3V5ZA

Structure of fbxl5 hemerythrin domain, c2 cell, grown anaerobically
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
156
structure length
154
Chain Sequence
b'FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title Structural and Molecular Characterization of Iron-sensing Hemerythrin-like Domain within F-box and Leucine-rich Repeat Protein 5 (FBXL5).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 72
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3v5zA00
3V5ZA 3U9JA 3CAXA 3U9MA 3V5XA 3V5YA 2P0NA
chains in the Genus database with same CATH superfamily
3EFOB 1KU2A 1LI5A 2CGEA 3LNRA 3VAYA 1A7DA 1HE9A 1VYKA 3MYIA 1SR2A 1D1CA 2A1DD 2AWCA 3HNIA 4CS9A 1G8XA 4EBJA 1QQ3A 3T6GB 4JTCB 5FCLA 1OR2A 1FFHA 3H65A 3M15A 3JCUQ 4BEJA 2R7VA 2ETSA 2R9RB 1MNEA 3FXHA 2Q7RA 1YLMA 3UMIA 4BJ6A 3B71A 3RYLA 5F5FA 3L34A 1MMAA 3RFYA 4JEBA 1A41A 1TWHA 1Y6DA 2VASA 2GA0A 3LLKA 4JZAA 4K0DA 4MVMA 4RDAA 5JSLA 2XS8A 2HS5A 3JT1A 2FGYA 1DOVA 3I5PA 2YQYA 3C8ZA 5KYYA 1NFNA 1KTMA 5T3WA 3POVA 3PDMP 3SYNA 3GORA 3TK0A 4IAOA 3DXJF 3ATPA 2AWYA 2KGOA 1NG1A 256BA 3JSZA 2DGJA 2M64A 4N6CA 2J0XA 1LS4A 5F5HA 3EH2A 3SXKA 4FX5A 1WOLA 2CYDA 2KW3C 2QUPA 3FMSA 2GWWA 3QW1A 1BDJB 1LIHA 4O7GA 1Z6AA 1YVIA 2ZXWC 4JIOA 4OINF 4LACB 3RIPA 2ASRA 2R02A 3S84A 5L3VA 1U0BB 4HFFB 2PX0A 2Y39A 3QMKA 1HMDA 1FMWA 3M79A 3RQFA 5B3IA 3NRHA 3RKOF 3U5SA 2J45A 1GM5A 2Y3GA 2D4UA 4NTFA 3WG7C 1NBBA 5L0IA 2Z15A 1BR4A 3WHNA 5A6AA 3EGXA 1RCPA 2F22A 5DQTA 3NDBB 3DE9A 3EHNA 1Z3IX 4WGYA 2R7QA 1F1MA 5AGFA 2D5RB 1G5ZA 2J0WA 2WB7A 3C63A 1WGWA 3GANA 3M4CA 4NC3A 4Z9JA 5T1DB 2NUTA 4AX2A 4ANJA 1V4AA 3G4XA 4U9EA 1FFTC 3EG9A 2EPNA 1V74B 2H7VC 1QSPA 2OQMA 2DI3A 4YT4A 3C7JA 5A69A 1H9TA 4EBKA 3Q6MA 1AUEA 3CZ6A 1M2OA 1OW8A 1YYXA 1PCXA 1OCZC 2YKZA 3IQ5A 4PJNA 4LDKA 1Z63A 3ASOC 3SXYA 4AE4B 2JPUA 1WWPA 2AU5A 4CDAA 3MYFA 1N1CA 2PF4E 5COMA 4O79A 3S9OA 3TJ6A 3NG1A 3V5XA 1TWAA 1WASA 2V26A 4U5BE 1K04A 3EJNA 2WL8A 2KQ9A 2OU6A 5E3CA 1Q0GA 2HUJA 3HNLA 2I15A 4JURI 2P61A 2R05A 5BUOA 3PCVA 2EIMC 1OXKA 2LK4A 4DBRA 2OG2A 3KKBA 1CPQA 2Q4FA 3L8IA 4JJFA 2EPLX 4GQHA 4CS8A 1EKYA 3FDQA 3GODA 2IYLD 3ASNC 3Q7GA 3QZCA 3ZSUA 3C18A 4ULWA 3F46A 4IWBA 2A69F 2P1AA 3ABMC 4E7SA 4UDVA 3R7CA 2CNWA 3SP1A 3S29A 3ABKC 5L3QA 1FAPB 1YZCA 3NYMA 4LERA 1S7ZA 4JKVA 4W8PA 4I1MA 4D4XA 5A6BA 4PR9A 2A68F 4JCHA 4PFOA 5K0IA 1RMVA 1C17M 2J7PA 3C62A 1HW1A 4JE9A 3SEOA 4A4AA 2M4EA 3MX3A 1YA9A 4QI0A 4AL1A 1MMDA 1TKNA 1ORYA 5F28E 1CGME 4CDVA 3EQLF 1WATA 4LLCA 1OW7A 4CX9A 5COGA 3UR3C 4CJGA 1PD0A 1SMYF 4RBNA 2R7SA 2XL4A 3V5YA 3I4UA 2MHRA 3L8JA 4DVZA 4AL0A 3DM9B 3CSKA 2G3KA 1LPEA 2XLEA 3DAFA 3AQCA 3HLZA 3FAPB 2OEVA 3A9CA 4I1OB 4J30B 4Q7CA 4YN0B 4JW1A 1RKEB 3KYIA 5GPGB 4DRJB 5CIVA 2Q00A 5KYUB 5DS5A 1V55C 1A7VA 3H2UA 4CIPA 3MBGA 1YARO 1E85A 2J9VA 1EA8A 4DOZA 5A6BD 5TJ5E 5L0GA 2NSFA 2R7UA 1HE1A 2HZ8A 2J7PD 5HV9A 3B0VC 1ZZPA 3DE8A 2EINC 2L6FA 2KJGA 3DKAA 1O87A 1D0XA 1ZU5A 3L0IA 4PFPA 1YJGA 1I4ZA 4CIHA 5JP7A 4D4NA 3C8GA 5L0DA 1LVKA 3RVZA 3B0PA 3TOLA 1UG7A 4P6IC 1GS9A 3EGDB 3AGTA 4DJ9A 3DJNB 4U5EE 2R7WA 4E7ZA 3B29A 3DD7A 3EFOA 4MNDA 4XQ1A 4W8KA 1NLXA 4YT8A 3G50A 1Q0FA 4G7ZF 2R7OA 3GWLA 2RD9A 4MVUA 2YEVA 4MVOA 2FAPB 4OD4A 2Y69C 2DYRC 1R5ID 3HNJA 4M63A 2W45A 1LM3B 4NCQA 3U8VA 3DZAA 2YHSA 2J8WA 4ZLCA 4CSAC 2A0UA 5KYWB 4LDRA 2UUIA 2YL7A 4Z9HA 3SXMA 2WZLA 3W8HA 1T01A 2R25A 5D91A 1HW2A 4BJ5A 1T5OA 3K7DA 4XEVA 1A7EA 3OA1A 3U2MA 3NMIA 4Q5SF 1G4US 5JT4A 2ICWG 4WGZA 1EI7A 3SNHA 3C8GD 4E0IA 1LE4A 4P9FA 1M57C 1YAUO 3EH1A 2QLAA 3LNMB 4XPWA 2GAQA 4U5DE 4PJMA 1OXBA 1WTYA 2O9XA 4HE8D 2BL2A 3T6JA 3WAQA 2IXPA 3LS1A 5EHHA 1Q0DA 3TQOA 1XZQA 2WVQA 5AC4A 4L6RA 5IY5C 2XXAA 2KYHA 2H8AA 3AG1C 3G4ZA 3NMJA 4KC9A 1S05A 3S28A 2LCHA 2CCYA 3S27A 1RJ9B 1NZEA 3OWTA 1ZHZA 1D1BA 3RVYA 2R7TA 1PD1A 3PMRA 2YL1A 3CEXA 3K1IA 1DOWA 2AP3A 1PV3A 4PACA 3T6BA 3A11A 5JUAA 3LUTB 3BEHA 3K6BA 3WODF 3O39A 4LDQA 4BG0A 3ZVRA 4CSAA 3ECSA 3NYJA 3Q7LA 4C7OA 4K1OA 3RH3A 1RKCA 4YL3A 1Z7Qc 5BQGA 3RQEA 2XL6A 4MTGA 5B1AC 3DWWA 2WZFA 4I44A 5B3SC 3M1CB 4U5FE 3KL4A 2L9JA 1EQ1A 1NU9C 2V3CC 4E0HA 1ZW3A 3PHF2 1JPJA 3SZRA 1FMVA 2EIKC 2JD3A 4IJJA 3UNGC 1ZHWA 1ZYRF 3KYJA 1JRAA 2YLIA 4C3EA 1IZMA 3EGXB 4XEKA 4XPXA 3S90A 4XTKA 2G3VA 2XSEA 2J9BA 4MVSA 1BZ4A 4XLNF 4E18A 3FVYA 2LP4A 2NUTB 3ZWIA 2YWAA 5L0HA 1WN0A 2ZXOA 3JRMO 3TD7A 5AC5A 3EG9B 2PBEA 1ZU4A 5E3AA 2HSBA 2H7OA 3E9VA 4QDLA 4J7YA 2GDCA 1TQGA 5DQZA 2VCAA 1D1AA 4JEAA 2XM4A 4IAQA 3UMHA 3U2LA 2E87A 1E84A 3ZQYA 5KYXA 1VLTA 1Z5ZA 4QI2A 2YL0A 4U5HA 2OKUA 4EWCA 4JTAB 4NQFA 2Q9AA 4EHPA 4RD9A 3BRJA 2EILC 3EHMA 4CS9C 1D0ZA 5L0FA 4Z9IA 1OQCA 5DS6A 1A0BA 1BR2A 3CQZA 3IQ6A 5B1BC 4CDYA 1OCOC 4BJ1A 2LIGA 4WABA 3EZIA 2AVKA 3GEIA 4MW3A 3DMDA 3TOMA 1E2XA 5E33A 2TMVP 1ZVZA 4BJ6C 5DLJA 2NUPA 4YWQA 3OEOA 3EPVA 1J8MF 3AOUA 2EPKX 2HJMA 3X1OA 2Q9CA 3AQBA 3LAYA 1UFBA 2A6HF 2R7XA 1M2VB 1E86A 3N24A 2C04A 2QY9A 3K1HA 3MFNA 4HFKB 5CI9A 2J9UA 2B0HA 2XLDA 2QE9A 3AG4C 3HTKC 1XZPA 1V54C 4JCZA 4K7BA 5JVEA 4MVQA 1L3PA 2LFFA 1OKKA 1VOMA 2CDQA 4DVYP 4NY3A 4O6YA 4J32B 1T9KA 2HFIA 4YK5A 3QTHA 3IQCA 2RSEB 3UGPA 1VK5A 2BE5F 2R03A 4MTOA 5EK0A 2CNWD 2IXOA 1LI7A 1HMOA 1L7CA 2OCCC 4MVZA 1RKEA 1SYQA 2XLVA 3IPMO 1U6HA 3W8IA 2IBFA 2Y3HA 2OOCA 2Q9BA 1VB5A 4JC7A 3ZQVA 4AK9A 1O5HA 4XPYA 2H7BA 4KBLA 4P9TA 4DBQA 1CPRA 4CJOA 5E2QA 3FHDA 4MVRA 3LJBA 4JTDB 3KMIA 4MS2A 1K40A 1M6TA 5T3TA 1ZW2A 2PFDA 2Y3DA 4NTAA 3ZG1A 1FNTc 3JYHA 4F4BA 2P7VA 2KSFA 1SZIA 1OKKD 2EPMX 1YA7O 3VYWA 4G78A 3U9JA 3X2QC 3LESA 2QNLA 3GM1A 2W4MA 2L6GA 3C8GB 4YT2A 2XL8A 4ULVA 3U3FA 3MLGA 2J9WA 1NU7D 4NTBA 1TWGA 4A2NB 4CBEA 1M56C 4U5CE 1TFOB 4EIYA 3GEEA 2PNOA 1JAFA 4OIQF 1JMWA 3KPHA 3W4YA 2VH3A 4DRIB 4IGGA 1CGOA 4C3DA 3DI5A 4U5GA 3ZTMA 3U3BA 4DRHB 5BQIA 5JLIA 5KYWA 1XWJA 3NKDA 2HMQA 1QPUA 4MQ9F 1ZHTA 4JVSA 2NPUA 1MQVA 1QZXA 1H6GA 4YL0A 2X0CA 4JJGA 3V7OA 1MNDA 5DS4A 3N0TA 3US6A 1NFOA 4PJJA 2LD6A 1GGQA 3JZ0A 4CS8C 5KYNA 4X0RA 3VM6A 4YT5A 5KYYB 4GEHA 4KI2A 1U89A 1OCRC 5JS5A 1VLSA 4HEAJ 1NSGB 3N2ZB 3DJUB 5EGYA 1AEPA 2DB4A 3ABLC 2L6HA 3AG3C 2KC3A 2MYSA 3T9OA 2HKVA 2XLWA 2XXAB 1RJ9A 4G7OF 2P0NA 3DM5A 1B68A 1ZHYA 1TR2A 1TWCA 3LS0A 1ZHXA 2OJQA 1VTMP 2BC5A 2ZPAA 2C03A 4KNVA 3ZDLA 3ZC4A 2KNHA 2J46A 4BJTA 1ORJA 1JPNA 2VB6A 3K66A 4XEFA 1T6QA 3NKEA 4R32A 2YRFA 4BEMJ 2LSEA 2W4BA 2VCCA 2YL3A 1R4TA 3NMKA 4G0HA 3RW0A 3W2VA 3VF0A 2YVKA 2LQGA 2P6VA 1H9GA 4OIPF 2XLHA 2I8BA 1QLEC 4EKWA 2PP4A 3O10A 1E83A 4C7OB 1I5NA 2ZXRA 4EUKB 4H54A 3UGOA 2DYSC 3UMKA 1GQAA 1MMNA 2EIJC 2A0BA 3U9MA 3S0XA 5HSWA 1FTSA 3GM3A 3ZTZA 3I5QA 5D92A 4KNWA 2MWQA 4OD5A 2LFDA 2XLMA 1O3UA 4AE4A 2HJ3A 1T6UA 3GM2A 4FAPB 3HJCA 4O6NA 3ZIBA 4B6IA 2WZGA 4Q4ZF 2Y3BA 2JX0A 4YL1A 2YLGA 3LEVA 2HMZA 2OEXA 3FAJA 4H4KC 1J8YF 2XM0A 2NG1A 1QVXA 3U0CA 3HKKA 1FR0A 2OJED 2FFHA 2NSGA 3T4RA 3RQGA 1T6IA 2WVNA 4FWVA 1MMGA 1Y4CA 4YJWA 1JR8A 1Q0MA 4BPMA 1VYIA 3FOPA 5COFA 2YLDA 4ONSA 3B0UX 3L1MA 3B9QA 3U8PA 3V5ZA 4JRZA 4E17A 3O6XA 1AVOB 1HY5A 5KYXB 1SF8A 4U9DA 1APCA 1Q0KA 4N06A 4IRUA 3JSEO 1YDIA 3DAGA 3FOOA 3LEOA 4IB4A 5L0CA 4BJ5C 1ORSC 2XRHA 3KH2A 5BQHA 3QVYA 2G62A 3ITFA 3M4BA 1BBHA 4J7TA 2VCBA 1VMAA 3R2PA 1K05A 2KK1A 3QVZA 2EPOA 3F47A 4XWJA 5FZTA 3J06A 1M2VA 1OR3A 1W2WA 1C02A 3JYYA 4PJLA 1KNYA 3VRCA 2NUPB 3CAXA 4CS7A 3AG2C 4LLEA 4O6MA 4WJ0A 5DVWA 2ZD9A 1LKXA 2L7AA 1G4WR 2PX3A 3GWNA 3W2WA 4OIOF 2L81A 1JOGA 4I3MA 4IARA 1Z23A 5KYUA 4G7HF 2WVOA 1IW7F 4PK4A 3AJMA 1YYJA 3JRTA 3Q6NA 5JRAA 4GYTA 1LS1A 2HSQA 4MTFA 3AGUA 3TJ5A 5L0JA 3K1IC 2YZSA 1OCCC 3SXZA 2ZXPA 3NYLA 3JTLO 2XS1A 3E70C 1ST6A 2Q3TA 2A6EF 3H2VA 1I4YA 5A6JA 3IHUA 3GEHA 3HNKA 4FESA 4ER9A 2W9YA 3EZHA 3IEEA 1H7IA 2QTVA 4XLPF 4MW8A 3O55A 3K33A 2CW0F 2IXMA 2HV6A 4N6HA 4EBBA 1OW6A 3RF3A 3EGDA 3QW0A 2B0JA 3IQTA 2GFHA 2UUHA 2HV7A 4N4WA 1C03A 4ZLDA 5CI8A 2IM8A 4C3BA 1D0YA 2X51A 1TFKB 3LLIA 1BR1A 1LE2A 5A6KA 1YZAA 2XLOA 4DXWA 1QKRA 4OIRF 1CGNA 3TULA 2IXNA 2R7RA 1RXQA 2IOQA 2VC9A
chains in the Genus database with same CATH topology
3V5ZA 3U9JA 3CAXA 3U9MA 3V5XA 3V5YA 2P0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5Z A;  3U9J A;  3CAX A;  3U9M A;  3V5X A;  3V5Y A;  2P0N A; 
#chains in the Genus database with same CATH topology
 3EFO B;  1KU2 A;  1LI5 A;  2CGE A;  3LNR A;  3VAY A;  1A7D A;  1HE9 A;  1VYK A;  3MYI A;  1SR2 A;  1D1C A;  2A1D D;  2AWC A;  3HNI A;  4CS9 A;  1G8X A;  4EBJ A;  1QQ3 A;  3T6G B;  4JTC B;  5FCL A;  1OR2 A;  1FFH A;  3H65 A;  3M15 A;  3JCU Q;  4BEJ A;  2R7V A;  2ETS A;  2R9R B;  1MNE A;  3FXH A;  2Q7R A;  1YLM A;  3UMI A;  4BJ6 A;  3B71 A;  3RYL A;  5F5F A;  3L34 A;  1MMA A;  3RFY A;  4JEB A;  1A41 A;  1TWH A;  1Y6D A;  2VAS A;  2GA0 A;  3LLK A;  4JZA A;  4K0D A;  4MVM A;  4RDA A;  5JSL A;  2XS8 A;  2HS5 A;  3JT1 A;  2FGY A;  1DOV A;  3I5P A;  2YQY A;  3C8Z A;  5KYY A;  1NFN A;  1KTM A;  5T3W A;  3POV A;  3PDM P;  3SYN A;  3GOR A;  3TK0 A;  4IAO A;  3DXJ F;  3ATP A;  2AWY A;  2KGO A;  1NG1 A;  256B A;  3JSZ A;  2DGJ A;  2M64 A;  4N6C A;  2J0X A;  1LS4 A;  5F5H A;  3EH2 A;  3SXK A;  4FX5 A;  1WOL A;  2CYD A;  2KW3 C;  2QUP A;  3FMS A;  2GWW A;  3QW1 A;  1BDJ B;  1LIH A;  4O7G A;  1Z6A A;  1YVI A;  2ZXW C;  4JIO A;  4OIN F;  4LAC B;  3RIP A;  2ASR A;  2R02 A;  3S84 A;  5L3V A;  1U0B B;  4HFF B;  2PX0 A;  2Y39 A;  3QMK A;  1HMD A;  1FMW A;  3M79 A;  3RQF A;  5B3I A;  3NRH A;  3RKO F;  3U5S A;  2J45 A;  1GM5 A;  2Y3G A;  2D4U A;  4NTF A;  3WG7 C;  1NBB A;  5L0I A;  2Z15 A;  1BR4 A;  3WHN A;  5A6A A;  3EGX A;  1RCP A;  2F22 A;  5DQT A;  3NDB B;  3DE9 A;  3EHN A;  1Z3I X;  4WGY A;  2R7Q A;  1F1M A;  5AGF A;  2D5R B;  1G5Z A;  2J0W A;  2WB7 A;  3C63 A;  1WGW A;  3GAN A;  3M4C A;  4NC3 A;  4Z9J A;  5T1D B;  2NUT A;  4AX2 A;  4ANJ A;  1V4A A;  3G4X A;  4U9E A;  1FFT C;  3EG9 A;  2EPN A;  1V74 B;  2H7V C;  1QSP A;  2OQM A;  2DI3 A;  4YT4 A;  3C7J A;  5A69 A;  1H9T A;  4EBK A;  3Q6M A;  1AUE A;  3CZ6 A;  1M2O A;  1OW8 A;  1YYX A;  1PCX A;  1OCZ C;  2YKZ A;  3IQ5 A;  4PJN A;  4LDK A;  1Z63 A;  3ASO C;  3SXY A;  4AE4 B;  2JPU A;  1WWP A;  2AU5 A;  4CDA A;  3MYF A;  1N1C A;  2PF4 E;  5COM A;  4O79 A;  3S9O A;  3TJ6 A;  3NG1 A;  3V5X A;  1TWA A;  1WAS A;  2V26 A;  4U5B E;  1K04 A;  3EJN A;  2WL8 A;  2KQ9 A;  2OU6 A;  5E3C A;  1Q0G A;  2HUJ A;  3HNL A;  2I15 A;  4JUR I;  2P61 A;  2R05 A;  5BUO A;  3PCV A;  2EIM C;  1OXK A;  2LK4 A;  4DBR A;  2OG2 A;  3KKB A;  1CPQ A;  2Q4F A;  3L8I A;  4JJF A;  2EPL X;  4GQH A;  4CS8 A;  1EKY A;  3FDQ A;  3GOD A;  2IYL D;  3ASN C;  3Q7G A;  3QZC A;  3ZSU A;  3C18 A;  4ULW A;  3F46 A;  4IWB A;  2A69 F;  2P1A A;  3ABM C;  4E7S A;  4UDV A;  3R7C A;  2CNW A;  3SP1 A;  3S29 A;  3ABK C;  5L3Q A;  1FAP B;  1YZC A;  3NYM A;  4LER A;  1S7Z A;  4JKV A;  4W8P A;  4I1M A;  4D4X A;  5A6B A;  4PR9 A;  2A68 F;  4JCH A;  4PFO A;  5K0I A;  1RMV A;  1C17 M;  2J7P A;  3C62 A;  1HW1 A;  4JE9 A;  3SEO A;  4A4A A;  2M4E A;  3MX3 A;  1YA9 A;  4QI0 A;  4AL1 A;  1MMD A;  1TKN A;  1ORY A;  5F28 E;  1CGM E;  4CDV A;  3EQL F;  1WAT A;  4LLC A;  1OW7 A;  4CX9 A;  5COG A;  3UR3 C;  4CJG A;  1PD0 A;  1SMY F;  4RBN A;  2R7S A;  2XL4 A;  3V5Y A;  3I4U A;  2MHR A;  3L8J A;  4DVZ A;  4AL0 A;  3DM9 B;  3CSK A;  2G3K A;  1LPE A;  2XLE A;  3DAF A;  3AQC A;  3HLZ A;  3FAP B;  2OEV A;  3A9C A;  4I1O B;  4J30 B;  4Q7C A;  4YN0 B;  4JW1 A;  1RKE B;  3KYI A;  5GPG B;  4DRJ B;  5CIV A;  2Q00 A;  5KYU B;  5DS5 A;  1V55 C;  1A7V A;  3H2U A;  4CIP A;  3MBG A;  1YAR O;  1E85 A;  2J9V A;  1EA8 A;  4DOZ A;  5A6B D;  5TJ5 E;  5L0G A;  2NSF A;  2R7U A;  1HE1 A;  2HZ8 A;  2J7P D;  5HV9 A;  3B0V C;  1ZZP A;  3DE8 A;  2EIN C;  2L6F A;  2KJG A;  3DKA A;  1O87 A;  1D0X A;  1ZU5 A;  3L0I A;  4PFP A;  1YJG A;  1I4Z A;  4CIH A;  5JP7 A;  4D4N A;  3C8G A;  5L0D A;  1LVK A;  3RVZ A;  3B0P A;  3TOL A;  1UG7 A;  4P6I C;  1GS9 A;  3EGD B;  3AGT A;  4DJ9 A;  3DJN B;  4U5E E;  2R7W A;  4E7Z A;  3B29 A;  3DD7 A;  3EFO A;  4MND A;  4XQ1 A;  4W8K A;  1NLX A;  4YT8 A;  3G50 A;  1Q0F A;  4G7Z F;  2R7O A;  3GWL A;  2RD9 A;  4MVU A;  2YEV A;  4MVO A;  2FAP B;  4OD4 A;  2Y69 C;  2DYR C;  1R5I D;  3HNJ A;  4M63 A;  2W45 A;  1LM3 B;  4NCQ A;  3U8V A;  3DZA A;  2YHS A;  2J8W A;  4ZLC A;  4CSA C;  2A0U A;  5KYW B;  4LDR A;  2UUI A;  2YL7 A;  4Z9H A;  3SXM A;  2WZL A;  3W8H A;  1T01 A;  2R25 A;  5D91 A;  1HW2 A;  4BJ5 A;  1T5O A;  3K7D A;  4XEV A;  1A7E A;  3OA1 A;  3U2M A;  3NMI A;  4Q5S F;  1G4U S;  5JT4 A;  2ICW G;  4WGZ A;  1EI7 A;  3SNH A;  3C8G D;  4E0I A;  1LE4 A;  4P9F A;  1M57 C;  1YAU O;  3EH1 A;  2QLA A;  3LNM B;  4XPW A;  2GAQ A;  4U5D E;  4PJM A;  1OXB A;  1WTY A;  2O9X A;  4HE8 D;  2BL2 A;  3T6J A;  3WAQ A;  2IXP A;  3LS1 A;  5EHH A;  1Q0D A;  3TQO A;  1XZQ A;  2WVQ A;  5AC4 A;  4L6R A;  5IY5 C;  2XXA A;  2KYH A;  2H8A A;  3AG1 C;  3G4Z A;  3NMJ A;  4KC9 A;  1S05 A;  3S28 A;  2LCH A;  2CCY A;  3S27 A;  1RJ9 B;  1NZE A;  3OWT A;  1ZHZ A;  1D1B A;  3RVY A;  2R7T A;  1PD1 A;  3PMR A;  2YL1 A;  3CEX A;  3K1I A;  1DOW A;  2AP3 A;  1PV3 A;  4PAC A;  3T6B A;  3A11 A;  5JUA A;  3LUT B;  3BEH A;  3K6B A;  3WOD F;  3O39 A;  4LDQ A;  4BG0 A;  3ZVR A;  4CSA A;  3ECS A;  3NYJ A;  3Q7L A;  4C7O A;  4K1O A;  3RH3 A;  1RKC A;  4YL3 A;  1Z7Q c;  5BQG A;  3RQE A;  2XL6 A;  4MTG A;  5B1A C;  3DWW A;  2WZF A;  4I44 A;  5B3S C;  3M1C B;  4U5F E;  3KL4 A;  2L9J A;  1EQ1 A;  1NU9 C;  2V3C C;  4E0H A;  1ZW3 A;  3PHF 2;  1JPJ A;  3SZR A;  1FMV A;  2EIK C;  2JD3 A;  4IJJ A;  3UNG C;  1ZHW A;  1ZYR F;  3KYJ A;  1JRA A;  2YLI A;  4C3E A;  1IZM A;  3EGX B;  4XEK A;  4XPX A;  3S90 A;  4XTK A;  2G3V A;  2XSE A;  2J9B A;  4MVS A;  1BZ4 A;  4XLN F;  4E18 A;  3FVY A;  2LP4 A;  2NUT B;  3ZWI A;  2YWA A;  5L0H A;  1WN0 A;  2ZXO A;  3JRM O;  3TD7 A;  5AC5 A;  3EG9 B;  2PBE A;  1ZU4 A;  5E3A A;  2HSB A;  2H7O A;  3E9V A;  4QDL A;  4J7Y A;  2GDC A;  1TQG A;  5DQZ A;  2VCA A;  1D1A A;  4JEA A;  2XM4 A;  4IAQ A;  3UMH A;  3U2L A;  2E87 A;  1E84 A;  3ZQY A;  5KYX A;  1VLT A;  1Z5Z A;  4QI2 A;  2YL0 A;  4U5H A;  2OKU A;  4EWC A;  4JTA B;  4NQF A;  2Q9A A;  4EHP A;  4RD9 A;  3BRJ A;  2EIL C;  3EHM A;  4CS9 C;  1D0Z A;  5L0F A;  4Z9I A;  1OQC A;  5DS6 A;  1A0B A;  1BR2 A;  3CQZ A;  3IQ6 A;  5B1B C;  4CDY A;  1OCO C;  4BJ1 A;  2LIG A;  4WAB A;  3EZI A;  2AVK A;  3GEI A;  4MW3 A;  3DMD A;  3TOM A;  1E2X A;  5E33 A;  2TMV P;  1ZVZ A;  4BJ6 C;  5DLJ A;  2NUP A;  4YWQ A;  3OEO A;  3EPV A;  1J8M F;  3AOU A;  2EPK X;  2HJM A;  3X1O A;  2Q9C A;  3AQB A;  3LAY A;  1UFB A;  2A6H F;  2R7X A;  1M2V B;  1E86 A;  3N24 A;  2C04 A;  2QY9 A;  3K1H A;  3MFN A;  4HFK B;  5CI9 A;  2J9U A;  2B0H A;  2XLD A;  2QE9 A;  3AG4 C;  3HTK C;  1XZP A;  1V54 C;  4JCZ A;  4K7B A;  5JVE A;  4MVQ A;  1L3P A;  2LFF A;  1OKK A;  1VOM A;  2CDQ A;  4DVY P;  4NY3 A;  4O6Y A;  4J32 B;  1T9K A;  2HFI A;  4YK5 A;  3QTH A;  3IQC A;  2RSE B;  3UGP A;  1VK5 A;  2BE5 F;  2R03 A;  4MTO A;  5EK0 A;  2CNW D;  2IXO A;  1LI7 A;  1HMO A;  1L7C A;  2OCC C;  4MVZ A;  1RKE A;  1SYQ A;  2XLV A;  3IPM O;  1U6H A;  3W8I A;  2IBF A;  2Y3H A;  2OOC A;  2Q9B A;  1VB5 A;  4JC7 A;  3ZQV A;  4AK9 A;  1O5H A;  4XPY A;  2H7B A;  4KBL A;  4P9T A;  4DBQ A;  1CPR A;  4CJO A;  5E2Q A;  3FHD A;  4MVR A;  3LJB A;  4JTD B;  3KMI A;  4MS2 A;  1K40 A;  1M6T A;  5T3T A;  1ZW2 A;  2PFD A;  2Y3D A;  4NTA A;  3ZG1 A;  1FNT c;  3JYH A;  4F4B A;  2P7V A;  2KSF A;  1SZI A;  1OKK D;  2EPM X;  1YA7 O;  3VYW A;  4G78 A;  3U9J A;  3X2Q C;  3LES A;  2QNL A;  3GM1 A;  2W4M A;  2L6G A;  3C8G B;  4YT2 A;  2XL8 A;  4ULV A;  3U3F A;  3MLG A;  2J9W A;  1NU7 D;  4NTB A;  1TWG A;  4A2N B;  4CBE A;  1M56 C;  4U5C E;  1TFO B;  4EIY A;  3GEE A;  2PNO A;  1JAF A;  4OIQ F;  1JMW A;  3KPH A;  3W4Y A;  2VH3 A;  4DRI B;  4IGG A;  1CGO A;  4C3D A;  3DI5 A;  4U5G A;  3ZTM A;  3U3B A;  4DRH B;  5BQI A;  5JLI A;  5KYW A;  1XWJ A;  3NKD A;  2HMQ A;  1QPU A;  4MQ9 F;  1ZHT A;  4JVS A;  2NPU A;  1MQV A;  1QZX A;  1H6G A;  4YL0 A;  2X0C A;  4JJG A;  3V7O A;  1MND A;  5DS4 A;  3N0T A;  3US6 A;  1NFO A;  4PJJ A;  2LD6 A;  1GGQ A;  3JZ0 A;  4CS8 C;  5KYN A;  4X0R A;  3VM6 A;  4YT5 A;  5KYY B;  4GEH A;  4KI2 A;  1U89 A;  1OCR C;  5JS5 A;  1VLS A;  4HEA J;  1NSG B;  3N2Z B;  3DJU B;  5EGY A;  1AEP A;  2DB4 A;  3ABL C;  2L6H A;  3AG3 C;  2KC3 A;  2MYS A;  3T9O A;  2HKV A;  2XLW A;  2XXA B;  1RJ9 A;  4G7O F;  2P0N A;  3DM5 A;  1B68 A;  1ZHY A;  1TR2 A;  1TWC A;  3LS0 A;  1ZHX A;  2OJQ A;  1VTM P;  2BC5 A;  2ZPA A;  2C03 A;  4KNV A;  3ZDL A;  3ZC4 A;  2KNH A;  2J46 A;  4BJT A;  1ORJ A;  1JPN A;  2VB6 A;  3K66 A;  4XEF A;  1T6Q A;  3NKE A;  4R32 A;  2YRF A;  4BEM J;  2LSE A;  2W4B A;  2VCC A;  2YL3 A;  1R4T A;  3NMK A;  4G0H A;  3RW0 A;  3W2V A;  3VF0 A;  2YVK A;  2LQG A;  2P6V A;  1H9G A;  4OIP F;  2XLH A;  2I8B A;  1QLE C;  4EKW A;  2PP4 A;  3O10 A;  1E83 A;  4C7O B;  1I5N A;  2ZXR A;  4EUK B;  4H54 A;  3UGO A;  2DYS C;  3UMK A;  1GQA A;  1MMN A;  2EIJ C;  2A0B A;  3U9M A;  3S0X A;  5HSW A;  1FTS A;  3GM3 A;  3ZTZ A;  3I5Q A;  5D92 A;  4KNW A;  2MWQ A;  4OD5 A;  2LFD A;  2XLM A;  1O3U A;  4AE4 A;  2HJ3 A;  1T6U A;  3GM2 A;  4FAP B;  3HJC A;  4O6N A;  3ZIB A;  4B6I A;  2WZG A;  4Q4Z F;  2Y3B A;  2JX0 A;  4YL1 A;  2YLG A;  3LEV A;  2HMZ A;  2OEX A;  3FAJ A;  4H4K C;  1J8Y F;  2XM0 A;  2NG1 A;  1QVX A;  3U0C A;  3HKK A;  1FR0 A;  2OJE D;  2FFH A;  2NSG A;  3T4R A;  3RQG A;  1T6I A;  2WVN A;  4FWV A;  1MMG A;  1Y4C A;  4YJW A;  1JR8 A;  1Q0M A;  4BPM A;  1VYI A;  3FOP A;  5COF A;  2YLD A;  4ONS A;  3B0U X;  3L1M A;  3B9Q A;  3U8P A;  3V5Z A;  4JRZ A;  4E17 A;  3O6X A;  1AVO B;  1HY5 A;  5KYX B;  1SF8 A;  4U9D A;  1APC A;  1Q0K A;  4N06 A;  4IRU A;  3JSE O;  1YDI A;  3DAG A;  3FOO A;  3LEO A;  4IB4 A;  5L0C A;  4BJ5 C;  1ORS C;  2XRH A;  3KH2 A;  5BQH A;  3QVY A;  2G62 A;  3ITF A;  3M4B A;  1BBH A;  4J7T A;  2VCB A;  1VMA A;  3R2P A;  1K05 A;  2KK1 A;  3QVZ A;  2EPO A;  3F47 A;  4XWJ A;  5FZT A;  3J06 A;  1M2V A;  1OR3 A;  1W2W A;  1C02 A;  3JYY A;  4PJL A;  1KNY A;  3VRC A;  2NUP B;  3CAX A;  4CS7 A;  3AG2 C;  4LLE A;  4O6M A;  4WJ0 A;  5DVW A;  2ZD9 A;  1LKX A;  2L7A A;  1G4W R;  2PX3 A;  3GWN A;  3W2W A;  4OIO F;  2L81 A;  1JOG A;  4I3M A;  4IAR A;  1Z23 A;  5KYU A;  4G7H F;  2WVO A;  1IW7 F;  4PK4 A;  3AJM A;  1YYJ A;  3JRT A;  3Q6N A;  5JRA A;  4GYT A;  1LS1 A;  2HSQ A;  4MTF A;  3AGU A;  3TJ5 A;  5L0J A;  3K1I C;  2YZS A;  1OCC C;  3SXZ A;  2ZXP A;  3NYL A;  3JTL O;  2XS1 A;  3E70 C;  1ST6 A;  2Q3T A;  2A6E F;  3H2V A;  1I4Y A;  5A6J A;  3IHU A;  3GEH A;  3HNK A;  4FES A;  4ER9 A;  2W9Y A;  3EZH A;  3IEE A;  1H7I A;  2QTV A;  4XLP F;  4MW8 A;  3O55 A;  3K33 A;  2CW0 F;  2IXM A;  2HV6 A;  4N6H A;  4EBB A;  1OW6 A;  3RF3 A;  3EGD A;  3QW0 A;  2B0J A;  3IQT A;  2GFH A;  2UUH A;  2HV7 A;  4N4W A;  1C03 A;  4ZLD A;  5CI8 A;  2IM8 A;  4C3B A;  1D0Y A;  2X51 A;  1TFK B;  3LLI A;  1BR1 A;  1LE2 A;  5A6K A;  1YZA A;  2XLO A;  4DXW A;  1QKR A;  4OIR F;  1CGN A;  3TUL A;  2IXN A;  2R7R A;  1RXQ A;  2IOQ A;  2VC9 A; 
#chains in the Genus database with same CATH homology
 3V5Z A;  3U9J A;  3CAX A;  3U9M A;  3V5X A;  3V5Y A;  2P0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...