1GM5A 2XL4A 2HV7A 2P7VA 1FAPB 1V55C 4EIYA 2YRFA 1TKNA 3DE8A 4JW1A 4YJWA 1MMGA 2W45A 4U5BE 5DLJA 2Y3BA 4BJ6C 4LDQA 5JT4A 3C63A 5K0IA 3M15A 3WODF 5L0HA 1LI7A 1R4TA 4DRJB 1OCRC 1M2VA 3QVYA 4XPWA 3V5ZA 3FHDA 3WHNA 4C7OB 1CPQA 1Z6AA 5BQIA 1GQAA 2RD9A 3SYNA 2J8WA 2EPNA 3FOPA 5DS5A 2OJQA 1LKXA 256BA 3Q7GA 4AL0A 3G4ZA 5L3QA 4G78A 1J8YF 2C04A 2IM8A 2A69F 1OCCC 4OD4A 1C02A 2CDQA 2R25A 2YLIA 2R7UA 1EKYA 3PMRA 5FZTA 3QMKA 1L3PA 3T9OA 2I15A 1V4AA 2XLVA 2J9WA 1ORYA 1ZHXA 4MVOA 3HLZA 3DM9B 1LI5A 1YA7O 2P61A 1Y4CA 3I4UA 1EI7A 4XTKA 3A9CA 1G5ZA 4YT8A 1CPRA 2R05A 4I3MA 2JX0A 2OOCA 3E9VA 2Q9AA 1T01A 4BJTA 5JUAA 1LS4A 2XL8A 2XLEA 3I5PA 4LLEA 1QSPA 1CGOA 4Z9JA 1IZMA 4CS7A 4CJOA 1J8MF 1LVKA 2AWCA 1ZYRF 1YZCA 4PJMA 3IQ5A 3EJNA 3U3BA 3RKOF 3W8HA 4JKVA 3VF0A 1RXQA 4IB4A 4MVRA 4M63A 3VYWA 1D0YA 3EFOA 2J45A 2WZLA 1Q0MA 3V7OA 2OQMA 3ZIBA 3POVA 2L7AA 4JEBA 3ATPA 4UDVA 1Z7Qc 4PR9A 5JLIA 1BBHA 4N4WA 2GFHA 2A0BA 2GAQA 4JTCB 1A41A 1ZVZA 5JRAA 3KL4A 4FESA 1N1CA 4IAQA 4N6HA 2H7OA 2R02A 1L7CA 3B71A 3EG9B 1JRAA 1MMNA 2J7PA 3B29A 5AGFA 1BR2A 1OR3A 3AGTA 4XLNF 4AE4A 3EGDB 4U5GA 2ZPAA 5B1BC 4XEFA 4XWJA 2IXPA 3ASOC 1ZU4A 2DYRC 2YLGA 3U5SA 1VOMA
chains in the Genus database with same CATH topology
3L1MA 2J9BA 4CDYA 1YYJA 1YYXA 3M4BA 2BC5A 1E86A 5B3IA 2YKZA 1QPUA 3C62A 1E84A 3HNLA 2YL0A 3IQ6A 4CX9A 3HNKA 3VRCA 2XLWA 5JS5A 5JP7A 4CJGA 4CIPA 2YL1A 1CGNA 1YZAA 3QW0A 5JVEA 4D4XA 1A7VA 2YLDA 3NMIA 4EIYA 3DE8A 1E83A 3ZTZA 5JT4A 3C63A 3M15A 3HNIA 3QVYA 3NMJA 2XLMA 1CPQA 1GQAA 2J8WA 3FOPA 3QW1A 4U9EA 1S05A 3QVZA 256BA 3ZQYA 1JAFA 2YL7A 1EKYA 2YLIA 1APCA 3TOLA 3U8PA 2XLDA 3TOMA 2CCYA 2XLVA 3M79A 4JE9A 1M6TA 3ZTMA 4JEAA 4CDAA 2XM4A 1CPRA 5JUAA 2XL8A 2XLEA 3DE9A 1CGOA 2YL3A 4NC3A 1RCPA 4CJOA 1NBBA 4ULVA 3ZQVA 1YZCA 4L6RA 5JSLA 3IQ5A 2XM0A 4JKVA 4IB4A 4JEBA 1QQ3A 5JLIA 2XLHA 1BBHA 4N4WA 4IARA 3M4CA 4U9DA 4WGYA 5JRAA 1E85A 3NMKA 4IAQA 4N6HA 3HNJA 4WGZA 5AGFA 4CDVA 4D4NA 1LM3B 1MQVA 4ER9A 2QLAA 2XL6A 2XLOA 3FOOA 2YLGA 3ZWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1M A;  2J9B A;  4CDY A;  1YYJ A;  1YYX A;  3M4B A;  2BC5 A;  1E86 A;  5B3I A;  2YKZ A;  1QPU A;  3C62 A;  1E84 A;  3HNL A;  2YL0 A;  3IQ6 A;  4CX9 A;  3HNK A;  3VRC A;  2XLW A;  5JS5 A;  5JP7 A;  4CJG A;  4CIP A;  2YL1 A;  1CGN A;  1YZA A;  3QW0 A;  5JVE A;  4D4X A;  1A7V A;  2YLD A;  3NMI A;  4EIY A;  3DE8 A;  1E83 A;  3ZTZ A;  5JT4 A;  3C63 A;  3M15 A;  3HNI A;  3QVY A;  3NMJ A;  2XLM A;  1CPQ A;  1GQA A;  2J8W A;  3FOP A;  3QW1 A;  4U9E A;  1S05 A;  3QVZ A;  256B A;  3ZQY A;  1JAF A;  2YL7 A;  1EKY A;  2YLI A;  1APC A;  3TOL A;  3U8P A;  2XLD A;  3TOM A;  2CCY A;  2XLV A;  3M79 A;  4JE9 A;  1M6T A;  3ZTM A;  4JEA A;  4CDA A;  2XM4 A;  1CPR A;  5JUA A;  2XL8 A;  2XLE A;  3DE9 A;  1CGO A;  2YL3 A;  4NC3 A;  1RCP A;  4CJO A;  1NBB A;  4ULV A;  3ZQV A;  1YZC A;  4L6R A;  5JSL A;  3IQ5 A;  2XM0 A;  4JKV A;  4IB4 A;  4JEB A;  1QQ3 A;  5JLI A;  2XLH A;  1BBH A;  4N4W A;  4IAR A;  3M4C A;  4U9D A;  4WGY A;  5JRA A;  1E85 A;  3NMK A;  4IAQ A;  4N6H A;  3HNJ A;  4WGZ A;  5AGF A;  4CDV A;  4D4N A;  1LM3 B;  1MQV A;  4ER9 A;  2QLA A;  2XL6 A;  2XLO A;  3FOO A;  2YLG A;  3ZWI A; 
#chains in the Genus database with same CATH topology
 3US6 A;  4IJJ A;  1OR2 A;  4MVS A;  2LFD A;  5L3V A;  2Q7R A;  1T5O A;  1NFN A;  1NSG B;  1D1B A;  4BG0 A;  2W4M A;  4NQF A;  4Z9I A;  3LEV A;  2WVO A;  3IPM O;  4P9F A;  1NU9 C;  1E86 A;  3K33 A;  3EHM A;  4PJN A;  1OCO C;  2YKZ A;  4LAC B;  3MYI A;  4NTB A;  5A6J A;  3C62 A;  1M57 C;  1TWA A;  1Z3I X;  4MTO A;  3T6G B;  5EGY A;  2L9J A;  4MVQ A;  3I5Q A;  4BJ1 A;  3JRT A;  4YN0 B;  3T6J A;  3HNL A;  1FTS A;  5KYU A;  4JJF A;  3IQ6 A;  4CX9 A;  2UUH A;  4C3D A;  2P1A A;  1T9K A;  4U5E E;  3AG3 C;  4CJG A;  4CIP A;  2GA0 A;  1ZHT A;  2R7X A;  1H9G A;  3EGD A;  4JJG A;  1R5I D;  4E18 A;  1A7E A;  2BE5 F;  1RKE B;  4NCQ A;  2Q4F A;  1YA9 A;  4CSA C;  1QVX A;  2ETS A;  4MVZ A;  4QI0 A;  5D92 A;  1G4W R;  4WAB A;  4DOZ A;  3S29 A;  3KPH A;  3HJC A;  3JT1 A;  2HV6 A;  2R7R A;  2XXA A;  3MFN A;  3K66 A;  4I44 A;  1M2V B;  2KQ9 A;  4CSA A;  2NPU A;  4JCZ A;  4JTD B;  3KMI A;  1PCX A;  3HNI A;  3DJN B;  2KW3 C;  2OKU A;  2HKV A;  4E0H A;  4EKW A;  3C8G D;  2HSB A;  2Y39 A;  1OW8 A;  4KI2 A;  3DJU B;  1OXB A;  4U9E A;  4JCH A;  3QTH A;  2DGJ A;  3KKB A;  2L6G A;  4J7Y A;  3T4R A;  1E2X A;  3ZQY A;  3O39 A;  1FMW A;  2W9Y A;  1FFT C;  3PCV A;  4Q4Z F;  3Q6M A;  3JRM O;  3V5Y A;  4U5H A;  1SMY F;  1JAF A;  3U8P A;  1T6I A;  3LES A;  3U9J A;  2XLD A;  4BPM A;  3EPV A;  1M2O A;  2Y3D A;  2YHS A;  3M79 A;  2AVK A;  4P9T A;  5E3A A;  5A6A A;  3DAG A;  3C18 A;  2R9R B;  4RD9 A;  1RKE A;  2QNL A;  3ZTM A;  3NRH A;  4JEA A;  1VYI A;  4OIO F;  4MND A;  5KYN A;  4O79 A;  1HW2 A;  4DRH B;  3RVY A;  4C3B A;  4YWQ A;  3DKA A;  2DYS C;  2Y3G A;  3K6B A;  1TWG A;  1ZW2 A;  1O3U A;  2IBF A;  3JZ0 A;  1PD1 A;  3GWL A;  4O7G A;  3RQG A;  3LAY A;  4DVZ A;  3S90 A;  3A11 A;  3DM5 A;  1LE4 A;  3TK0 A;  3EFO B;  5DS6 A;  2XRH A;  3H2U A;  4H4K C;  2Y69 C;  3C8G B;  4LER A;  5JSL A;  2Z15 A;  2OU6 A;  2Q00 A;  4HEA J;  3FVY A;  4CS8 A;  5GPG B;  2WZG A;  5L0G A;  2FAP B;  2YVK A;  3GEI A;  1OW6 A;  2QTV A;  4K0D A;  3CAX A;  1BR4 A;  2A1D D;  3RF3 A;  3J06 A;  2R7O A;  1VTM P;  2HJM A;  5DQT A;  4O6N A;  4B6I A;  2YQY A;  4A4A A;  2XLH A;  5L0C A;  3X2Q C;  2PF4 E;  4G7Z F;  3AGU A;  1YAU O;  3M4C A;  4WGY A;  2R03 A;  5A69 A;  1E85 A;  4AE4 B;  1HY5 A;  2AP3 A;  2P0N A;  2WL8 A;  3MBG A;  3NMK A;  1EQ1 A;  4YT2 A;  1DOW A;  1LS1 A;  4OIP F;  1IW7 F;  3WAQ A;  4E17 A;  3W8I A;  1LM3 B;  1U89 A;  3DWW A;  4KNV A;  2M4E A;  3RW0 A;  4Q5S F;  4MQ9 F;  2GDC A;  3W2W A;  2KSF A;  1TWC A;  2A6E F;  3JSE O;  1VYK A;  3NYL A;  2EPK X;  1NG1 A;  1NZE A;  4MW8 A;  3ZG1 A;  2J9V A;  4XEV A;  2Q3T A;  2JD3 A;  5CI8 A;  5BUO A;  3SP1 A;  2WVN A;  2LIG A;  4ULW A;  4G7O F;  4OIR F;  2IOQ A;  1TR2 A;  2FGY A;  5HV9 A;  4HFK B;  2R7S A;  1YYJ A;  2CYD A;  4J30 B;  3C8G A;  5COF A;  4BEJ A;  2R7V A;  3M4B A;  2LK4 A;  3GAN A;  4YT4 A;  3EHN A;  3F47 A;  2BC5 A;  3DD7 A;  1O5H A;  3LUT B;  4IAO A;  1BDJ B;  5F28 E;  3ABL C;  2F22 A;  2L6F A;  1QPU A;  3BRJ A;  4GEH A;  2CNW A;  5EK0 A;  5KYU B;  4JTA B;  1OXK A;  5AC5 A;  2PX3 A;  1H7I A;  2CW0 F;  3F46 A;  5TJ5 E;  5A6K A;  4CBE A;  4BJ5 C;  3EH1 A;  3VAY A;  3UMK A;  1GS9 A;  3L34 A;  3ZDL A;  1HW1 A;  1K05 A;  2OJE D;  2XLW A;  3C8Z A;  5JS5 A;  3HTK C;  5JP7 A;  3SXK A;  3RFY A;  2YL1 A;  3NKD A;  1ORJ A;  2NSG A;  3O55 A;  3FAJ A;  2EIM C;  3JYH A;  3K7D A;  2HZ8 A;  5BQH A;  2RSE B;  2XXA B;  4NTF A;  2OCC C;  5AC4 A;  2AWY A;  2BL2 A;  1ZHW A;  2GWW A;  2YLD A;  3OWT A;  4PFP A;  1VMA A;  4O6Y A;  1ZHY A;  2B0J A;  1Q0D A;  3DZA A;  3N0T A;  2D5R B;  4EWC A;  1E83 A;  1K40 A;  3LNM B;  4G0H A;  3G50 A;  2R7T A;  1D1A A;  3M1C B;  3L8I A;  2ZXW C;  3K1H A;  1M56 C;  2ICW G;  4LDR A;  3ZSU A;  2A68 F;  4DJ9 A;  2ZXO A;  3U0C A;  2V26 A;  2R7Q A;  3U2L A;  1KTM A;  4OIQ F;  2XLM A;  5DQZ A;  1RJ9 A;  5B3S C;  4MW3 A;  3SXY A;  3ECS A;  3GM2 A;  4DVY P;  3QW1 A;  4OIN F;  4MS2 A;  2ZXP A;  3S84 A;  2V3C C;  2CGE A;  3ZC4 A;  1MMA A;  1APC A;  2WB7 A;  3MLG A;  4O6M A;  1SR2 A;  3LNR A;  3L8J A;  4G7H F;  1Z23 A;  3VM6 A;  2HMQ A;  1M6T A;  4XQ1 A;  1VLT A;  3W4Y A;  4DXW A;  2XM4 A;  2YWA A;  1SYQ A;  1HMD A;  2LP4 A;  4E7S A;  4YT5 A;  4PJJ A;  2A6H F;  4FAP B;  2XS8 A;  1FMV A;  4I1O B;  2YEV A;  1NU7 D;  2M64 A;  4NC3 A;  1RCP A;  2VAS A;  3NG1 A;  3RVZ A;  2HUJ A;  2HJ3 A;  4CS9 A;  1NBB A;  3LS1 A;  3NKE A;  4ULV A;  3RQE A;  3HKK A;  1G4U S;  4L6R A;  1QZX A;  1A7D A;  1UG7 A;  1JOG A;  1YJG A;  2KC3 A;  2W4B A;  2IYL D;  2XM0 A;  3IQC A;  4KBL A;  3CSK A;  4W8P A;  3ABK C;  4GYT A;  2HMZ A;  1O87 A;  3RIP A;  2QUP A;  1PD0 A;  1KU2 A;  2DB4 A;  3AOU A;  3GEE A;  3B0U X;  2XSE A;  1S7Z A;  1XWJ A;  1NLX A;  1I4Y A;  2CNW D;  2IXO A;  1QQ3 A;  2VCC A;  3N24 A;  4MVU A;  3X1O A;  2OG2 A;  1LPE A;  2EIJ C;  3EZI A;  4IAR A;  4LLC A;  4U9D A;  4ZLD A;  4BEM J;  2PX0 A;  1XZP A;  4NTA A;  4W8K A;  3AQC A;  1W2W A;  1ZU5 A;  1HE1 A;  4R32 A;  4YL3 A;  5T3T A;  1LE2 A;  2L6H A;  3ASN C;  4CDV A;  2HS5 A;  1A0B A;  4CS8 C;  4MTF A;  1MQV A;  5KYY B;  4ER9 A;  2LQG A;  2QLA A;  2XL6 A;  1GGQ A;  2XLO A;  3Q6N A;  5HSW A;  3DMD A;  3SZR A;  3FOO A;  3GOR A;  1YVI A;  5L0I A;  3FAP B;  2TMV P;  3SEO A;  2G3K A;  3FMS A;  1BR1 A;  3DAF A;  3MYF A;  1YLM A;  3DXJ F;  3AG2 C;  3JYY A;  3LJB A;  1QLE C;  3C7J A;  3O10 A;  4H54 A;  5D91 A;  5EHH A;  3AJM A;  3FXH A;  2MYS A;  3LS0 A;  3NYM A;  4MVM A;  5DS4 A;  2H8A A;  1BZ4 A;  1C03 A;  2NUP B;  1Q0G A;  1EA8 A;  3WG7 C;  3GM3 A;  2EIK C;  4ONS A;  4ANJ A;  5IY5 C;  2NUT A;  5F5H A;  3B0V C;  1U6H A;  1HE9 A;  2FFH A;  2H7V C;  4JC7 A;  4YL0 A;  4Z9H A;  3NYJ A;  3RH3 A;  3SXZ A;  5E2Q A;  5KYX B;  4WJ0 A;  4JZA A;  1VB5 A;  1RMV A;  3CQZ A;  1YDI A;  4BJ5 A;  2O9X A;  3EGX B;  2NSF A;  4NY3 A;  2MWQ A;  4KNW A;  1Z63 A;  2PP4 A;  2VB6 A;  2KGO A;  2YL0 A;  1ORS C;  2WVQ A;  3VRC A;  4J32 B;  1I4Z A;  3OA1 A;  4YL1 A;  3UMH A;  3W2V A;  3JCU Q;  4BJ6 A;  4C3E A;  2UUI A;  5KYY A;  4GQH A;  1D0X A;  5A6B D;  1WAT A;  3CZ6 A;  4XEK A;  2QE9 A;  4EBB A;  4E7Z A;  5FCL A;  1U0B B;  1YZA A;  4HE8 D;  2VC9 A;  4Q7C A;  5L0J A;  3QW0 A;  4AK9 A;  5JVE A;  4QI2 A;  4EBJ A;  4D4X A;  3LLK A;  3KH2 A;  1CGM E;  4K7B A;  2J46 A;  4E0I A;  1SF8 A;  3UR3 C;  2Y3H A;  1QKR A;  3NMI A;  2ZXR A;  2NUP A;  1H6G A;  1LIH A;  3ZTZ A;  2Q9B A;  2A0U A;  4N6C A;  2PBE A;  5CI9 A;  1RJ9 B;  3EH2 A;  2X0C A;  5KYX A;  2DI3 A;  2C03 A;  4KC9 A;  1TFO B;  2E87 A;  3NMJ A;  4DBQ A;  5KYW B;  3NDB B;  3CEX A;  1WGW A;  3E70 C;  5E33 A;  1WTY A;  3MX3 A;  4LDK A;  1HMO A;  3EGX A;  1S05 A;  4PFO A;  3QVZ A;  4FX5 A;  2OEX A;  1MMD A;  2WZF A;  2MHR A;  3H65 A;  4FWV A;  1PV3 A;  4K1O A;  5B1A C;  3S27 A;  3U9M A;  4JRZ A;  1AVO B;  1H9T A;  4C7O A;  2YL7 A;  3V5X A;  1TQG A;  3TOL A;  3S28 A;  2L81 A;  4HFF B;  3TOM A;  2CCY A;  1SZI A;  2LD6 A;  2G62 A;  1FNT c;  3BEH A;  4PJL A;  2YZS A;  3U8V A;  2LCH A;  4IRU A;  4JE9 A;  4QDL A;  4U5C E;  1Q0F A;  1FR0 A;  3SXM A;  1V74 B;  4CDA A;  3K1I C;  2ASR A;  2HFI A;  3B9Q A;  1T6U A;  1ZHZ A;  2I8B A;  4YK5 A;  2JPU A;  4XLP F;  3O6X A;  2OEV A;  2PNO A;  3DE9 A;  4RDA A;  2YL3 A;  3TUL A;  2EIL C;  1MND A;  1ST6 A;  3TD7 A;  2LFF A;  3N2Z B;  1YAR O;  3B0P A;  3AG4 C;  3K1I A;  4PAC A;  2PFD A;  3TJ6 A;  3ZQV A;  1OKK D;  3ZVR A;  1JMW A;  3DI5 A;  2J0W A;  2AU5 A;  3TJ5 A;  2EPL X;  2VH3 A;  2D4U A;  3U2M A;  2LSE A;  1V54 C;  2VCB A;  3AG1 C;  2KK1 A;  3L0I A;  3UNG C;  5KYW A;  4J7T A;  1AUE A;  1T6Q A;  2H7B A;  2B0H A;  3UGO A;  1ZW3 A;  4MTG A;  3SNH A;  5L0D A;  3LEO A;  4EUK B;  3PDM P;  1UFB A;  5BQG A;  3R7C A;  4CIH A;  5A6B A;  4U5F E;  4CS9 C;  1VLS A;  1D0Z A;  3JTL O;  4XPY A;  3GEH A;  4DRI B;  3RYL A;  3QZC A;  3HNJ A;  1RKC A;  4I1M A;  4WGZ A;  4AX2 A;  4D4N A;  4OD5 A;  5F5F A;  3JSZ A;  5COM A;  2G3V A;  1FFH A;  2KYH A;  3IQT A;  1TWH A;  3GWN A;  4ZLC A;  5L0F A;  3EZH A;  1OQC A;  3EG9 A;  4IWB A;  2IXM A;  1WN0 A;  1XZQ A;  2P6V A;  5T3W A;  2KNH A;  3IEE A;  3IHU A;  2NG1 A;  2KJG A;  1ZZP A;  4N06 A;  1KNY A;  3ZWI A;  5CIV A;  3UGP A;  4JIO A;  5T1D B;  3L1M A;  2J9B A;  1WOL A;  2EPO A;  2NUT B;  2VCA A;  1Z5Z A;  1JPN A;  3KYI A;  2XS1 A;  4XPX A;  4EBK A;  2R7W A;  1JR8 A;  4CDY A;  1C17 M;  1YYX A;  4IGG A;  2IXN A;  3RQF A;  3G4X A;  2ZD9 A;  3S9O A;  4PK4 A;  4F4B A;  5B3I A;  1WAS A;  2QY9 A;  4DBR A;  3GM1 A;  1MNE A;  3FDQ A;  3KYJ A;  1OCZ C;  1I5N A;  3AQB A;  3LLI A;  1AEP A;  3U3F A;  1E84 A;  1K04 A;  1Q0K A;  4JUR I;  4X0R A;  5DVW A;  3S0X A;  4A2N B;  3HNK A;  3H2V A;  1JPJ A;  1NFO A;  3ITF A;  3R2P A;  1Y6D A;  5COG A;  1G8X A;  3Q7L A;  4AL1 A;  2J0X A;  4EHP A;  3T6B A;  4U5D E;  2HSQ A;  3GOD A;  1DOV A;  1CGN A;  1B68 A;  2EPM X;  1OW7 A;  3TQO A;  3PHF 2;  3ABM C;  2EIN C;  1VK5 A;  1WWP A;  1TFK B;  4P6I C;  4JVS A;  2J7P D;  1F1M A;  1D1C A;  2Q9C A;  3OEO A;  1A7V A;  1OKK A;  3EQL F;  4RBN A;  5E3C A;  2X51 A;  3UMI A;  2J9U A;  1GM5 A;  2XL4 A;  2HV7 A;  2P7V A;  1FAP B;  1V55 C;  4EIY A;  2YRF A;  1TKN A;  3DE8 A;  4JW1 A;  4YJW A;  1MMG A;  2W45 A;  4U5B E;  5DLJ A;  2Y3B A;  4BJ6 C;  4LDQ A;  5JT4 A;  3C63 A;  5K0I A;  3M15 A;  3WOD F;  5L0H A;  1LI7 A;  1R4T A;  4DRJ B;  1OCR C;  1M2V A;  3QVY A;  4XPW A;  3V5Z A;  3FHD A;  3WHN A;  4C7O B;  1CPQ A;  1Z6A A;  5BQI A;  1GQA A;  2RD9 A;  3SYN A;  2J8W A;  2EPN A;  3FOP A;  5DS5 A;  2OJQ A;  1LKX A;  256B A;  3Q7G A;  4AL0 A;  3G4Z A;  5L3Q A;  4G78 A;  1J8Y F;  2C04 A;  2IM8 A;  2A69 F;  1OCC C;  4OD4 A;  1C02 A;  2CDQ A;  2R25 A;  2YLI A;  2R7U A;  1EKY A;  3PMR A;  5FZT A;  3QMK A;  1L3P A;  3T9O A;  2I15 A;  1V4A A;  2XLV A;  2J9W A;  1ORY A;  1ZHX A;  4MVO A;  3HLZ A;  3DM9 B;  1LI5 A;  1YA7 O;  2P61 A;  1Y4C A;  3I4U A;  1EI7 A;  4XTK A;  3A9C A;  1G5Z A;  4YT8 A;  1CPR A;  2R05 A;  4I3M A;  2JX0 A;  2OOC A;  3E9V A;  2Q9A A;  1T01 A;  4BJT A;  5JUA A;  1LS4 A;  2XL8 A;  2XLE A;  3I5P A;  4LLE A;  1QSP A;  1CGO A;  4Z9J A;  1IZM A;  4CS7 A;  4CJO A;  1J8M F;  1LVK A;  2AWC A;  1ZYR F;  1YZC A;  4PJM A;  3IQ5 A;  3EJN A;  3U3B A;  3RKO F;  3W8H A;  4JKV A;  3VF0 A;  1RXQ A;  4IB4 A;  4MVR A;  4M63 A;  3VYW A;  1D0Y A;  3EFO A;  2J45 A;  2WZL A;  1Q0M A;  3V7O A;  2OQM A;  3ZIB A;  3POV A;  2L7A A;  4JEB A;  3ATP A;  4UDV A;  1Z7Q c;  4PR9 A;  5JLI A;  1BBH A;  4N4W A;  2GFH A;  2A0B A;  2GAQ A;  4JTC B;  1A41 A;  1ZVZ A;  5JRA A;  3KL4 A;  4FES A;  1N1C A;  4IAQ A;  4N6H A;  2H7O A;  2R02 A;  1L7C A;  3B71 A;  3EG9 B;  1JRA A;  1MMN A;  2J7P A;  3B29 A;  5AGF A;  1BR2 A;  1OR3 A;  3AGT A;  4XLN F;  4AE4 A;  3EGD B;  4U5G A;  2ZPA A;  5B1B C;  4XEF A;  4XWJ A;  2IXP A;  3ASO C;  1ZU4 A;  2DYR C;  2YLG A;  3U5S A;  1VOM A; 
#chains in the Genus database with same CATH homology
 3L1M A;  2J9B A;  4CDY A;  1YYJ A;  1YYX A;  3M4B A;  2BC5 A;  1E86 A;  5B3I A;  2YKZ A;  1QPU A;  3C62 A;  1E84 A;  3HNL A;  2YL0 A;  3IQ6 A;  4CX9 A;  3HNK A;  3VRC A;  2XLW A;  5JS5 A;  5JP7 A;  4CJG A;  4CIP A;  2YL1 A;  1CGN A;  1YZA A;  3QW0 A;  5JVE A;  4D4X A;  1A7V A;  2YLD A;  3NMI A;  4EIY A;  3DE8 A;  1E83 A;  3ZTZ A;  5JT4 A;  3C63 A;  3M15 A;  3HNI A;  3QVY A;  3NMJ A;  2XLM A;  1CPQ A;  1GQA A;  2J8W A;  3FOP A;  3QW1 A;  4U9E A;  1S05 A;  3QVZ A;  256B A;  3ZQY A;  1JAF A;  2YL7 A;  1EKY A;  2YLI A;  1APC A;  3TOL A;  3U8P A;  2XLD A;  3TOM A;  2CCY A;  2XLV A;  3M79 A;  4JE9 A;  1M6T A;  3ZTM A;  4JEA A;  4CDA A;  2XM4 A;  1CPR A;  5JUA A;  2XL8 A;  2XLE A;  3DE9 A;  1CGO A;  2YL3 A;  4NC3 A;  1RCP A;  4CJO A;  1NBB A;  4ULV A;  3ZQV A;  1YZC A;  4L6R A;  5JSL A;  3IQ5 A;  2XM0 A;  4JKV A;  4IB4 A;  4JEB A;  1QQ3 A;  5JLI A;  2XLH A;  1BBH A;  4N4W A;  4IAR A;  3M4C A;  4U9D A;  4WGY A;  5JRA A;  1E85 A;  3NMK A;  4IAQ A;  4N6H A;  3HNJ A;  4WGZ A;  5AGF A;  4CDV A;  4D4N A;  1LM3 B;  1MQV A;  4ER9 A;  2QLA A;  2XL6 A;  2XLO A;  3FOO A;  2YLG A;  3ZWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...