3M4CA

A zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4cA00
4CJGA 3ZQVA 4CIPA 2QLAA 1CPQA 2YL0A 3L1MA 3ZTMA 3VRCA 4D4NA 1RCPA 3M15A 1CGNA 3QVZA 1YZAA 4WGYA 3M4CA 1QPUA 2YL3A 2YL7A 1QQ3A 4IAQA 3FOPA 4ULVA 3C63A 2YL1A 1E86A 3TOLA 1YYXA 2XLMA 2J8WA 5AGFA 3ZQYA 3IQ6A 5JVEA 2YLDA 1LM3B 4CX9A 3NMIA 1BBHA 1CPRA 4IB4A 2J9BA 3QW1A 4EIYA 5B3IA 1MQVA 3ZWIA 3NMJA 3FOOA 4ER9A 4CDAA 2XL6A 4JEAA 3QVYA 1CGOA 4CDVA 5JRAA 5JP7A 2CCYA 2XL8A 1GQAA 3HNJA 1M6TA 3ZTZA 1E83A 3DE9A 1YZCA 3IQ5A 1E85A 2BC5A 2XLWA 1EKYA 3DE8A 4JE9A 3U8PA 3HNKA 5JSLA 5JLIA 256BA 1YYJA 4JKVA 4D4XA 4JEBA 4N6HA 4L6RA 2XLVA 2XLDA 2XLHA 1S05A 4U9DA 1E84A 3M4BA 3QW0A 5JUAA 4N4WA 1A7VA 3M79A 2XLEA 5JS5A 2YLIA 4CDYA 4NC3A 1JAFA 2XLOA 1APCA 4IARA 2XM0A 4CJOA 2YKZA 5JT4A 2YLGA 2XM4A 3C62A 3HNIA 3NMKA 4WGZA 1NBBA 3HNLA 4U9EA 3TOMA
chains in the Genus database with same CATH superfamily
3WODF 2LFDA 2E87A 3JT1A 4JCHA 3AG2C 4JTCB 4NTFA 5EK0A 3DZAA 4CS9C 4YT8A 4RDAA 3TJ6A 2RD9A 3VYWA 3VM6A 1LS1A 5BUOA 4XWJA 5DS6A 2IXNA 3GM3A 3W2VA 1VLTA 4YT5A 2J9VA 4EUKB 3VRCA 1RKEB 3L0IA 2HV6A 4JJGA 3AQCA 3OA1A 4U5DE 4XPXA 5K0IA 4GEHA 5D92A 1TWGA 3EHMA 3UNGC 1YZAA 5A6BD 4P9FA 1HW1A 3US6A 3BEHA 3K33A 2JD3A 4AX2A 1TKNA 2YL3A 1VOMA 2GWWA 2R25A 4PFOA 4CSAC 4PFPA 3AG4C 3PMRA 2OJED 2Q9BA 1AVOB 2YL1A 2HFIA 3SXKA 1E86A 3SEOA 1WGWA 3TOLA 1T01A 3AJMA 5E2QA 2XLMA 2FFHA 1RJ9A 1XWJA 2CNWD 5KYYB 2ZPAA 1LE4A 1R5ID 3LEVA 2EIJC 3MFNA 1QZXA 3U9JA 3K1IC 3NKEA 3GWLA 2OG2A 3EHNA 4XQ1A 2NSFA 3E70C 1Q0KA 3RQEA 3U3FA 2Y69C 4XLPF 2XXAA 1DOVA 2OOCA 2IBFA 3UMKA 3S84A 1G8XA 3TK0A 4BG0A 1SMYF 1WOLA 2QNLA 3BRJA 3IHUA 4MVUA 5A6BA 3KKBA 3QMKA 3R2PA 3EJNA 1CPRA 2P1AA 5D91A 3SYNA 2NUTB 3UGPA 2CW0F 2EIKC 3FVYA 5L0DA 2OKUA 1PV3A 2VC9A 4DJ9A 2P7VA 1H9GA 2H7BA 2XL4A 3NMJA 1ZVZA 3HJCA 4N6CA 2LQGA 3JSEO 2Y39A 4P6IC 2CNWA 3QTHA 3NYMA 1D1AA 1CGOA 1SZIA 4QDLA 4R32A 1YAUO 5F5HA 3DM5A 1A41A 3UMHA 1NFNA 1MNDA 1RKEA 5KYWB 5JP7A 4XLNF 3HTKC 4NTBA 2Y3DA 3DWWA 4FWVA 1SR2A 3DE9A 1YZCA 3GANA 4W8KA 4F4BA 2ICWG 2J45A 3DD7A 4JZAA 3PDMP 3X1OA 3DXJF 3DE8A 5T3TA 1E2XA 2R02A 3W4YA 3ZIBA 4E0HA 1ORYA 2J9WA 3U8PA 2R7TA 2HUJA 4LLCA 5B3SC 2R05A 4JC7A 1SYQA 5JSLA 4MQ9F 2FGYA 4RD9A 2LFFA 4DRJB 2I15A 2MWQA 1GS9A 3W8IA 4IAOA 3CZ6A 3C18A 3HKKA 4JURI 4O7GA 4IGGA 4L6RA 4NQFA 1ZU4A 3S28A 2XLHA 4U9DA 3DAFA 4EBBA 1E84A 1O3UA 3WG7C 2HKVA 1JMWA 2EPMX 1H9TA 4YT2A 3F47A 3RVZA 5JUAA 4OD4A 4ULWA 3AGTA 2KK1A 2IOQA 3MLGA 4I3MA 5COMA 1MNEA 2B0HA 4E0IA 4CS9A 2R7QA 3VAYA 2C04A 1G4WR 1V55C 4NC3A 2EPNA 2VCBA 1LIHA 1TFKB 1APCA 4MVOA 2XM0A 1FFTC 4CJOA 4CIHA 4GQHA 1VMAA 4JCZA 1J8MF 5JT4A 3NMKA 2XS1A 5L0HA 1JOGA 4YL3A 1NBBA 3TOMA 4O6YA 3J06A 4MW8A 3U2MA 3DAGA 3JTLO 2TMVP 2HZ8A 3ZQVA 1T6QA 4CIPA 4EBJA 5B1BC 4PJMA 4XTKA 5KYUB 3I4UA 2H7VC 3L34A 1CPQA 2YL0A 1RMVA 4ZLDA 3TJ5A 4JJFA 2A6HF 1QVXA 1FR0A 3KYIA 2AU5A 3CAXA 1OW7A 3JCUQ 2R7WA 1PD0A 3UGOA 2XRHA 1NZEA 5DLJA 1U6HA 2IXMA 4O6NA 4D4NA 4G7HF 4FAPB 3K1IA 1YVIA 1OR2A 3QVZA 3ZDLA 5AC5A 1LPEA 4WGYA 5FCLA 2VB6A 3U8VA 2HSBA 1OXKA 3RQFA 2XXAB 1H6GA 2YL7A 2OQMA 3S0XA 3JYYA 3IQTA 1IZMA 3F46A 1QQ3A 4IAQA 2PX0A 2HJMA 2WVNA 4IWBA 3U2LA 3POVA 1S7ZA 2HSQA 1M2OA 1YYXA 5AGFA 2VCAA 5BQGA 3UR3C 3ZQYA 4OD5A 3AOUA 3IPMO 4YK5A 4E17A 3RIPA 2IYLD 2LIGA 5TJ5E 3PHF2 2AVKA 4JVSA 3LS1A 4OINF 2L6FA 2V3CC 1D0YA 3NMIA 1T6UA 3T4RA 2KYHA 3PCVA 4RBNA 1BBHA 2WL8A 4C3EA 5E33A 4G7OF 3JSZA 5B3IA 2DYRC 2GA0A 2D4UA 3FOOA 3EGXA 4C3BA 5AC4A 3T6GB 2G3VA 3V5ZA 2YRFA 3ZC4A 1R4TA 1VB5A 2HMZA 3WHNA 5L3QA 3SXZA 4AE4A 2H8AA 4Q5SF 2OJQA 4YL0A 2R7RA 2CCYA 2PFDA 4C3DA 1C03A 4KBLA 3HNJA 2R9RB 2PP4A 3LS0A 3N24A 5B1AC 3ZTMA 3ZTZA 2Q4FA 4DVYP 1E83A 4OIRF 4K0DA 4E18A 2DI3A 1E85A 1ZHZA 1PD1A 2XLWA 4JE9A 3RW0A 3CSKA 5HSWA 1HY5A 4BEMJ 1ORJA 1TWCA 4HEAJ 4DOZA 4C7OA 2M4EA 5GPGB 1JRAA 2PBEA 1AEPA 4A4AA 4GYTA 2FAPB 1QSPA 1FFHA 2M64A 1UG7A 1TR2A 2A1DD 1YYJA 4A2NB 4CBEA 4CS8C 2A6EF 5E3CA 1FMWA 3S90A 4W8PA 1D1BA 2BL2A 1DOWA 1HMOA 3RVYA 1OCOC 2Q3TA 3O39A 3HLZA 3EH2A 2W4MA 3LEOA 2Q7RA 1LKXA 3W8HA 2DYSC 1WN0A 4BJ1A 3C8GD 3AG1C 3Q7GA 1S05A 3GM1A 4I44A 4G78A 2OU6A 3A9CA 2QTVA 4J32B 1FMVA 4J7TA 4NY3A 4XEKA 4LERA 1BR1A 2YWAA 4Z9JA 5A6AA 3LNMB 3S29A 3GWNA 1H7IA 3M79A 4EKWA 1W2WA 2J0WA 2B0JA 2PX3A 2XLEA 2F22A 2ZD9A 4HFKB 5F28E 3B0UX 3GODA 3IQCA 1JAFA 5L3VA 2L6HA 2G62A 2AWYA 1HE9A 4YWQA 1VK5A 5CI9A 3MBGA 4AL1A 2YKZA 4PACA 4KC9A 4K1OA 1T9KA 2YLGA 1C02A 3B0PA 3EG9A 3H65A 5T1DB 1VTMP 3C8GA 1OW8A 2HV7A 4KNVA 1O5HA 2ETSA 3B29A 2ZXPA 3LESA 3JYHA 4BJ5C 4MVSA 2KJGA 5DS4A 2HMQA 1F1MA 2I8BA 2MHRA 4Z9IA 4YJWA 2QLAA 1ZU5A 3RYLA 4XEFA 2MYSA 3A11A 3S27A 2YVKA 3ITFA 2NPUA 3H2VA 3KL4A 4O79A 2CGEA 1I4ZA 4WJ0A 3SP1A 3JRMO 3ASNC 1I5NA 3FAJA 1EI7A 3EFOA 4NCQA 3Q6MA 1G4US 1Y4CA 2Y3BA 3DM9B 3FXHA 1ZW2A 4BJTA 4MW3A 1JPJA 5L0IA 1KU2A 1NSGB 2EIMC 4BPMA 4QI2A 2DGJA 2LP4A 3K6BA 4PJLA 1ZHXA 1T5OA 3M4CA 1C17M 1OKKD 2EPOA 1ZW3A 2CDQA 2Y3HA 4DBRA 3LNRA 1ZHTA 1NFOA 1MMGA 2IXPA 2P61A 1Z7Qc 3C63A 4PJJA 2X51A 1OR3A 3LLIA 1OW6A 4Z9HA 3FAPB 1A0BA 3GM2A 2WZLA 4YL1A 1I4YA 3IQ6A 5KYUA 1MMNA 2KQ9A 3ABLC 1QLEC 3JRTA 3EGXB 1TWHA 2JX0A 3CEXA 2YLDA 4JTDB 3ATPA 2W4BA 1HMDA 1N1CA 5JVEA 2C03A 2Q9AA 1LM3B 3CQZA 4G0HA 4CX9A 4OIPF 4AE4B 1VYIA 1J8YF 1NLXA 4EBKA 4MTGA 1OKKA 3ZSUA 2J9BA 2V26A 1ZZPA 2EPLX 4XPWA 1LI5A 4EIYA 3U3BA 1L3PA 2WB7A 4KNWA 4LDKA 2VASA 4PR9A 4ER9A 3ABMC 2OEVA 5L0JA 4MTFA 1YARO 2ASRA 4N06A 3ZVRA 1VLSA 4EWCA 3QVYA 4NTAA 1Z63A 2P0NA 2NUPB 4C7OB 2UUHA 1Z5ZA 2VCCA 3MX3A 3SXYA 1HE1A 2EINC 3H2UA 4CS8A 1L7CA 2KNHA 2XL8A 2A0BA 2EILC 1GGQA 2NSGA 4M63A 3IQ5A 2J46A 1KNYA 4MS2A 2AWCA 2GDCA 4I1MA 3RF3A 3T9OA 3FDQA 1HW2A 1TFOB 3SZRA 1K40A 4U5BE 4MNDA 2R7XA 1U0BB 4JTAB 3G4XA 3K1HA 2JPUA 5DVWA 3G4ZA 1AUEA 3C8ZA 3MYIA 2ZXRA 2IM8A 3DJUB 3N2ZB 1VYKA 1M56C 3Q7LA 4IJJA 1UFBA 4XEVA 2LD6A 5L0GA 3AQBA 5F5FA 3NYLA 4HE8D 1V4AA 4JIOA 4JEBA 4D4XA 4N6HA 3NRHA 2HJ3A 3N0TA 1Z3IX 4PK4A 1LVKA 1FTSA 4FX5A 1WWPA 3SNHA 3M4BA 3Q6NA 2A0UA 3MYFA 1TQGA 1XZPA 4YN0B 3NG1A 3EG9B 1ZHYA 1D0ZA 1A7VA 3C8GB 5A69A 4XPYA 2GFHA 1FNTc 5KYXA 4DRIB 1V54C 2O9XA 2H7OA 1NG1A 3O55A 1OCRC 2G3KA 3GEIA 4MVMA 5COFA 1Z6AA 4CDYA 2NUPA 2XLOA 2ZXWC 1SF8A 3GEHA 2YHSA 1U89A 1RXQA 3B71A 1LS4A 3KH2A 3EGDA 3O10A 4MVZA 2WZGA 4IRUA 2P6VA 1Q0GA 4U5EE 4EHPA 1YDIA 1M2VB 1TWAA 2XM4A 2OCCC 3C62A 2DB4A 2KGOA 4H4KC 4WGZA 4KI2A 4J30B 5IY5C 3EFOB 3HNLA 2QE9A 3ASOC 4U9EA 3T6BA 5BQIA 1XZQA 4CJGA 3JZ0A 2A68F 3I5QA 1ZYRF 3I5PA 2Q00A 4OIOF 4AL0A 3AG3C 1O87A 3V5YA 2Z15A 3RH3A 3L1MA 3KYJA 1LE2A 1M57C 2R7UA 1FAPB 3FMSA 2CYDA 5DQTA 2LCHA 3GORA 4QI0A 1D0XA 4DRHB 1RCPA 3K66A 3U0CA 4ZLCA 1NU7D 4LACB 2WVOA 5A6KA 3M15A 3W2WA 4MTOA 1A7DA 2IXOA 1CGNA 3EPVA 1OCZC 3LJBA 2L6GA 3ABKC 2KSFA 4O6MA 4B6IA 3L8IA 4UDVA 1YA9A 4LDRA 1BZ4A 1QPUA 5DS5A 3IEEA 1NU9C 4LDQA 3EZHA 3V7OA 3X2QC 4G7ZF 4ULVA 3FOPA 1WTYA 4BJ6A 2KW3C 4K7BA 3ZG1A 4MVRA 4MVQA 4PJNA 2J8WA 2J9UA 3B9QA 3NDBB 1MMDA 2A69F 2VH3A 1OQCA 3OEOA 1JPNA 4DBQA 3DMDA 3KMIA 4U5CE 3OWTA 5COGA 4BJ6C 2GAQA 2X0CA 1M2VA 3RQGA 1Q0DA 2J0XA 1YJGA 1GM5A 4FESA 3RKOF 4IB4A 2LSEA 2R03A 1K04A 3QW1A 3G50A 3NYJA 5E3AA 1WATA 5L0FA 5KYYA 1OXBA 4OIQF 1MQVA 2W45A 3ZWIA 2YEVA 4CDAA 2XL6A 1JR8A 1IW7F 4JEAA 4Q7CA 3LAYA 4U5GA 2L81A 1QKRA 4J7YA 2YZSA 5EHHA 3EQLF 4CDVA 1ORSC 1PCXA 3V5XA 5JRAA 3VF0A 3O6XA 5L0CA 2NG1A 2AP3A 3SXMA 1BR2A 2NUTA 2OEXA 1GQAA 1M6TA 1ST6A 4AK9A 2QY9A 4YT4A 1A7EA 5T3WA 2BC5A 2RSEB 1MMAA 3E9VA 4Q4ZF 3ECSA 1EKYA 1ZHWA 3R7CA 2KC3A 2L7AA 3HNKA 3K7DA 3UMIA 5KYNA 3TULA 3NKDA 5KYWA 3DI5A 1YA7O 5JLIA 2UUIA 1T6IA 3DJNB 4X0RA 3TQOA 2QUPA 256BA 2HS5A 2WZFA 1EA8A 1V74B 1B68A 2R7SA 5FZTA 1Q0MA 4JKVA 4U5FE 3C7JA 1K05A 2D5RB 2WVQA 4U5HA 5KYXB 2R7OA 2XSEA 2J7PD 3RFYA 1CGME 4BJ5A 3GEEA 2XLVA 2Q9CA 2XLDA 2PNOA 3DKAA 5DQZA 3EH1A 2XS8A 4LLEA 3KPHA 1RKCA 2ZXOA 3EGDB 4CSAA 4ONSA 2YQYA 3T6JA 3LLKA 3QW0A 1KTMA 4N4WA 3U9MA 3EZIA 1Q0FA 3M1CB 4DXWA 2LK4A 5CI8A 1EQ1A 3TD7A 1Z23A 4HFFB 4BEJA 4E7ZA 2R7VA 2L9JA 1LI7A 5JS5A 2YLIA 4DVZA 3FHDA 3L8JA 3B0VC 1RJ9B 3WAQA 3LUTB 1Y6DA 1WASA 5CIVA 4I1OB 2PF4E 4IARA 1G5ZA 4JRZA 3S9OA 4ANJA 2J7PA 2BE5F 4JW1A 1BR4A 3AGUA 1OCCC 1YLMA 4E7SA 3HNIA 5EGYA 5HV9A 2EPKX 1D1CA 3QZCA 3U5SA 5BQHA 4CS7A 4H54A 2Y3GA 1BDJB 4WABA 5A6JA 2W9YA 4P9TA
chains in the Genus database with same CATH topology
4CJGA 3ZQVA 4CIPA 2QLAA 1CPQA 2YL0A 3L1MA 3ZTMA 3VRCA 4D4NA 1RCPA 3M15A 1CGNA 3QVZA 1YZAA 4WGYA 3M4CA 1QPUA 2YL3A 2YL7A 1QQ3A 4IAQA 3FOPA 4ULVA 3C63A 2YL1A 1E86A 3TOLA 1YYXA 2XLMA 2J8WA 5AGFA 3ZQYA 3IQ6A 5JVEA 2YLDA 1LM3B 4CX9A 3NMIA 1BBHA 1CPRA 4IB4A 2J9BA 3QW1A 4EIYA 5B3IA 1MQVA 3ZWIA 3NMJA 3FOOA 4ER9A 4CDAA 2XL6A 4JEAA 3QVYA 1CGOA 4CDVA 5JRAA 5JP7A 2CCYA 2XL8A 1GQAA 3HNJA 1M6TA 3ZTZA 1E83A 3DE9A 1YZCA 3IQ5A 1E85A 2BC5A 2XLWA 1EKYA 3DE8A 4JE9A 3U8PA 3HNKA 5JSLA 5JLIA 256BA 1YYJA 4JKVA 4D4XA 4JEBA 4N6HA 4L6RA 2XLVA 2XLDA 2XLHA 1S05A 4U9DA 1E84A 3M4BA 3QW0A 5JUAA 4N4WA 1A7VA 3M79A 2XLEA 5JS5A 2YLIA 4CDYA 4NC3A 1JAFA 2XLOA 1APCA 4IARA 2XM0A 4CJOA 2YKZA 5JT4A 2YLGA 2XM4A 3C62A 3HNIA 3NMKA 4WGZA 1NBBA 3HNLA 4U9EA 3TOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJG A;  3ZQV A;  4CIP A;  2QLA A;  1CPQ A;  2YL0 A;  3L1M A;  3ZTM A;  3VRC A;  4D4N A;  1RCP A;  3M15 A;  1CGN A;  3QVZ A;  1YZA A;  4WGY A;  3M4C A;  1QPU A;  2YL3 A;  2YL7 A;  1QQ3 A;  4IAQ A;  3FOP A;  4ULV A;  3C63 A;  2YL1 A;  1E86 A;  3TOL A;  1YYX A;  2XLM A;  2J8W A;  5AGF A;  3ZQY A;  3IQ6 A;  5JVE A;  2YLD A;  1LM3 B;  4CX9 A;  3NMI A;  1BBH A;  1CPR A;  4IB4 A;  2J9B A;  3QW1 A;  4EIY A;  5B3I A;  1MQV A;  3ZWI A;  3NMJ A;  3FOO A;  4ER9 A;  4CDA A;  2XL6 A;  4JEA A;  3QVY A;  1CGO A;  4CDV A;  5JRA A;  5JP7 A;  2CCY A;  2XL8 A;  1GQA A;  3HNJ A;  1M6T A;  3ZTZ A;  1E83 A;  3DE9 A;  1YZC A;  3IQ5 A;  1E85 A;  2BC5 A;  2XLW A;  1EKY A;  3DE8 A;  4JE9 A;  3U8P A;  3HNK A;  5JSL A;  5JLI A;  256B A;  1YYJ A;  4JKV A;  4D4X A;  4JEB A;  4N6H A;  4L6R A;  2XLV A;  2XLD A;  2XLH A;  1S05 A;  4U9D A;  1E84 A;  3M4B A;  3QW0 A;  5JUA A;  4N4W A;  1A7V A;  3M79 A;  2XLE A;  5JS5 A;  2YLI A;  4CDY A;  4NC3 A;  1JAF A;  2XLO A;  1APC A;  4IAR A;  2XM0 A;  4CJO A;  2YKZ A;  5JT4 A;  2YLG A;  2XM4 A;  3C62 A;  3HNI A;  3NMK A;  4WGZ A;  1NBB A;  3HNL A;  4U9E A;  3TOM A; 
#chains in the Genus database with same CATH topology
 3WOD F;  2LFD A;  2E87 A;  3JT1 A;  4JCH A;  3AG2 C;  4JTC B;  4NTF A;  5EK0 A;  3DZA A;  4CS9 C;  4YT8 A;  4RDA A;  3TJ6 A;  2RD9 A;  3VYW A;  3VM6 A;  1LS1 A;  5BUO A;  4XWJ A;  5DS6 A;  2IXN A;  3GM3 A;  3W2V A;  1VLT A;  4YT5 A;  2J9V A;  4EUK B;  3VRC A;  1RKE B;  3L0I A;  2HV6 A;  4JJG A;  3AQC A;  3OA1 A;  4U5D E;  4XPX A;  5K0I A;  4GEH A;  5D92 A;  1TWG A;  3EHM A;  3UNG C;  1YZA A;  5A6B D;  4P9F A;  1HW1 A;  3US6 A;  3BEH A;  3K33 A;  2JD3 A;  4AX2 A;  1TKN A;  2YL3 A;  1VOM A;  2GWW A;  2R25 A;  4PFO A;  4CSA C;  4PFP A;  3AG4 C;  3PMR A;  2OJE D;  2Q9B A;  1AVO B;  2YL1 A;  2HFI A;  3SXK A;  1E86 A;  3SEO A;  1WGW A;  3TOL A;  1T01 A;  3AJM A;  5E2Q A;  2XLM A;  2FFH A;  1RJ9 A;  1XWJ A;  2CNW D;  5KYY B;  2ZPA A;  1LE4 A;  1R5I D;  3LEV A;  2EIJ C;  3MFN A;  1QZX A;  3U9J A;  3K1I C;  3NKE A;  3GWL A;  2OG2 A;  3EHN A;  4XQ1 A;  2NSF A;  3E70 C;  1Q0K A;  3RQE A;  3U3F A;  2Y69 C;  4XLP F;  2XXA A;  1DOV A;  2OOC A;  2IBF A;  3UMK A;  3S84 A;  1G8X A;  3TK0 A;  4BG0 A;  1SMY F;  1WOL A;  2QNL A;  3BRJ A;  3IHU A;  4MVU A;  5A6B A;  3KKB A;  3QMK A;  3R2P A;  3EJN A;  1CPR A;  2P1A A;  5D91 A;  3SYN A;  2NUT B;  3UGP A;  2CW0 F;  2EIK C;  3FVY A;  5L0D A;  2OKU A;  1PV3 A;  2VC9 A;  4DJ9 A;  2P7V A;  1H9G A;  2H7B A;  2XL4 A;  3NMJ A;  1ZVZ A;  3HJC A;  4N6C A;  2LQG A;  3JSE O;  2Y39 A;  4P6I C;  2CNW A;  3QTH A;  3NYM A;  1D1A A;  1CGO A;  1SZI A;  4QDL A;  4R32 A;  1YAU O;  5F5H A;  3DM5 A;  1A41 A;  3UMH A;  1NFN A;  1MND A;  1RKE A;  5KYW B;  5JP7 A;  4XLN F;  3HTK C;  4NTB A;  2Y3D A;  3DWW A;  4FWV A;  1SR2 A;  3DE9 A;  1YZC A;  3GAN A;  4W8K A;  4F4B A;  2ICW G;  2J45 A;  3DD7 A;  4JZA A;  3PDM P;  3X1O A;  3DXJ F;  3DE8 A;  5T3T A;  1E2X A;  2R02 A;  3W4Y A;  3ZIB A;  4E0H A;  1ORY A;  2J9W A;  3U8P A;  2R7T A;  2HUJ A;  4LLC A;  5B3S C;  2R05 A;  4JC7 A;  1SYQ A;  5JSL A;  4MQ9 F;  2FGY A;  4RD9 A;  2LFF A;  4DRJ B;  2I15 A;  2MWQ A;  1GS9 A;  3W8I A;  4IAO A;  3CZ6 A;  3C18 A;  3HKK A;  4JUR I;  4O7G A;  4IGG A;  4L6R A;  4NQF A;  1ZU4 A;  3S28 A;  2XLH A;  4U9D A;  3DAF A;  4EBB A;  1E84 A;  1O3U A;  3WG7 C;  2HKV A;  1JMW A;  2EPM X;  1H9T A;  4YT2 A;  3F47 A;  3RVZ A;  5JUA A;  4OD4 A;  4ULW A;  3AGT A;  2KK1 A;  2IOQ A;  3MLG A;  4I3M A;  5COM A;  1MNE A;  2B0H A;  4E0I A;  4CS9 A;  2R7Q A;  3VAY A;  2C04 A;  1G4W R;  1V55 C;  4NC3 A;  2EPN A;  2VCB A;  1LIH A;  1TFK B;  1APC A;  4MVO A;  2XM0 A;  1FFT C;  4CJO A;  4CIH A;  4GQH A;  1VMA A;  4JCZ A;  1J8M F;  5JT4 A;  3NMK A;  2XS1 A;  5L0H A;  1JOG A;  4YL3 A;  1NBB A;  3TOM A;  4O6Y A;  3J06 A;  4MW8 A;  3U2M A;  3DAG A;  3JTL O;  2TMV P;  2HZ8 A;  3ZQV A;  1T6Q A;  4CIP A;  4EBJ A;  5B1B C;  4PJM A;  4XTK A;  5KYU B;  3I4U A;  2H7V C;  3L34 A;  1CPQ A;  2YL0 A;  1RMV A;  4ZLD A;  3TJ5 A;  4JJF A;  2A6H F;  1QVX A;  1FR0 A;  3KYI A;  2AU5 A;  3CAX A;  1OW7 A;  3JCU Q;  2R7W A;  1PD0 A;  3UGO A;  2XRH A;  1NZE A;  5DLJ A;  1U6H A;  2IXM A;  4O6N A;  4D4N A;  4G7H F;  4FAP B;  3K1I A;  1YVI A;  1OR2 A;  3QVZ A;  3ZDL A;  5AC5 A;  1LPE A;  4WGY A;  5FCL A;  2VB6 A;  3U8V A;  2HSB A;  1OXK A;  3RQF A;  2XXA B;  1H6G A;  2YL7 A;  2OQM A;  3S0X A;  3JYY A;  3IQT A;  1IZM A;  3F46 A;  1QQ3 A;  4IAQ A;  2PX0 A;  2HJM A;  2WVN A;  4IWB A;  3U2L A;  3POV A;  1S7Z A;  2HSQ A;  1M2O A;  1YYX A;  5AGF A;  2VCA A;  5BQG A;  3UR3 C;  3ZQY A;  4OD5 A;  3AOU A;  3IPM O;  4YK5 A;  4E17 A;  3RIP A;  2IYL D;  2LIG A;  5TJ5 E;  3PHF 2;  2AVK A;  4JVS A;  3LS1 A;  4OIN F;  2L6F A;  2V3C C;  1D0Y A;  3NMI A;  1T6U A;  3T4R A;  2KYH A;  3PCV A;  4RBN A;  1BBH A;  2WL8 A;  4C3E A;  5E33 A;  4G7O F;  3JSZ A;  5B3I A;  2DYR C;  2GA0 A;  2D4U A;  3FOO A;  3EGX A;  4C3B A;  5AC4 A;  3T6G B;  2G3V A;  3V5Z A;  2YRF A;  3ZC4 A;  1R4T A;  1VB5 A;  2HMZ A;  3WHN A;  5L3Q A;  3SXZ A;  4AE4 A;  2H8A A;  4Q5S F;  2OJQ A;  4YL0 A;  2R7R A;  2CCY A;  2PFD A;  4C3D A;  1C03 A;  4KBL A;  3HNJ A;  2R9R B;  2PP4 A;  3LS0 A;  3N24 A;  5B1A C;  3ZTM A;  3ZTZ A;  2Q4F A;  4DVY P;  1E83 A;  4OIR F;  4K0D A;  4E18 A;  2DI3 A;  1E85 A;  1ZHZ A;  1PD1 A;  2XLW A;  4JE9 A;  3RW0 A;  3CSK A;  5HSW A;  1HY5 A;  4BEM J;  1ORJ A;  1TWC A;  4HEA J;  4DOZ A;  4C7O A;  2M4E A;  5GPG B;  1JRA A;  2PBE A;  1AEP A;  4A4A A;  4GYT A;  2FAP B;  1QSP A;  1FFH A;  2M64 A;  1UG7 A;  1TR2 A;  2A1D D;  1YYJ A;  4A2N B;  4CBE A;  4CS8 C;  2A6E F;  5E3C A;  1FMW A;  3S90 A;  4W8P A;  1D1B A;  2BL2 A;  1DOW A;  1HMO A;  3RVY A;  1OCO C;  2Q3T A;  3O39 A;  3HLZ A;  3EH2 A;  2W4M A;  3LEO A;  2Q7R A;  1LKX A;  3W8H A;  2DYS C;  1WN0 A;  4BJ1 A;  3C8G D;  3AG1 C;  3Q7G A;  1S05 A;  3GM1 A;  4I44 A;  4G78 A;  2OU6 A;  3A9C A;  2QTV A;  4J32 B;  1FMV A;  4J7T A;  4NY3 A;  4XEK A;  4LER A;  1BR1 A;  2YWA A;  4Z9J A;  5A6A A;  3LNM B;  3S29 A;  3GWN A;  1H7I A;  3M79 A;  4EKW A;  1W2W A;  2J0W A;  2B0J A;  2PX3 A;  2XLE A;  2F22 A;  2ZD9 A;  4HFK B;  5F28 E;  3B0U X;  3GOD A;  3IQC A;  1JAF A;  5L3V A;  2L6H A;  2G62 A;  2AWY A;  1HE9 A;  4YWQ A;  1VK5 A;  5CI9 A;  3MBG A;  4AL1 A;  2YKZ A;  4PAC A;  4KC9 A;  4K1O A;  1T9K A;  2YLG A;  1C02 A;  3B0P A;  3EG9 A;  3H65 A;  5T1D B;  1VTM P;  3C8G A;  1OW8 A;  2HV7 A;  4KNV A;  1O5H A;  2ETS A;  3B29 A;  2ZXP A;  3LES A;  3JYH A;  4BJ5 C;  4MVS A;  2KJG A;  5DS4 A;  2HMQ A;  1F1M A;  2I8B A;  2MHR A;  4Z9I A;  4YJW A;  2QLA A;  1ZU5 A;  3RYL A;  4XEF A;  2MYS A;  3A11 A;  3S27 A;  2YVK A;  3ITF A;  2NPU A;  3H2V A;  3KL4 A;  4O79 A;  2CGE A;  1I4Z A;  4WJ0 A;  3SP1 A;  3JRM O;  3ASN C;  1I5N A;  3FAJ A;  1EI7 A;  3EFO A;  4NCQ A;  3Q6M A;  1G4U S;  1Y4C A;  2Y3B A;  3DM9 B;  3FXH A;  1ZW2 A;  4BJT A;  4MW3 A;  1JPJ A;  5L0I A;  1KU2 A;  1NSG B;  2EIM C;  4BPM A;  4QI2 A;  2DGJ A;  2LP4 A;  3K6B A;  4PJL A;  1ZHX A;  1T5O A;  3M4C A;  1C17 M;  1OKK D;  2EPO A;  1ZW3 A;  2CDQ A;  2Y3H A;  4DBR A;  3LNR A;  1ZHT A;  1NFO A;  1MMG A;  2IXP A;  2P61 A;  1Z7Q c;  3C63 A;  4PJJ A;  2X51 A;  1OR3 A;  3LLI A;  1OW6 A;  4Z9H A;  3FAP B;  1A0B A;  3GM2 A;  2WZL A;  4YL1 A;  1I4Y A;  3IQ6 A;  5KYU A;  1MMN A;  2KQ9 A;  3ABL C;  1QLE C;  3JRT A;  3EGX B;  1TWH A;  2JX0 A;  3CEX A;  2YLD A;  4JTD B;  3ATP A;  2W4B A;  1HMD A;  1N1C A;  5JVE A;  2C03 A;  2Q9A A;  1LM3 B;  3CQZ A;  4G0H A;  4CX9 A;  4OIP F;  4AE4 B;  1VYI A;  1J8Y F;  1NLX A;  4EBK A;  4MTG A;  1OKK A;  3ZSU A;  2J9B A;  2V26 A;  1ZZP A;  2EPL X;  4XPW A;  1LI5 A;  4EIY A;  3U3B A;  1L3P A;  2WB7 A;  4KNW A;  4LDK A;  2VAS A;  4PR9 A;  4ER9 A;  3ABM C;  2OEV A;  5L0J A;  4MTF A;  1YAR O;  2ASR A;  4N06 A;  3ZVR A;  1VLS A;  4EWC A;  3QVY A;  4NTA A;  1Z63 A;  2P0N A;  2NUP B;  4C7O B;  2UUH A;  1Z5Z A;  2VCC A;  3MX3 A;  3SXY A;  1HE1 A;  2EIN C;  3H2U A;  4CS8 A;  1L7C A;  2KNH A;  2XL8 A;  2A0B A;  2EIL C;  1GGQ A;  2NSG A;  4M63 A;  3IQ5 A;  2J46 A;  1KNY A;  4MS2 A;  2AWC A;  2GDC A;  4I1M A;  3RF3 A;  3T9O A;  3FDQ A;  1HW2 A;  1TFO B;  3SZR A;  1K40 A;  4U5B E;  4MND A;  2R7X A;  1U0B B;  4JTA B;  3G4X A;  3K1H A;  2JPU A;  5DVW A;  3G4Z A;  1AUE A;  3C8Z A;  3MYI A;  2ZXR A;  2IM8 A;  3DJU B;  3N2Z B;  1VYK A;  1M56 C;  3Q7L A;  4IJJ A;  1UFB A;  4XEV A;  2LD6 A;  5L0G A;  3AQB A;  5F5F A;  3NYL A;  4HE8 D;  1V4A A;  4JIO A;  4JEB A;  4D4X A;  4N6H A;  3NRH A;  2HJ3 A;  3N0T A;  1Z3I X;  4PK4 A;  1LVK A;  1FTS A;  4FX5 A;  1WWP A;  3SNH A;  3M4B A;  3Q6N A;  2A0U A;  3MYF A;  1TQG A;  1XZP A;  4YN0 B;  3NG1 A;  3EG9 B;  1ZHY A;  1D0Z A;  1A7V A;  3C8G B;  5A69 A;  4XPY A;  2GFH A;  1FNT c;  5KYX A;  4DRI B;  1V54 C;  2O9X A;  2H7O A;  1NG1 A;  3O55 A;  1OCR C;  2G3K A;  3GEI A;  4MVM A;  5COF A;  1Z6A A;  4CDY A;  2NUP A;  2XLO A;  2ZXW C;  1SF8 A;  3GEH A;  2YHS A;  1U89 A;  1RXQ A;  3B71 A;  1LS4 A;  3KH2 A;  3EGD A;  3O10 A;  4MVZ A;  2WZG A;  4IRU A;  2P6V A;  1Q0G A;  4U5E E;  4EHP A;  1YDI A;  1M2V B;  1TWA A;  2XM4 A;  2OCC C;  3C62 A;  2DB4 A;  2KGO A;  4H4K C;  4WGZ A;  4KI2 A;  4J30 B;  5IY5 C;  3EFO B;  3HNL A;  2QE9 A;  3ASO C;  4U9E A;  3T6B A;  5BQI A;  1XZQ A;  4CJG A;  3JZ0 A;  2A68 F;  3I5Q A;  1ZYR F;  3I5P A;  2Q00 A;  4OIO F;  4AL0 A;  3AG3 C;  1O87 A;  3V5Y A;  2Z15 A;  3RH3 A;  3L1M A;  3KYJ A;  1LE2 A;  1M57 C;  2R7U A;  1FAP B;  3FMS A;  2CYD A;  5DQT A;  2LCH A;  3GOR A;  4QI0 A;  1D0X A;  4DRH B;  1RCP A;  3K66 A;  3U0C A;  4ZLC A;  1NU7 D;  4LAC B;  2WVO A;  5A6K A;  3M15 A;  3W2W A;  4MTO A;  1A7D A;  2IXO A;  1CGN A;  3EPV A;  1OCZ C;  3LJB A;  2L6G A;  3ABK C;  2KSF A;  4O6M A;  4B6I A;  3L8I A;  4UDV A;  1YA9 A;  4LDR A;  1BZ4 A;  1QPU A;  5DS5 A;  3IEE A;  1NU9 C;  4LDQ A;  3EZH A;  3V7O A;  3X2Q C;  4G7Z F;  4ULV A;  3FOP A;  1WTY A;  4BJ6 A;  2KW3 C;  4K7B A;  3ZG1 A;  4MVR A;  4MVQ A;  4PJN A;  2J8W A;  2J9U A;  3B9Q A;  3NDB B;  1MMD A;  2A69 F;  2VH3 A;  1OQC A;  3OEO A;  1JPN A;  4DBQ A;  3DMD A;  3KMI A;  4U5C E;  3OWT A;  5COG A;  4BJ6 C;  2GAQ A;  2X0C A;  1M2V A;  3RQG A;  1Q0D A;  2J0X A;  1YJG A;  1GM5 A;  4FES A;  3RKO F;  4IB4 A;  2LSE A;  2R03 A;  1K04 A;  3QW1 A;  3G50 A;  3NYJ A;  5E3A A;  1WAT A;  5L0F A;  5KYY A;  1OXB A;  4OIQ F;  1MQV A;  2W45 A;  3ZWI A;  2YEV A;  4CDA A;  2XL6 A;  1JR8 A;  1IW7 F;  4JEA A;  4Q7C A;  3LAY A;  4U5G A;  2L81 A;  1QKR A;  4J7Y A;  2YZS A;  5EHH A;  3EQL F;  4CDV A;  1ORS C;  1PCX A;  3V5X A;  5JRA A;  3VF0 A;  3O6X A;  5L0C A;  2NG1 A;  2AP3 A;  3SXM A;  1BR2 A;  2NUT A;  2OEX A;  1GQA A;  1M6T A;  1ST6 A;  4AK9 A;  2QY9 A;  4YT4 A;  1A7E A;  5T3W A;  2BC5 A;  2RSE B;  1MMA A;  3E9V A;  4Q4Z F;  3ECS A;  1EKY A;  1ZHW A;  3R7C A;  2KC3 A;  2L7A A;  3HNK A;  3K7D A;  3UMI A;  5KYN A;  3TUL A;  3NKD A;  5KYW A;  3DI5 A;  1YA7 O;  5JLI A;  2UUI A;  1T6I A;  3DJN B;  4X0R A;  3TQO A;  2QUP A;  256B A;  2HS5 A;  2WZF A;  1EA8 A;  1V74 B;  1B68 A;  2R7S A;  5FZT A;  1Q0M A;  4JKV A;  4U5F E;  3C7J A;  1K05 A;  2D5R B;  2WVQ A;  4U5H A;  5KYX B;  2R7O A;  2XSE A;  2J7P D;  3RFY A;  1CGM E;  4BJ5 A;  3GEE A;  2XLV A;  2Q9C A;  2XLD A;  2PNO A;  3DKA A;  5DQZ A;  3EH1 A;  2XS8 A;  4LLE A;  3KPH A;  1RKC A;  2ZXO A;  3EGD B;  4CSA A;  4ONS A;  2YQY A;  3T6J A;  3LLK A;  3QW0 A;  1KTM A;  4N4W A;  3U9M A;  3EZI A;  1Q0F A;  3M1C B;  4DXW A;  2LK4 A;  5CI8 A;  1EQ1 A;  3TD7 A;  1Z23 A;  4HFF B;  4BEJ A;  4E7Z A;  2R7V A;  2L9J A;  1LI7 A;  5JS5 A;  2YLI A;  4DVZ A;  3FHD A;  3L8J A;  3B0V C;  1RJ9 B;  3WAQ A;  3LUT B;  1Y6D A;  1WAS A;  5CIV A;  4I1O B;  2PF4 E;  4IAR A;  1G5Z A;  4JRZ A;  3S9O A;  4ANJ A;  2J7P A;  2BE5 F;  4JW1 A;  1BR4 A;  3AGU A;  1OCC C;  1YLM A;  4E7S A;  3HNI A;  5EGY A;  5HV9 A;  2EPK X;  1D1C A;  3QZC A;  3U5S A;  5BQH A;  4CS7 A;  4H54 A;  2Y3G A;  1BDJ B;  4WAB A;  5A6J A;  2W9Y A;  4P9T A; 
#chains in the Genus database with same CATH homology
 4CJG A;  3ZQV A;  4CIP A;  2QLA A;  1CPQ A;  2YL0 A;  3L1M A;  3ZTM A;  3VRC A;  4D4N A;  1RCP A;  3M15 A;  1CGN A;  3QVZ A;  1YZA A;  4WGY A;  3M4C A;  1QPU A;  2YL3 A;  2YL7 A;  1QQ3 A;  4IAQ A;  3FOP A;  4ULV A;  3C63 A;  2YL1 A;  1E86 A;  3TOL A;  1YYX A;  2XLM A;  2J8W A;  5AGF A;  3ZQY A;  3IQ6 A;  5JVE A;  2YLD A;  1LM3 B;  4CX9 A;  3NMI A;  1BBH A;  1CPR A;  4IB4 A;  2J9B A;  3QW1 A;  4EIY A;  5B3I A;  1MQV A;  3ZWI A;  3NMJ A;  3FOO A;  4ER9 A;  4CDA A;  2XL6 A;  4JEA A;  3QVY A;  1CGO A;  4CDV A;  5JRA A;  5JP7 A;  2CCY A;  2XL8 A;  1GQA A;  3HNJ A;  1M6T A;  3ZTZ A;  1E83 A;  3DE9 A;  1YZC A;  3IQ5 A;  1E85 A;  2BC5 A;  2XLW A;  1EKY A;  3DE8 A;  4JE9 A;  3U8P A;  3HNK A;  5JSL A;  5JLI A;  256B A;  1YYJ A;  4JKV A;  4D4X A;  4JEB A;  4N6H A;  4L6R A;  2XLV A;  2XLD A;  2XLH A;  1S05 A;  4U9D A;  1E84 A;  3M4B A;  3QW0 A;  5JUA A;  4N4W A;  1A7V A;  3M79 A;  2XLE A;  5JS5 A;  2YLI A;  4CDY A;  4NC3 A;  1JAF A;  2XLO A;  1APC A;  4IAR A;  2XM0 A;  4CJO A;  2YKZ A;  5JT4 A;  2YLG A;  2XM4 A;  3C62 A;  3HNI A;  3NMK A;  4WGZ A;  1NBB A;  3HNL A;  4U9E A;  3TOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...