3M4CA

A zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4cA00
5JVEA 3HNLA 5JRAA 1E84A 1YYXA 3ZQYA 1CPRA 3QW1A 4JEAA 1GQAA 2YLDA 1S05A 1YYJA 2YL7A 3QVZA 2J9BA 3NMKA 2YLGA 3ZQVA 3HNIA 2XL6A 5JT4A 2XM0A 4CDAA 3ZWIA 5JLIA 1APCA 2YKZA 1RCPA 4JKVA 2XL8A 1E83A 1MQVA 2J8WA 3TOMA 3NMJA 4N4WA 2YL0A 4CJGA 5JUAA 1E85A 3C62A 3U8PA 4WGYA 4CX9A 5JS5A 3C63A 2XLVA 3ZTZA 3QW0A 3M4CA 3M4BA 3M15A 5AGFA 1JAFA 4L6RA 3L1MA 5JP7A 3QVYA 3M79A 4D4NA 2XLHA 1YZCA 1NBBA 3VRCA 2XLDA 3IQ6A 1E86A 4U9DA 4WGZA 4CIPA 4N6HA 4JEBA 4IB4A 2XLEA 3DE8A 3NMIA 2XLOA 4CDYA 1CGOA 4ULVA 1BBHA 2XLMA 3TOLA 4ER9A 256BA 4CJOA 1QPUA 1A7VA 2QLAA 3DE9A 1YZAA 3FOPA 1CPQA 2CCYA 4IARA 1LM3B 5B3IA 3HNJA 1EKYA 4D4XA 2YLIA 4IAQA 2YL3A 4JE9A 2YL1A 3HNKA 1QQ3A 4U9EA 4CDVA 2BC5A 4EIYA 3IQ5A 2XLWA 4NC3A 2XM4A 3ZTMA 1CGNA 5JSLA 1M6TA 3FOOA
chains in the Genus database with same CATH superfamily
4YWQA 5JVEA 3IHUA 4MNDA 2LSEA 3UMIA 3QW1A 3VYWA 2DYRC 5HSWA 3G50A 4YL3A 1NU9C 3TD7A 4MTFA 3KKBA 1YYJA 2P6VA 2EIJC 4QI0A 2NUPB 4GQHA 4XPWA 2XS8A 3ZQVA 3UNGC 2XL6A 4PACA 4KBLA 1JPJA 2C04A 1U6HA 2GDCA 2L7AA 3S0XA 4BG0A 3V5XA 3ZWIA 4B6IA 2LQGA 5JLIA 2QE9A 4JVSA 1APCA 5CI8A 2IXPA 2W4BA 1HW2A 1Z3IX 3ATPA 1G4US 1PCXA 1VYIA 3AQBA 3R2PA 5L0IA 1WATA 3ECSA 2I15A 2HZ8A 3AG2C 2HJ3A 2BE5F 3SYNA 3LEVA 2KQ9A 2Q9CA 2V26A 3K1HA 2H7BA 4BEJA 2D5RB 4JCHA 1HY5A 1TWAA 2R03A 2HS5A 5DLJA 5JUAA 3I5PA 3V5ZA 1D0XA 2Y3DA 1OW7A 3EPVA 3JSZA 4WGYA 3RFYA 4CX9A 1VLSA 4LERA 1AVOB 2ICWG 2WZGA 3QW0A 2IBFA 2ZXPA 3CAXA 2M4EA 3IEEA 4L6RA 3L8IA 3HKKA 4H54A 1J8YF 5BQGA 3FXHA 4KI2A 5JP7A 2OEXA 3GM2A 4D4NA 2XL4A 3U9JA 2H7OA 3H65A 2XLHA 1YZCA 3HTKC 1GGQA 1OR2A 3NYLA 3VRCA 4DOZA 5KYWB 4W8PA 4EUKB 4U9DA 1U89A 2Y3HA 1NU7D 2R7TA 3RQGA 4KNWA 3EFOA 1WTYA 3JTLO 1RMVA 1QKRA 2J7PD 3MX3A 4F4BA 5KYUB 4W8KA 4Z9JA 1L3PA 4EBKA 3N24A 1IZMA 2OOCA 2Y3GA 3K7DA 4ANJA 5KYYB 1LI5A 4NTAA 3GEHA 2X51A 4CDYA 3I4UA 3C8GD 3NKEA 4I1MA 5B3SC 1ZW2A 2J7PA 2XLMA 1WASA 3GM1A 1H9GA 2H7VC 2J9VA 1WN0A 2NUTB 3TOLA 5HV9A 3JSEO 2MWQA 4CIHA 3RW0A 5L0GA 5AC4A 2H8AA 4I1OB 1D1AA 3S28A 1A7DA 2GWWA 4AL1A 3U0CA 3LESA 4CJOA 3U5SA 4O7GA 3C18A 4YJWA 2UUHA 4OIRF 1LI7A 4G7OF 1K40A 4HFFB 4KNVA 2EIKC 1LPEA 2HFIA 1XZPA 5CI9A 4BJ6C 4EWCA 1RXQA 3FOPA 1GS9A 3FHDA 3VF0A 3MYIA 3K66A 3DJNB 4J7TA 4NTBA 3AQCA 3S84A 2GAQA 2RD9A 2XS1A 5BUOA 1VK5A 3OEOA 4BEMJ 4PR9A 5L0HA 1C17M 2OCCC 2EPNA 3MYFA 3F47A 2IXOA 5B3IA 4E7ZA 5BQHA 1C02A 1Q0GA 1QVXA 1AUEA 2BL2A 2Q00A 5A6JA 3TQOA 4U5EE 3UGOA 2KC3A 1LE4A 3I5QA 1QSPA 3HNKA 2KK1A 1ORYA 3RQFA 1LE2A 4CSAA 4IRUA 4BJ6A 2NPUA 2VH3A 1ZU4A 2R7QA 3X2QC 1M2VB 3US6A 1K05A 3ZIBA 1OW6A 4BJ5C 4O6YA 2A69F 2CW0F 5D92A 3B0PA 2LP4A 2MHRA 3JT1A 2LIGA 4Z9IA 1T6UA 1Y4CA 3ZTMA 4GEHA 5JSLA 4QDLA 2KW3C 3AGTA 4FWVA 3DI5A 1NSGB 4G0HA 5COFA 3W8IA 3MFNA 1M56C 1I4ZA 3GWLA 4U5BE 2IXNA 4CS8C 3GWNA 4YL1A 1MMNA 3QVZA 3WAQA 2EPKX 3WG7C 2XRHA 3ZC4A 4U5FE 4C3EA 3OA1A 2HJMA 2ZXRA 3KPHA 2DGJA 4XEFA 1D1BA 4AE4A 3EGDA 5K0IA 1D0ZA 4CS9C 1YVIA 3UGPA 2QNLA 2IM8A 3DZAA 4BJ5A 4C7OB 5CIVA 4OD4A 4ZLCA 5EHHA 1UG7A 4IGGA 4JC7A 1KNYA 3DXJF 3FAJA 2ZXWC 2O9XA 3JZ0A 1TWHA 4JRZA 3T9OA 4EHPA 1T01A 1I5NA 4CS8A 3PHF2 2JD3A 2R7OA 2WZLA 2YZSA 2PFDA 1RKEA 3QTHA 2XXAB 3U2MA 4NQFA 4LDRA 3EGXB 4N4WA 3RIPA 4ONSA 5FZTA 2Q4FA 3GANA 3T4RA 4CJGA 1WOLA 1ORJA 2Y3BA 2PX3A 2J0XA 3IQCA 2OQMA 3C62A 3EH1A 4AX2A 4PFPA 3AGUA 4ULWA 3C8ZA 3ZTZA 1Q0FA 2PBEA 5AGFA 4XTKA 2FFHA 3PDMP 1SR2A 3AG3C 3L1MA 3CEXA 1BR1A 3RVYA 1PV3A 2LD6A 3M79A 3QVYA 5DQZA 3N0TA 4LLEA 1YA9A 2V3CC 3KL4A 4DVYP 2YEVA 2VC9A 3A9CA 3L8JA 1E86A 4YT2A 4WGZA 4N6HA 2VCAA 2J0WA 3V5YA 2CNWD 3NYJA 4OIQF 5T3TA 2YRFA 5L0DA 2PP4A 4CS7A 3EHMA 3RH3A 1OXKA 3BRJA 5DS5A 2EPMX 3K1IC 2P1AA 2AP3A 2G3KA 5TJ5E 5F5FA 3Q6MA 5E3AA 2B0JA 3AOUA 2PX0A 4PFOA 3SZRA 1N1CA 1ZYRF 2Q3TA 3SNHA 1YAUO 2PNOA 2JX0A 1MNDA 4J7YA 1R5ID 3S29A 3GORA 3NYMA 2F22A 4MVMA 3TJ5A 3U3FA 4FAPB 3Q7GA 1TR2A 1ZHYA 2YVKA 3EZIA 5L0JA 4XLNF 2A0UA 4MS2A 3G4ZA 4MTGA 3H2UA 1OCOC 1VOMA 1YARO 2OU6A 4JTDB 3KYJA 1A7VA 3K6BA 2E87A 3K1IA 2R7UA 2W4MA 1OCZC 2Z15A 1VTMP 4JIOA 4O6NA 3TULA 2KSFA 3S90A 2ZXOA 2OEVA 4YL0A 2HSBA 1NFOA 3LUTB 4U5HA 5B1AC 1Z7Qc 4XEKA 1FFTC 1TFOB 2AWCA 3HJCA 4MTOA 2EINC 2IOQA 5E3CA 3GEIA 3PCVA 4N06A 1SF8A 2OG2A 5E33A 3ZDLA 3HNJA 3ZG1A 4JCZA 4P6IC 4YT8A 1EKYA 3U9MA 2UUIA 5KYXB 1BZ4A 3W4YA 1U0BB 3EJNA 2RSEB 1DOWA 1PD0A 3RKOF 2TMVP 3T6GB 1T6QA 2QUPA 3KH2A 4N6CA 1OKKD 4E0IA 4DBQA 4U9EA 3C8GA 3VM6A 1M57C 1YJGA 2IXMA 2L6GA 2L6FA 1DOVA 2BC5A 4G78A 4EIYA 2VCCA 2NG1A 3RYLA 2DB4A 2XLWA 4MVOA 4NC3A 2R9RB 2XM4A 1AEPA 4G7HF 1KTMA 5FCLA 1V55C 2KGOA 4FX5A 1M6TA 2WB7A 4K0DA 4C3DA 3IPMO 1JOGA 3DD7A 5JRAA 1MMGA 3QMKA 4Q7CA 4RBNA 1ZHZA 4Q5SF 1OCRC 1GQAA 2YLDA 1OCCC 3N2ZB 4OINF 1V54C 1FTSA 2R7VA 2QY9A 1T6IA 1G8XA 2YLGA 1RJ9A 2HMZA 4PK4A 2B0HA 3HNIA 4BPMA 1S7ZA 1LVKA 1UFBA 1ZHXA 2XM0A 3SXZA 5JT4A 1EA8A 1FAPB 4FESA 2ZPAA 4MVQA 2G3VA 5BQIA 1Y6DA 4OIOF 2VCBA 2HKVA 3DJUB 1E2XA 4YK5A 1SZIA 1VYKA 3B71A 4MVSA 2XSEA 4M63A 3K33A 4BJ1A 5F28E 4IJJA 2W45A 2NUPA 1TWCA 2VASA 3G4XA 1ZHWA 3UMKA 3NMJA 4Z9HA 3MLGA 4DJ9A 2CGEA 3UMHA 2WVNA 5DS6A 3JRMO 4LDQA 3S27A 2KJGA 2YL0A 4AK9A 4JZAA 5B1BC 2D4UA 1H7IA 1A7EA 3FAPB 2DI3A 1OR3A 1OXBA 3U8PA 1D1CA 1ORSC 4X0RA 2PF4E 2R7XA 2GFHA 4IAOA 1WGWA 3M4CA 4JJGA 4DXWA 2R02A 4KC9A 1H9TA 4E7SA 1NLXA 4NY3A 2WL8A 5DVWA 2C03A 5EK0A 4PJLA 3RVZA 3LS1A 2L81A 3ABMC 3LJBA 3O39A 1NBBA 4E0HA 3JYYA 3ZVRA 5EGYA 5L0FA 2YHSA 3IQTA 3EH2A 3TK0A 3E9VA 2Q9AA 3DAGA 3O10A 4JEBA 4U5CE 4IB4A 2G62A 2HSQA 3J06A 3UR3C 1HMOA 1MMAA 1FMVA 1M2OA 1YDIA 4LDKA 4YT4A 5A6BD 4UDVA 2EILC 2ZD9A 4MW3A 4U5DE 3T6JA 4GYTA 3NMIA 2XLOA 3L34A 3WODF 1QLEC 3EHNA 4ULVA 5KYWA 2KYHA 3LNMB 4CS9A 4DRIB 5T1DB 1K04A 1HW1A 3W2WA 1A41A 2MYSA 4J30B 1VB5A 4C3BA 5KYUA 2AU5A 4ER9A 1TQGA 3POVA 3O55A 3ASNC 3Q7LA 4DRHB 1Q0DA 256BA 3OWTA 4HFKB 2L9JA 2LK4A 3DM5A 4XWJA 1QPUA 5KYYA 1FFHA 1FMWA 5L3VA 3EZHA 4H4KC 3FDQA 2R05A 2I8BA 2P61A 3ABLC 3DE9A 3M1CB 4I3MA 3SXYA 4JJFA 3EG9B 4MVZA 5A6KA 2J9WA 1LKXA 1YA7O 4OD5A 1A0BA 2QTVA 3LNRA 3Q6NA 2NUTA 3GEEA 3SEOA 3KMIA 3NDBB 5L0CA 4AL0A 4XPYA 1H6GA 2YWAA 1Z63A 1W2WA 4JW1A 1I4YA 3BEHA 2CNWA 2P0NA 4K7BA 5T3WA 4EBBA 1CGME 2A0BA 4A4AA 4QI2A 1PD1A 2J45A 2R7WA 4D4XA 1LS1A 1ZHTA 2YLIA 1B68A 4IAQA 3MBGA 4LLCA 3EQLF 3NRHA 3ASOC 4P9FA 5COGA 4CBEA 4MVUA 1QQ3A 4WABA 4CDVA 1T9KA 4DRJB 1TWGA 1ST6A 4AE4B 3EGDB 3LS0A 5D91A 3R7CA 4O6MA 2NSGA 3KYIA 1V74B 3FOOA 3DMDA 3HNLA 1E84A 1C03A 1YYXA 3ZQYA 1CPRA 4JEAA 2ASRA 1SYQA 5F5HA 4MVRA 1Z6AA 2KNHA 4XPXA 1S05A 2VB6A 4A2NB 2A6EF 2YL7A 4HEAJ 1Z5ZA 3LAYA 4YN0B 2R7RA 2J9BA 1M2VA 3NMKA 4PJMA 3LLKA 1G4WR 3AG1C 4RDAA 5A6AA 2IYLD 1RKEB 1YLMA 3U3BA 1JMWA 4CDAA 1BR4A 2CYDA 2A1DD 1Q0KA 3DAFA 1JPNA 5AC5A 4MQ9F 2A6HF 4O79A 2YKZA 3U8VA 4G7ZF 2OJQA 1RCPA 1MNEA 2DYSC 1TFKB 1SMYF 5L3QA 4JKVA 2XL8A 3W2VA 1E83A 1MQVA 4Q4ZF 1BDJB 2J8WA 1V4AA 1ZU5A 2J46A 2OJED 4PJNA 3TOMA 2Y39A 2Q7RA 2LFFA 1ZW3A 2EPLX 1JR8A 1QZXA 1XWJA 1OKKA 4EBJA 4C7OA 3SXMA 4ZLDA 1LIHA 3JYHA 3A11A 3AJMA 4JTCB 1E85A 1O5HA 2HMQA 4WJ0A 1LS4A 1IW7F 1Z23A 5JS5A 3C63A 2Q9BA 2R7SA 2XLVA 5COMA 2OKUA 2NSFA 3ABKC 3LEOA 1JRAA 3DM9B 3M15A 3M4BA 1JAFA 2FAPB 4XQ1A 3V7OA 5A69A 1HMDA 3F46A 2EIMC 5DQTA 1D0YA 1G5ZA 3H2VA 1GM5A 2XXAA 3JRTA 4E17A 1ZZPA 2P7VA 3EGXA 1XZQA 4LACB 4XEVA 3ZSUA 2XLDA 3IQ6A 2GA0A 2CDQA 4CIPA 4CSAC 4PJJA 1O3UA 2AVKA 2JPUA 2YQYA 3HLZA 4XLPF 1Q0MA 2Y69C 3U2LA 1TKNA 3GM3A 3L0IA 1L7CA 3O6XA 2XLEA 3CSKA 3FVYA 4HE8D 4U5GA 1MMDA 3DWWA 3QZCA 3DE8A 1VMAA 5KYNA 4JURI 1WWPA 1ZVZA 4E18A 2HV6A 2EPOA 3CQZA 1CGOA 3PMRA 3LLIA 1BBHA 3GODA 4IWBA 1HE1A 3C7JA 3TJ6A 5IY5C 3RF3A 1NFNA 3EFOB 1OW8A 3EG9A 5KYXA 2WVQA 4MW8A 4DBRA 3W8HA 1R4TA 3FMSA 4RD9A 4P9TA 1NZEA 2LFDA 2QLAA 2X0CA 1FR0A 3ITFA 1OQCA 1YZAA 2R25A 2AWYA 3B0UX 1CPQA 4DVZA 2CCYA 4YT5A 2WZFA 1J8MF 1NG1A 2L6HA 4J32B 3DKAA 1F1MA 1O87A 1VLTA 3C8GB 4K1OA 4I44A 1FNTc 1RKCA 3SXKA 4IARA 1BR2A 1HE9A 1LM3B 2J9UA 4NTFA 4OIPF 1T5OA 5E2QA 2HUJA 2FGYA 2WVOA 1EQ1A 1KU2A 3VAYA 3CZ6A 5DS4A 3X1OA 3B9QA 5A6BA 2YL3A 4JE9A 3B0VC 2YL1A 3B29A 3SP1A 3RQEA 3JCUQ 5GPGB 2A68F 4JTAB 1EI7A 2M64A 4R32A 3WHNA 3S9OA 4EKWA 3T6BA 2HV7A 1RJ9B 3IQ5A 3E70C 4BJTA 1CGNA 2ETSA 2W9YA 4NCQA 3NKDA 2LCHA 3NG1A 3AG4C
chains in the Genus database with same CATH topology
5JVEA 3HNLA 5JRAA 1E84A 1YYXA 3ZQYA 1CPRA 3QW1A 4JEAA 1GQAA 2YLDA 1S05A 1YYJA 2YL7A 3QVZA 2J9BA 3NMKA 2YLGA 3ZQVA 3HNIA 2XL6A 5JT4A 2XM0A 4CDAA 3ZWIA 5JLIA 1APCA 2YKZA 1RCPA 4JKVA 2XL8A 1E83A 1MQVA 2J8WA 3TOMA 3NMJA 4N4WA 2YL0A 4CJGA 5JUAA 1E85A 3C62A 3U8PA 4WGYA 4CX9A 5JS5A 3C63A 2XLVA 3ZTZA 3QW0A 3M4CA 3M4BA 3M15A 5AGFA 1JAFA 4L6RA 3L1MA 5JP7A 3QVYA 3M79A 4D4NA 2XLHA 1YZCA 1NBBA 3VRCA 2XLDA 3IQ6A 1E86A 4U9DA 4WGZA 4CIPA 4N6HA 4JEBA 4IB4A 2XLEA 3DE8A 3NMIA 2XLOA 4CDYA 1CGOA 4ULVA 1BBHA 2XLMA 3TOLA 4ER9A 256BA 4CJOA 1QPUA 1A7VA 2QLAA 3DE9A 1YZAA 3FOPA 1CPQA 2CCYA 4IARA 1LM3B 5B3IA 3HNJA 1EKYA 4D4XA 2YLIA 4IAQA 2YL3A 4JE9A 2YL1A 3HNKA 1QQ3A 4U9EA 4CDVA 2BC5A 4EIYA 3IQ5A 2XLWA 4NC3A 2XM4A 3ZTMA 1CGNA 5JSLA 1M6TA 3FOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVE A;  3HNL A;  5JRA A;  1E84 A;  1YYX A;  3ZQY A;  1CPR A;  3QW1 A;  4JEA A;  1GQA A;  2YLD A;  1S05 A;  1YYJ A;  2YL7 A;  3QVZ A;  2J9B A;  3NMK A;  2YLG A;  3ZQV A;  3HNI A;  2XL6 A;  5JT4 A;  2XM0 A;  4CDA A;  3ZWI A;  5JLI A;  1APC A;  2YKZ A;  1RCP A;  4JKV A;  2XL8 A;  1E83 A;  1MQV A;  2J8W A;  3TOM A;  3NMJ A;  4N4W A;  2YL0 A;  4CJG A;  5JUA A;  1E85 A;  3C62 A;  3U8P A;  4WGY A;  4CX9 A;  5JS5 A;  3C63 A;  2XLV A;  3ZTZ A;  3QW0 A;  3M4C A;  3M4B A;  3M15 A;  5AGF A;  1JAF A;  4L6R A;  3L1M A;  5JP7 A;  3QVY A;  3M79 A;  4D4N A;  2XLH A;  1YZC A;  1NBB A;  3VRC A;  2XLD A;  3IQ6 A;  1E86 A;  4U9D A;  4WGZ A;  4CIP A;  4N6H A;  4JEB A;  4IB4 A;  2XLE A;  3DE8 A;  3NMI A;  2XLO A;  4CDY A;  1CGO A;  4ULV A;  1BBH A;  2XLM A;  3TOL A;  4ER9 A;  256B A;  4CJO A;  1QPU A;  1A7V A;  2QLA A;  3DE9 A;  1YZA A;  3FOP A;  1CPQ A;  2CCY A;  4IAR A;  1LM3 B;  5B3I A;  3HNJ A;  1EKY A;  4D4X A;  2YLI A;  4IAQ A;  2YL3 A;  4JE9 A;  2YL1 A;  3HNK A;  1QQ3 A;  4U9E A;  4CDV A;  2BC5 A;  4EIY A;  3IQ5 A;  2XLW A;  4NC3 A;  2XM4 A;  3ZTM A;  1CGN A;  5JSL A;  1M6T A;  3FOO A; 
#chains in the Genus database with same CATH topology
 4YWQ A;  5JVE A;  3IHU A;  4MND A;  2LSE A;  3UMI A;  3QW1 A;  3VYW A;  2DYR C;  5HSW A;  3G50 A;  4YL3 A;  1NU9 C;  3TD7 A;  4MTF A;  3KKB A;  1YYJ A;  2P6V A;  2EIJ C;  4QI0 A;  2NUP B;  4GQH A;  4XPW A;  2XS8 A;  3ZQV A;  3UNG C;  2XL6 A;  4PAC A;  4KBL A;  1JPJ A;  2C04 A;  1U6H A;  2GDC A;  2L7A A;  3S0X A;  4BG0 A;  3V5X A;  3ZWI A;  4B6I A;  2LQG A;  5JLI A;  2QE9 A;  4JVS A;  1APC A;  5CI8 A;  2IXP A;  2W4B A;  1HW2 A;  1Z3I X;  3ATP A;  1G4U S;  1PCX A;  1VYI A;  3AQB A;  3R2P A;  5L0I A;  1WAT A;  3ECS A;  2I15 A;  2HZ8 A;  3AG2 C;  2HJ3 A;  2BE5 F;  3SYN A;  3LEV A;  2KQ9 A;  2Q9C A;  2V26 A;  3K1H A;  2H7B A;  4BEJ A;  2D5R B;  4JCH A;  1HY5 A;  1TWA A;  2R03 A;  2HS5 A;  5DLJ A;  5JUA A;  3I5P A;  3V5Z A;  1D0X A;  2Y3D A;  1OW7 A;  3EPV A;  3JSZ A;  4WGY A;  3RFY A;  4CX9 A;  1VLS A;  4LER A;  1AVO B;  2ICW G;  2WZG A;  3QW0 A;  2IBF A;  2ZXP A;  3CAX A;  2M4E A;  3IEE A;  4L6R A;  3L8I A;  3HKK A;  4H54 A;  1J8Y F;  5BQG A;  3FXH A;  4KI2 A;  5JP7 A;  2OEX A;  3GM2 A;  4D4N A;  2XL4 A;  3U9J A;  2H7O A;  3H65 A;  2XLH A;  1YZC A;  3HTK C;  1GGQ A;  1OR2 A;  3NYL A;  3VRC A;  4DOZ A;  5KYW B;  4W8P A;  4EUK B;  4U9D A;  1U89 A;  2Y3H A;  1NU7 D;  2R7T A;  3RQG A;  4KNW A;  3EFO A;  1WTY A;  3JTL O;  1RMV A;  1QKR A;  2J7P D;  3MX3 A;  4F4B A;  5KYU B;  4W8K A;  4Z9J A;  1L3P A;  4EBK A;  3N24 A;  1IZM A;  2OOC A;  2Y3G A;  3K7D A;  4ANJ A;  5KYY B;  1LI5 A;  4NTA A;  3GEH A;  2X51 A;  4CDY A;  3I4U A;  3C8G D;  3NKE A;  4I1M A;  5B3S C;  1ZW2 A;  2J7P A;  2XLM A;  1WAS A;  3GM1 A;  1H9G A;  2H7V C;  2J9V A;  1WN0 A;  2NUT B;  3TOL A;  5HV9 A;  3JSE O;  2MWQ A;  4CIH A;  3RW0 A;  5L0G A;  5AC4 A;  2H8A A;  4I1O B;  1D1A A;  3S28 A;  1A7D A;  2GWW A;  4AL1 A;  3U0C A;  3LES A;  4CJO A;  3U5S A;  4O7G A;  3C18 A;  4YJW A;  2UUH A;  4OIR F;  1LI7 A;  4G7O F;  1K40 A;  4HFF B;  4KNV A;  2EIK C;  1LPE A;  2HFI A;  1XZP A;  5CI9 A;  4BJ6 C;  4EWC A;  1RXQ A;  3FOP A;  1GS9 A;  3FHD A;  3VF0 A;  3MYI A;  3K66 A;  3DJN B;  4J7T A;  4NTB A;  3AQC A;  3S84 A;  2GAQ A;  2RD9 A;  2XS1 A;  5BUO A;  1VK5 A;  3OEO A;  4BEM J;  4PR9 A;  5L0H A;  1C17 M;  2OCC C;  2EPN A;  3MYF A;  3F47 A;  2IXO A;  5B3I A;  4E7Z A;  5BQH A;  1C02 A;  1Q0G A;  1QVX A;  1AUE A;  2BL2 A;  2Q00 A;  5A6J A;  3TQO A;  4U5E E;  3UGO A;  2KC3 A;  1LE4 A;  3I5Q A;  1QSP A;  3HNK A;  2KK1 A;  1ORY A;  3RQF A;  1LE2 A;  4CSA A;  4IRU A;  4BJ6 A;  2NPU A;  2VH3 A;  1ZU4 A;  2R7Q A;  3X2Q C;  1M2V B;  3US6 A;  1K05 A;  3ZIB A;  1OW6 A;  4BJ5 C;  4O6Y A;  2A69 F;  2CW0 F;  5D92 A;  3B0P A;  2LP4 A;  2MHR A;  3JT1 A;  2LIG A;  4Z9I A;  1T6U A;  1Y4C A;  3ZTM A;  4GEH A;  5JSL A;  4QDL A;  2KW3 C;  3AGT A;  4FWV A;  3DI5 A;  1NSG B;  4G0H A;  5COF A;  3W8I A;  3MFN A;  1M56 C;  1I4Z A;  3GWL A;  4U5B E;  2IXN A;  4CS8 C;  3GWN A;  4YL1 A;  1MMN A;  3QVZ A;  3WAQ A;  2EPK X;  3WG7 C;  2XRH A;  3ZC4 A;  4U5F E;  4C3E A;  3OA1 A;  2HJM A;  2ZXR A;  3KPH A;  2DGJ A;  4XEF A;  1D1B A;  4AE4 A;  3EGD A;  5K0I A;  1D0Z A;  4CS9 C;  1YVI A;  3UGP A;  2QNL A;  2IM8 A;  3DZA A;  4BJ5 A;  4C7O B;  5CIV A;  4OD4 A;  4ZLC A;  5EHH A;  1UG7 A;  4IGG A;  4JC7 A;  1KNY A;  3DXJ F;  3FAJ A;  2ZXW C;  2O9X A;  3JZ0 A;  1TWH A;  4JRZ A;  3T9O A;  4EHP A;  1T01 A;  1I5N A;  4CS8 A;  3PHF 2;  2JD3 A;  2R7O A;  2WZL A;  2YZS A;  2PFD A;  1RKE A;  3QTH A;  2XXA B;  3U2M A;  4NQF A;  4LDR A;  3EGX B;  4N4W A;  3RIP A;  4ONS A;  5FZT A;  2Q4F A;  3GAN A;  3T4R A;  4CJG A;  1WOL A;  1ORJ A;  2Y3B A;  2PX3 A;  2J0X A;  3IQC A;  2OQM A;  3C62 A;  3EH1 A;  4AX2 A;  4PFP A;  3AGU A;  4ULW A;  3C8Z A;  3ZTZ A;  1Q0F A;  2PBE A;  5AGF A;  4XTK A;  2FFH A;  3PDM P;  1SR2 A;  3AG3 C;  3L1M A;  3CEX A;  1BR1 A;  3RVY A;  1PV3 A;  2LD6 A;  3M79 A;  3QVY A;  5DQZ A;  3N0T A;  4LLE A;  1YA9 A;  2V3C C;  3KL4 A;  4DVY P;  2YEV A;  2VC9 A;  3A9C A;  3L8J A;  1E86 A;  4YT2 A;  4WGZ A;  4N6H A;  2VCA A;  2J0W A;  3V5Y A;  2CNW D;  3NYJ A;  4OIQ F;  5T3T A;  2YRF A;  5L0D A;  2PP4 A;  4CS7 A;  3EHM A;  3RH3 A;  1OXK A;  3BRJ A;  5DS5 A;  2EPM X;  3K1I C;  2P1A A;  2AP3 A;  2G3K A;  5TJ5 E;  5F5F A;  3Q6M A;  5E3A A;  2B0J A;  3AOU A;  2PX0 A;  4PFO A;  3SZR A;  1N1C A;  1ZYR F;  2Q3T A;  3SNH A;  1YAU O;  2PNO A;  2JX0 A;  1MND A;  4J7Y A;  1R5I D;  3S29 A;  3GOR A;  3NYM A;  2F22 A;  4MVM A;  3TJ5 A;  3U3F A;  4FAP B;  3Q7G A;  1TR2 A;  1ZHY A;  2YVK A;  3EZI A;  5L0J A;  4XLN F;  2A0U A;  4MS2 A;  3G4Z A;  4MTG A;  3H2U A;  1OCO C;  1VOM A;  1YAR O;  2OU6 A;  4JTD B;  3KYJ A;  1A7V A;  3K6B A;  2E87 A;  3K1I A;  2R7U A;  2W4M A;  1OCZ C;  2Z15 A;  1VTM P;  4JIO A;  4O6N A;  3TUL A;  2KSF A;  3S90 A;  2ZXO A;  2OEV A;  4YL0 A;  2HSB A;  1NFO A;  3LUT B;  4U5H A;  5B1A C;  1Z7Q c;  4XEK A;  1FFT C;  1TFO B;  2AWC A;  3HJC A;  4MTO A;  2EIN C;  2IOQ A;  5E3C A;  3GEI A;  3PCV A;  4N06 A;  1SF8 A;  2OG2 A;  5E33 A;  3ZDL A;  3HNJ A;  3ZG1 A;  4JCZ A;  4P6I C;  4YT8 A;  1EKY A;  3U9M A;  2UUI A;  5KYX B;  1BZ4 A;  3W4Y A;  1U0B B;  3EJN A;  2RSE B;  1DOW A;  1PD0 A;  3RKO F;  2TMV P;  3T6G B;  1T6Q A;  2QUP A;  3KH2 A;  4N6C A;  1OKK D;  4E0I A;  4DBQ A;  4U9E A;  3C8G A;  3VM6 A;  1M57 C;  1YJG A;  2IXM A;  2L6G A;  2L6F A;  1DOV A;  2BC5 A;  4G78 A;  4EIY A;  2VCC A;  2NG1 A;  3RYL A;  2DB4 A;  2XLW A;  4MVO A;  4NC3 A;  2R9R B;  2XM4 A;  1AEP A;  4G7H F;  1KTM A;  5FCL A;  1V55 C;  2KGO A;  4FX5 A;  1M6T A;  2WB7 A;  4K0D A;  4C3D A;  3IPM O;  1JOG A;  3DD7 A;  5JRA A;  1MMG A;  3QMK A;  4Q7C A;  4RBN A;  1ZHZ A;  4Q5S F;  1OCR C;  1GQA A;  2YLD A;  1OCC C;  3N2Z B;  4OIN F;  1V54 C;  1FTS A;  2R7V A;  2QY9 A;  1T6I A;  1G8X A;  2YLG A;  1RJ9 A;  2HMZ A;  4PK4 A;  2B0H A;  3HNI A;  4BPM A;  1S7Z A;  1LVK A;  1UFB A;  1ZHX A;  2XM0 A;  3SXZ A;  5JT4 A;  1EA8 A;  1FAP B;  4FES A;  2ZPA A;  4MVQ A;  2G3V A;  5BQI A;  1Y6D A;  4OIO F;  2VCB A;  2HKV A;  3DJU B;  1E2X A;  4YK5 A;  1SZI A;  1VYK A;  3B71 A;  4MVS A;  2XSE A;  4M63 A;  3K33 A;  4BJ1 A;  5F28 E;  4IJJ A;  2W45 A;  2NUP A;  1TWC A;  2VAS A;  3G4X A;  1ZHW A;  3UMK A;  3NMJ A;  4Z9H A;  3MLG A;  4DJ9 A;  2CGE A;  3UMH A;  2WVN A;  5DS6 A;  3JRM O;  4LDQ A;  3S27 A;  2KJG A;  2YL0 A;  4AK9 A;  4JZA A;  5B1B C;  2D4U A;  1H7I A;  1A7E A;  3FAP B;  2DI3 A;  1OR3 A;  1OXB A;  3U8P A;  1D1C A;  1ORS C;  4X0R A;  2PF4 E;  2R7X A;  2GFH A;  4IAO A;  1WGW A;  3M4C A;  4JJG A;  4DXW A;  2R02 A;  4KC9 A;  1H9T A;  4E7S A;  1NLX A;  4NY3 A;  2WL8 A;  5DVW A;  2C03 A;  5EK0 A;  4PJL A;  3RVZ A;  3LS1 A;  2L81 A;  3ABM C;  3LJB A;  3O39 A;  1NBB A;  4E0H A;  3JYY A;  3ZVR A;  5EGY A;  5L0F A;  2YHS A;  3IQT A;  3EH2 A;  3TK0 A;  3E9V A;  2Q9A A;  3DAG A;  3O10 A;  4JEB A;  4U5C E;  4IB4 A;  2G62 A;  2HSQ A;  3J06 A;  3UR3 C;  1HMO A;  1MMA A;  1FMV A;  1M2O A;  1YDI A;  4LDK A;  4YT4 A;  5A6B D;  4UDV A;  2EIL C;  2ZD9 A;  4MW3 A;  4U5D E;  3T6J A;  4GYT A;  3NMI A;  2XLO A;  3L34 A;  3WOD F;  1QLE C;  3EHN A;  4ULV A;  5KYW A;  2KYH A;  3LNM B;  4CS9 A;  4DRI B;  5T1D B;  1K04 A;  1HW1 A;  3W2W A;  1A41 A;  2MYS A;  4J30 B;  1VB5 A;  4C3B A;  5KYU A;  2AU5 A;  4ER9 A;  1TQG A;  3POV A;  3O55 A;  3ASN C;  3Q7L A;  4DRH B;  1Q0D A;  256B A;  3OWT A;  4HFK B;  2L9J A;  2LK4 A;  3DM5 A;  4XWJ A;  1QPU A;  5KYY A;  1FFH A;  1FMW A;  5L3V A;  3EZH A;  4H4K C;  3FDQ A;  2R05 A;  2I8B A;  2P61 A;  3ABL C;  3DE9 A;  3M1C B;  4I3M A;  3SXY A;  4JJF A;  3EG9 B;  4MVZ A;  5A6K A;  2J9W A;  1LKX A;  1YA7 O;  4OD5 A;  1A0B A;  2QTV A;  3LNR A;  3Q6N A;  2NUT A;  3GEE A;  3SEO A;  3KMI A;  3NDB B;  5L0C A;  4AL0 A;  4XPY A;  1H6G A;  2YWA A;  1Z63 A;  1W2W A;  4JW1 A;  1I4Y A;  3BEH A;  2CNW A;  2P0N A;  4K7B A;  5T3W A;  4EBB A;  1CGM E;  2A0B A;  4A4A A;  4QI2 A;  1PD1 A;  2J45 A;  2R7W A;  4D4X A;  1LS1 A;  1ZHT A;  2YLI A;  1B68 A;  4IAQ A;  3MBG A;  4LLC A;  3EQL F;  3NRH A;  3ASO C;  4P9F A;  5COG A;  4CBE A;  4MVU A;  1QQ3 A;  4WAB A;  4CDV A;  1T9K A;  4DRJ B;  1TWG A;  1ST6 A;  4AE4 B;  3EGD B;  3LS0 A;  5D91 A;  3R7C A;  4O6M A;  2NSG A;  3KYI A;  1V74 B;  3FOO A;  3DMD A;  3HNL A;  1E84 A;  1C03 A;  1YYX A;  3ZQY A;  1CPR A;  4JEA A;  2ASR A;  1SYQ A;  5F5H A;  4MVR A;  1Z6A A;  2KNH A;  4XPX A;  1S05 A;  2VB6 A;  4A2N B;  2A6E F;  2YL7 A;  4HEA J;  1Z5Z A;  3LAY A;  4YN0 B;  2R7R A;  2J9B A;  1M2V A;  3NMK A;  4PJM A;  3LLK A;  1G4W R;  3AG1 C;  4RDA A;  5A6A A;  2IYL D;  1RKE B;  1YLM A;  3U3B A;  1JMW A;  4CDA A;  1BR4 A;  2CYD A;  2A1D D;  1Q0K A;  3DAF A;  1JPN A;  5AC5 A;  4MQ9 F;  2A6H F;  4O79 A;  2YKZ A;  3U8V A;  4G7Z F;  2OJQ A;  1RCP A;  1MNE A;  2DYS C;  1TFK B;  1SMY F;  5L3Q A;  4JKV A;  2XL8 A;  3W2V A;  1E83 A;  1MQV A;  4Q4Z F;  1BDJ B;  2J8W A;  1V4A A;  1ZU5 A;  2J46 A;  2OJE D;  4PJN A;  3TOM A;  2Y39 A;  2Q7R A;  2LFF A;  1ZW3 A;  2EPL X;  1JR8 A;  1QZX A;  1XWJ A;  1OKK A;  4EBJ A;  4C7O A;  3SXM A;  4ZLD A;  1LIH A;  3JYH A;  3A11 A;  3AJM A;  4JTC B;  1E85 A;  1O5H A;  2HMQ A;  4WJ0 A;  1LS4 A;  1IW7 F;  1Z23 A;  5JS5 A;  3C63 A;  2Q9B A;  2R7S A;  2XLV A;  5COM A;  2OKU A;  2NSF A;  3ABK C;  3LEO A;  1JRA A;  3DM9 B;  3M15 A;  3M4B A;  1JAF A;  2FAP B;  4XQ1 A;  3V7O A;  5A69 A;  1HMD A;  3F46 A;  2EIM C;  5DQT A;  1D0Y A;  1G5Z A;  3H2V A;  1GM5 A;  2XXA A;  3JRT A;  4E17 A;  1ZZP A;  2P7V A;  3EGX A;  1XZQ A;  4LAC B;  4XEV A;  3ZSU A;  2XLD A;  3IQ6 A;  2GA0 A;  2CDQ A;  4CIP A;  4CSA C;  4PJJ A;  1O3U A;  2AVK A;  2JPU A;  2YQY A;  3HLZ A;  4XLP F;  1Q0M A;  2Y69 C;  3U2L A;  1TKN A;  3GM3 A;  3L0I A;  1L7C A;  3O6X A;  2XLE A;  3CSK A;  3FVY A;  4HE8 D;  4U5G A;  1MMD A;  3DWW A;  3QZC A;  3DE8 A;  1VMA A;  5KYN A;  4JUR I;  1WWP A;  1ZVZ A;  4E18 A;  2HV6 A;  2EPO A;  3CQZ A;  1CGO A;  3PMR A;  3LLI A;  1BBH A;  3GOD A;  4IWB A;  1HE1 A;  3C7J A;  3TJ6 A;  5IY5 C;  3RF3 A;  1NFN A;  3EFO B;  1OW8 A;  3EG9 A;  5KYX A;  2WVQ A;  4MW8 A;  4DBR A;  3W8H A;  1R4T A;  3FMS A;  4RD9 A;  4P9T A;  1NZE A;  2LFD A;  2QLA A;  2X0C A;  1FR0 A;  3ITF A;  1OQC A;  1YZA A;  2R25 A;  2AWY A;  3B0U X;  1CPQ A;  4DVZ A;  2CCY A;  4YT5 A;  2WZF A;  1J8M F;  1NG1 A;  2L6H A;  4J32 B;  3DKA A;  1F1M A;  1O87 A;  1VLT A;  3C8G B;  4K1O A;  4I44 A;  1FNT c;  1RKC A;  3SXK A;  4IAR A;  1BR2 A;  1HE9 A;  1LM3 B;  2J9U A;  4NTF A;  4OIP F;  1T5O A;  5E2Q A;  2HUJ A;  2FGY A;  2WVO A;  1EQ1 A;  1KU2 A;  3VAY A;  3CZ6 A;  5DS4 A;  3X1O A;  3B9Q A;  5A6B A;  2YL3 A;  4JE9 A;  3B0V C;  2YL1 A;  3B29 A;  3SP1 A;  3RQE A;  3JCU Q;  5GPG B;  2A68 F;  4JTA B;  1EI7 A;  2M64 A;  4R32 A;  3WHN A;  3S9O A;  4EKW A;  3T6B A;  2HV7 A;  1RJ9 B;  3IQ5 A;  3E70 C;  4BJT A;  1CGN A;  2ETS A;  2W9Y A;  4NCQ A;  3NKD A;  2LCH A;  3NG1 A;  3AG4 C; 
#chains in the Genus database with same CATH homology
 5JVE A;  3HNL A;  5JRA A;  1E84 A;  1YYX A;  3ZQY A;  1CPR A;  3QW1 A;  4JEA A;  1GQA A;  2YLD A;  1S05 A;  1YYJ A;  2YL7 A;  3QVZ A;  2J9B A;  3NMK A;  2YLG A;  3ZQV A;  3HNI A;  2XL6 A;  5JT4 A;  2XM0 A;  4CDA A;  3ZWI A;  5JLI A;  1APC A;  2YKZ A;  1RCP A;  4JKV A;  2XL8 A;  1E83 A;  1MQV A;  2J8W A;  3TOM A;  3NMJ A;  4N4W A;  2YL0 A;  4CJG A;  5JUA A;  1E85 A;  3C62 A;  3U8P A;  4WGY A;  4CX9 A;  5JS5 A;  3C63 A;  2XLV A;  3ZTZ A;  3QW0 A;  3M4C A;  3M4B A;  3M15 A;  5AGF A;  1JAF A;  4L6R A;  3L1M A;  5JP7 A;  3QVY A;  3M79 A;  4D4N A;  2XLH A;  1YZC A;  1NBB A;  3VRC A;  2XLD A;  3IQ6 A;  1E86 A;  4U9D A;  4WGZ A;  4CIP A;  4N6H A;  4JEB A;  4IB4 A;  2XLE A;  3DE8 A;  3NMI A;  2XLO A;  4CDY A;  1CGO A;  4ULV A;  1BBH A;  2XLM A;  3TOL A;  4ER9 A;  256B A;  4CJO A;  1QPU A;  1A7V A;  2QLA A;  3DE9 A;  1YZA A;  3FOP A;  1CPQ A;  2CCY A;  4IAR A;  1LM3 B;  5B3I A;  3HNJ A;  1EKY A;  4D4X A;  2YLI A;  4IAQ A;  2YL3 A;  4JE9 A;  2YL1 A;  3HNK A;  1QQ3 A;  4U9E A;  4CDV A;  2BC5 A;  4EIY A;  3IQ5 A;  2XLW A;  4NC3 A;  2XM4 A;  3ZTM A;  1CGN A;  5JSL A;  1M6T A;  3FOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...