3M4CA

A zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m4cA00
1LM3B 5JT4A 2YLDA 3U8PA 4CX9A 3NMKA 1E86A 1EKYA 1CGOA 4U9EA 5JSLA 3M79A 5JUAA 3DE8A 4IAQA 4D4NA 1YYXA 3QW0A 4JEAA 4ULVA 256BA 4CDVA 4EIYA 4WGYA 1QPUA 2J8WA 4NC3A 3C63A 1MQVA 2YKZA 3FOPA 1GQAA 2YL0A 3TOMA 3ZTZA 4IB4A 3QVYA 4N4WA 4WGZA 2BC5A 3QVZA 1YZCA 3IQ5A 3IQ6A 1CGNA 3ZTMA 3HNJA 2QLAA 2YL7A 5JS5A 2YL1A 1E84A 3ZQYA 1RCPA 2XLHA 2XL8A 3FOOA 2XLEA 3HNIA 2XLOA 3NMJA 4D4XA 5JRAA 3M4CA 5JP7A 4ER9A 1YYJA 2XM0A 3ZWIA 3ZQVA 4CDYA 4CDAA 2YLGA 3M15A 5JVEA 1BBHA 3NMIA 2XLDA 2XLMA 3L1MA 2YLIA 4U9DA 3M4BA 1CPQA 3HNLA 4CIPA 1YZAA 1A7VA 2XL6A 5AGFA 1APCA 1M6TA 2XM4A 4CJOA 4L6RA 4CJGA 5JLIA 1E83A 1S05A 4JE9A 3DE9A 1JAFA 1E85A 1QQ3A 3C62A 3TOLA 3QW1A 4N6HA 4JKVA 2XLWA 2YL3A 4IARA 1CPRA 5B3IA 3HNKA 4JEBA 2J9BA 3VRCA 1NBBA 2CCYA 2XLVA
chains in the Genus database with same CATH superfamily
2R7RA 1PCXA 1G8XA 1NFNA 2PP4A 3C8GB 2YLDA 3U8PA 2R7UA 3GM3A 3GORA 2VCBA 3VAYA 4K7BA 3RQEA 4KC9A 4KNWA 4YWQA 3B0VC 1A0BA 2R7XA 4O79A 1ST6A 1WN0A 5JSLA 4NY3A 3FHDA 3M79A 5B3SC 3DE8A 4H54A 1YYXA 1VTMP 4JEAA 3V5ZA 2QNLA 2XSEA 3IEEA 3ZDLA 2GFHA 4BJ6A 2CNWD 1JR8A 3EHMA 2P61A 2CNWA 1OCRC 2OQMA 1A7EA 4OD5A 4CS8C 4EHPA 3PDMP 3TD7A 4OIOF 2XXAA 2Q00A 4IJJA 4X0RA 2YVKA 4HE8D 1WATA 4E0HA 1K05A 1G4WR 1OW6A 2LIGA 1OCOC 4MVQA 2YZSA 4NC3A 2WVNA 5L3QA 1D1BA 4K0DA 2H8AA 3C63A 5A6JA 3F46A 3X2QC 2AWCA 4YT5A 1ZHWA 2HJ3A 2PBEA 2YL0A 1HW1A 3Q6NA 4MTFA 3WHNA 1FR0A 4IB4A 4DVZA 3EG9A 4N4WA 1NG1A 2BC5A 3UGOA 3A9CA 2O9XA 1GS9A 1B68A 4JJGA 4ULWA 4YN0B 5HV9A 2IOQA 3HNJA 4RD9A 4I3MA 5CI9A 2Y3GA 3SXMA 4Z9HA 4MVMA 3ZQYA 1E84A 2HSBA 4CSAA 3TQOA 1SZIA 4GYTA 3US6A 2DI3A 4NQFA 3NDBB 3IPMO 3U3BA 3S28A 1RCPA 2MHRA 2XRHA 3FVYA 4YL3A 3R7CA 4AK9A 3FOOA 2Q3TA 2XLEA 4BG0A 5AC4A 2XLOA 4JRZA 5D92A 1M2VA 3NRHA 4PK4A 3KYIA 2B0HA 5L0CA 1ZW3A 4DJ9A 3GEEA 3EH2A 3M4CA 4IAOA 4U5DE 1EA8A 2L81A 5BQGA 4BEJA 1XZPA 2XM0A 5BQHA 1JPJA 2IXOA 1TQGA 2J46A 3B71A 5T1DB 1ZHYA 4JTDB 4QI0A 2I8BA 1FFTC 1F1MA 2HV7A 1GM5A 2NUTA 5GPGB 1M2OA 1WOLA 2FGYA 1VYKA 1BBHA 3V7OA 5JVEA 1FNTc 1KTMA 3NMIA 1O3UA 2KJGA 1LKXA 2PF4E 2XLDA 4ANJA 4EBKA 4EKWA 3JRTA 4YT2A 3CAXA 4OD4A 3L1MA 4CS9C 1MMNA 1T6UA 3NYJA 1FMWA 1T01A 2EPMX 4U9DA 4CS8A 3WODF 2XL4A 3Q7GA 3HNLA 4KNVA 3LAYA 1T6IA 4IRUA 5L0JA 3KYJA 1SF8A 2VC9A 1OR2A 2R05A 3LESA 3RKOF 2ZPAA 4B6IA 1HMOA 4BEMJ 4CX9A 2J9UA 2P7VA 3G4ZA 4XPXA 4ZLCA 2W45A 1YA9A 1JRAA 4XQ1A 4K1OA 3TJ6A 3HLZA 5E3AA 2Q9BA 1S05A 1HE1A 2R02A 4JIOA 5COMA 1ORSC 1LS1A 3PMRA 4YT4A 2A6HF 3MBGA 3SXYA 2XXAB 1TFOB 4EBJA 5F28E 5D91A 3GM1A 1BDJB 1ZU4A 5EK0A 2KSFA 4BJ6C 3ABKC 3RVYA 1QSPA 2KC3A 4NTBA 3SXZA 4XEFA 4FX5A 1OW8A 1D0XA 3M1CB 3PHF2 1VLSA 3QMKA 3HJCA 4GQHA 4IARA 3HNKA 3B9QA 4JCZA 4UDVA 3O55A 3VRCA 1S7ZA 1IW7F 2J9VA 2EILC 4I44A 3GEHA 1OXBA 4A4AA 1OXKA 2F22A 3EGXB 5F5HA 2Q4FA 4WJ0A 3VF0A 5TJ5E 4O7GA 2A1DD 3HKKA 4I1OB 1I5NA 3K66A 1OR3A 4MNDA 3T6BA 2R7SA 1RXQA 2Q7RA 1E86A 2MYSA 2IXNA 4G0HA 4FAPB 3DM9B 4JVSA 4U9EA 4Q7CA 2GWWA 3RFYA 4U5CE 1MMDA 4OIPF 1YARO 3K7DA 2WVQA 1JOGA 1DOWA 1AEPA 4C3BA 1VK5A 2WZGA 256BA 1HMDA 1Q0MA 4ULVA 4F4BA 4I1MA 5A6BA 4CSAC 1YDIA 3LLKA 1T6QA 4XEVA 4EIYA 1Z63A 2VCCA 1M2VB 2AU5A 3W2VA 1Z5ZA 4DBRA 4WGYA 1FMVA 2B0JA 1W2WA 4Z9JA 2DYRC 3ABLC 1MNEA 3DZAA 3UR3C 2PX3A 3DKAA 5A6AA 3N2ZB 1MQVA 3ABMC 2PX0A 1GQAA 3FOPA 3U2LA 4U5GA 4JW1A 4HEAJ 3C8ZA 3CEXA 2P0NA 3EZHA 2IXMA 3ZTZA 1WTYA 1UFBA 1N1CA 3QVYA 4WGZA 1SR2A 2NUTB 3RW0A 2H7VC 1KNYA 1TKNA 4P9TA 2ZXOA 3IQ6A 1BZ4A 2EPNA 3U2MA 3ZTMA 1QZXA 2JPUA 3C7JA 2LFFA 2RSEB 2L9JA 2YL7A 4XPWA 1XWJA 5DLJA 5BQIA 1D1CA 1H7IA 2EIMC 3DAFA 1ORJA 3NKDA 2Q9CA 2YWAA 2ZXPA 4XWJA 3I5PA 1ZHXA 4N6CA 4LLEA 3X1OA 3RQGA 1LI7A 3KH2A 2BE5F 4XTKA 2C03A 2JD3A 2GDCA 2OU6A 2QY9A 4NTFA 3ATPA 3HNIA 1Q0DA 5FZTA 5B1AC 3JYHA 2A0BA 2UUHA 1Z3IX 3NYMA 5JRAA 1WGWA 3TK0A 4DRJB 2VB6A 1C17M 1RMVA 4E18A 1L7CA 2W4MA 3DJNB 3ZQVA 1TWGA 2EPKX 2LK4A 3LEVA 5L0DA 2RD9A 2OG2A 3EGXA 4DRHB 1LVKA 4PJLA 4G78A 3S84A 3FDQA 4P9FA 4JURI 3W8HA 1LS4A 3Q7LA 3G50A 3ECSA 4U5HA 4JTAB 4BJTA 5L3VA 2VCAA 2EIJC 3GEIA 2Y39A 4E7SA 2YLIA 4IWBA 4LLCA 4Z9IA 2TMVP 3I4UA 2D4UA 2H7BA 1T5OA 1ZHTA 2ZD9A 2OCCC 3FAPB 3FXHA 3JCUQ 2R7VA 4YT8A 1J8YF 3N0TA 1PV3A 2WB7A 3H2VA 3FMSA 5A69A 1I4ZA 3DD7A 2A69F 2HKVA 3ZIBA 4CJOA 3O10A 1H9GA 1HE9A 5KYXB 3FAJA 1E83A 4J30B 1OW7A 1YJGA 1YLMA 1E85A 1XZQA 5T3TA 3C62A 1NZEA 2HUJA 3BRJA 3DXJF 3EH1A 1IZMA 4MVRA 4NTAA 4U5EE 3GM2A 5AC5A 2NSFA 4EUKB 3CQZA 1VLTA 4MW8A 4E0IA 1VOMA 1BR1A 3SP1A 3W8IA 2A68F 3EPVA 3NKEA 1G4US 5E2QA 2A0UA 1NBBA 1L3PA 4JC7A 3T4RA 1C02A 1LM3B 4QI2A 4YK5A 3EGDA 3DMDA 5DS5A 3DWWA 1JMWA 3LUTB 4NCQA 5B1BC 1CGME 4J32B 4G7OF 3NMKA 3IHUA 1SYQA 3MFNA 4XPYA 1CGOA 2HFIA 3O6XA 4JJFA 3L8IA 2NPUA 4P6IC 1EKYA 4DRIB 4ZLDA 5FCLA 2R7OA 3H2UA 3BEHA 3JYYA 3ZG1A 4G7ZF 3B0UX 1ORYA 2IBFA 2H7OA 2CYDA 1AUEA 1V54C 1LE4A 3OWTA 3QW0A 4OINF 3SXKA 2EIKC 2L7AA 3MLGA 2Y3DA 4MVOA 4XEKA 3AGTA 5KYUA 2OOCA 2LP4A 4LDRA 1Y6DA 4M63A 1JPNA 1QPUA 2J8WA 1VB5A 4BJ5A 3MX3A 4W8KA 4J7TA 1TWAA 1ZW2A 3AG3C 2GA0A 3V5YA 1O87A 3JSZA 3DI5A 3O39A 2W9YA 1V4AA 3GANA 3RVZA 2W4BA 3RH3A 2M64A 2QTVA 4ONSA 1NLXA 3U5SA 3QVZA 1LIHA 4LDKA 3IQ5A 1V55C 1CGNA 1U89A 2OEXA 3RQFA 2NSGA 2EPLX 3POVA 1K04A 1FTSA 2ETSA 2YHSA 4C3DA 3S90A 3E70C 2YL1A 4HFFB 4AL0A 1OQCA 5KYXA 3U8VA 1PD1A 3N24A 3RYLA 4LDQA 4CBEA 2X0CA 3W2WA 3IQTA 4O6NA 4U5FE 4EWCA 3K6BA 5L0IA 3LS1A 4MTOA 3UMIA 4E17A 1YVIA 2NG1A 2Y69C 1R4TA 3QTHA 2XL8A 1TWHA 1YA7O 2KYHA 3LJBA 2E87A 1ZZPA 2YQYA 3NMJA 4PFOA 2YEVA 1PD0A 3EFOA 4CS7A 4D4XA 3UMHA 2XS8A 2IXPA 1ZYRF 2PFDA 3KKBA 4ER9A 1YYJA 5DQZA 2KGOA 5E33A 5T3WA 1VYIA 4U5BE 5K0IA 2XS1A 1ZHZA 3RF3A 2R7TA 2A6EF 1I4YA 1TWCA 2YLGA 3M15A 1E2XA 4IGGA 5L0FA 3TJ5A 2ZXWC 3JTLO 1KU2A 1O5HA 2J9WA 2KNHA 3K1HA 4MQ9F 5L0HA 2V3CC 3DM5A 1RJ9B 3OEOA 4DBQA 2JX0A 3E9VA 2GAQA 3S9OA 3EGDB 4E7ZA 2I15A 5IY5C 3ZSUA 4CIPA 1DOVA 4YL1A 2XL6A 3CSKA 3LEOA 1MNDA 3OA1A 2DB4A 2G3KA 1APCA 3I5QA 1A41A 1M6TA 1VMAA 1WWPA 4JTCB 3RIPA 1K40A 3EJNA 2J0XA 4MTGA 1LI5A 1RKEA 4MW3A 3NYLA 2HSQA 2QUPA 4L6RA 5COFA 4CJGA 1EQ1A 4PJJA 3PCVA 4FWVA 4JE9A 4RDAA 4PJMA 1JAFA 2G3VA 3WAQA 4DXWA 4EBBA 5KYUB 3K1IA 2OKUA 2HZ8A 4MS2A 2Y3BA 5KYWA 5HSWA 3QZCA 3QW1A 5EHHA 3JT1A 4N6HA 3ZVRA 1NU9C 4C7OB 2YL3A 2Y3HA 3F47A 2ICWG 4XLNF 1D0YA 2L6FA 4MVSA 4KI2A 2HJMA 3T6GB 4BJ5C 3DJUB 2ASRA 1ZU5A 2J9BA 2FAPB 3VYWA 5COGA 2CCYA 1Q0FA 1H6GA 3U3FA 3AG2C 5JT4A 2OEVA 3L34A 3ITFA 3Q6MA 4RBNA 1RKCA 2DYSC 2V26A 4LACB 5E3CA 4DVYP 5KYNA 2HMQA 2AWYA 3DAGA 2J0WA 3GWNA 4BPMA 1YAUO 2LFDA 1TR2A 2NUPA 1Z7Qc 1OCZC 3K33A 2KW3C 5JUAA 2R9RB 4IAQA 2UUIA 4D4NA 5KYYA 2CW0F 5DS6A 5F5FA 2EPOA 4A2NB 3KL4A 2YRFA 3LS0A 1EI7A 3R2PA 4CDVA 3KMIA 3UNGC 2EINC 3EHNA 3ASNC 4AX2A 1WASA 2LQGA 3EFOB 1RJ9A 1OCCC 3W4YA 2IM8A 2LCHA 3VM6A 3WG7C 5L0GA 4AE4B 3T9OA 2QE9A 4H4KC 3A11A 2YKZA 4YL0A 3AG4C 2D5RB 1QLEC 1Q0KA 3TOMA 4J7YA 3H65A 3IQCA 3S27A 3S0XA 1SMYF 4HFKB 3U9JA 2M4EA 3C8GD 1BR2A 3C8GA 1FAPB 2R7QA 5DQTA 5DVWA 1YZCA 4XLPF 2DGJA 4O6YA 3AQBA 4MVZA 5CI8A 2L6GA 3JRMO 4QDLA 2Q9AA 2QLAA 3SYNA 3EQLF 4MVUA 5JS5A 1LE2A 4PACA 2LD6A 1NFOA 2J45A 1V74B 2CDQA 1H9TA 4AL1A 1Y4CA 2R25A 4DOZA 2R03A 4CIHA 3NG1A 1NU7D 3U0CA 3AQCA 2XLHA 2KQ9A 3GWLA 3LNMB 4FESA 4OIRF 1T9KA 2WVOA 2WZFA 2X51A 2OJED 4C7OA 3B0PA 1RKEB 4Q5SF 2WL8A 5JP7A 5A6KA 2R7WA 2IYLD 1Z6AA 1M57C 5EGYA 3AOUA 1C03A 1A7DA 2HMZA 3ASOC 4O6MA 3ZWIA 4Q4ZF 4JZAA 3J06A 3AGUA 1HY5A 1GGQA 1R5ID 2VH3A 4CDYA 2AVKA 5DS4A 3HTKC 4CDAA 4R32A 4GEHA 1MMAA 1MMGA 5KYWB 3S29A 2AP3A 1U6HA 2BL2A 4KBLA 3K1IC 1U0BB 4OIQF 1FFHA 4LERA 2WZLA 3SNHA 4PFPA 4PR9A 4C3EA 3C18A 1J8MF 2OJQA 2P6VA 2XLMA 2CGEA 3V5XA 2J7PD 3GODA 2J7PA 3JZ0A 1G5ZA 3M4BA 1CPQA 2LSEA 1TFKB 4WABA 3AJMA 1YZAA 1Z23A 3ZC4A 3EG9B 1A7VA 2G62A 3LNRA 5AGFA 4PJNA 5BUOA 3TULA 4BJ1A 1QKRA 1HW2A 2VASA 3U9MA 2HV6A 1UG7A 3MYFA 4YJWA 3T6JA 2XM4A 4AE4A 2FFHA 3UGPA 1BR4A 2KK1A 2NUPB 2Z15A 3SZRA 4G7HF 2ZXRA 3KPHA 5JLIA 2C04A 5KYYB 3DE9A 4N06A 2PNOA 1NSGB 5CIVA 4W8PA 1D1AA 1QQ3A 1QVXA 5A6BD 3TOLA 3L8JA 3AG1C 4JCHA 1ZVZA 3JSEO 2P1AA 2L6HA 3SEOA 4JKVA 2XLWA 3LLIA 1D0ZA 3EZIA 4CS9A 1Q0GA 1CPRA 3UMKA 1M56C 3L0IA 3G4XA 2HS5A 3B29A 1OKKD 1AVOB 4JEBA 5B3IA 1OKKA 2MWQA 3MYIA 1LPEA 3CZ6A 2XLVA
chains in the Genus database with same CATH topology
1LM3B 5JT4A 2YLDA 3U8PA 4CX9A 3NMKA 1E86A 1EKYA 1CGOA 4U9EA 5JSLA 3M79A 5JUAA 3DE8A 4IAQA 4D4NA 1YYXA 3QW0A 4JEAA 4ULVA 256BA 4CDVA 4EIYA 4WGYA 1QPUA 2J8WA 4NC3A 3C63A 1MQVA 2YKZA 3FOPA 1GQAA 2YL0A 3TOMA 3ZTZA 4IB4A 3QVYA 4N4WA 4WGZA 2BC5A 3QVZA 1YZCA 3IQ5A 3IQ6A 1CGNA 3ZTMA 3HNJA 2QLAA 2YL7A 5JS5A 2YL1A 1E84A 3ZQYA 1RCPA 2XLHA 2XL8A 3FOOA 2XLEA 3HNIA 2XLOA 3NMJA 4D4XA 5JRAA 3M4CA 5JP7A 4ER9A 1YYJA 2XM0A 3ZWIA 3ZQVA 4CDYA 4CDAA 2YLGA 3M15A 5JVEA 1BBHA 3NMIA 2XLDA 2XLMA 3L1MA 2YLIA 4U9DA 3M4BA 1CPQA 3HNLA 4CIPA 1YZAA 1A7VA 2XL6A 5AGFA 1APCA 1M6TA 2XM4A 4CJOA 4L6RA 4CJGA 5JLIA 1E83A 1S05A 4JE9A 3DE9A 1JAFA 1E85A 1QQ3A 3C62A 3TOLA 3QW1A 4N6HA 4JKVA 2XLWA 2YL3A 4IARA 1CPRA 5B3IA 3HNKA 4JEBA 2J9BA 3VRCA 1NBBA 2CCYA 2XLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  5JT4 A;  2YLD A;  3U8P A;  4CX9 A;  3NMK A;  1E86 A;  1EKY A;  1CGO A;  4U9E A;  5JSL A;  3M79 A;  5JUA A;  3DE8 A;  4IAQ A;  4D4N A;  1YYX A;  3QW0 A;  4JEA A;  4ULV A;  256B A;  4CDV A;  4EIY A;  4WGY A;  1QPU A;  2J8W A;  4NC3 A;  3C63 A;  1MQV A;  2YKZ A;  3FOP A;  1GQA A;  2YL0 A;  3TOM A;  3ZTZ A;  4IB4 A;  3QVY A;  4N4W A;  4WGZ A;  2BC5 A;  3QVZ A;  1YZC A;  3IQ5 A;  3IQ6 A;  1CGN A;  3ZTM A;  3HNJ A;  2QLA A;  2YL7 A;  5JS5 A;  2YL1 A;  1E84 A;  3ZQY A;  1RCP A;  2XLH A;  2XL8 A;  3FOO A;  2XLE A;  3HNI A;  2XLO A;  3NMJ A;  4D4X A;  5JRA A;  3M4C A;  5JP7 A;  4ER9 A;  1YYJ A;  2XM0 A;  3ZWI A;  3ZQV A;  4CDY A;  4CDA A;  2YLG A;  3M15 A;  5JVE A;  1BBH A;  3NMI A;  2XLD A;  2XLM A;  3L1M A;  2YLI A;  4U9D A;  3M4B A;  1CPQ A;  3HNL A;  4CIP A;  1YZA A;  1A7V A;  2XL6 A;  5AGF A;  1APC A;  1M6T A;  2XM4 A;  4CJO A;  4L6R A;  4CJG A;  5JLI A;  1E83 A;  1S05 A;  4JE9 A;  3DE9 A;  1JAF A;  1E85 A;  1QQ3 A;  3C62 A;  3TOL A;  3QW1 A;  4N6H A;  4JKV A;  2XLW A;  2YL3 A;  4IAR A;  1CPR A;  5B3I A;  3HNK A;  4JEB A;  2J9B A;  3VRC A;  1NBB A;  2CCY A;  2XLV A; 
#chains in the Genus database with same CATH topology
 2R7R A;  1PCX A;  1G8X A;  1NFN A;  2PP4 A;  3C8G B;  2YLD A;  3U8P A;  2R7U A;  3GM3 A;  3GOR A;  2VCB A;  3VAY A;  4K7B A;  3RQE A;  4KC9 A;  4KNW A;  4YWQ A;  3B0V C;  1A0B A;  2R7X A;  4O79 A;  1ST6 A;  1WN0 A;  5JSL A;  4NY3 A;  3FHD A;  3M79 A;  5B3S C;  3DE8 A;  4H54 A;  1YYX A;  1VTM P;  4JEA A;  3V5Z A;  2QNL A;  2XSE A;  3IEE A;  3ZDL A;  2GFH A;  4BJ6 A;  2CNW D;  1JR8 A;  3EHM A;  2P61 A;  2CNW A;  1OCR C;  2OQM A;  1A7E A;  4OD5 A;  4CS8 C;  4EHP A;  3PDM P;  3TD7 A;  4OIO F;  2XXA A;  2Q00 A;  4IJJ A;  4X0R A;  2YVK A;  4HE8 D;  1WAT A;  4E0H A;  1K05 A;  1G4W R;  1OW6 A;  2LIG A;  1OCO C;  4MVQ A;  2YZS A;  4NC3 A;  2WVN A;  5L3Q A;  1D1B A;  4K0D A;  2H8A A;  3C63 A;  5A6J A;  3F46 A;  3X2Q C;  2AWC A;  4YT5 A;  1ZHW A;  2HJ3 A;  2PBE A;  2YL0 A;  1HW1 A;  3Q6N A;  4MTF A;  3WHN A;  1FR0 A;  4IB4 A;  4DVZ A;  3EG9 A;  4N4W A;  1NG1 A;  2BC5 A;  3UGO A;  3A9C A;  2O9X A;  1GS9 A;  1B68 A;  4JJG A;  4ULW A;  4YN0 B;  5HV9 A;  2IOQ A;  3HNJ A;  4RD9 A;  4I3M A;  5CI9 A;  2Y3G A;  3SXM A;  4Z9H A;  4MVM A;  3ZQY A;  1E84 A;  2HSB A;  4CSA A;  3TQO A;  1SZI A;  4GYT A;  3US6 A;  2DI3 A;  4NQF A;  3NDB B;  3IPM O;  3U3B A;  3S28 A;  1RCP A;  2MHR A;  2XRH A;  3FVY A;  4YL3 A;  3R7C A;  4AK9 A;  3FOO A;  2Q3T A;  2XLE A;  4BG0 A;  5AC4 A;  2XLO A;  4JRZ A;  5D92 A;  1M2V A;  3NRH A;  4PK4 A;  3KYI A;  2B0H A;  5L0C A;  1ZW3 A;  4DJ9 A;  3GEE A;  3EH2 A;  3M4C A;  4IAO A;  4U5D E;  1EA8 A;  2L81 A;  5BQG A;  4BEJ A;  1XZP A;  2XM0 A;  5BQH A;  1JPJ A;  2IXO A;  1TQG A;  2J46 A;  3B71 A;  5T1D B;  1ZHY A;  4JTD B;  4QI0 A;  2I8B A;  1FFT C;  1F1M A;  2HV7 A;  1GM5 A;  2NUT A;  5GPG B;  1M2O A;  1WOL A;  2FGY A;  1VYK A;  1BBH A;  3V7O A;  5JVE A;  1FNT c;  1KTM A;  3NMI A;  1O3U A;  2KJG A;  1LKX A;  2PF4 E;  2XLD A;  4ANJ A;  4EBK A;  4EKW A;  3JRT A;  4YT2 A;  3CAX A;  4OD4 A;  3L1M A;  4CS9 C;  1MMN A;  1T6U A;  3NYJ A;  1FMW A;  1T01 A;  2EPM X;  4U9D A;  4CS8 A;  3WOD F;  2XL4 A;  3Q7G A;  3HNL A;  4KNV A;  3LAY A;  1T6I A;  4IRU A;  5L0J A;  3KYJ A;  1SF8 A;  2VC9 A;  1OR2 A;  2R05 A;  3LES A;  3RKO F;  2ZPA A;  4B6I A;  1HMO A;  4BEM J;  4CX9 A;  2J9U A;  2P7V A;  3G4Z A;  4XPX A;  4ZLC A;  2W45 A;  1YA9 A;  1JRA A;  4XQ1 A;  4K1O A;  3TJ6 A;  3HLZ A;  5E3A A;  2Q9B A;  1S05 A;  1HE1 A;  2R02 A;  4JIO A;  5COM A;  1ORS C;  1LS1 A;  3PMR A;  4YT4 A;  2A6H F;  3MBG A;  3SXY A;  2XXA B;  1TFO B;  4EBJ A;  5F28 E;  5D91 A;  3GM1 A;  1BDJ B;  1ZU4 A;  5EK0 A;  2KSF A;  4BJ6 C;  3ABK C;  3RVY A;  1QSP A;  2KC3 A;  4NTB A;  3SXZ A;  4XEF A;  4FX5 A;  1OW8 A;  1D0X A;  3M1C B;  3PHF 2;  1VLS A;  3QMK A;  3HJC A;  4GQH A;  4IAR A;  3HNK A;  3B9Q A;  4JCZ A;  4UDV A;  3O55 A;  3VRC A;  1S7Z A;  1IW7 F;  2J9V A;  2EIL C;  4I44 A;  3GEH A;  1OXB A;  4A4A A;  1OXK A;  2F22 A;  3EGX B;  5F5H A;  2Q4F A;  4WJ0 A;  3VF0 A;  5TJ5 E;  4O7G A;  2A1D D;  3HKK A;  4I1O B;  1I5N A;  3K66 A;  1OR3 A;  4MND A;  3T6B A;  2R7S A;  1RXQ A;  2Q7R A;  1E86 A;  2MYS A;  2IXN A;  4G0H A;  4FAP B;  3DM9 B;  4JVS A;  4U9E A;  4Q7C A;  2GWW A;  3RFY A;  4U5C E;  1MMD A;  4OIP F;  1YAR O;  3K7D A;  2WVQ A;  1JOG A;  1DOW A;  1AEP A;  4C3B A;  1VK5 A;  2WZG A;  256B A;  1HMD A;  1Q0M A;  4ULV A;  4F4B A;  4I1M A;  5A6B A;  4CSA C;  1YDI A;  3LLK A;  1T6Q A;  4XEV A;  4EIY A;  1Z63 A;  2VCC A;  1M2V B;  2AU5 A;  3W2V A;  1Z5Z A;  4DBR A;  4WGY A;  1FMV A;  2B0J A;  1W2W A;  4Z9J A;  2DYR C;  3ABL C;  1MNE A;  3DZA A;  3UR3 C;  2PX3 A;  3DKA A;  5A6A A;  3N2Z B;  1MQV A;  3ABM C;  2PX0 A;  1GQA A;  3FOP A;  3U2L A;  4U5G A;  4JW1 A;  4HEA J;  3C8Z A;  3CEX A;  2P0N A;  3EZH A;  2IXM A;  3ZTZ A;  1WTY A;  1UFB A;  1N1C A;  3QVY A;  4WGZ A;  1SR2 A;  2NUT B;  3RW0 A;  2H7V C;  1KNY A;  1TKN A;  4P9T A;  2ZXO A;  3IQ6 A;  1BZ4 A;  2EPN A;  3U2M A;  3ZTM A;  1QZX A;  2JPU A;  3C7J A;  2LFF A;  2RSE B;  2L9J A;  2YL7 A;  4XPW A;  1XWJ A;  5DLJ A;  5BQI A;  1D1C A;  1H7I A;  2EIM C;  3DAF A;  1ORJ A;  3NKD A;  2Q9C A;  2YWA A;  2ZXP A;  4XWJ A;  3I5P A;  1ZHX A;  4N6C A;  4LLE A;  3X1O A;  3RQG A;  1LI7 A;  3KH2 A;  2BE5 F;  4XTK A;  2C03 A;  2JD3 A;  2GDC A;  2OU6 A;  2QY9 A;  4NTF A;  3ATP A;  3HNI A;  1Q0D A;  5FZT A;  5B1A C;  3JYH A;  2A0B A;  2UUH A;  1Z3I X;  3NYM A;  5JRA A;  1WGW A;  3TK0 A;  4DRJ B;  2VB6 A;  1C17 M;  1RMV A;  4E18 A;  1L7C A;  2W4M A;  3DJN B;  3ZQV A;  1TWG A;  2EPK X;  2LK4 A;  3LEV A;  5L0D A;  2RD9 A;  2OG2 A;  3EGX A;  4DRH B;  1LVK A;  4PJL A;  4G78 A;  3S84 A;  3FDQ A;  4P9F A;  4JUR I;  3W8H A;  1LS4 A;  3Q7L A;  3G50 A;  3ECS A;  4U5H A;  4JTA B;  4BJT A;  5L3V A;  2VCA A;  2EIJ C;  3GEI A;  2Y39 A;  4E7S A;  2YLI A;  4IWB A;  4LLC A;  4Z9I A;  2TMV P;  3I4U A;  2D4U A;  2H7B A;  1T5O A;  1ZHT A;  2ZD9 A;  2OCC C;  3FAP B;  3FXH A;  3JCU Q;  2R7V A;  4YT8 A;  1J8Y F;  3N0T A;  1PV3 A;  2WB7 A;  3H2V A;  3FMS A;  5A69 A;  1I4Z A;  3DD7 A;  2A69 F;  2HKV A;  3ZIB A;  4CJO A;  3O10 A;  1H9G A;  1HE9 A;  5KYX B;  3FAJ A;  1E83 A;  4J30 B;  1OW7 A;  1YJG A;  1YLM A;  1E85 A;  1XZQ A;  5T3T A;  3C62 A;  1NZE A;  2HUJ A;  3BRJ A;  3DXJ F;  3EH1 A;  1IZM A;  4MVR A;  4NTA A;  4U5E E;  3GM2 A;  5AC5 A;  2NSF A;  4EUK B;  3CQZ A;  1VLT A;  4MW8 A;  4E0I A;  1VOM A;  1BR1 A;  3SP1 A;  3W8I A;  2A68 F;  3EPV A;  3NKE A;  1G4U S;  5E2Q A;  2A0U A;  1NBB A;  1L3P A;  4JC7 A;  3T4R A;  1C02 A;  1LM3 B;  4QI2 A;  4YK5 A;  3EGD A;  3DMD A;  5DS5 A;  3DWW A;  1JMW A;  3LUT B;  4NCQ A;  5B1B C;  1CGM E;  4J32 B;  4G7O F;  3NMK A;  3IHU A;  1SYQ A;  3MFN A;  4XPY A;  1CGO A;  2HFI A;  3O6X A;  4JJF A;  3L8I A;  2NPU A;  4P6I C;  1EKY A;  4DRI B;  4ZLD A;  5FCL A;  2R7O A;  3H2U A;  3BEH A;  3JYY A;  3ZG1 A;  4G7Z F;  3B0U X;  1ORY A;  2IBF A;  2H7O A;  2CYD A;  1AUE A;  1V54 C;  1LE4 A;  3OWT A;  3QW0 A;  4OIN F;  3SXK A;  2EIK C;  2L7A A;  3MLG A;  2Y3D A;  4MVO A;  4XEK A;  3AGT A;  5KYU A;  2OOC A;  2LP4 A;  4LDR A;  1Y6D A;  4M63 A;  1JPN A;  1QPU A;  2J8W A;  1VB5 A;  4BJ5 A;  3MX3 A;  4W8K A;  4J7T A;  1TWA A;  1ZW2 A;  3AG3 C;  2GA0 A;  3V5Y A;  1O87 A;  3JSZ A;  3DI5 A;  3O39 A;  2W9Y A;  1V4A A;  3GAN A;  3RVZ A;  2W4B A;  3RH3 A;  2M64 A;  2QTV A;  4ONS A;  1NLX A;  3U5S A;  3QVZ A;  1LIH A;  4LDK A;  3IQ5 A;  1V55 C;  1CGN A;  1U89 A;  2OEX A;  3RQF A;  2NSG A;  2EPL X;  3POV A;  1K04 A;  1FTS A;  2ETS A;  2YHS A;  4C3D A;  3S90 A;  3E70 C;  2YL1 A;  4HFF B;  4AL0 A;  1OQC A;  5KYX A;  3U8V A;  1PD1 A;  3N24 A;  3RYL A;  4LDQ A;  4CBE A;  2X0C A;  3W2W A;  3IQT A;  4O6N A;  4U5F E;  4EWC A;  3K6B A;  5L0I A;  3LS1 A;  4MTO A;  3UMI A;  4E17 A;  1YVI A;  2NG1 A;  2Y69 C;  1R4T A;  3QTH A;  2XL8 A;  1TWH A;  1YA7 O;  2KYH A;  3LJB A;  2E87 A;  1ZZP A;  2YQY A;  3NMJ A;  4PFO A;  2YEV A;  1PD0 A;  3EFO A;  4CS7 A;  4D4X A;  3UMH A;  2XS8 A;  2IXP A;  1ZYR F;  2PFD A;  3KKB A;  4ER9 A;  1YYJ A;  5DQZ A;  2KGO A;  5E33 A;  5T3W A;  1VYI A;  4U5B E;  5K0I A;  2XS1 A;  1ZHZ A;  3RF3 A;  2R7T A;  2A6E F;  1I4Y A;  1TWC A;  2YLG A;  3M15 A;  1E2X A;  4IGG A;  5L0F A;  3TJ5 A;  2ZXW C;  3JTL O;  1KU2 A;  1O5H A;  2J9W A;  2KNH A;  3K1H A;  4MQ9 F;  5L0H A;  2V3C C;  3DM5 A;  1RJ9 B;  3OEO A;  4DBQ A;  2JX0 A;  3E9V A;  2GAQ A;  3S9O A;  3EGD B;  4E7Z A;  2I15 A;  5IY5 C;  3ZSU A;  4CIP A;  1DOV A;  4YL1 A;  2XL6 A;  3CSK A;  3LEO A;  1MND A;  3OA1 A;  2DB4 A;  2G3K A;  1APC A;  3I5Q A;  1A41 A;  1M6T A;  1VMA A;  1WWP A;  4JTC B;  3RIP A;  1K40 A;  3EJN A;  2J0X A;  4MTG A;  1LI5 A;  1RKE A;  4MW3 A;  3NYL A;  2HSQ A;  2QUP A;  4L6R A;  5COF A;  4CJG A;  1EQ1 A;  4PJJ A;  3PCV A;  4FWV A;  4JE9 A;  4RDA A;  4PJM A;  1JAF A;  2G3V A;  3WAQ A;  4DXW A;  4EBB A;  5KYU B;  3K1I A;  2OKU A;  2HZ8 A;  4MS2 A;  2Y3B A;  5KYW A;  5HSW A;  3QZC A;  3QW1 A;  5EHH A;  3JT1 A;  4N6H A;  3ZVR A;  1NU9 C;  4C7O B;  2YL3 A;  2Y3H A;  3F47 A;  2ICW G;  4XLN F;  1D0Y A;  2L6F A;  4MVS A;  4KI2 A;  2HJM A;  3T6G B;  4BJ5 C;  3DJU B;  2ASR A;  1ZU5 A;  2J9B A;  2FAP B;  3VYW A;  5COG A;  2CCY A;  1Q0F A;  1H6G A;  3U3F A;  3AG2 C;  5JT4 A;  2OEV A;  3L34 A;  3ITF A;  3Q6M A;  4RBN A;  1RKC A;  2DYS C;  2V26 A;  4LAC B;  5E3C A;  4DVY P;  5KYN A;  2HMQ A;  2AWY A;  3DAG A;  2J0W A;  3GWN A;  4BPM A;  1YAU O;  2LFD A;  1TR2 A;  2NUP A;  1Z7Q c;  1OCZ C;  3K33 A;  2KW3 C;  5JUA A;  2R9R B;  4IAQ A;  2UUI A;  4D4N A;  5KYY A;  2CW0 F;  5DS6 A;  5F5F A;  2EPO A;  4A2N B;  3KL4 A;  2YRF A;  3LS0 A;  1EI7 A;  3R2P A;  4CDV A;  3KMI A;  3UNG C;  2EIN C;  3EHN A;  3ASN C;  4AX2 A;  1WAS A;  2LQG A;  3EFO B;  1RJ9 A;  1OCC C;  3W4Y A;  2IM8 A;  2LCH A;  3VM6 A;  3WG7 C;  5L0G A;  4AE4 B;  3T9O A;  2QE9 A;  4H4K C;  3A11 A;  2YKZ A;  4YL0 A;  3AG4 C;  2D5R B;  1QLE C;  1Q0K A;  3TOM A;  4J7Y A;  3H65 A;  3IQC A;  3S27 A;  3S0X A;  1SMY F;  4HFK B;  3U9J A;  2M4E A;  3C8G D;  1BR2 A;  3C8G A;  1FAP B;  2R7Q A;  5DQT A;  5DVW A;  1YZC A;  4XLP F;  2DGJ A;  4O6Y A;  3AQB A;  4MVZ A;  5CI8 A;  2L6G A;  3JRM O;  4QDL A;  2Q9A A;  2QLA A;  3SYN A;  3EQL F;  4MVU A;  5JS5 A;  1LE2 A;  4PAC A;  2LD6 A;  1NFO A;  2J45 A;  1V74 B;  2CDQ A;  1H9T A;  4AL1 A;  1Y4C A;  2R25 A;  4DOZ A;  2R03 A;  4CIH A;  3NG1 A;  1NU7 D;  3U0C A;  3AQC A;  2XLH A;  2KQ9 A;  3GWL A;  3LNM B;  4FES A;  4OIR F;  1T9K A;  2WVO A;  2WZF A;  2X51 A;  2OJE D;  4C7O A;  3B0P A;  1RKE B;  4Q5S F;  2WL8 A;  5JP7 A;  5A6K A;  2R7W A;  2IYL D;  1Z6A A;  1M57 C;  5EGY A;  3AOU A;  1C03 A;  1A7D A;  2HMZ A;  3ASO C;  4O6M A;  3ZWI A;  4Q4Z F;  4JZA A;  3J06 A;  3AGU A;  1HY5 A;  1GGQ A;  1R5I D;  2VH3 A;  4CDY A;  2AVK A;  5DS4 A;  3HTK C;  4CDA A;  4R32 A;  4GEH A;  1MMA A;  1MMG A;  5KYW B;  3S29 A;  2AP3 A;  1U6H A;  2BL2 A;  4KBL A;  3K1I C;  1U0B B;  4OIQ F;  1FFH A;  4LER A;  2WZL A;  3SNH A;  4PFP A;  4PR9 A;  4C3E A;  3C18 A;  1J8M F;  2OJQ A;  2P6V A;  2XLM A;  2CGE A;  3V5X A;  2J7P D;  3GOD A;  2J7P A;  3JZ0 A;  1G5Z A;  3M4B A;  1CPQ A;  2LSE A;  1TFK B;  4WAB A;  3AJM A;  1YZA A;  1Z23 A;  3ZC4 A;  3EG9 B;  1A7V A;  2G62 A;  3LNR A;  5AGF A;  4PJN A;  5BUO A;  3TUL A;  4BJ1 A;  1QKR A;  1HW2 A;  2VAS A;  3U9M A;  2HV6 A;  1UG7 A;  3MYF A;  4YJW A;  3T6J A;  2XM4 A;  4AE4 A;  2FFH A;  3UGP A;  1BR4 A;  2KK1 A;  2NUP B;  2Z15 A;  3SZR A;  4G7H F;  2ZXR A;  3KPH A;  5JLI A;  2C04 A;  5KYY B;  3DE9 A;  4N06 A;  2PNO A;  1NSG B;  5CIV A;  4W8P A;  1D1A A;  1QQ3 A;  1QVX A;  5A6B D;  3TOL A;  3L8J A;  3AG1 C;  4JCH A;  1ZVZ A;  3JSE O;  2P1A A;  2L6H A;  3SEO A;  4JKV A;  2XLW A;  3LLI A;  1D0Z A;  3EZI A;  4CS9 A;  1Q0G A;  1CPR A;  3UMK A;  1M56 C;  3L0I A;  3G4X A;  2HS5 A;  3B29 A;  1OKK D;  1AVO B;  4JEB A;  5B3I A;  1OKK A;  2MWQ A;  3MYI A;  1LPE A;  3CZ6 A;  2XLV A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  5JT4 A;  2YLD A;  3U8P A;  4CX9 A;  3NMK A;  1E86 A;  1EKY A;  1CGO A;  4U9E A;  5JSL A;  3M79 A;  5JUA A;  3DE8 A;  4IAQ A;  4D4N A;  1YYX A;  3QW0 A;  4JEA A;  4ULV A;  256B A;  4CDV A;  4EIY A;  4WGY A;  1QPU A;  2J8W A;  4NC3 A;  3C63 A;  1MQV A;  2YKZ A;  3FOP A;  1GQA A;  2YL0 A;  3TOM A;  3ZTZ A;  4IB4 A;  3QVY A;  4N4W A;  4WGZ A;  2BC5 A;  3QVZ A;  1YZC A;  3IQ5 A;  3IQ6 A;  1CGN A;  3ZTM A;  3HNJ A;  2QLA A;  2YL7 A;  5JS5 A;  2YL1 A;  1E84 A;  3ZQY A;  1RCP A;  2XLH A;  2XL8 A;  3FOO A;  2XLE A;  3HNI A;  2XLO A;  3NMJ A;  4D4X A;  5JRA A;  3M4C A;  5JP7 A;  4ER9 A;  1YYJ A;  2XM0 A;  3ZWI A;  3ZQV A;  4CDY A;  4CDA A;  2YLG A;  3M15 A;  5JVE A;  1BBH A;  3NMI A;  2XLD A;  2XLM A;  3L1M A;  2YLI A;  4U9D A;  3M4B A;  1CPQ A;  3HNL A;  4CIP A;  1YZA A;  1A7V A;  2XL6 A;  5AGF A;  1APC A;  1M6T A;  2XM4 A;  4CJO A;  4L6R A;  4CJG A;  5JLI A;  1E83 A;  1S05 A;  4JE9 A;  3DE9 A;  1JAF A;  1E85 A;  1QQ3 A;  3C62 A;  3TOL A;  3QW1 A;  4N6H A;  4JKV A;  2XLW A;  2YL3 A;  4IAR A;  1CPR A;  5B3I A;  3HNK A;  4JEB A;  2J9B A;  3VRC A;  1NBB A;  2CCY A;  2XLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...