3V5ZA

Structure of fbxl5 hemerythrin domain, c2 cell, grown anaerobically
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
154
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5zA00
3V5ZA 3V5YA 3U9MA 3U9JA 2P0NA 3CAXA 3V5XA
chains in the Genus database with same CATH superfamily
3O39A 4Q7CA 5A6AA 1E86A 3H2VA 2A6EF 4CS7A 4J32B 3M79A 4OIQF 3I5PA 4YK5A 1FR0A 1HMDA 4U5FE 5DS6A 5L0GA 4NY3A 2Y3DA 3C8GA 4IGGA 2P7VA 4XEKA 3K1IC 3J06A 4Q5SF 3DM5A 4PR9A 3CZ6A 1VTMP 5JUAA 3VM6A 3EPVA 2YLDA 3R2PA 1OW6A 3TD7A 2LD6A 5DLJA 5KYNA 3FMSA 4KBLA 2R7WA 2V26A 4NTBA 2WB7A 3C8GB 4U5DE 5D92A 5DQTA 3E70C 1HW2A 1LE4A 1G4US 4BJ1A 4G7ZF 3E9VA 1YA9A 4F4BA 3DZAA 5AC4A 3AGTA 1A41A 1JPNA 3VYWA 2KC3A 3T6JA 2J7PA 2I8BA 4E0IA 1G4WR 2XM0A 3ASNC 3KL4A 3DI5A 3ZWIA 3CQZA 3AQCA 4DBRA 2IXNA 2PX0A 2H7OA 2KW3C 4MS2A 3UGOA 4QI0A 1N1CA 2VASA 2PP4A 1QLEC 4E7SA 1SR2A 3JSEO 4WJ0A 1WOLA 3O10A 3A11A 4O6YA 3ZTMA 1PCXA 1NFNA 1NU9C 1TWHA 3ASOC 4ER9A 5TJ5E 4JJGA 2KK1A 3NYMA 2G62A 1ZHZA 4JIOA 2A68F 3FOOA 4JW1A 3SZRA 5JSLA 1WTYA 4PACA 1WN0A 1MQVA 5A6BD 5KYXB 1U0BB 1L7CA 3EQLF 3EHNA 3DWWA 2A69F 2XXAA 2EIMC 2OJED 4LACB 1R4TA 2YL7A 3T9OA 2G3VA 2YVKA 3FAPB 3Q6MA 3LLIA 2Q9AA 4MW3A 4IAQA 4PK4A 4D4XA 1I4YA 1OR2A 5F28E 4J7TA 4ZLDA 3IHUA 1APCA 1DOVA 4LERA 4QDLA 2LIGA 3EJNA 2PBEA 4BEJA 4NQFA 2KYHA 2XXAB 4XLNF 2IXPA 3HNLA 1ZHTA 1FFTC 1OXBA 2KJGA 3L34A 5FZTA 4U9EA 2V3CC 3I5QA 3DD7A 3JRMO 2BL2A 1D1AA 1YZCA 3X1OA 4DVZA 4JC7A 1TKNA 1H6GA 3HJCA 2I15A 3PMRA 1M56C 3KYIA 1FTSA 1OW8A 2A6HF 3ABMC 4JCZA 4NC3A 4PFPA 2XLOA 1YVIA 1VOMA 2ZXPA 3U9MA 2Q9CA 3WAQA 4FAPB 5JRAA 3NKDA 1V74B 1V4AA 3KMIA 1YDIA 2W45A 3NYJA 4RD9A 4G7OF 1XWJA 1Y6DA 1OCOC 1D1CA 5L3VA 1MMDA 1U89A 2GFHA 4WABA 2R7QA 1OQCA 2R9RB 3RVZA 2P61A 2L6FA 4EBJA 3RQEA 4JTCB 4MVRA 3GEEA 3GORA 4CJGA 4CS8C 2YL1A 1QVXA 3ZQVA 4G0HA 2AWYA 4OIPF 2NUTA 5KYYB 2FGYA 1VYKA 2R03A 2D4UA 3G4XA 1I5NA 2OOCA 2Q4FA 4MVZA 4U5GA 1EQ1A 2UUHA 1NLXA 2VCCA 2WVQA 5F5FA 2Q3TA 1YA7O 3LJBA 4W8KA 4XEVA 2HFIA 4K0DA 1PD1A 3S0XA 3B71A 2NUTB 3IQ6A 3Q7GA 5L0JA 4CIHA 4C3EA 2MWQA 4CSAA 1JMWA 3DE9A 3TJ6A 4DXWA 1O87A 1OKKD 3DE8A 4CBEA 2Y3HA 4MTGA 1YLMA 4LLCA 1FAPB 1E84A 4G7HF 3U9JA 2OKUA 4JVSA 3LLKA 2OEVA 2BC5A 4YL0A 2H8AA 2R02A 2J9WA 2XS8A 1A7DA 3BEHA 1H7IA 3SEOA 2CYDA 1BR4A 2LFFA 2PFDA 3UMIA 3WG7C 3X2QC 2B0HA 3SXKA 1TR2A 3JYHA 3NG1A 3FHDA 2MHRA 1QQ3A 3S29A 3UNGC 2L6GA 2FFHA 3GEIA 4WGYA 2KNHA 1C03A 1M2VA 1AEPA 1QSPA 4OD5A 2KSFA 2EPKX 5A6KA 1H9TA 2W4BA 4L6RA 4MNDA 2WZGA 4AE4A 1NU7D 2A1DD 2DI3A 2LQGA 3RH3A 1M57C 5EK0A 3TOLA 3HLZA 1UFBA 1UG7A 4BPMA 3EHMA 1M2VB 4AX2A 1KU2A 3QW0A 3L8JA 4LDKA 1MMAA 1YYXA 2EPMX 1T6QA 2R7TA 4AE4B 3EG9B 1V55C 2QLAA 4MVMA 1FFHA 2H7VC 3QVZA 3PCVA 2NG1A 4I1OB 4PJJA 5A6JA 4CX9A 2YLGA 1Z23A 1OCCC 1ZYRF 2CNWA 3NMKA 5T3WA 5L0IA 2LFDA 5JLIA 3EZIA 3ZIBA 3ABKC 4CS9A 2ZXWC 4W8PA 1ZW2A 1MMGA 2HKVA 3DKAA 3CSKA 1MNDA 3JTLO 4DBQA 4CIPA 1GM5A 1Q0DA 1NG1A 3IPMO 1IZMA 3QTHA 1VYIA 2YRFA 1HY5A 1Q0MA 2YKZA 4BJTA 3LAYA 2EIKC 3C63A 5B3SC 3RIPA 5A69A 1TFKB 3CEXA 5BQGA 4IRUA 1RKEB 5KYWB 1PV3A 1EKYA 3GWLA 2LK4A 3ZDLA 3DMDA 5L0CA 1FNTc 2JPUA 1YZAA 3DJUB 3EH2A 1HE1A 2RSEB 4KI2A 2Y3GA 3AQBA 3LS0A 1TFOB 2O9XA 2XL4A 3M4CA 3L8IA 3PHF2 2PX3A 3H65A 3K1HA 1DOWA 2XL6A 4PJLA 3GM2A 5L0HA 1BDJB 4EIYA 1TWAA 1Z6AA 1EI7A 2DYSC 2ICWG 3EGXB 1OW7A 3NRHA 2HJMA 1JOGA 5KYXA 4YT4A 1CPQA 1TWCA 1CGME 1TWGA 2MYSA 2VH3A 1RJ9A 2AU5A 3FOPA 1RCPA 1SF8A 2WZLA 4JE9A 2XLHA 1G5ZA 4C3DA 3DAGA 4XQ1A 3TK0A 4DJ9A 3NMIA 4MVUA 3HNJA 3GM1A 4P9FA 2XRHA 4PJNA 4OIRF 5DS4A 4YWQA 1CPRA 2J9UA 4IB4A 1RJ9B 3UMHA 1T6UA 3V5YA 1BZ4A 3Q7LA 5B1AC 3RKOF 1LKXA 5EHHA 2HUJA 3AGUA 3G4ZA 1BR1A 4JCHA 5A6BA 2ETSA 2CW0F 4YL1A 4KC9A 3SNHA 4XEFA 1SMYF 1QZXA 2Y39A 3MFNA 4FX5A 4O6MA 4XTKA 1EA8A 1VLTA 2KQ9A 2VCAA 4YL3A 1SZIA 2DB4A 5E3CA 5JS5A 1A7VA 1TQGA 2HSBA 3HNIA 3LUTB 4C3BA 3EH1A 3LEVA 3K33A 2AP3A 4HFFB 3OEOA 3EGDA 3JCUQ 4JEBA 4JRZA 4MTOA 3U3FA 2XLVA 3JSZA 1C17M 3LNMB 5B1BC 2EILC 3U8VA 1R5ID 4O7GA 1QKRA 3Q6NA 5BQIA 2W9YA 1Z63A 1WATA 2L7AA 1FMVA 2LCHA 3EGDB 4NTFA 3WODF 4N06A 1KNYA 1LE2A 1WGWA 2R05A 4U5BE 3TOMA 2PF4E 3SXMA 5KYYA 5COFA 2YZSA 2E87A 1OCZC 5KYUA 3RQGA 3W8IA 4CDYA 4JKVA 3GM3A 2KGOA 3N24A 1GGQA 2OEXA 2HMQA 3T4RA 5JVEA 4EUKB 1ORJA 3RF3A 4IARA 4JURI 2Z15A 4U5CE 1WASA 4E7ZA 1E83A 1C02A 1Y4CA 2PNOA 1LIHA 3ABLC 4U9DA 5KYUB 2YQYA 3DXJF 3IQCA 3A9CA 1E85A 3JZ0A 3SP1A 2DGJA 3ZC4A 1ZU4A 2HMZA 3EZHA 1K04A 4YT5A 2G3KA 1RMVA 2J9VA 1ZZPA 4BJ6A 3L1MA 3QZCA 1A7EA 4CSAC 3JT1A 3U2MA 4GEHA 3TJ5A 1K40A 2HJ3A 2L9JA 4BEMJ 4DOZA 3C8ZA 1VB5A 5HSWA 3B0VC 1Z3IX 3EFOA 4O6NA 1VK5A 3FAJA 3G50A 3IEEA 3K6BA 4LDQA 4MVQA 2Y69C 4AL0A 1VMAA 2GDCA 2D5RB 5FCLA 3PDMP 3NKEA 1D0YA 4FESA 4JJFA 4N6CA 1NSGB 3JRTA 4FWVA 2J45A 3EFOB 1XZQA 5E2QA 2IOQA 2X0CA 2P0NA 1I4ZA 5HV9A 4H54A 2QTVA 4JZAA 4PFOA 3LNRA 4P6IC 3ZSUA 3KYJA 2LP4A 5T1DB 1YAUO 1T5OA 3MBGA 3B0PA 2TMVP 4IAOA 4OD4A 1Q0FA 1Z7Qc 3B9QA 3EG9A 4BJ5A 4EWCA 2GAQA 3C62A 2NPUA 1G8XA 5COGA 3RVYA 3B0UX 2IBFA 4CDAA 2NSFA 4B6IA 5E3AA 1ZHYA 2FAPB 2HV6A 1YARO 5GPGB 3NMJA 1O5HA 4GYTA 4CS9C 5K0IA 4Z9HA 1LS4A 2M4EA 3R7CA 3NDBB 1HW1A 1ORSC 3AJMA 3O55A 2DYRC 4I1MA 3RQFA 1RKEA 3ECSA 3S28A 5KYWA 3H2UA 1WWPA 2J0XA 1E2XA 1F1MA 3U5SA 2F22A 2CDQA 1U6HA 1ZHWA 3CAXA 2XLEA 4G78A 4BG0A 4C7OB 2EPLX 1J8YF 4ONSA 4YN0B 3M1CB 2IXOA 3C8GD 3W2VA 1RKCA 2CNWD 5AC5A 1CGOA 2RD9A 4P9TA 2P6VA 2IXMA 2R25A 3HNKA 3C7JA 5L0DA 3ATPA 3EGXA 4GQHA 2IYLD 2W4MA 4ULVA 1LS1A 4MVOA 4PJMA 3LEOA 4A4AA 1YJGA 1W2WA 1BR2A 5COMA 1LVKA 1T9KA 1S7ZA 2BE5F 2QUPA 4MQ9F 3FVYA 1AVOB 2ZXRA 3LESA 3K1IA 1Z5ZA 3AG4C 5F5HA 4EHPA 4XWJA 4XPYA 5EGYA 1OR3A 2L81A 3JYYA 3SYNA 2J7PD 3AG3C 2YL0A 1ZHXA 1S05A 2WZFA 2R7OA 4JTDB 2ZD9A 4D4NA 3UGPA 5L3QA 1JR8A 2VC9A 3K7DA 2YL3A 1NBBA 3HKKA 2OCCC 3T6GB 3RFYA 4E0HA 3F46A 3W2WA 1IW7F 3HTKC 3ITFA 1J8MF 2QE9A 3POVA 2R7RA 2ZPAA 1Q0GA 2HZ8A 5L0FA 3VAYA 2IM8A 3IQTA 2VB6A 4KNVA 1YYJA 5DQZA 4DVYP 2OU6A 1NZEA 2Y3BA 1OCRC 2C04A 3M15A 3US6A 4LLEA 2OG2A 5AGFA 2HS5A 2VCBA 3GWNA 3KKBA 4NCQA 1D1BA 1GS9A 4R32A 3K66A 1SYQA 4RDAA 4Z9IA 1D0ZA 1T01A 2XSEA 4IWBA 3U0CA 1MNEA 2EPNA 4EBBA 2EPOA 2A0UA 4ZLCA 3FDQA 2OQMA 4N6HA 3ZTZA 2L6HA 4O79A 1ZVZA 3TQOA 2R7SA 1BBHA 2B0JA 3M4BA 4CDVA 5JP7A 4Q4ZF 2UUIA 4N4WA 2CCYA 3U8PA 3VF0A 4IJJA 1ST6A 2J9BA 1ZW3A 4AL1A 1H9GA 4K7BA 4HFKB 4KNWA 3ZVRA 2J0WA 4Z9JA 3U2LA 4E17A 3TULA 4JEAA 4DRJB 2R7XA 2YWAA 4OIOF 3N0TA 1D0XA 4JTAB 4OINF 4I3MA 2ASRA 3GANA 5CIVA 1CGNA 3QMKA 3ZG1A 4ANJA 4ULWA 2HSQA 2WL8A 2AWCA 5E33A 1JRAA 1AUEA 1M6TA 3KPHA 3V5ZA 4QI2A 1PD0A 1LPEA 4J7YA 3VRCA 1KTMA 3AOUA 4X0RA 5IY5C 4HE8D 4H4KC 3FXHA 3SXZA 4XPXA 1FMWA 4U5HA 3DJNB 2EIJC 2J8WA 4LDRA 4BJ6C 5B3IA 5DS5A 2QY9A 3IQ5A 3OA1A 2OJQA 2X51A 2NUPA 3V7OA 3MX3A 3O6XA 1A0BA 1LI5A 3MLGA 5CI9A 1GQAA 1L3PA 2WVNA 3C18A 2EINC 1ZU5A 1K05A 2JD3A 3RYLA 3UMKA 1VLSA 3GODA 3QW1A 3RW0A 1ORYA 3DM9B 2M64A 4NTAA 4I44A 3OWTA 4U5EE 3AG1C 2YLIA 1HMOA 2NUPB 4AK9A 4A2NB 2Q7RA 3B29A 3S9OA 2GWWA 1OKKA 4MTFA 4CS8A 4EBKA 4YT2A 5D91A 4XLPF 2R7UA 4MVSA 5BQHA 2JX0A 4M63A 2Q00A 4CJOA 3QVYA 1JAFA 2WVOA 4K1OA 1OXKA 3F47A 1HE9A 4J30B 4XPWA 4E18A 5DVWA 1MMNA 3BRJA 2AVKA 2XLDA 2XL8A 3SXYA 4BJ5C 3MYIA 3AG2C 1NFOA 4YT8A 5T3TA 1RXQA 3UR3C 4DRIB 1V54C 2QNLA 3S27A 1XZPA 1B68A 2C03A 4UDVA 3DAFA 1LI7A 4RBNA 3T6BA 3L0IA 5BUOA 2HV7A 2LSEA 2H7BA 3S84A 1JPJA 4MW8A 4DRHB 3WHNA 3S90A 1QPUA 3MYFA 2CGEA 4YJWA 4EKWA 4C7OA 3LS1A 2R7VA 2J46A 1T6IA 2XM4A 3W4YA 3U3BA 256BA 4HEAJ 5JT4A 3W8HA 1Q0KA 2Q9BA 2GA0A 2YEVA 3GEHA 3I4UA 2NSGA 5CI8A 1O3UA 3V5XA 3NYLA 3ZQYA 2XLMA 2P1AA 2XLWA 3KH2A 2XS1A 1LM3B 2YHSA 2ZXOA 2A0BA 4WGZA 3N2ZB 1M2OA
chains in the Genus database with same CATH topology
3V5ZA 3V5YA 3U9MA 3U9JA 2P0NA 3CAXA 3V5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5Z A;  3V5Y A;  3U9M A;  3U9J A;  2P0N A;  3CAX A;  3V5X A; 
#chains in the Genus database with same CATH topology
 3O39 A;  4Q7C A;  5A6A A;  1E86 A;  3H2V A;  2A6E F;  4CS7 A;  4J32 B;  3M79 A;  4OIQ F;  3I5P A;  4YK5 A;  1FR0 A;  1HMD A;  4U5F E;  5DS6 A;  5L0G A;  4NY3 A;  2Y3D A;  3C8G A;  4IGG A;  2P7V A;  4XEK A;  3K1I C;  3J06 A;  4Q5S F;  3DM5 A;  4PR9 A;  3CZ6 A;  1VTM P;  5JUA A;  3VM6 A;  3EPV A;  2YLD A;  3R2P A;  1OW6 A;  3TD7 A;  2LD6 A;  5DLJ A;  5KYN A;  3FMS A;  4KBL A;  2R7W A;  2V26 A;  4NTB A;  2WB7 A;  3C8G B;  4U5D E;  5D92 A;  5DQT A;  3E70 C;  1HW2 A;  1LE4 A;  1G4U S;  4BJ1 A;  4G7Z F;  3E9V A;  1YA9 A;  4F4B A;  3DZA A;  5AC4 A;  3AGT A;  1A41 A;  1JPN A;  3VYW A;  2KC3 A;  3T6J A;  2J7P A;  2I8B A;  4E0I A;  1G4W R;  2XM0 A;  3ASN C;  3KL4 A;  3DI5 A;  3ZWI A;  3CQZ A;  3AQC A;  4DBR A;  2IXN A;  2PX0 A;  2H7O A;  2KW3 C;  4MS2 A;  3UGO A;  4QI0 A;  1N1C A;  2VAS A;  2PP4 A;  1QLE C;  4E7S A;  1SR2 A;  3JSE O;  4WJ0 A;  1WOL A;  3O10 A;  3A11 A;  4O6Y A;  3ZTM A;  1PCX A;  1NFN A;  1NU9 C;  1TWH A;  3ASO C;  4ER9 A;  5TJ5 E;  4JJG A;  2KK1 A;  3NYM A;  2G62 A;  1ZHZ A;  4JIO A;  2A68 F;  3FOO A;  4JW1 A;  3SZR A;  5JSL A;  1WTY A;  4PAC A;  1WN0 A;  1MQV A;  5A6B D;  5KYX B;  1U0B B;  1L7C A;  3EQL F;  3EHN A;  3DWW A;  2A69 F;  2XXA A;  2EIM C;  2OJE D;  4LAC B;  1R4T A;  2YL7 A;  3T9O A;  2G3V A;  2YVK A;  3FAP B;  3Q6M A;  3LLI A;  2Q9A A;  4MW3 A;  4IAQ A;  4PK4 A;  4D4X A;  1I4Y A;  1OR2 A;  5F28 E;  4J7T A;  4ZLD A;  3IHU A;  1APC A;  1DOV A;  4LER A;  4QDL A;  2LIG A;  3EJN A;  2PBE A;  4BEJ A;  4NQF A;  2KYH A;  2XXA B;  4XLN F;  2IXP A;  3HNL A;  1ZHT A;  1FFT C;  1OXB A;  2KJG A;  3L34 A;  5FZT A;  4U9E A;  2V3C C;  3I5Q A;  3DD7 A;  3JRM O;  2BL2 A;  1D1A A;  1YZC A;  3X1O A;  4DVZ A;  4JC7 A;  1TKN A;  1H6G A;  3HJC A;  2I15 A;  3PMR A;  1M56 C;  3KYI A;  1FTS A;  1OW8 A;  2A6H F;  3ABM C;  4JCZ A;  4NC3 A;  4PFP A;  2XLO A;  1YVI A;  1VOM A;  2ZXP A;  3U9M A;  2Q9C A;  3WAQ A;  4FAP B;  5JRA A;  3NKD A;  1V74 B;  1V4A A;  3KMI A;  1YDI A;  2W45 A;  3NYJ A;  4RD9 A;  4G7O F;  1XWJ A;  1Y6D A;  1OCO C;  1D1C A;  5L3V A;  1MMD A;  1U89 A;  2GFH A;  4WAB A;  2R7Q A;  1OQC A;  2R9R B;  3RVZ A;  2P61 A;  2L6F A;  4EBJ A;  3RQE A;  4JTC B;  4MVR A;  3GEE A;  3GOR A;  4CJG A;  4CS8 C;  2YL1 A;  1QVX A;  3ZQV A;  4G0H A;  2AWY A;  4OIP F;  2NUT A;  5KYY B;  2FGY A;  1VYK A;  2R03 A;  2D4U A;  3G4X A;  1I5N A;  2OOC A;  2Q4F A;  4MVZ A;  4U5G A;  1EQ1 A;  2UUH A;  1NLX A;  2VCC A;  2WVQ A;  5F5F A;  2Q3T A;  1YA7 O;  3LJB A;  4W8K A;  4XEV A;  2HFI A;  4K0D A;  1PD1 A;  3S0X A;  3B71 A;  2NUT B;  3IQ6 A;  3Q7G A;  5L0J A;  4CIH A;  4C3E A;  2MWQ A;  4CSA A;  1JMW A;  3DE9 A;  3TJ6 A;  4DXW A;  1O87 A;  1OKK D;  3DE8 A;  4CBE A;  2Y3H A;  4MTG A;  1YLM A;  4LLC A;  1FAP B;  1E84 A;  4G7H F;  3U9J A;  2OKU A;  4JVS A;  3LLK A;  2OEV A;  2BC5 A;  4YL0 A;  2H8A A;  2R02 A;  2J9W A;  2XS8 A;  1A7D A;  3BEH A;  1H7I A;  3SEO A;  2CYD A;  1BR4 A;  2LFF A;  2PFD A;  3UMI A;  3WG7 C;  3X2Q C;  2B0H A;  3SXK A;  1TR2 A;  3JYH A;  3NG1 A;  3FHD A;  2MHR A;  1QQ3 A;  3S29 A;  3UNG C;  2L6G A;  2FFH A;  3GEI A;  4WGY A;  2KNH A;  1C03 A;  1M2V A;  1AEP A;  1QSP A;  4OD5 A;  2KSF A;  2EPK X;  5A6K A;  1H9T A;  2W4B A;  4L6R A;  4MND A;  2WZG A;  4AE4 A;  1NU7 D;  2A1D D;  2DI3 A;  2LQG A;  3RH3 A;  1M57 C;  5EK0 A;  3TOL A;  3HLZ A;  1UFB A;  1UG7 A;  4BPM A;  3EHM A;  1M2V B;  4AX2 A;  1KU2 A;  3QW0 A;  3L8J A;  4LDK A;  1MMA A;  1YYX A;  2EPM X;  1T6Q A;  2R7T A;  4AE4 B;  3EG9 B;  1V55 C;  2QLA A;  4MVM A;  1FFH A;  2H7V C;  3QVZ A;  3PCV A;  2NG1 A;  4I1O B;  4PJJ A;  5A6J A;  4CX9 A;  2YLG A;  1Z23 A;  1OCC C;  1ZYR F;  2CNW A;  3NMK A;  5T3W A;  5L0I A;  2LFD A;  5JLI A;  3EZI A;  3ZIB A;  3ABK C;  4CS9 A;  2ZXW C;  4W8P A;  1ZW2 A;  1MMG A;  2HKV A;  3DKA A;  3CSK A;  1MND A;  3JTL O;  4DBQ A;  4CIP A;  1GM5 A;  1Q0D A;  1NG1 A;  3IPM O;  1IZM A;  3QTH A;  1VYI A;  2YRF A;  1HY5 A;  1Q0M A;  2YKZ A;  4BJT A;  3LAY A;  2EIK C;  3C63 A;  5B3S C;  3RIP A;  5A69 A;  1TFK B;  3CEX A;  5BQG A;  4IRU A;  1RKE B;  5KYW B;  1PV3 A;  1EKY A;  3GWL A;  2LK4 A;  3ZDL A;  3DMD A;  5L0C A;  1FNT c;  2JPU A;  1YZA A;  3DJU B;  3EH2 A;  1HE1 A;  2RSE B;  4KI2 A;  2Y3G A;  3AQB A;  3LS0 A;  1TFO B;  2O9X A;  2XL4 A;  3M4C A;  3L8I A;  3PHF 2;  2PX3 A;  3H65 A;  3K1H A;  1DOW A;  2XL6 A;  4PJL A;  3GM2 A;  5L0H A;  1BDJ B;  4EIY A;  1TWA A;  1Z6A A;  1EI7 A;  2DYS C;  2ICW G;  3EGX B;  1OW7 A;  3NRH A;  2HJM A;  1JOG A;  5KYX A;  4YT4 A;  1CPQ A;  1TWC A;  1CGM E;  1TWG A;  2MYS A;  2VH3 A;  1RJ9 A;  2AU5 A;  3FOP A;  1RCP A;  1SF8 A;  2WZL A;  4JE9 A;  2XLH A;  1G5Z A;  4C3D A;  3DAG A;  4XQ1 A;  3TK0 A;  4DJ9 A;  3NMI A;  4MVU A;  3HNJ A;  3GM1 A;  4P9F A;  2XRH A;  4PJN A;  4OIR F;  5DS4 A;  4YWQ A;  1CPR A;  2J9U A;  4IB4 A;  1RJ9 B;  3UMH A;  1T6U A;  3V5Y A;  1BZ4 A;  3Q7L A;  5B1A C;  3RKO F;  1LKX A;  5EHH A;  2HUJ A;  3AGU A;  3G4Z A;  1BR1 A;  4JCH A;  5A6B A;  2ETS A;  2CW0 F;  4YL1 A;  4KC9 A;  3SNH A;  4XEF A;  1SMY F;  1QZX A;  2Y39 A;  3MFN A;  4FX5 A;  4O6M A;  4XTK A;  1EA8 A;  1VLT A;  2KQ9 A;  2VCA A;  4YL3 A;  1SZI A;  2DB4 A;  5E3C A;  5JS5 A;  1A7V A;  1TQG A;  2HSB A;  3HNI A;  3LUT B;  4C3B A;  3EH1 A;  3LEV A;  3K33 A;  2AP3 A;  4HFF B;  3OEO A;  3EGD A;  3JCU Q;  4JEB A;  4JRZ A;  4MTO A;  3U3F A;  2XLV A;  3JSZ A;  1C17 M;  3LNM B;  5B1B C;  2EIL C;  3U8V A;  1R5I D;  4O7G A;  1QKR A;  3Q6N A;  5BQI A;  2W9Y A;  1Z63 A;  1WAT A;  2L7A A;  1FMV A;  2LCH A;  3EGD B;  4NTF A;  3WOD F;  4N06 A;  1KNY A;  1LE2 A;  1WGW A;  2R05 A;  4U5B E;  3TOM A;  2PF4 E;  3SXM A;  5KYY A;  5COF A;  2YZS A;  2E87 A;  1OCZ C;  5KYU A;  3RQG A;  3W8I A;  4CDY A;  4JKV A;  3GM3 A;  2KGO A;  3N24 A;  1GGQ A;  2OEX A;  2HMQ A;  3T4R A;  5JVE A;  4EUK B;  1ORJ A;  3RF3 A;  4IAR A;  4JUR I;  2Z15 A;  4U5C E;  1WAS A;  4E7Z A;  1E83 A;  1C02 A;  1Y4C A;  2PNO A;  1LIH A;  3ABL C;  4U9D A;  5KYU B;  2YQY A;  3DXJ F;  3IQC A;  3A9C A;  1E85 A;  3JZ0 A;  3SP1 A;  2DGJ A;  3ZC4 A;  1ZU4 A;  2HMZ A;  3EZH A;  1K04 A;  4YT5 A;  2G3K A;  1RMV A;  2J9V A;  1ZZP A;  4BJ6 A;  3L1M A;  3QZC A;  1A7E A;  4CSA C;  3JT1 A;  3U2M A;  4GEH A;  3TJ5 A;  1K40 A;  2HJ3 A;  2L9J A;  4BEM J;  4DOZ A;  3C8Z A;  1VB5 A;  5HSW A;  3B0V C;  1Z3I X;  3EFO A;  4O6N A;  1VK5 A;  3FAJ A;  3G50 A;  3IEE A;  3K6B A;  4LDQ A;  4MVQ A;  2Y69 C;  4AL0 A;  1VMA A;  2GDC A;  2D5R B;  5FCL A;  3PDM P;  3NKE A;  1D0Y A;  4FES A;  4JJF A;  4N6C A;  1NSG B;  3JRT A;  4FWV A;  2J45 A;  3EFO B;  1XZQ A;  5E2Q A;  2IOQ A;  2X0C A;  2P0N A;  1I4Z A;  5HV9 A;  4H54 A;  2QTV A;  4JZA A;  4PFO A;  3LNR A;  4P6I C;  3ZSU A;  3KYJ A;  2LP4 A;  5T1D B;  1YAU O;  1T5O A;  3MBG A;  3B0P A;  2TMV P;  4IAO A;  4OD4 A;  1Q0F A;  1Z7Q c;  3B9Q A;  3EG9 A;  4BJ5 A;  4EWC A;  2GAQ A;  3C62 A;  2NPU A;  1G8X A;  5COG A;  3RVY A;  3B0U X;  2IBF A;  4CDA A;  2NSF A;  4B6I A;  5E3A A;  1ZHY A;  2FAP B;  2HV6 A;  1YAR O;  5GPG B;  3NMJ A;  1O5H A;  4GYT A;  4CS9 C;  5K0I A;  4Z9H A;  1LS4 A;  2M4E A;  3R7C A;  3NDB B;  1HW1 A;  1ORS C;  3AJM A;  3O55 A;  2DYR C;  4I1M A;  3RQF A;  1RKE A;  3ECS A;  3S28 A;  5KYW A;  3H2U A;  1WWP A;  2J0X A;  1E2X A;  1F1M A;  3U5S A;  2F22 A;  2CDQ A;  1U6H A;  1ZHW A;  3CAX A;  2XLE A;  4G78 A;  4BG0 A;  4C7O B;  2EPL X;  1J8Y F;  4ONS A;  4YN0 B;  3M1C B;  2IXO A;  3C8G D;  3W2V A;  1RKC A;  2CNW D;  5AC5 A;  1CGO A;  2RD9 A;  4P9T A;  2P6V A;  2IXM A;  2R25 A;  3HNK A;  3C7J A;  5L0D A;  3ATP A;  3EGX A;  4GQH A;  2IYL D;  2W4M A;  4ULV A;  1LS1 A;  4MVO A;  4PJM A;  3LEO A;  4A4A A;  1YJG A;  1W2W A;  1BR2 A;  5COM A;  1LVK A;  1T9K A;  1S7Z A;  2BE5 F;  2QUP A;  4MQ9 F;  3FVY A;  1AVO B;  2ZXR A;  3LES A;  3K1I A;  1Z5Z A;  3AG4 C;  5F5H A;  4EHP A;  4XWJ A;  4XPY A;  5EGY A;  1OR3 A;  2L81 A;  3JYY A;  3SYN A;  2J7P D;  3AG3 C;  2YL0 A;  1ZHX A;  1S05 A;  2WZF A;  2R7O A;  4JTD B;  2ZD9 A;  4D4N A;  3UGP A;  5L3Q A;  1JR8 A;  2VC9 A;  3K7D A;  2YL3 A;  1NBB A;  3HKK A;  2OCC C;  3T6G B;  3RFY A;  4E0H A;  3F46 A;  3W2W A;  1IW7 F;  3HTK C;  3ITF A;  1J8M F;  2QE9 A;  3POV A;  2R7R A;  2ZPA A;  1Q0G A;  2HZ8 A;  5L0F A;  3VAY A;  2IM8 A;  3IQT A;  2VB6 A;  4KNV A;  1YYJ A;  5DQZ A;  4DVY P;  2OU6 A;  1NZE A;  2Y3B A;  1OCR C;  2C04 A;  3M15 A;  3US6 A;  4LLE A;  2OG2 A;  5AGF A;  2HS5 A;  2VCB A;  3GWN A;  3KKB A;  4NCQ A;  1D1B A;  1GS9 A;  4R32 A;  3K66 A;  1SYQ A;  4RDA A;  4Z9I A;  1D0Z A;  1T01 A;  2XSE A;  4IWB A;  3U0C A;  1MNE A;  2EPN A;  4EBB A;  2EPO A;  2A0U A;  4ZLC A;  3FDQ A;  2OQM A;  4N6H A;  3ZTZ A;  2L6H A;  4O79 A;  1ZVZ A;  3TQO A;  2R7S A;  1BBH A;  2B0J A;  3M4B A;  4CDV A;  5JP7 A;  4Q4Z F;  2UUI A;  4N4W A;  2CCY A;  3U8P A;  3VF0 A;  4IJJ A;  1ST6 A;  2J9B A;  1ZW3 A;  4AL1 A;  1H9G A;  4K7B A;  4HFK B;  4KNW A;  3ZVR A;  2J0W A;  4Z9J A;  3U2L A;  4E17 A;  3TUL A;  4JEA A;  4DRJ B;  2R7X A;  2YWA A;  4OIO F;  3N0T A;  1D0X A;  4JTA B;  4OIN F;  4I3M A;  2ASR A;  3GAN A;  5CIV A;  1CGN A;  3QMK A;  3ZG1 A;  4ANJ A;  4ULW A;  2HSQ A;  2WL8 A;  2AWC A;  5E33 A;  1JRA A;  1AUE A;  1M6T A;  3KPH A;  3V5Z A;  4QI2 A;  1PD0 A;  1LPE A;  4J7Y A;  3VRC A;  1KTM A;  3AOU A;  4X0R A;  5IY5 C;  4HE8 D;  4H4K C;  3FXH A;  3SXZ A;  4XPX A;  1FMW A;  4U5H A;  3DJN B;  2EIJ C;  2J8W A;  4LDR A;  4BJ6 C;  5B3I A;  5DS5 A;  2QY9 A;  3IQ5 A;  3OA1 A;  2OJQ A;  2X51 A;  2NUP A;  3V7O A;  3MX3 A;  3O6X A;  1A0B A;  1LI5 A;  3MLG A;  5CI9 A;  1GQA A;  1L3P A;  2WVN A;  3C18 A;  2EIN C;  1ZU5 A;  1K05 A;  2JD3 A;  3RYL A;  3UMK A;  1VLS A;  3GOD A;  3QW1 A;  3RW0 A;  1ORY A;  3DM9 B;  2M64 A;  4NTA A;  4I44 A;  3OWT A;  4U5E E;  3AG1 C;  2YLI A;  1HMO A;  2NUP B;  4AK9 A;  4A2N B;  2Q7R A;  3B29 A;  3S9O A;  2GWW A;  1OKK A;  4MTF A;  4CS8 A;  4EBK A;  4YT2 A;  5D91 A;  4XLP F;  2R7U A;  4MVS A;  5BQH A;  2JX0 A;  4M63 A;  2Q00 A;  4CJO A;  3QVY A;  1JAF A;  2WVO A;  4K1O A;  1OXK A;  3F47 A;  1HE9 A;  4J30 B;  4XPW A;  4E18 A;  5DVW A;  1MMN A;  3BRJ A;  2AVK A;  2XLD A;  2XL8 A;  3SXY A;  4BJ5 C;  3MYI A;  3AG2 C;  1NFO A;  4YT8 A;  5T3T A;  1RXQ A;  3UR3 C;  4DRI B;  1V54 C;  2QNL A;  3S27 A;  1XZP A;  1B68 A;  2C03 A;  4UDV A;  3DAF A;  1LI7 A;  4RBN A;  3T6B A;  3L0I A;  5BUO A;  2HV7 A;  2LSE A;  2H7B A;  3S84 A;  1JPJ A;  4MW8 A;  4DRH B;  3WHN A;  3S90 A;  1QPU A;  3MYF A;  2CGE A;  4YJW A;  4EKW A;  4C7O A;  3LS1 A;  2R7V A;  2J46 A;  1T6I A;  2XM4 A;  3W4Y A;  3U3B A;  256B A;  4HEA J;  5JT4 A;  3W8H A;  1Q0K A;  2Q9B A;  2GA0 A;  2YEV A;  3GEH A;  3I4U A;  2NSG A;  5CI8 A;  1O3U A;  3V5X A;  3NYL A;  3ZQY A;  2XLM A;  2P1A A;  2XLW A;  3KH2 A;  2XS1 A;  1LM3 B;  2YHS A;  2ZXO A;  2A0B A;  4WGZ A;  3N2Z B;  1M2O A; 
#chains in the Genus database with same CATH homology
 3V5Z A;  3V5Y A;  3U9M A;  3U9J A;  2P0N A;  3CAX A;  3V5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...