2GDCA

Structure of vinculin vd1 / ipaa560-633 complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
249
structure length
238
Chain Sequence
PVFHTRTIESILEPVAQQISHGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell invasion
total genus 99
structure length 238
sequence length 249
ec nomenclature
pdb deposition date 2006-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA01
1DOVA 1RKCA 3T6GB 1H6GA 1RKEA 4DJ9A 5FZTA 1ZVZA 3S90A 5L0HA 2HSQA 4K1OA 4PR9A 5L0FA 1ZW3A 4E17A 4E18A 4IGGA 4ONSA 5L0GA 2B0HA 1U89A 2IBFA 3TJ5A 1TR2A 1L7CA 2X0CA 5L0CA 3RF3A 1RKEB 1ST6A 3ZDLA 3TJ6A 3VF0A 3H2UA 3MYIA 1ZW2A 5L0JA 2GDCA 1SYQA 3H2VA 1YDIA 1DOWA 1QKRA 4W8PA 5L0IA 1T01A 2L7AA 1U6HA 4P9TA 5L0DA 4EHPA 1XWJA 2GWWA 2LQGA
chains in the Genus database with same CATH superfamily
3T6GB 5D92A 1TFKB 2BE5F 3T4RA 1E83A 4LLCA 1LI7A 1YZCA 2PX0A 3Q6MA 4Z9JA 2LD6A 1NSGB 1YYJA 5KYWB 5E3CA 3U2LA 4PR9A 2OOCA 5L0FA 5B3SC 1V4AA 2QUPA 1KNYA 2CGEA 2Q9BA 3L8IA 1NFOA 3M4BA 3MX3A 1CPRA 4LDKA 4RD9A 3V5ZA 3FAPB 2OEXA 1K40A 1G8XA 1SZIA 2H8AA 2Y3BA 3DJUB 1D0YA 2VB6A 1YAUO 2LIGA 2KW3C 2J9UA 3HNJA 2AWYA 4GYTA 5BQHA 5KYUB 3ABLC 2AVKA 1PV3A 3VAYA 4U9DA 1XZPA 5A6BA 4WGZA 5HV9A 1C17M 2YVKA 3IEEA 4MVSA 2XL8A 1GM5A 3U8PA 3U5SA 2J7PD 4BJ6A 2P61A 2GWWA 1A7DA 2KNHA 1K04A 4CSAC 3PDMP 1M6TA 5E3AA 4E0IA 3EH1A 4MVZA 4MTFA 3RQFA 5L0HA 3Q7GA 1OW7A 1Q0KA 1Q0DA 1NBBA 2GA0A 2XS1A 5GPGB 2OEVA 4YT5A 4LACB 2HFIA 2WB7A 2Z15A 1KTMA 1MMGA 1K05A 2UUIA 2W9YA 3PCVA 3ZQVA 3GWNA 1RKEB 4PK4A 4DVZA 1GGQA 1BZ4A 1R5ID 4N4WA 1O3UA 3K1IC 2J45A 4U5FE 2MHRA 1ZHZA 1QKRA 3SXYA 4C3EA 3HNIA 1TWCA 4IAQA 5KYNA 3EGDA 2YL3A 3ZTMA 2LQGA 3W8HA 2CDQA 2OG2A 3AQBA 3NG1A 3IQ5A 1Z5ZA 3ABMC 3NMIA 4JURI 4E18A 1QPUA 1YYXA 3KYIA 4G0HA 1JAFA 2ETSA 3JTLO 4J7YA 2VASA 3K6BA 3M1CB 2IBFA 1U0BB 3UNGC 3HTKC 3N2ZB 5T3TA 3V7OA 4BJ5C 4JZAA 1NU9C 4F4BA 4G7HF 4GEHA 2KC3A 4Q4ZF 5JRAA 2PNOA 3Q7LA 1JR8A 1T6QA 1L3PA 1T5OA 5JLIA 1LI5A 2DGJA 2GAQA 2KK1A 5CI9A 3FOPA 1WGWA 4YJWA 1EI7A 5A6AA 4ZLDA 5B3IA 2YLGA 4YL0A 2V26A 4YT2A 4PACA 3DE9A 1LE2A 3LLIA 3JYYA 2PX3A 2OU6A 1FR0A 2XLWA 3RH3A 4AL0A 3TQOA 3AOUA 4K0DA 2X51A 3FAJA 2NUPA 2GFHA 1ZHXA 3NYMA 4G78A 1ORJA 2AP3A 2LK4A 3SXMA 4D4XA 3LEOA 4DRHB 3EFOB 2PF4E 3NYJA 2XXAB 2C03A 4YWQA 2HS5A 3EGXB 4A2NB 4JVSA 4AE4A 4BJ6C 4G7ZF 3U9MA 2J0XA 3T6JA 3GEIA 4FESA 1NLXA 2EIJC 2WVNA 4CDAA 3S0XA 2J9WA 1CGOA 3FDQA 1XZQA 3C8ZA 4AL1A 3DWWA 3GORA 4CDVA 1E84A 1D0ZA 1UFBA 2L7AA 4HFFB 3HNLA 3TOLA 1SF8A 4JKVA 1HE9A 4J30B 4WABA 5A6BD 4KI2A 4C7OB 3RIPA 3HKKA 2R05A 1TWAA 1JRAA 2YQYA 5DS5A 3GEHA 4E7SA 2Y3HA 2WL8A 2XM4A 3JSZA 2CYDA 1U89A 1NU7D 4I1OB 1BR1A 2YL0A 4MTOA 4XEVA 4FX5A 2YWAA 2Y69C 2R7SA 2OJED 4NCQA 3IQCA 2KGOA 1VK5A 2F22A 2IOQA 3EPVA 3QVZA 1EA8A 3MYIA 3E70C 1FFTC 3K66A 3PMRA 4XQ1A 3VF0A 5BQGA 2IXMA 1HW2A 2FGYA 1C03A 2W45A 3KPHA 4PJJA 4XWJA 3JRTA 3I5QA 5L0CA 3RFYA 1HY5A 4ER9A 1YJGA 1ZHYA 4JTAB 3S29A 3B9QA 1N1CA 3RVZA 2R7WA 4JTDB 4DBQA 1ZVZA 4I1MA 4IWBA 2AWCA 4LERA 1H7IA 1MMNA 2VCAA 4N6CA 2R9RB 4RBNA 4AX2A 2LFFA 2G3KA 4HE8D 3V5XA 4OINF 1R4TA 1JMWA 3LAYA 3LS0A 4JJFA 4U5BE 5EGYA 3B0VC 3DE8A 1BR4A 2W4MA 2V3CC 1OCOC 3RQGA 2H7VC 3HJCA 2PFDA 2XLHA 3KL4A 2JPUA 2M4EA 2M64A 4JC7A 4U5DE 1TWGA 3UR3C 3ZDLA 4EUKB 1ZW2A 2GDCA 4X0RA 3UMHA 1CGME 2R7XA 1VOMA 3UMIA 2HV7A 3EG9B 3H2VA 3IPMO 4FAPB 1A0BA 3OA1A 3S28A 256BA 3N0TA 2IXPA 4PFOA 3EQLF 1U6HA 1ORYA 2BL2A 2LP4A 4M63A 1XWJA 2CNWA 4P9TA 3W2VA 1MNDA 4O6MA 3ZVRA 1BBHA 1DOVA 2JD3A 1ZHWA 2MWQA 2NUTB 2XLOA 4P6IC 1PD0A 5AGFA 1YVIA 3C8GB 3VRCA 4K7BA 3FVYA 4NTBA 2HSQA 4U5GA 5JSLA 4EBJA 4JRZA 3M15A 3U3FA 4DOZA 3LESA 2RD9A 5L0GA 1Z6AA 4DRIB 2L6FA 3FXHA 2OQMA 2HJ3A 1M2VA 4MVOA 3K33A 3SYNA 1T6UA 2CW0F 1YARO 3DM5A 4KNWA 4NTAA 3TD7A 5JUAA 3ABKC 1A7VA 5FCLA 4LLEA 1J8MF 3F46A 3CZ6A 1I4YA 4MS2A 1S7ZA 5KYWA 4CJGA 3RQEA 1ZHTA 1DOWA 3QZCA 4IB4A 2EINC 2AU5A 3R2PA 4PJNA 5L0IA 3POVA 2BC5A 2J8WA 4Q7CA 3HLZA 2FAPB 3QW1A 2DB4A 1E86A 2G62A 1WN0A 3DD7A 3EJNA 2R03A 3SNHA 4LDQA 3W4YA 2R7UA 4LDRA 4U9EA 4DXWA 1V55C 4NQFA 1SR2A 3LS1A 4U5HA 5D91A 2EPOA 5FZTA 5KYUA 4Z9HA 3U9JA 4PFPA 3QMKA 3NKDA 3WODF 2R7RA 5COFA 3EG9A 1WWPA 2XL4A 2OCCC 1OQCA 2H7OA 3ZIBA 2B0HA 2EPKX 3TULA 4DBRA 1M57C 3UGPA 1HMOA 3GWLA 2DI3A 4FWVA 1WTYA 2NG1A 4P9FA 4XPYA 1VYIA 3S84A 1SYQA 4JJGA 2A6HF 1O5HA 2P7VA 2QLAA 2WVQA 3ZSUA 2O9XA 1I4ZA 3MLGA 1B68A 4XEKA 1PCXA 2ICWG 2YHSA 3O39A 4W8KA 2WZFA 4XPXA 1JPNA 3VM6A 2EPNA 3DAFA 4IARA 3UMKA 3NKEA 1TWHA 5KYXB 3TK0A 1YA7O 2HZ8A 1F1MA 3WHNA 1RKEA 5L3QA 4J7TA 1BR2A 2HV6A 1M56C 2P0NA 5F28E 5DQTA 4C3DA 2WZGA 2L81A 3M4CA 4MVUA 3T9OA 4ONSA 4EKWA 3AGTA 3OWTA 3C63A 4GQHA 4ULVA 3QVYA 4G7OF 3G50A 3ASOC 5DVWA 1S05A 2A68F 2XRHA 3O55A 4U5CE 1D1CA 3Q6NA 5COGA 1HW1A 3E9VA 3TJ6A 3GM2A 3JZ0A 4BPMA 5DS6A 2KSFA 2ZXOA 3L34A 1A7EA 1WATA 4I3MA 1QVXA 2HUJA 1E2XA 2W4BA 3ZQYA 4B6IA 3M79A 4XTKA 2J0WA 2XLVA 2ZPAA 2YZSA 4MVMA 5CIVA 3UGOA 3AGUA 4HFKB 3ZC4A 1LKXA 3AJMA 4JEAA 3LEVA 4QDLA 3SZRA 4EHPA 4CS8A 3NRHA 1RJ9B 2WVOA 3MYFA 4H4KC 3X1OA 3G4XA 2J9BA 5T3WA 1UG7A 1CPQA 2EPMX 1LE4A 5F5FA 2CNWD 1GS9A 2EIKC 1QSPA 1RMVA 2R02A 3WAQA 5K0IA 5HSWA 3OEOA 4JW1A 4Z9IA 1TR2A 4MNDA 1OCZC 3DAGA 1H9GA 4E7ZA 1WASA 1AEPA 5T1DB 4KC9A 3H65A 5COMA 2EILC 3GODA 5IY5C 3BRJA 4HEAJ 4I44A 2XL6A 2TMVP 1H9TA 3WG7C 4O7GA 3US6A 1EQ1A 4U5EE 3FHDA 3DXJF 2YLDA 1J8YF 2HMQA 3KH2A 1EKYA 3DZAA 3O10A 2HSBA 2L6GA 3K1IA 4OD5A 2HMZA 4O79A 3W8IA 2A6EF 2I15A 2FFHA 3EHNA 4EWCA 3EFOA 1OW8A 2XXAA 4DVYP 5BQIA 3EGXA 3QTHA 4OD4A 4YK5A 4CIPA 4UDVA 2YLIA 4EIYA 1ZW3A 5E33A 5DQZA 1FNTc 2HKVA 1D0XA 1OCCC 1Y6DA 2Y39A 5AC5A 3DKAA 3C18A 2PP4A 1LS4A 4H54A 1RXQA 4YN0B 4IJJA 3V5YA 4CX9A 3NYLA 1Y4CA 2LCHA 3GANA 3K1HA 4C3BA 5L0JA 1AVOB 2QY9A 3C62A 4QI0A 4XEFA 4C7OA 2XSEA 2ZXWC 4KBLA 2L6HA 3DI5A 1YZAA 1LPEA 1T9KA 5JVEA 4W8PA 3BEHA 3ASNC 3JT1A 2IXNA 4PJMA 4YT4A 1APCA 4ULWA 1VMAA 4CIHA 3I5PA 3SXKA 5A69A 2E87A 3LJBA 3GEEA 2A69F 3LLKA 3FMSA 4MW8A 1TFOB 1Z7Qc 3CEXA 1D1BA 1AUEA 4AK9A 4NC3A 2ZXRA 4D4NA 4MQ9F 3RVYA 3S27A 4OIPF 3ITFA 1GQAA 2UUHA 1JOGA 1VLTA 2KYHA 3EGDB 1OR2A 3LNMB 4JTCB 2Q7RA 4EBKA 1NG1A 3AG4C 2ZD9A 3HNKA 4YT8A 4IAOA 3X2QC 1ST6A 1WOLA 2Q4FA 3ECSA 3GM3A 3U3BA 2B0JA 2OJQA 2KJGA 4JCHA 3ZWIA 4CS8C 3DMDA 1MQVA 3AG3C 3EZIA 4L6RA 1OW6A 2NSGA 3L1MA 2IM8A 1IW7F 1LS1A 3CQZA 1YDIA 4OIOF 2PBEA 1T6IA 4MVQA 4BEMJ 4JEBA 3R7CA 4O6YA 2ASRA 2P1AA 2XM0A 5EHHA 3SEOA 1FMWA 1H6GA 2A0UA 1BDJB 1OKKA 2VH3A 4NTFA 3PHF2 1V74B 1LVKA 3S90A 2R7QA 2C04A 2LSEA 2XLDA 3KKBA 3S9OA 1Q0GA 4EBBA 3U0CA 3L8JA 3RW0A 2DYSC 5EK0A 3B0UX 1G5ZA 1JPJA 1OXBA 5KYYA 5DLJA 2NUTA 3FOOA 3JSEO 4MVRA 3C8GA 3JCUQ 2NUPB 3JYHA 3LNRA 3SXZA 5A6JA 4XLPF 3NDBB 3O6XA 4O6NA 3EHMA 4BG0A 2VCBA 3N24A 4XPWA 5BUOA 1V54C 1T01A 2QNLA 2J46A 1A41A 2HJMA 2EPLX 2VCCA 3AG1C 3IQ6A 1NFNA 4YL3A 4OIRF 4CS9A 1YA9A 2XLMA 1MNEA 3G4ZA 3MBGA 2JX0A 4AE4B 3T6BA 3RKOF 2DYRC 2YKZA 3AG2C 4CJOA 4DJ9A 4YL1A 4CBEA 4JE9A 1FAPB 1D1AA 1LM3B 4R32A 1HMDA 3DM9B 2Y3DA 4K1OA 1ZU4A 4WGYA 1VTMP 2KQ9A 1NZEA 2RSEB 1ORSC 2Y3GA 5E2QA 3RYLA 2NSFA 4ANJA 1Q0MA 2Q9CA 2LFDA 3KYJA 4J32B 3ZTZA 5TJ5E 3CAXA 1L7CA 4N06A 2G3VA 3GM1A 4CS7A 2J7PA 3B0PA 4KNVA 1QQ3A 1LIHA 4WJ0A 1CGNA 1HE1A 2I8BA 4MTGA 1TKNA 2IXOA 4PJLA 3A9CA 1VYKA 5AC4A 4RDAA 2YL7A 1RCPA 2A0BA 4MW3A 3EH2A 3F47A 3K7DA 3DJNB 1RKCA 2QTVA 2CCYA 5B1AC 4OIQF 5L3VA 1G4WR 1ZU5A 4E17A 3J06A 4CSAA 3I4UA 4CDYA 1SMYF 4IRUA 2R7TA 3C7JA 5B1BC 3TJ5A 3U2MA 4Q5SF 5DS4A 5KYXA 2XLEA 4BEJA 3RF3A 1KU2A 2XS8A 3ZG1A 5JS5A 1OCRC 2OKUA 1I5NA 2YL1A 3H2UA 4E0HA 4N6HA 2NPUA 3IQTA 2EIMC 2MYSA 1PD1A 2Q9AA 3VYWA 2R25A 4BJ1A 3W2WA 3CSKA 3QW0A 3MFNA 4JCZA 4JIOA 2YRFA 3JRMO 3U8VA 4QI2A 2R7VA 1M2OA 1TQGA 3IHUA 1W2WA 1FMVA 1ZYRF 1Q0FA 2ZXPA 5JP7A 1VB5A 3LUTB 1QLEC 1MMDA 2L9JA 3TOMA 5KYYB 2A1DD 1O87A 3KMIA 5JT4A 1FTSA 2VC9A 5A6KA 3NMKA 1C02A 1YLMA 2Q3TA 4XLNF 4IGGA 2H7BA 2WZLA 1VLSA 1ZZPA 1FFHA 1OKKD 2Q00A 2YEVA 2QE9A 3SP1A 1MMAA 1OR3A 2X0CA 1Z63A 1OXKA 1G4US 3B71A 1RJ9A 2D4UA 3AQCA 1IZMA 4A4AA 4CS9C 5CI8A 4NY3A 3L0IA 1E85A 4DRJB 1QZXA 1Z23A 2J9VA 4BJTA 3NMJA 5F5HA 4ZLCA 2P6VA 1Z3IX 2IYLD 2D5RB 3A11A 3ATPA 3EZHA 1M2VB 4BJ5A 3B29A 5L0DA 3C8GD 2R7OA
chains in the Genus database with same CATH topology
1DOVA 1RKCA 3T6GB 1H6GA 1RKEA 4DJ9A 5FZTA 1ZVZA 3S90A 5L0HA 2HSQA 4K1OA 4PR9A 5L0FA 1ZW3A 4E17A 4E18A 4IGGA 4ONSA 5L0GA 2B0HA 1U89A 2IBFA 3TJ5A 1TR2A 1L7CA 2X0CA 5L0CA 3RF3A 1RKEB 1ST6A 3ZDLA 3TJ6A 3VF0A 3H2UA 3MYIA 1ZW2A 5L0JA 2GDCA 1SYQA 3H2VA 1YDIA 1DOWA 1QKRA 4W8PA 5L0IA 1T01A 2L7AA 1U6HA 4P9TA 5L0DA 4EHPA 1XWJA 2GWWA 2LQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOV A;  1RKC A;  3T6G B;  1H6G A;  1RKE A;  4DJ9 A;  5FZT A;  1ZVZ A;  3S90 A;  5L0H A;  2HSQ A;  4K1O A;  4PR9 A;  5L0F A;  1ZW3 A;  4E17 A;  4E18 A;  4IGG A;  4ONS A;  5L0G A;  2B0H A;  1U89 A;  2IBF A;  3TJ5 A;  1TR2 A;  1L7C A;  2X0C A;  5L0C A;  3RF3 A;  1RKE B;  1ST6 A;  3ZDL A;  3TJ6 A;  3VF0 A;  3H2U A;  3MYI A;  1ZW2 A;  5L0J A;  2GDC A;  1SYQ A;  3H2V A;  1YDI A;  1DOW A;  1QKR A;  4W8P A;  5L0I A;  1T01 A;  2L7A A;  1U6H A;  4P9T A;  5L0D A;  4EHP A;  1XWJ A;  2GWW A;  2LQG A; 
#chains in the Genus database with same CATH topology
 3T6G B;  5D92 A;  1TFK B;  2BE5 F;  3T4R A;  1E83 A;  4LLC A;  1LI7 A;  1YZC A;  2PX0 A;  3Q6M A;  4Z9J A;  2LD6 A;  1NSG B;  1YYJ A;  5KYW B;  5E3C A;  3U2L A;  4PR9 A;  2OOC A;  5L0F A;  5B3S C;  1V4A A;  2QUP A;  1KNY A;  2CGE A;  2Q9B A;  3L8I A;  1NFO A;  3M4B A;  3MX3 A;  1CPR A;  4LDK A;  4RD9 A;  3V5Z A;  3FAP B;  2OEX A;  1K40 A;  1G8X A;  1SZI A;  2H8A A;  2Y3B A;  3DJU B;  1D0Y A;  2VB6 A;  1YAU O;  2LIG A;  2KW3 C;  2J9U A;  3HNJ A;  2AWY A;  4GYT A;  5BQH A;  5KYU B;  3ABL C;  2AVK A;  1PV3 A;  3VAY A;  4U9D A;  1XZP A;  5A6B A;  4WGZ A;  5HV9 A;  1C17 M;  2YVK A;  3IEE A;  4MVS A;  2XL8 A;  1GM5 A;  3U8P A;  3U5S A;  2J7P D;  4BJ6 A;  2P61 A;  2GWW A;  1A7D A;  2KNH A;  1K04 A;  4CSA C;  3PDM P;  1M6T A;  5E3A A;  4E0I A;  3EH1 A;  4MVZ A;  4MTF A;  3RQF A;  5L0H A;  3Q7G A;  1OW7 A;  1Q0K A;  1Q0D A;  1NBB A;  2GA0 A;  2XS1 A;  5GPG B;  2OEV A;  4YT5 A;  4LAC B;  2HFI A;  2WB7 A;  2Z15 A;  1KTM A;  1MMG A;  1K05 A;  2UUI A;  2W9Y A;  3PCV A;  3ZQV A;  3GWN A;  1RKE B;  4PK4 A;  4DVZ A;  1GGQ A;  1BZ4 A;  1R5I D;  4N4W A;  1O3U A;  3K1I C;  2J45 A;  4U5F E;  2MHR A;  1ZHZ A;  1QKR A;  3SXY A;  4C3E A;  3HNI A;  1TWC A;  4IAQ A;  5KYN A;  3EGD A;  2YL3 A;  3ZTM A;  2LQG A;  3W8H A;  2CDQ A;  2OG2 A;  3AQB A;  3NG1 A;  3IQ5 A;  1Z5Z A;  3ABM C;  3NMI A;  4JUR I;  4E18 A;  1QPU A;  1YYX A;  3KYI A;  4G0H A;  1JAF A;  2ETS A;  3JTL O;  4J7Y A;  2VAS A;  3K6B A;  3M1C B;  2IBF A;  1U0B B;  3UNG C;  3HTK C;  3N2Z B;  5T3T A;  3V7O A;  4BJ5 C;  4JZA A;  1NU9 C;  4F4B A;  4G7H F;  4GEH A;  2KC3 A;  4Q4Z F;  5JRA A;  2PNO A;  3Q7L A;  1JR8 A;  1T6Q A;  1L3P A;  1T5O A;  5JLI A;  1LI5 A;  2DGJ A;  2GAQ A;  2KK1 A;  5CI9 A;  3FOP A;  1WGW A;  4YJW A;  1EI7 A;  5A6A A;  4ZLD A;  5B3I A;  2YLG A;  4YL0 A;  2V26 A;  4YT2 A;  4PAC A;  3DE9 A;  1LE2 A;  3LLI A;  3JYY A;  2PX3 A;  2OU6 A;  1FR0 A;  2XLW A;  3RH3 A;  4AL0 A;  3TQO A;  3AOU A;  4K0D A;  2X51 A;  3FAJ A;  2NUP A;  2GFH A;  1ZHX A;  3NYM A;  4G78 A;  1ORJ A;  2AP3 A;  2LK4 A;  3SXM A;  4D4X A;  3LEO A;  4DRH B;  3EFO B;  2PF4 E;  3NYJ A;  2XXA B;  2C03 A;  4YWQ A;  2HS5 A;  3EGX B;  4A2N B;  4JVS A;  4AE4 A;  4BJ6 C;  4G7Z F;  3U9M A;  2J0X A;  3T6J A;  3GEI A;  4FES A;  1NLX A;  2EIJ C;  2WVN A;  4CDA A;  3S0X A;  2J9W A;  1CGO A;  3FDQ A;  1XZQ A;  3C8Z A;  4AL1 A;  3DWW A;  3GOR A;  4CDV A;  1E84 A;  1D0Z A;  1UFB A;  2L7A A;  4HFF B;  3HNL A;  3TOL A;  1SF8 A;  4JKV A;  1HE9 A;  4J30 B;  4WAB A;  5A6B D;  4KI2 A;  4C7O B;  3RIP A;  3HKK A;  2R05 A;  1TWA A;  1JRA A;  2YQY A;  5DS5 A;  3GEH A;  4E7S A;  2Y3H A;  2WL8 A;  2XM4 A;  3JSZ A;  2CYD A;  1U89 A;  1NU7 D;  4I1O B;  1BR1 A;  2YL0 A;  4MTO A;  4XEV A;  4FX5 A;  2YWA A;  2Y69 C;  2R7S A;  2OJE D;  4NCQ A;  3IQC A;  2KGO A;  1VK5 A;  2F22 A;  2IOQ A;  3EPV A;  3QVZ A;  1EA8 A;  3MYI A;  3E70 C;  1FFT C;  3K66 A;  3PMR A;  4XQ1 A;  3VF0 A;  5BQG A;  2IXM A;  1HW2 A;  2FGY A;  1C03 A;  2W45 A;  3KPH A;  4PJJ A;  4XWJ A;  3JRT A;  3I5Q A;  5L0C A;  3RFY A;  1HY5 A;  4ER9 A;  1YJG A;  1ZHY A;  4JTA B;  3S29 A;  3B9Q A;  1N1C A;  3RVZ A;  2R7W A;  4JTD B;  4DBQ A;  1ZVZ A;  4I1M A;  4IWB A;  2AWC A;  4LER A;  1H7I A;  1MMN A;  2VCA A;  4N6C A;  2R9R B;  4RBN A;  4AX2 A;  2LFF A;  2G3K A;  4HE8 D;  3V5X A;  4OIN F;  1R4T A;  1JMW A;  3LAY A;  3LS0 A;  4JJF A;  4U5B E;  5EGY A;  3B0V C;  3DE8 A;  1BR4 A;  2W4M A;  2V3C C;  1OCO C;  3RQG A;  2H7V C;  3HJC A;  2PFD A;  2XLH A;  3KL4 A;  2JPU A;  2M4E A;  2M64 A;  4JC7 A;  4U5D E;  1TWG A;  3UR3 C;  3ZDL A;  4EUK B;  1ZW2 A;  2GDC A;  4X0R A;  3UMH A;  1CGM E;  2R7X A;  1VOM A;  3UMI A;  2HV7 A;  3EG9 B;  3H2V A;  3IPM O;  4FAP B;  1A0B A;  3OA1 A;  3S28 A;  256B A;  3N0T A;  2IXP A;  4PFO A;  3EQL F;  1U6H A;  1ORY A;  2BL2 A;  2LP4 A;  4M63 A;  1XWJ A;  2CNW A;  4P9T A;  3W2V A;  1MND A;  4O6M A;  3ZVR A;  1BBH A;  1DOV A;  2JD3 A;  1ZHW A;  2MWQ A;  2NUT B;  2XLO A;  4P6I C;  1PD0 A;  5AGF A;  1YVI A;  3C8G B;  3VRC A;  4K7B A;  3FVY A;  4NTB A;  2HSQ A;  4U5G A;  5JSL A;  4EBJ A;  4JRZ A;  3M15 A;  3U3F A;  4DOZ A;  3LES A;  2RD9 A;  5L0G A;  1Z6A A;  4DRI B;  2L6F A;  3FXH A;  2OQM A;  2HJ3 A;  1M2V A;  4MVO A;  3K33 A;  3SYN A;  1T6U A;  2CW0 F;  1YAR O;  3DM5 A;  4KNW A;  4NTA A;  3TD7 A;  5JUA A;  3ABK C;  1A7V A;  5FCL A;  4LLE A;  1J8M F;  3F46 A;  3CZ6 A;  1I4Y A;  4MS2 A;  1S7Z A;  5KYW A;  4CJG A;  3RQE A;  1ZHT A;  1DOW A;  3QZC A;  4IB4 A;  2EIN C;  2AU5 A;  3R2P A;  4PJN A;  5L0I A;  3POV A;  2BC5 A;  2J8W A;  4Q7C A;  3HLZ A;  2FAP B;  3QW1 A;  2DB4 A;  1E86 A;  2G62 A;  1WN0 A;  3DD7 A;  3EJN A;  2R03 A;  3SNH A;  4LDQ A;  3W4Y A;  2R7U A;  4LDR A;  4U9E A;  4DXW A;  1V55 C;  4NQF A;  1SR2 A;  3LS1 A;  4U5H A;  5D91 A;  2EPO A;  5FZT A;  5KYU A;  4Z9H A;  3U9J A;  4PFP A;  3QMK A;  3NKD A;  3WOD F;  2R7R A;  5COF A;  3EG9 A;  1WWP A;  2XL4 A;  2OCC C;  1OQC A;  2H7O A;  3ZIB A;  2B0H A;  2EPK X;  3TUL A;  4DBR A;  1M57 C;  3UGP A;  1HMO A;  3GWL A;  2DI3 A;  4FWV A;  1WTY A;  2NG1 A;  4P9F A;  4XPY A;  1VYI A;  3S84 A;  1SYQ A;  4JJG A;  2A6H F;  1O5H A;  2P7V A;  2QLA A;  2WVQ A;  3ZSU A;  2O9X A;  1I4Z A;  3MLG A;  1B68 A;  4XEK A;  1PCX A;  2ICW G;  2YHS A;  3O39 A;  4W8K A;  2WZF A;  4XPX A;  1JPN A;  3VM6 A;  2EPN A;  3DAF A;  4IAR A;  3UMK A;  3NKE A;  1TWH A;  5KYX B;  3TK0 A;  1YA7 O;  2HZ8 A;  1F1M A;  3WHN A;  1RKE A;  5L3Q A;  4J7T A;  1BR2 A;  2HV6 A;  1M56 C;  2P0N A;  5F28 E;  5DQT A;  4C3D A;  2WZG A;  2L81 A;  3M4C A;  4MVU A;  3T9O A;  4ONS A;  4EKW A;  3AGT A;  3OWT A;  3C63 A;  4GQH A;  4ULV A;  3QVY A;  4G7O F;  3G50 A;  3ASO C;  5DVW A;  1S05 A;  2A68 F;  2XRH A;  3O55 A;  4U5C E;  1D1C A;  3Q6N A;  5COG A;  1HW1 A;  3E9V A;  3TJ6 A;  3GM2 A;  3JZ0 A;  4BPM A;  5DS6 A;  2KSF A;  2ZXO A;  3L34 A;  1A7E A;  1WAT A;  4I3M A;  1QVX A;  2HUJ A;  1E2X A;  2W4B A;  3ZQY A;  4B6I A;  3M79 A;  4XTK A;  2J0W A;  2XLV A;  2ZPA A;  2YZS A;  4MVM A;  5CIV A;  3UGO A;  3AGU A;  4HFK B;  3ZC4 A;  1LKX A;  3AJM A;  4JEA A;  3LEV A;  4QDL A;  3SZR A;  4EHP A;  4CS8 A;  3NRH A;  1RJ9 B;  2WVO A;  3MYF A;  4H4K C;  3X1O A;  3G4X A;  2J9B A;  5T3W A;  1UG7 A;  1CPQ A;  2EPM X;  1LE4 A;  5F5F A;  2CNW D;  1GS9 A;  2EIK C;  1QSP A;  1RMV A;  2R02 A;  3WAQ A;  5K0I A;  5HSW A;  3OEO A;  4JW1 A;  4Z9I A;  1TR2 A;  4MND A;  1OCZ C;  3DAG A;  1H9G A;  4E7Z A;  1WAS A;  1AEP A;  5T1D B;  4KC9 A;  3H65 A;  5COM A;  2EIL C;  3GOD A;  5IY5 C;  3BRJ A;  4HEA J;  4I44 A;  2XL6 A;  2TMV P;  1H9T A;  3WG7 C;  4O7G A;  3US6 A;  1EQ1 A;  4U5E E;  3FHD A;  3DXJ F;  2YLD A;  1J8Y F;  2HMQ A;  3KH2 A;  1EKY A;  3DZA A;  3O10 A;  2HSB A;  2L6G A;  3K1I A;  4OD5 A;  2HMZ A;  4O79 A;  3W8I A;  2A6E F;  2I15 A;  2FFH A;  3EHN A;  4EWC A;  3EFO A;  1OW8 A;  2XXA A;  4DVY P;  5BQI A;  3EGX A;  3QTH A;  4OD4 A;  4YK5 A;  4CIP A;  4UDV A;  2YLI A;  4EIY A;  1ZW3 A;  5E33 A;  5DQZ A;  1FNT c;  2HKV A;  1D0X A;  1OCC C;  1Y6D A;  2Y39 A;  5AC5 A;  3DKA A;  3C18 A;  2PP4 A;  1LS4 A;  4H54 A;  1RXQ A;  4YN0 B;  4IJJ A;  3V5Y A;  4CX9 A;  3NYL A;  1Y4C A;  2LCH A;  3GAN A;  3K1H A;  4C3B A;  5L0J A;  1AVO B;  2QY9 A;  3C62 A;  4QI0 A;  4XEF A;  4C7O A;  2XSE A;  2ZXW C;  4KBL A;  2L6H A;  3DI5 A;  1YZA A;  1LPE A;  1T9K A;  5JVE A;  4W8P A;  3BEH A;  3ASN C;  3JT1 A;  2IXN A;  4PJM A;  4YT4 A;  1APC A;  4ULW A;  1VMA A;  4CIH A;  3I5P A;  3SXK A;  5A69 A;  2E87 A;  3LJB A;  3GEE A;  2A69 F;  3LLK A;  3FMS A;  4MW8 A;  1TFO B;  1Z7Q c;  3CEX A;  1D1B A;  1AUE A;  4AK9 A;  4NC3 A;  2ZXR A;  4D4N A;  4MQ9 F;  3RVY A;  3S27 A;  4OIP F;  3ITF A;  1GQA A;  2UUH A;  1JOG A;  1VLT A;  2KYH A;  3EGD B;  1OR2 A;  3LNM B;  4JTC B;  2Q7R A;  4EBK A;  1NG1 A;  3AG4 C;  2ZD9 A;  3HNK A;  4YT8 A;  4IAO A;  3X2Q C;  1ST6 A;  1WOL A;  2Q4F A;  3ECS A;  3GM3 A;  3U3B A;  2B0J A;  2OJQ A;  2KJG A;  4JCH A;  3ZWI A;  4CS8 C;  3DMD A;  1MQV A;  3AG3 C;  3EZI A;  4L6R A;  1OW6 A;  2NSG A;  3L1M A;  2IM8 A;  1IW7 F;  1LS1 A;  3CQZ A;  1YDI A;  4OIO F;  2PBE A;  1T6I A;  4MVQ A;  4BEM J;  4JEB A;  3R7C A;  4O6Y A;  2ASR A;  2P1A A;  2XM0 A;  5EHH A;  3SEO A;  1FMW A;  1H6G A;  2A0U A;  1BDJ B;  1OKK A;  2VH3 A;  4NTF A;  3PHF 2;  1V74 B;  1LVK A;  3S90 A;  2R7Q A;  2C04 A;  2LSE A;  2XLD A;  3KKB A;  3S9O A;  1Q0G A;  4EBB A;  3U0C A;  3L8J A;  3RW0 A;  2DYS C;  5EK0 A;  3B0U X;  1G5Z A;  1JPJ A;  1OXB A;  5KYY A;  5DLJ A;  2NUT A;  3FOO A;  3JSE O;  4MVR A;  3C8G A;  3JCU Q;  2NUP B;  3JYH A;  3LNR A;  3SXZ A;  5A6J A;  4XLP F;  3NDB B;  3O6X A;  4O6N A;  3EHM A;  4BG0 A;  2VCB A;  3N24 A;  4XPW A;  5BUO A;  1V54 C;  1T01 A;  2QNL A;  2J46 A;  1A41 A;  2HJM A;  2EPL X;  2VCC A;  3AG1 C;  3IQ6 A;  1NFN A;  4YL3 A;  4OIR F;  4CS9 A;  1YA9 A;  2XLM A;  1MNE A;  3G4Z A;  3MBG A;  2JX0 A;  4AE4 B;  3T6B A;  3RKO F;  2DYR C;  2YKZ A;  3AG2 C;  4CJO A;  4DJ9 A;  4YL1 A;  4CBE A;  4JE9 A;  1FAP B;  1D1A A;  1LM3 B;  4R32 A;  1HMD A;  3DM9 B;  2Y3D A;  4K1O A;  1ZU4 A;  4WGY A;  1VTM P;  2KQ9 A;  1NZE A;  2RSE B;  1ORS C;  2Y3G A;  5E2Q A;  3RYL A;  2NSF A;  4ANJ A;  1Q0M A;  2Q9C A;  2LFD A;  3KYJ A;  4J32 B;  3ZTZ A;  5TJ5 E;  3CAX A;  1L7C A;  4N06 A;  2G3V A;  3GM1 A;  4CS7 A;  2J7P A;  3B0P A;  4KNV A;  1QQ3 A;  1LIH A;  4WJ0 A;  1CGN A;  1HE1 A;  2I8B A;  4MTG A;  1TKN A;  2IXO A;  4PJL A;  3A9C A;  1VYK A;  5AC4 A;  4RDA A;  2YL7 A;  1RCP A;  2A0B A;  4MW3 A;  3EH2 A;  3F47 A;  3K7D A;  3DJN B;  1RKC A;  2QTV A;  2CCY A;  5B1A C;  4OIQ F;  5L3V A;  1G4W R;  1ZU5 A;  4E17 A;  3J06 A;  4CSA A;  3I4U A;  4CDY A;  1SMY F;  4IRU A;  2R7T A;  3C7J A;  5B1B C;  3TJ5 A;  3U2M A;  4Q5S F;  5DS4 A;  5KYX A;  2XLE A;  4BEJ A;  3RF3 A;  1KU2 A;  2XS8 A;  3ZG1 A;  5JS5 A;  1OCR C;  2OKU A;  1I5N A;  2YL1 A;  3H2U A;  4E0H A;  4N6H A;  2NPU A;  3IQT A;  2EIM C;  2MYS A;  1PD1 A;  2Q9A A;  3VYW A;  2R25 A;  4BJ1 A;  3W2W A;  3CSK A;  3QW0 A;  3MFN A;  4JCZ A;  4JIO A;  2YRF A;  3JRM O;  3U8V A;  4QI2 A;  2R7V A;  1M2O A;  1TQG A;  3IHU A;  1W2W A;  1FMV A;  1ZYR F;  1Q0F A;  2ZXP A;  5JP7 A;  1VB5 A;  3LUT B;  1QLE C;  1MMD A;  2L9J A;  3TOM A;  5KYY B;  2A1D D;  1O87 A;  3KMI A;  5JT4 A;  1FTS A;  2VC9 A;  5A6K A;  3NMK A;  1C02 A;  1YLM A;  2Q3T A;  4XLN F;  4IGG A;  2H7B A;  2WZL A;  1VLS A;  1ZZP A;  1FFH A;  1OKK D;  2Q00 A;  2YEV A;  2QE9 A;  3SP1 A;  1MMA A;  1OR3 A;  2X0C A;  1Z63 A;  1OXK A;  1G4U S;  3B71 A;  1RJ9 A;  2D4U A;  3AQC A;  1IZM A;  4A4A A;  4CS9 C;  5CI8 A;  4NY3 A;  3L0I A;  1E85 A;  4DRJ B;  1QZX A;  1Z23 A;  2J9V A;  4BJT A;  3NMJ A;  5F5H A;  4ZLC A;  2P6V A;  1Z3I X;  2IYL D;  2D5R B;  3A11 A;  3ATP A;  3EZH A;  1M2V B;  4BJ5 A;  3B29 A;  5L0D A;  3C8G D;  2R7O A; 
#chains in the Genus database with same CATH homology
 1DOV A;  1RKC A;  3T6G B;  1H6G A;  1RKE A;  4DJ9 A;  5FZT A;  1ZVZ A;  3S90 A;  5L0H A;  2HSQ A;  4K1O A;  4PR9 A;  5L0F A;  1ZW3 A;  4E17 A;  4E18 A;  4IGG A;  4ONS A;  5L0G A;  2B0H A;  1U89 A;  2IBF A;  3TJ5 A;  1TR2 A;  1L7C A;  2X0C A;  5L0C A;  3RF3 A;  1RKE B;  1ST6 A;  3ZDL A;  3TJ6 A;  3VF0 A;  3H2U A;  3MYI A;  1ZW2 A;  5L0J A;  2GDC A;  1SYQ A;  3H2V A;  1YDI A;  1DOW A;  1QKR A;  4W8P A;  5L0I A;  1T01 A;  2L7A A;  1U6H A;  4P9T A;  5L0D A;  4EHP A;  1XWJ A;  2GWW A;  2LQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...