3V5ZA

Structure of fbxl5 hemerythrin domain, c2 cell, grown anaerobically
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
154
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 72
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5zA00
3CAXA 3V5ZA 3U9JA 2P0NA 3V5XA 3V5YA 3U9MA
chains in the Genus database with same CATH superfamily
3AG2C 2HV6A 4PFPA 2Y3DA 3TD7A 4D4NA 1MMAA 1RJ9A 1QPUA 2DGJA 2IM8A 2XS8A 4LERA 4MQ9F 5B1AC 5HV9A 1RMVA 1Z23A 3RQGA 2FAPB 2NPUA 1VLSA 2EIKC 4P9FA 4PACA 1MNEA 2A0BA 3RH3A 4OIPF 3VF0A 3VYWA 1T01A 2OJED 4CJGA 1RXQA 4JCHA 1TR2A 3W2VA 5JP7A 3ABKC 3DWWA 5DS5A 1V54C 1ZHTA 4LACB 4RD9A 3AOUA 5A6JA 3KYJA 3U2MA 1A0BA 1WGWA 4Q5SF 2OG2A 3LJBA 2GA0A 2PBEA 4YT5A 3L1MA 3TOLA 3C7JA 3ZDLA 3UGPA 2R7VA 4MVUA 2KGOA 1WWPA 2L6HA 3M4BA 4EWCA 3S27A 1BZ4A 4XPWA 2XL8A 4JEBA 3IPMO 4O6YA 4DJ9A 5HSWA 1TWHA 2G3KA 1MMDA 5B1BC 1E86A 3AQBA 4YL3A 1D1CA 2IYLD 1YZAA 1YA7O 3NYJA 4JVSA 2CNWD 3NDBB 1PV3A 1ZZPA 2NSFA 3AG4C 3NYMA 3RVZA 5L0IA 2VC9A 1GGQA 3FMSA 1YYXA 2GFHA 5JRAA 2Q9CA 1UG7A 1ZU4A 4P6IC 2CGEA 5EK0A 1S7ZA 3SNHA 2A68F 2YL1A 3FAPB 4ULVA 2FFHA 2WZGA 3GM1A 2RSEB 2PX0A 4O6MA 4XTKA 4KC9A 3JZ0A 4U5HA 4J30B 2J0WA 2J8WA 3C8GB 3IEEA 2OQMA 3FOOA 5A6AA 3U2LA 2R7OA 2ZXPA 3S29A 5DLJA 3S0XA 3MBGA 4I44A 1YYJA 2OU6A 2OJQA 4HEAJ 4IWBA 4J7TA 5CI9A 5BUOA 4NTFA 2TMVP 4YJWA 4IB4A 4N06A 4DVZA 2J7PA 1K05A 4JW1A 4G7ZF 3EZIA 3SXMA 3V5XA 4XQ1A 3ECSA 4CSAC 3KH2A 1D0YA 4N6CA 5L0DA 1RKEB 2XM0A 3MYFA 4LDRA 1JOGA 1I4YA 4G0HA 3SXYA 4Z9IA 4E18A 3W8IA 3G4ZA 1OR2A 3JYYA 4MW8A 4E0IA 3EH1A 2A1DD 2L6GA 4YK5A 2J0XA 4HE8D 2WL8A 3RQFA 3ATPA 2NUPA 3E70C 4I1OB 2M4EA 4W8KA 3TK0A 1Q0GA 1JRAA 2Y3BA 1VMAA 1ST6A 3BEHA 1NSGB 3O10A 3EGDA 3DD7A 1G5ZA 1KNYA 2VCCA 2WZFA 4JJFA 1ZW2A 4K1OA 4DRIB 1G8XA 2KK1A 5AC5A 3X2QC 5L3VA 1E83A 2YEVA 4MNDA 4XLNF 2GWWA 4E17A 1OW6A 3Q7LA 1YDIA 2Y3GA 2L6FA 3DE8A 5F5HA 3BRJA 3B0UX 2YRFA 3EFOA 4CS9C 3DM5A 2ZPAA 3GORA 1AEPA 1EA8A 3QW0A 2MYSA 3AJMA 3WHNA 2ETSA 1ORYA 2R7UA 4H54A 4BJ1A 3K6BA 3EGXB 4ER9A 4DXWA 3LLKA 3U9JA 1BR1A 4JTDB 3V5YA 4NC3A 2QE9A 3QZCA 4XWJA 2JD3A 3NMKA 2O9XA 3DE9A 1YLMA 3MX3A 4IARA 3FHDA 4IJJA 1JPNA 1N1CA 2IBFA 1FFTC 3N24A 4YT2A 4OIRF 4QDLA 2IXMA 3B0PA 5AGFA 3PHF2 1Q0MA 4GQHA 1L3PA 2F22A 1J8YF 1M2VB 1DOWA 1T6UA 2HS5A 2HV7A 1NU7D 2LD6A 3VM6A 4YWQA 1FNTc 1CGNA 1OCOC 4CDVA 3NKDA 4I3MA 4JKVA 1S05A 4DVYP 1U0BB 1HW1A 2R02A 2Q7RA 1RJ9B 2QY9A 3VAYA 1MQVA 2KYHA 3GANA 1U6HA 1TFOB 3QMKA 3U5SA 5A6BA 1B68A 3X1OA 5DS6A 2R7XA 4M63A 5B3SC 1WN0A 1Y4CA 3K1IA 1JPJA 4MVZA 2HSBA 1M2OA 1K40A 1YVIA 2WVNA 2VCBA 2CCYA 3MYIA 1TQGA 2XLDA 4NQFA 1H6GA 3RFYA 2EIJC 2OEXA 4F4BA 1JAFA 2RD9A 1M6TA 2XLEA 3GM2A 3TJ6A 4AE4A 2CYDA 4AK9A 4MTOA 3TOMA 2C04A 4CDAA 2ZXRA 4RDAA 5E3AA 5COMA 2HMZA 2W45A 4Q7CA 3W4YA 1MMGA 3A11A 4O7GA 5DS4A 2PP4A 1QLEC 2Q3TA 5KYUA 3T6JA 2R7RA 4MVOA 4MVMA 4QI2A 3RKOF 1FMWA 2YL0A 3B9QA 2D4UA 5AC4A 2X51A 2Y39A 2J9UA 3OEOA 1C17M 1OCRC 1ZHYA 3M4CA 4JC7A 2XLOA 1NFOA 2P61A 2R03A 5JT4A 4G7OF 1XWJA 2YWAA 4U5BE 4PJMA 4R32A 1A7VA 2YL7A 3LNMB 3HLZA 3HNLA 4BJ6C 1TWGA 5A69A 5JLIA 2V3CC 1FR0A 2QNLA 3UR3C 3ZQYA 1Y6DA 2J7PD 3CSKA 3JSEO 3ZTMA 3Q7GA 5T3WA 2XXAA 2MHRA 3S9OA 3ASNC 1PD1A 2EPLX 2W4BA 3TJ5A 5KYYA 2LFFA 3JTLO 2UUHA 2W4MA 3C8GD 4N6HA 2WB7A 3QW1A 3SEOA 3TQOA 5B3IA 2I15A 3O39A 4C3DA 4NY3A 1CGOA 2VB6A 3DI5A 2EPOA 2XL4A 1YAUO 1V55C 1Z7Qc 2XS1A 3DXJF 4PJLA 4FESA 4U5CE 4WJ0A 3M1CB 2VH3A 3CAXA 3A9CA 4JE9A 5CIVA 2R9RB 2AP3A 2OOCA 3B0VC 3DM9B 4DRJB 4U5GA 2J9VA 2AVKA 1LKXA 2EPNA 1D0XA 2HZ8A 4I1MA 4Z9HA 1APCA 3UMHA 1NFNA 4FAPB 4MS2A 1M57C 3LAYA 5E3CA 4E7ZA 1HMDA 3EPVA 3MLGA 4CS8A 3PDMP 3EH2A 3SXZA 4CX9A 4CIHA 1WTYA 2DB4A 1J8MF 4L6RA 1AUEA 4BJ5C 3S84A 3QTHA 4DBRA 1Q0DA 2PFDA 2H8AA 2J45A 3FVYA 4WGYA 5COFA 4KI2A 5D91A 4NTAA 2C03A 2QLAA 5EHHA 2JX0A 1TFKB 5L0GA 1TWAA 3Q6NA 3U3FA 4UDVA 2R7SA 1OXKA 3EJNA 2NUPB 2DI3A 3WAQA 1C03A 1OQCA 5TJ5E 1SYQA 1ZW3A 3QVZA 1VK5A 2AWYA 3AGTA 4Z9JA 3I5QA 1NZEA 4A4AA 1FAPB 1HY5A 2CW0F 3EGDB 3GEIA 2YZSA 3N2ZB 4D4XA 4PK4A 4Q4ZF 4BG0A 2HJMA 2KC3A 1F1MA 1NBBA 5L0HA 3DZAA 3DJNB 4BEJA 4IGGA 2PNOA 3JRTA 2P1AA 3AGUA 3JT1A 1A7DA 1QZXA 3ASOC 2V26A 3B29A 3EFOB 3UMKA 1LE4A 4XLPF 2P6VA 3UGOA 3GEHA 3SXKA 2H7VC 1HMOA 2LSEA 3EG9A 1PCXA 2GAQA 2QTVA 4YT8A 4CSAA 3JCUQ 4MVQA 4O79A 2DYSC 3RYLA 5COGA 5KYXA 3G50A 2LQGA 4ZLDA 1M56C 1ZHXA 2LK4A 2WVQA 4MVRA 3T6BA 3GODA 2EPKX 4IAQA 3FAJA 2IXPA 3L8IA 5L3QA 2XLHA 1YARO 3ZTZA 5BQHA 1EQ1A 2XL6A 1R4TA 3ABMC 2B0JA 4JRZA 2IXNA 3PMRA 3POVA 3OWTA 4EKWA 4C3EA 1HW2A 1D1BA 1PD0A 3O55A 1EKYA 1H9GA 2R05A 4CJOA 1LVKA 3DAFA 2YL3A 1JR8A 3C63A 4RBNA 3DJUB 5JUAA 2A69F 5F28E 2MWQA 4MW3A 1O87A 3SZRA 3B71A 2YLIA 2W9YA 3M15A 3I5PA 4U9EA 4PFOA 4O6NA 2YLGA 2HSQA 3ZVRA 2JPUA 4CS9A 4EBBA 1L7CA 2OCCC 4N4WA 2OEVA 4DRHB 3S90A 3FXHA 2R7WA 2EINC 1CPRA 2XSEA 5DQZA 2WZLA 4DOZA 1Z6AA 2EILC 1MNDA 4JCZA 4LDQA 3IHUA 1WATA 3ZIBA 4AE4B 2LIGA 3MFNA 4AL0A 2IOQA 2KNHA 2KW3C 2LP4A 3C62A 2QUPA 4WGZA 3SP1A 4H4KC 1OXBA 4U5EE 3HNIA 4W8PA 5KYUB 1V4AA 4HFKB 3UNGC 1Z63A 4U5FE 3PCVA 2KSFA 1ZYRF 2NUTA 4YT4A 3U0CA 3C18A 1ZHWA 3U9MA 4QI0A 4HFFB 5L0JA 3KMIA 4IAOA 4P9TA 2XRHA 3G4XA 2Y69C 5BQGA 3AG3C 4CIPA 1Z3IX 2YQYA 2HMQA 2YKZA 4G78A 4JIOA 1BR4A 5A6KA 1MMNA 3U8PA 4X0RA 1AVOB 3EHNA 1QQ3A 1R5ID 2PF4E 2UUIA 5K0IA 4C7OA 4CDYA 1NLXA 4GEHA 2XXAB 3OA1A 5KYYB 1FFHA 2AU5A 4AL1A 3IQ5A 1WOLA 4ANJA 1V74B 2HJ3A 2YVKA 2XLVA 3T6GB 3JYHA 4K0DA 4YL0A 2ICWG 1A41A 4C3BA 3K1HA 3K66A 1H7IA 2FGYA 2PX3A 3LLIA 3DKAA 1LM3B 3H2VA 1HE1A 2EPMX 2L81A 4LDKA 1I5NA 4XPYA 3ITFA 3RF3A 3EHMA 3RQEA 5DVWA 1OCCC 3EQLF 3KKBA 4EHPA 3U3BA 1SMYF 1VB5A 2J9BA 1LS1A 4EUKB 2R25A 4LLCA 2WVOA 3LS0A 5EGYA 2XLWA 2Z15A 3EZHA 3KPHA 3NG1A 4OD5A 3L8JA 4EIYA 1VYKA 3HNJA 4EBJA 3US6A 2LFDA 2ASRA 2Y3HA 1YZCA 3IQ6A 1I4ZA 2NG1A 5L0CA 3RVYA 3O6XA 1SR2A 4BPMA 3K7DA 3NMJA 1GM5A 2A6EF 3L0IA 4MTFA 3U8VA 3V5ZA 1E2XA 3AQCA 4MVSA 4BJ6A 4E0HA 3R2PA 5CI8A 4U5DE 4XEVA 2H7BA 2E87A 1OKKA 2HUJA 4CS8C 1OCZC 2L9JA 1LIHA 5T1DB 1FMVA 4K7BA 2Q00A 3FOPA 4YL1A 1ZVZA 3LUTB 5BQIA 1BR2A 4JZAA 1IW7F 1D1AA 1GQAA 1BDJB 1UFBA 2GDCA 2P7VA 1D0ZA 3HTKC 3QVYA 4IRUA 4XEKA 3FDQA 4NCQA 4CS7A 3J06A 1KTMA 4OD4A 1E84A 2DYRC 2M64A 1VYIA 1O5HA 3DAGA 4FWVA 2EIMC 4ULWA 5KYNA 4KBLA 1CPQA 1ORJA 2G62A 3T9OA 2VASA 4MTGA 1VLTA 1A7EA 2CDQA 2KJGA 3GWNA 2AWCA 1GS9A 3EG9B 3Q6MA 5FZTA 4LLEA 3WODF 4A2NB 2G3VA 1XZQA 3NKEA 1EI7A 1G4WR 5KYXB 4B6IA 1LI7A 4BJ5A 2I8BA 4ZLCA 3ABLC 4JTCB 4NTBA 1NU9C 3F47A 3T4RA 2L7AA 4CBEA 3UMIA 1ZHZA 3JRMO 4JJGA 3L34A 5A6BD 2IXOA 4AX2A 3C8GA 5E2QA 3GEEA 3M79A 3CEXA 3NMIA 2Q9BA 2YHSA 3NRHA 2ZXWC 3ZG1A 3SYNA 4JURI 1T5OA 3E9VA 1O3UA 1HE9A 1ZU5A 4JEAA 3LEVA 4PR9A 2CNWA 1OW7A 3CZ6A 5JS5A 5JSLA 5L0FA 3ZC4A 1TKNA 1ORSC 2YLDA 5E33A 1RKEA 4U9DA 1K04A 4PJNA 4E7SA 1T9KA 1T6QA 2B0HA 3F46A 1VOMA 5FCLA 2X0CA 3AG1C 1TWCA 1OW8A 3H65A 4BEMJ 2HKVA 1H9TA 4XPXA 1G4US 3DMDA 3GWLA 2NSGA 4XEFA 2BE5F 3HNKA 2J46A 2LCHA 3C8ZA 3HKKA 3R7CA 3RIPA 5T3TA 1CGME 4BJTA 2HFIA 1LE2A 2Q4FA 1JMWA 1OR3A 1LPEA 1NG1A 1QKRA 1WASA 2R7QA 3KYIA 2XM4A 5D92A 3VRCA 1LI5A 4G7HF 2NUTB 1BBHA 4J7YA 4PJJA 3S28A 4GYTA 2Q9AA 256BA 4YN0B 3W2WA 2ZXOA 2D5RB 2A0UA 5GPGB 1Q0FA 1RCPA 1U89A 3IQCA 3K1IC 4EBKA 4DBQA 1XZPA 3LESA 1VTMP 2VCAA 3IQTA 2A6HF 4OIQF 4WABA 5F5FA 2BL2A 3LS1A 1SF8A 3TULA 3RW0A 2P0NA 4OINF 1E85A 4C7OB 1SZIA 1QVXA 1YJGA 3EGXA 3ZSUA 2R7TA 4ONSA 1RKCA 2KQ9A 3ZQVA 4J32B 2H7OA 3CQZA 1YA9A 3LNRA 5DQTA 5KYWB 3K33A 1Q0KA 1Z5ZA 2J9WA 2ZD9A 1OKKD 4FX5A 1W2WA 3ZWIA 4KNVA 5IY5C 4JTAB 3NYLA 1C02A 2BC5A 3I4UA 3H2UA 4OIOF 3HJCA 1T6IA 3LEOA 1DOVA 1FTSA 2OKUA 1KU2A 1M2VA 1LS4A 1QSPA 2XLMA 3V7OA 3WG7C 5KYWA 1IZMA 3JSZA 3GM3A 3W8HA 3N0TA 3KL4A 5JVEA 4KNWA
chains in the Genus database with same CATH topology
3CAXA 3V5ZA 3U9JA 2P0NA 3V5XA 3V5YA 3U9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3V5Z A;  3U9J A;  2P0N A;  3V5X A;  3V5Y A;  3U9M A; 
#chains in the Genus database with same CATH topology
 3AG2 C;  2HV6 A;  4PFP A;  2Y3D A;  3TD7 A;  4D4N A;  1MMA A;  1RJ9 A;  1QPU A;  2DGJ A;  2IM8 A;  2XS8 A;  4LER A;  4MQ9 F;  5B1A C;  5HV9 A;  1RMV A;  1Z23 A;  3RQG A;  2FAP B;  2NPU A;  1VLS A;  2EIK C;  4P9F A;  4PAC A;  1MNE A;  2A0B A;  3RH3 A;  4OIP F;  3VF0 A;  3VYW A;  1T01 A;  2OJE D;  4CJG A;  1RXQ A;  4JCH A;  1TR2 A;  3W2V A;  5JP7 A;  3ABK C;  3DWW A;  5DS5 A;  1V54 C;  1ZHT A;  4LAC B;  4RD9 A;  3AOU A;  5A6J A;  3KYJ A;  3U2M A;  1A0B A;  1WGW A;  4Q5S F;  2OG2 A;  3LJB A;  2GA0 A;  2PBE A;  4YT5 A;  3L1M A;  3TOL A;  3C7J A;  3ZDL A;  3UGP A;  2R7V A;  4MVU A;  2KGO A;  1WWP A;  2L6H A;  3M4B A;  4EWC A;  3S27 A;  1BZ4 A;  4XPW A;  2XL8 A;  4JEB A;  3IPM O;  4O6Y A;  4DJ9 A;  5HSW A;  1TWH A;  2G3K A;  1MMD A;  5B1B C;  1E86 A;  3AQB A;  4YL3 A;  1D1C A;  2IYL D;  1YZA A;  1YA7 O;  3NYJ A;  4JVS A;  2CNW D;  3NDB B;  1PV3 A;  1ZZP A;  2NSF A;  3AG4 C;  3NYM A;  3RVZ A;  5L0I A;  2VC9 A;  1GGQ A;  3FMS A;  1YYX A;  2GFH A;  5JRA A;  2Q9C A;  1UG7 A;  1ZU4 A;  4P6I C;  2CGE A;  5EK0 A;  1S7Z A;  3SNH A;  2A68 F;  2YL1 A;  3FAP B;  4ULV A;  2FFH A;  2WZG A;  3GM1 A;  2RSE B;  2PX0 A;  4O6M A;  4XTK A;  4KC9 A;  3JZ0 A;  4U5H A;  4J30 B;  2J0W A;  2J8W A;  3C8G B;  3IEE A;  2OQM A;  3FOO A;  5A6A A;  3U2L A;  2R7O A;  2ZXP A;  3S29 A;  5DLJ A;  3S0X A;  3MBG A;  4I44 A;  1YYJ A;  2OU6 A;  2OJQ A;  4HEA J;  4IWB A;  4J7T A;  5CI9 A;  5BUO A;  4NTF A;  2TMV P;  4YJW A;  4IB4 A;  4N06 A;  4DVZ A;  2J7P A;  1K05 A;  4JW1 A;  4G7Z F;  3EZI A;  3SXM A;  3V5X A;  4XQ1 A;  3ECS A;  4CSA C;  3KH2 A;  1D0Y A;  4N6C A;  5L0D A;  1RKE B;  2XM0 A;  3MYF A;  4LDR A;  1JOG A;  1I4Y A;  4G0H A;  3SXY A;  4Z9I A;  4E18 A;  3W8I A;  3G4Z A;  1OR2 A;  3JYY A;  4MW8 A;  4E0I A;  3EH1 A;  2A1D D;  2L6G A;  4YK5 A;  2J0X A;  4HE8 D;  2WL8 A;  3RQF A;  3ATP A;  2NUP A;  3E70 C;  4I1O B;  2M4E A;  4W8K A;  3TK0 A;  1Q0G A;  1JRA A;  2Y3B A;  1VMA A;  1ST6 A;  3BEH A;  1NSG B;  3O10 A;  3EGD A;  3DD7 A;  1G5Z A;  1KNY A;  2VCC A;  2WZF A;  4JJF A;  1ZW2 A;  4K1O A;  4DRI B;  1G8X A;  2KK1 A;  5AC5 A;  3X2Q C;  5L3V A;  1E83 A;  2YEV A;  4MND A;  4XLN F;  2GWW A;  4E17 A;  1OW6 A;  3Q7L A;  1YDI A;  2Y3G A;  2L6F A;  3DE8 A;  5F5H A;  3BRJ A;  3B0U X;  2YRF A;  3EFO A;  4CS9 C;  3DM5 A;  2ZPA A;  3GOR A;  1AEP A;  1EA8 A;  3QW0 A;  2MYS A;  3AJM A;  3WHN A;  2ETS A;  1ORY A;  2R7U A;  4H54 A;  4BJ1 A;  3K6B A;  3EGX B;  4ER9 A;  4DXW A;  3LLK A;  3U9J A;  1BR1 A;  4JTD B;  3V5Y A;  4NC3 A;  2QE9 A;  3QZC A;  4XWJ A;  2JD3 A;  3NMK A;  2O9X A;  3DE9 A;  1YLM A;  3MX3 A;  4IAR A;  3FHD A;  4IJJ A;  1JPN A;  1N1C A;  2IBF A;  1FFT C;  3N24 A;  4YT2 A;  4OIR F;  4QDL A;  2IXM A;  3B0P A;  5AGF A;  3PHF 2;  1Q0M A;  4GQH A;  1L3P A;  2F22 A;  1J8Y F;  1M2V B;  1DOW A;  1T6U A;  2HS5 A;  2HV7 A;  1NU7 D;  2LD6 A;  3VM6 A;  4YWQ A;  1FNT c;  1CGN A;  1OCO C;  4CDV A;  3NKD A;  4I3M A;  4JKV A;  1S05 A;  4DVY P;  1U0B B;  1HW1 A;  2R02 A;  2Q7R A;  1RJ9 B;  2QY9 A;  3VAY A;  1MQV A;  2KYH A;  3GAN A;  1U6H A;  1TFO B;  3QMK A;  3U5S A;  5A6B A;  1B68 A;  3X1O A;  5DS6 A;  2R7X A;  4M63 A;  5B3S C;  1WN0 A;  1Y4C A;  3K1I A;  1JPJ A;  4MVZ A;  2HSB A;  1M2O A;  1K40 A;  1YVI A;  2WVN A;  2VCB A;  2CCY A;  3MYI A;  1TQG A;  2XLD A;  4NQF A;  1H6G A;  3RFY A;  2EIJ C;  2OEX A;  4F4B A;  1JAF A;  2RD9 A;  1M6T A;  2XLE A;  3GM2 A;  3TJ6 A;  4AE4 A;  2CYD A;  4AK9 A;  4MTO A;  3TOM A;  2C04 A;  4CDA A;  2ZXR A;  4RDA A;  5E3A A;  5COM A;  2HMZ A;  2W45 A;  4Q7C A;  3W4Y A;  1MMG A;  3A11 A;  4O7G A;  5DS4 A;  2PP4 A;  1QLE C;  2Q3T A;  5KYU A;  3T6J A;  2R7R A;  4MVO A;  4MVM A;  4QI2 A;  3RKO F;  1FMW A;  2YL0 A;  3B9Q A;  2D4U A;  5AC4 A;  2X51 A;  2Y39 A;  2J9U A;  3OEO A;  1C17 M;  1OCR C;  1ZHY A;  3M4C A;  4JC7 A;  2XLO A;  1NFO A;  2P61 A;  2R03 A;  5JT4 A;  4G7O F;  1XWJ A;  2YWA A;  4U5B E;  4PJM A;  4R32 A;  1A7V A;  2YL7 A;  3LNM B;  3HLZ A;  3HNL A;  4BJ6 C;  1TWG A;  5A69 A;  5JLI A;  2V3C C;  1FR0 A;  2QNL A;  3UR3 C;  3ZQY A;  1Y6D A;  2J7P D;  3CSK A;  3JSE O;  3ZTM A;  3Q7G A;  5T3W A;  2XXA A;  2MHR A;  3S9O A;  3ASN C;  1PD1 A;  2EPL X;  2W4B A;  3TJ5 A;  5KYY A;  2LFF A;  3JTL O;  2UUH A;  2W4M A;  3C8G D;  4N6H A;  2WB7 A;  3QW1 A;  3SEO A;  3TQO A;  5B3I A;  2I15 A;  3O39 A;  4C3D A;  4NY3 A;  1CGO A;  2VB6 A;  3DI5 A;  2EPO A;  2XL4 A;  1YAU O;  1V55 C;  1Z7Q c;  2XS1 A;  3DXJ F;  4PJL A;  4FES A;  4U5C E;  4WJ0 A;  3M1C B;  2VH3 A;  3CAX A;  3A9C A;  4JE9 A;  5CIV A;  2R9R B;  2AP3 A;  2OOC A;  3B0V C;  3DM9 B;  4DRJ B;  4U5G A;  2J9V A;  2AVK A;  1LKX A;  2EPN A;  1D0X A;  2HZ8 A;  4I1M A;  4Z9H A;  1APC A;  3UMH A;  1NFN A;  4FAP B;  4MS2 A;  1M57 C;  3LAY A;  5E3C A;  4E7Z A;  1HMD A;  3EPV A;  3MLG A;  4CS8 A;  3PDM P;  3EH2 A;  3SXZ A;  4CX9 A;  4CIH A;  1WTY A;  2DB4 A;  1J8M F;  4L6R A;  1AUE A;  4BJ5 C;  3S84 A;  3QTH A;  4DBR A;  1Q0D A;  2PFD A;  2H8A A;  2J45 A;  3FVY A;  4WGY A;  5COF A;  4KI2 A;  5D91 A;  4NTA A;  2C03 A;  2QLA A;  5EHH A;  2JX0 A;  1TFK B;  5L0G A;  1TWA A;  3Q6N A;  3U3F A;  4UDV A;  2R7S A;  1OXK A;  3EJN A;  2NUP B;  2DI3 A;  3WAQ A;  1C03 A;  1OQC A;  5TJ5 E;  1SYQ A;  1ZW3 A;  3QVZ A;  1VK5 A;  2AWY A;  3AGT A;  4Z9J A;  3I5Q A;  1NZE A;  4A4A A;  1FAP B;  1HY5 A;  2CW0 F;  3EGD B;  3GEI A;  2YZS A;  3N2Z B;  4D4X A;  4PK4 A;  4Q4Z F;  4BG0 A;  2HJM A;  2KC3 A;  1F1M A;  1NBB A;  5L0H A;  3DZA A;  3DJN B;  4BEJ A;  4IGG A;  2PNO A;  3JRT A;  2P1A A;  3AGU A;  3JT1 A;  1A7D A;  1QZX A;  3ASO C;  2V26 A;  3B29 A;  3EFO B;  3UMK A;  1LE4 A;  4XLP F;  2P6V A;  3UGO A;  3GEH A;  3SXK A;  2H7V C;  1HMO A;  2LSE A;  3EG9 A;  1PCX A;  2GAQ A;  2QTV A;  4YT8 A;  4CSA A;  3JCU Q;  4MVQ A;  4O79 A;  2DYS C;  3RYL A;  5COG A;  5KYX A;  3G50 A;  2LQG A;  4ZLD A;  1M56 C;  1ZHX A;  2LK4 A;  2WVQ A;  4MVR A;  3T6B A;  3GOD A;  2EPK X;  4IAQ A;  3FAJ A;  2IXP A;  3L8I A;  5L3Q A;  2XLH A;  1YAR O;  3ZTZ A;  5BQH A;  1EQ1 A;  2XL6 A;  1R4T A;  3ABM C;  2B0J A;  4JRZ A;  2IXN A;  3PMR A;  3POV A;  3OWT A;  4EKW A;  4C3E A;  1HW2 A;  1D1B A;  1PD0 A;  3O55 A;  1EKY A;  1H9G A;  2R05 A;  4CJO A;  1LVK A;  3DAF A;  2YL3 A;  1JR8 A;  3C63 A;  4RBN A;  3DJU B;  5JUA A;  2A69 F;  5F28 E;  2MWQ A;  4MW3 A;  1O87 A;  3SZR A;  3B71 A;  2YLI A;  2W9Y A;  3M15 A;  3I5P A;  4U9E A;  4PFO A;  4O6N A;  2YLG A;  2HSQ A;  3ZVR A;  2JPU A;  4CS9 A;  4EBB A;  1L7C A;  2OCC C;  4N4W A;  2OEV A;  4DRH B;  3S90 A;  3FXH A;  2R7W A;  2EIN C;  1CPR A;  2XSE A;  5DQZ A;  2WZL A;  4DOZ A;  1Z6A A;  2EIL C;  1MND A;  4JCZ A;  4LDQ A;  3IHU A;  1WAT A;  3ZIB A;  4AE4 B;  2LIG A;  3MFN A;  4AL0 A;  2IOQ A;  2KNH A;  2KW3 C;  2LP4 A;  3C62 A;  2QUP A;  4WGZ A;  3SP1 A;  4H4K C;  1OXB A;  4U5E E;  3HNI A;  4W8P A;  5KYU B;  1V4A A;  4HFK B;  3UNG C;  1Z63 A;  4U5F E;  3PCV A;  2KSF A;  1ZYR F;  2NUT A;  4YT4 A;  3U0C A;  3C18 A;  1ZHW A;  3U9M A;  4QI0 A;  4HFF B;  5L0J A;  3KMI A;  4IAO A;  4P9T A;  2XRH A;  3G4X A;  2Y69 C;  5BQG A;  3AG3 C;  4CIP A;  1Z3I X;  2YQY A;  2HMQ A;  2YKZ A;  4G78 A;  4JIO A;  1BR4 A;  5A6K A;  1MMN A;  3U8P A;  4X0R A;  1AVO B;  3EHN A;  1QQ3 A;  1R5I D;  2PF4 E;  2UUI A;  5K0I A;  4C7O A;  4CDY A;  1NLX A;  4GEH A;  2XXA B;  3OA1 A;  5KYY B;  1FFH A;  2AU5 A;  4AL1 A;  3IQ5 A;  1WOL A;  4ANJ A;  1V74 B;  2HJ3 A;  2YVK A;  2XLV A;  3T6G B;  3JYH A;  4K0D A;  4YL0 A;  2ICW G;  1A41 A;  4C3B A;  3K1H A;  3K66 A;  1H7I A;  2FGY A;  2PX3 A;  3LLI A;  3DKA A;  1LM3 B;  3H2V A;  1HE1 A;  2EPM X;  2L81 A;  4LDK A;  1I5N A;  4XPY A;  3ITF A;  3RF3 A;  3EHM A;  3RQE A;  5DVW A;  1OCC C;  3EQL F;  3KKB A;  4EHP A;  3U3B A;  1SMY F;  1VB5 A;  2J9B A;  1LS1 A;  4EUK B;  2R25 A;  4LLC A;  2WVO A;  3LS0 A;  5EGY A;  2XLW A;  2Z15 A;  3EZH A;  3KPH A;  3NG1 A;  4OD5 A;  3L8J A;  4EIY A;  1VYK A;  3HNJ A;  4EBJ A;  3US6 A;  2LFD A;  2ASR A;  2Y3H A;  1YZC A;  3IQ6 A;  1I4Z A;  2NG1 A;  5L0C A;  3RVY A;  3O6X A;  1SR2 A;  4BPM A;  3K7D A;  3NMJ A;  1GM5 A;  2A6E F;  3L0I A;  4MTF A;  3U8V A;  3V5Z A;  1E2X A;  3AQC A;  4MVS A;  4BJ6 A;  4E0H A;  3R2P A;  5CI8 A;  4U5D E;  4XEV A;  2H7B A;  2E87 A;  1OKK A;  2HUJ A;  4CS8 C;  1OCZ C;  2L9J A;  1LIH A;  5T1D B;  1FMV A;  4K7B A;  2Q00 A;  3FOP A;  4YL1 A;  1ZVZ A;  3LUT B;  5BQI A;  1BR2 A;  4JZA A;  1IW7 F;  1D1A A;  1GQA A;  1BDJ B;  1UFB A;  2GDC A;  2P7V A;  1D0Z A;  3HTK C;  3QVY A;  4IRU A;  4XEK A;  3FDQ A;  4NCQ A;  4CS7 A;  3J06 A;  1KTM A;  4OD4 A;  1E84 A;  2DYR C;  2M64 A;  1VYI A;  1O5H A;  3DAG A;  4FWV A;  2EIM C;  4ULW A;  5KYN A;  4KBL A;  1CPQ A;  1ORJ A;  2G62 A;  3T9O A;  2VAS A;  4MTG A;  1VLT A;  1A7E A;  2CDQ A;  2KJG A;  3GWN A;  2AWC A;  1GS9 A;  3EG9 B;  3Q6M A;  5FZT A;  4LLE A;  3WOD F;  4A2N B;  2G3V A;  1XZQ A;  3NKE A;  1EI7 A;  1G4W R;  5KYX B;  4B6I A;  1LI7 A;  4BJ5 A;  2I8B A;  4ZLC A;  3ABL C;  4JTC B;  4NTB A;  1NU9 C;  3F47 A;  3T4R A;  2L7A A;  4CBE A;  3UMI A;  1ZHZ A;  3JRM O;  4JJG A;  3L34 A;  5A6B D;  2IXO A;  4AX2 A;  3C8G A;  5E2Q A;  3GEE A;  3M79 A;  3CEX A;  3NMI A;  2Q9B A;  2YHS A;  3NRH A;  2ZXW C;  3ZG1 A;  3SYN A;  4JUR I;  1T5O A;  3E9V A;  1O3U A;  1HE9 A;  1ZU5 A;  4JEA A;  3LEV A;  4PR9 A;  2CNW A;  1OW7 A;  3CZ6 A;  5JS5 A;  5JSL A;  5L0F A;  3ZC4 A;  1TKN A;  1ORS C;  2YLD A;  5E33 A;  1RKE A;  4U9D A;  1K04 A;  4PJN A;  4E7S A;  1T9K A;  1T6Q A;  2B0H A;  3F46 A;  1VOM A;  5FCL A;  2X0C A;  3AG1 C;  1TWC A;  1OW8 A;  3H65 A;  4BEM J;  2HKV A;  1H9T A;  4XPX A;  1G4U S;  3DMD A;  3GWL A;  2NSG A;  4XEF A;  2BE5 F;  3HNK A;  2J46 A;  2LCH A;  3C8Z A;  3HKK A;  3R7C A;  3RIP A;  5T3T A;  1CGM E;  4BJT A;  2HFI A;  1LE2 A;  2Q4F A;  1JMW A;  1OR3 A;  1LPE A;  1NG1 A;  1QKR A;  1WAS A;  2R7Q A;  3KYI A;  2XM4 A;  5D92 A;  3VRC A;  1LI5 A;  4G7H F;  2NUT B;  1BBH A;  4J7Y A;  4PJJ A;  3S28 A;  4GYT A;  2Q9A A;  256B A;  4YN0 B;  3W2W A;  2ZXO A;  2D5R B;  2A0U A;  5GPG B;  1Q0F A;  1RCP A;  1U89 A;  3IQC A;  3K1I C;  4EBK A;  4DBQ A;  1XZP A;  3LES A;  1VTM P;  2VCA A;  3IQT A;  2A6H F;  4OIQ F;  4WAB A;  5F5F A;  2BL2 A;  3LS1 A;  1SF8 A;  3TUL A;  3RW0 A;  2P0N A;  4OIN F;  1E85 A;  4C7O B;  1SZI A;  1QVX A;  1YJG A;  3EGX A;  3ZSU A;  2R7T A;  4ONS A;  1RKC A;  2KQ9 A;  3ZQV A;  4J32 B;  2H7O A;  3CQZ A;  1YA9 A;  3LNR A;  5DQT A;  5KYW B;  3K33 A;  1Q0K A;  1Z5Z A;  2J9W A;  2ZD9 A;  1OKK D;  4FX5 A;  1W2W A;  3ZWI A;  4KNV A;  5IY5 C;  4JTA B;  3NYL A;  1C02 A;  2BC5 A;  3I4U A;  3H2U A;  4OIO F;  3HJC A;  1T6I A;  3LEO A;  1DOV A;  1FTS A;  2OKU A;  1KU2 A;  1M2V A;  1LS4 A;  1QSP A;  2XLM A;  3V7O A;  3WG7 C;  5KYW A;  1IZM A;  3JSZ A;  3GM3 A;  3W8H A;  3N0T A;  3KL4 A;  5JVE A;  4KNW A; 
#chains in the Genus database with same CATH homology
 3CAX A;  3V5Z A;  3U9J A;  2P0N A;  3V5X A;  3V5Y A;  3U9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...