2GDCA

Structure of vinculin vd1 / ipaa560-633 complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
249
structure length
238
Chain Sequence
PVFHTRTIESILEPVAQQISHGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell invasion
molecule keywords Vinculin
total genus 99
structure length 238
sequence length 249
ec nomenclature
pdb deposition date 2006-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA01
1QKRA 5L0GA 5L0FA 1YDIA 2L7AA 2IBFA 1L7CA 5FZTA 3H2VA 4E18A 2HSQA 5L0JA 4ONSA 3TJ6A 4DJ9A 3S90A 3H2UA 1TR2A 4EHPA 5L0IA 4P9TA 1DOVA 3MYIA 4W8PA 2X0CA 3RF3A 2B0HA 4E17A 1U89A 5L0CA 1ZW2A 1DOWA 1RKCA 1T01A 2GWWA 1RKEB 4K1OA 3ZDLA 5L0DA 1H6GA 1SYQA 1U6HA 1XWJA 1ZVZA 2LQGA 1ZW3A 2GDCA 5L0HA 3T6GB 3TJ5A 1RKEA 1ST6A 4PR9A 3VF0A 4IGGA
chains in the Genus database with same CATH superfamily
4OD4A 1OKKD 1Z6AA 4M63A 4BG0A 4U9EA 3JZ0A 2TMVP 4JTDB 3GANA 2ZXOA 3IEEA 4U5CE 2R03A 2P1AA 3DAFA 2P61A 2W4BA 3HNJA 4JEBA 5KYUB 4Q5SF 4K0DA 4Z9JA 3IHUA 2R7TA 4PFPA 5E33A 2QE9A 2XLMA 3RF3A 4JTAB 4E17A 1E2XA 2YLGA 3PCVA 5KYXB 1ZYRF 3PDMP 2Q9BA 4NCQA 3X2QC 4C3BA 5CI8A 2IXMA 5HSWA 3AGTA 4PJMA 4EIYA 4PACA 1KNYA 2VCCA 3G50A 3JYYA 2HJ3A 1Z23A 4JKVA 1H9GA 3K1IC 1TWCA 2LIGA 4AX2A 4RD9A 1ZHXA 2XLVA 5B3IA 5KYXA 1TWAA 1CPQA 2VCBA 3HLZA 3LS1A 3W4YA 3SP1A 3ZC4A 2DB4A 3DJNB 4EUKB 1PCXA 4I3MA 4IB4A 3IQTA 2FFHA 2ZXPA 3CAXA 4XLPF 3K7DA 5D91A 4DJ9A 2J8WA 2PNOA 5F5HA 3BRJA 3GEIA 5T3TA 1Z7Qc 3VM6A 4DVYP 1A7VA 4QDLA 2A69F 2I8BA 1T01A 2H7VC 4ZLDA 2XL8A 4HEAJ 5TJ5E 3FVYA 1VK5A 4J30B 2QLAA 3EJNA 3S29A 1SYQA 3G4XA 4O7GA 3FDQA 1K40A 5A6KA 2Z15A 3ZSUA 1QZXA 2D4UA 3VAYA 3L0IA 1TWHA 3AQBA 2CDQA 1OR2A 2JPUA 3KL4A 1H9TA 1BR2A 2MYSA 2Q7RA 1XZQA 3S84A 2IXPA 2Y3DA 3K33A 1IZMA 4GYTA 2YLIA 2B0JA 3GWNA 3A11A 4MVRA 2BL2A 3OA1A 3V5ZA 3W2WA 5E3CA 1D1AA 3RH3A 5AC4A 4GQHA 4EHPA 3LEOA 3LJBA 4Q4ZF 3MYIA 3FAJA 4C7OA 1N1CA 3EQLF 3RQFA 4MVUA 2D5RB 2XL6A 1O5HA 1FMVA 1UFBA 2WZGA 5A6JA 3HNIA 3QVZA 3DKAA 3SXMA 3T6BA 2HMZA 3GM3A 4KBLA 3B9QA 2CNWA 4BEMJ 1ZVZA 3LEVA 3MX3A 1GGQA 4IAOA 2KNHA 2XLEA 4JRZA 4OD5A 5BUOA 1M56C 3VF0A 4U5BE 1LE4A 2NPUA 1ST6A 3M4BA 4PR9A 3BEHA 3CQZA 4ZLCA 2IYLD 2EIMC 4JURI 1YZAA 5KYNA 2CW0F 5E2QA 5JVEA 3PMRA 1JAFA 1V74B 2QTVA 2XRHA 5GPGB 2I15A 3PHF2 2XXAB 5BQGA 2HSQA 4I1MA 4ULVA 1NU7D 3DAGA 1Q0MA 1AUEA 1W2WA 1Z5ZA 2LK4A 3H2UA 4U5DE 4BJ5A 2J0WA 2YVKA 3S90A 1YVIA 2XM0A 1ORYA 3K6BA 3RQGA 1LKXA 4N6HA 3EG9A 1HMDA 3B29A 4Z9HA 4YT4A 1LIHA 4OINF 1OW8A 3TK0A 3L8IA 4FAPB 5T3WA 3QZCA 4J7TA 4JJGA 3RIPA 1Y6DA 2UUHA 1SR2A 2WZLA 5DQZA 3WODF 1RMVA 1D0YA 1HE9A 1Q0KA 2AWYA 4DOZA 1QSPA 1SF8A 1G5ZA 4BJ6A 5L0FA 3KYJA 3O39A 1WATA 4K7BA 3C7JA 1C03A 1QLEC 2HFIA 4L6RA 4O6YA 3F47A 2XXAA 3DM5A 4CS7A 4DBQA 3MFNA 1M2VA 2FAPB 4GEHA 3O55A 1I4ZA 3ZTZA 2A1DD 2R9RB 4MVOA 256BA 1FAPB 5B1BC 3T4RA 5K0IA 1RXQA 5KYYB 3U9JA 1A0BA 5A6BD 1FR0A 3EG9B 2J45A 1H7IA 1BR1A 2HV6A 4CSAC 1AEPA 4MNDA 5D92A 3U0CA 2PP4A 2VC9A 1MMDA 1Q0DA 1HY5A 4DBRA 1H6GA 1Q0FA 1MMAA 1YJGA 3C63A 4NQFA 4XTKA 1S7ZA 4YL1A 5A6AA 5L0DA 2PBEA 2YLDA 2HUJA 3NMIA 3B0PA 4B6IA 3EGDA 2M4EA 1OKKA 4NY3A 4A2NB 1FMWA 1QKRA 2HSBA 4JEAA 4CDYA 4DVZA 1CGME 1VTMP 3HKKA 1VOMA 2KQ9A 3AQCA 5JRAA 2CCYA 1G4US 2EIKC 2JX0A 4PFOA 4XEFA 2XS1A 4CX9A 1M2OA 3EZIA 3IPMO 2MHRA 2HKVA 1G8XA 4W8KA 2HZ8A 2GA0A 4AL1A 4BJ6C 1PD0A 1LI5A 2WZFA 1R4TA 4ER9A 1IW7F 2J9BA 1CPRA 3DXJF 5JSLA 1GM5A 2YQYA 1OW6A 1Z3IX 4J7YA 2NUTA 5F5FA 2EPOA 3L34A 1RJ9B 4NTBA 1NLXA 5L0HA 4A4AA 3ATPA 3SYNA 4JC7A 3K66A 3RYLA 2ZXWC 2NSFA 3CZ6A 5L0GA 5B3SC 4CS9A 2LFFA 2OEXA 3JT1A 3GM2A 2NUTB 4U9DA 3U8VA 2XS8A 4XPXA 4EBJA 4BJ1A 5L0JA 2BC5A 3U8PA 2Y3GA 1T6UA 3HNKA 3E70C 2Y69C 3Q7GA 4BJTA 2GFHA 2IM8A 3UMHA 2KSFA 2M64A 3CEXA 2EPNA 2J7PA 4X0RA 4WGYA 5KYWA 1K04A 2R7RA 3FOPA 1NFOA 3E9VA 2OJED 4JW1A 3DE9A 3I5PA 2EINC 1MNDA 2J9VA 3NYLA 5EK0A 3TOLA 5EGYA 2QUPA 3QMKA 2VB6A 4XEVA 1QPUA 2R7QA 4WJ0A 5KYWB 1O87A 1WGWA 2AVKA 3DM9B 4NTFA 4UDVA 4CBEA 5JS5A 2H7OA 2Y3BA 1A7DA 4NTAA 1GS9A 4G78A 2DI3A 2MWQA 2RSEB 2L6HA 3L8JA 3TOMA 3US6A 2EPLX 1YDIA 1M2VB 2HMQA 2L7AA 3B71A 3FAPB 3KYIA 1M57C 2YEVA 3O6XA 1ZHTA 1VLSA 1WASA 3M1CB 3U3FA 1LS4A 4MVMA 2HJMA 4HFFB 5KYUA 2AP3A 3ZWIA 4XWJA 5A69A 2YZSA 3LLKA 1U89A 2UUIA 2XM4A 4IWBA 1E83A 4C3DA 4AK9A 2R02A 1EI7A 4OIOF 2ETSA 4FWVA 2GWWA 2LSEA 4ANJA 3SXYA 1V55C 2J7PD 2CNWD 3C18A 1MMNA 4F4BA 4O79A 1FNTc 4JVSA 2Y39A 1ORJA 2KYHA 2LQGA 2Q3TA 3POVA 5JT4A 3ABLC 1NZEA 3B0UX 2IOQA 4CJOA 2FGYA 3AJMA 3B0VC 4G7HF 3Q6NA 4CS8A 3RW0A 3C8GD 1RJ9A 3C8ZA 5CI9A 3LNMB 3M15A 3GM1A 2H7BA 3NG1A 3NMKA 5FCLA 3A9CA 2C04A 3T6JA 3LNRA 2YL1A 1JMWA 1T6QA 3JSEO 4PJLA 4AE4B 3S0XA 3C8GA 1L3PA 1J8YF 1VYIA 3GODA 1TFOB 2OJQA 3JSZA 4O6MA 4WGZA 3RQEA 3EGDB 2Q4FA 2R7SA 5COGA 3ZVRA 2YHSA 3EH2A 4DRIB 1ZW2A 3ITFA 1KTMA 4JCZA 1G4WR 1PD1A 4RBNA 2J0XA 4N06A 2A0BA 1VB5A 4I1OB 3NYJA 1YA9A 3DI5A 3U2LA 3C62A 2R25A 3HJCA 3QW1A 4LDQA 1FTSA 4G7OF 3SEOA 1YA7O 4U5HA 2NUPA 4MVSA 3FOOA 2OKUA 3JYHA 1JPNA 1F1MA 4O6NA 4YN0B 4LDRA 3S27A 4KI2A 1T6IA 4WABA 4YWQA 1BBHA 3EPVA 3GEEA 4EWCA 5KYYA 2YL7A 2WVOA 4NC3A 1B68A 4E7ZA 1YYJA 2NUPB 3VRCA 4QI2A 4OIQF 3MBGA 2OCCC 3UMIA 2NG1A 1V4AA 2QNLA 1TWGA 2B0HA 3ECSA 2J46A 3H65A 3JCUQ 4D4XA 4XPYA 4CS8C 1RKCA 4HE8D 2LD6A 2OG2A 1I5NA 4R32A 3AGUA 4PK4A 1GQAA 1MNEA 1LI7A 1ZZPA 4HFKB 3IQ5A 2XLWA 3DE8A 3EZHA 1ZW3A 3T6GB 1D0XA 3TJ5A 3O10A 1OXBA 4YT2A 3K1HA 2R7XA 4LDKA 3S28A 1OCOC 3T9OA 3UGOA 1Q0GA 1K05A 1LS1A 1WN0A 2IBFA 2R05A 1L7CA 1NFNA 1NSGB 1V54C 3ASNC 3JRTA 1T5OA 3NMJA 1R5ID 4JE9A 4MQ9F 3U3BA 4E18A 4AL0A 2XSEA 4JIOA 1YAUO 1FFHA 2DYSC 2KC3A 3K1IA 1PV3A 3N24A 3R2PA 3FHDA 4P9TA 2EIJC 2X0CA 3S9OA 3UR3C 5F28E 1EKYA 3GEHA 1U0BB 3EFOA 2AWCA 4FX5A 3X1OA 1EQ1A 2YKZA 1D1BA 4H4KC 1TFKB 1RKEB 2DGJA 4Z9IA 2E87A 3VYWA 2OU6A 2XLHA 3NRHA 1LVKA 4CS9C 2KGOA 3IQCA 1FFTC 4LLEA 5DS5A 5HV9A 4EBBA 1E86A 2EPKX 2XL4A 5COFA 3RKOF 1SZIA 2XLDA 3MYFA 4U5GA 4LLCA 4LACB 2XLOA 1ORSC 1E85A 2Q00A 3IQ6A 3WG7C 3AG1C 2V3CC 2PX3A 3M4CA 1T9KA 4EKWA 2A6HF 4W8PA 1LE2A 2EILC 3M79A 1ZHWA 1NBBA 3R7CA 2R7WA 1A7EA 1M6TA 3KH2A 1ZU5A 3OWTA 3NDBB 3AG4C 3EFOB 5JP7A 5BQHA 3EHMA 2ZXRA 1Y4CA 3TULA 4IAQA 3CSKA 3ZDLA 3V5XA 1VYKA 4JJFA 2CYDA 3ASOC 4KNVA 3ZQVA 4G0HA 4Q7CA 1HW1A 1WTYA 2G62A 2GDCA 4MW8A 3ZIBA 3RFYA 4MS2A 2P0NA 2W9YA 2VH3A 2ASRA 2DYRC 4PJNA 5FZTA 4P9FA 5JLIA 2LCHA 2PX0A 3QVYA 4ULWA 4YK5A 4DXWA 4ONSA 2OEVA 3TJ6A 4E0HA 1HW2A 2V26A 3LLIA 2O9XA 4MTFA 1TR2A 3DJUB 3KKBA 3GWLA 2NSGA 4N4WA 4XQ1A 3RVYA 4IJJA 3AG2C 3LAYA 2OOCA 3J06A 2J9UA 1OR3A 3UGPA 1EA8A 5DQTA 3L1MA 2KW3C 3SNHA 4QI0A 5E3AA 1U6HA 4AE4A 4CJGA 2G3VA 5BQIA 3W8HA 3NKEA 1SMYF 2P6VA 3JTLO 3WHNA 3KMIA 1LM3B 2F22A 1RKEA 2H8AA 5CIVA 3UMKA 3JRMO 1BDJB 1C17M 3WAQA 4EBKA 3C8GB 1CGOA 1C02A 3SXKA 4CDAA 4OIPF 4J32B 2R7UA 1LPEA 4KNWA 2WVQA 2WL8A 4YT8A 3TQOA 3N2ZB 2A6EF 1E84A 2ZPAA 4MVQA 3I5QA 1CGNA 2W45A 1YARO 3RVZA 4CIPA 1TKNA 4MTGA 2A0UA 1MQVA 5L0IA 1ZHYA 2AU5A 2Q9CA 1AVOB 3FXHA 3ZG1A 3NKDA 5L0CA 1J8MF 5T1DB 3U5SA 4JZAA 2JD3A 1XZPA 3OEOA 1YYXA 2EPMX 3EGXA 3Q7LA 3LESA 5AGFA 3F46A 1BZ4A 4K1OA 2A68F 1JRAA 3DD7A 3V5YA 3ABMC 4C7OB 2Y3HA 3KPHA 3EGXB 5A6BA 1Z63A 2YRFA 4MTOA 3U2MA 2C03A 4BEJA 3TD7A 1YZCA 1JR8A 3EHNA 3FMSA 3LS0A 4E0IA 3Q6MA 1OCRC 3DMDA 1HMOA 1OQCA 4JTCB 1VMAA 1ZHZA 4U5FE 1MMGA 2R7OA 5DVWA 1OCCC 2GAQA 2IXOA 4JCHA 2LFDA 4DRHB 1HE1A 4BPMA 1VLTA 2LP4A 2ZD9A 2QY9A 3AOUA 3W8IA 1APCA 4YJWA 2G3KA 3LUTB 4YT5A 2L6GA 4YL0A 5DS6A 3ZTMA 4CSAA 4U5EE 2P7VA 1OXKA 2YWAA 3ABKC 2HS5A 1A41A 2BE5F 2WB7A 3ZQYA 5IY5C 1I4YA 2X51A 2RD9A 4I44A 2IXNA 3SXZA 1OCZC 1XWJA 3SZRA 2WVNA 1OW7A 1QVXA 1WOLA 2L9JA 2OQMA 2Q9AA 3MLGA 5L3QA 3I4UA 4CIHA 3EH1A 4PJJA 1QQ3A 1KU2A 2W4MA 4IGGA 5COMA 4XLNF 5AC5A 5EHHA 5L3VA 3DZAA 3QTHA 4IARA 5B1AC 4N6CA 3H2VA 4FESA 3QW0A 1JOGA 2CGEA 5DLJA 1S05A 3NYMA 3HTKC 4IRUA 1NU9C 5JUAA 2ICWG 4XEKA 3UNGC 4C3EA 2YL3A 1DOVA 1ZU4A 4OIRF 4G7ZF 4H54A 1NG1A 3GORA 4MVZA 4D4NA 2L6FA 2YL0A 1O3UA 4LERA 1D1CA 2PF4E 2J9WA 2PFDA 4XPWA 1DOWA 1UG7A 3DWWA 4YL3A 5DS4A 2KJGA 3G4ZA 1BR4A 4KC9A 2VCAA 3HNLA 4MW3A 1RCPA 4DRJB 2KK1A 1D0ZA 1WWPA 3N0TA 4BJ5C 4CDVA 4E7SA 1YLMA 2HV7A 4RDAA 2VASA 3W2VA 1JPJA 2R7VA 2L81A 1TQGA 3U9MA 3V7OA 3AG3C 4P6IC
chains in the Genus database with same CATH topology
1QKRA 5L0GA 5L0FA 1YDIA 2L7AA 2IBFA 1L7CA 5FZTA 3H2VA 4E18A 2HSQA 5L0JA 4ONSA 3TJ6A 4DJ9A 3S90A 3H2UA 1TR2A 4EHPA 5L0IA 4P9TA 1DOVA 3MYIA 4W8PA 2X0CA 3RF3A 2B0HA 4E17A 1U89A 5L0CA 1ZW2A 1DOWA 1RKCA 1T01A 2GWWA 1RKEB 4K1OA 3ZDLA 5L0DA 1H6GA 1SYQA 1U6HA 1XWJA 1ZVZA 2LQGA 1ZW3A 2GDCA 5L0HA 3T6GB 3TJ5A 1RKEA 1ST6A 4PR9A 3VF0A 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKR A;  5L0G A;  5L0F A;  1YDI A;  2L7A A;  2IBF A;  1L7C A;  5FZT A;  3H2V A;  4E18 A;  2HSQ A;  5L0J A;  4ONS A;  3TJ6 A;  4DJ9 A;  3S90 A;  3H2U A;  1TR2 A;  4EHP A;  5L0I A;  4P9T A;  1DOV A;  3MYI A;  4W8P A;  2X0C A;  3RF3 A;  2B0H A;  4E17 A;  1U89 A;  5L0C A;  1ZW2 A;  1DOW A;  1RKC A;  1T01 A;  2GWW A;  1RKE B;  4K1O A;  3ZDL A;  5L0D A;  1H6G A;  1SYQ A;  1U6H A;  1XWJ A;  1ZVZ A;  2LQG A;  1ZW3 A;  2GDC A;  5L0H A;  3T6G B;  3TJ5 A;  1RKE A;  1ST6 A;  4PR9 A;  3VF0 A;  4IGG A; 
#chains in the Genus database with same CATH topology
 4OD4 A;  1OKK D;  1Z6A A;  4M63 A;  4BG0 A;  4U9E A;  3JZ0 A;  2TMV P;  4JTD B;  3GAN A;  2ZXO A;  3IEE A;  4U5C E;  2R03 A;  2P1A A;  3DAF A;  2P61 A;  2W4B A;  3HNJ A;  4JEB A;  5KYU B;  4Q5S F;  4K0D A;  4Z9J A;  3IHU A;  2R7T A;  4PFP A;  5E33 A;  2QE9 A;  2XLM A;  3RF3 A;  4JTA B;  4E17 A;  1E2X A;  2YLG A;  3PCV A;  5KYX B;  1ZYR F;  3PDM P;  2Q9B A;  4NCQ A;  3X2Q C;  4C3B A;  5CI8 A;  2IXM A;  5HSW A;  3AGT A;  4PJM A;  4EIY A;  4PAC A;  1KNY A;  2VCC A;  3G50 A;  3JYY A;  2HJ3 A;  1Z23 A;  4JKV A;  1H9G A;  3K1I C;  1TWC A;  2LIG A;  4AX2 A;  4RD9 A;  1ZHX A;  2XLV A;  5B3I A;  5KYX A;  1TWA A;  1CPQ A;  2VCB A;  3HLZ A;  3LS1 A;  3W4Y A;  3SP1 A;  3ZC4 A;  2DB4 A;  3DJN B;  4EUK B;  1PCX A;  4I3M A;  4IB4 A;  3IQT A;  2FFH A;  2ZXP A;  3CAX A;  4XLP F;  3K7D A;  5D91 A;  4DJ9 A;  2J8W A;  2PNO A;  5F5H A;  3BRJ A;  3GEI A;  5T3T A;  1Z7Q c;  3VM6 A;  4DVY P;  1A7V A;  4QDL A;  2A69 F;  2I8B A;  1T01 A;  2H7V C;  4ZLD A;  2XL8 A;  4HEA J;  5TJ5 E;  3FVY A;  1VK5 A;  4J30 B;  2QLA A;  3EJN A;  3S29 A;  1SYQ A;  3G4X A;  4O7G A;  3FDQ A;  1K40 A;  5A6K A;  2Z15 A;  3ZSU A;  1QZX A;  2D4U A;  3VAY A;  3L0I A;  1TWH A;  3AQB A;  2CDQ A;  1OR2 A;  2JPU A;  3KL4 A;  1H9T A;  1BR2 A;  2MYS A;  2Q7R A;  1XZQ A;  3S84 A;  2IXP A;  2Y3D A;  3K33 A;  1IZM A;  4GYT A;  2YLI A;  2B0J A;  3GWN A;  3A11 A;  4MVR A;  2BL2 A;  3OA1 A;  3V5Z A;  3W2W A;  5E3C A;  1D1A A;  3RH3 A;  5AC4 A;  4GQH A;  4EHP A;  3LEO A;  3LJB A;  4Q4Z F;  3MYI A;  3FAJ A;  4C7O A;  1N1C A;  3EQL F;  3RQF A;  4MVU A;  2D5R B;  2XL6 A;  1O5H A;  1FMV A;  1UFB A;  2WZG A;  5A6J A;  3HNI A;  3QVZ A;  3DKA A;  3SXM A;  3T6B A;  2HMZ A;  3GM3 A;  4KBL A;  3B9Q A;  2CNW A;  4BEM J;  1ZVZ A;  3LEV A;  3MX3 A;  1GGQ A;  4IAO A;  2KNH A;  2XLE A;  4JRZ A;  4OD5 A;  5BUO A;  1M56 C;  3VF0 A;  4U5B E;  1LE4 A;  2NPU A;  1ST6 A;  3M4B A;  4PR9 A;  3BEH A;  3CQZ A;  4ZLC A;  2IYL D;  2EIM C;  4JUR I;  1YZA A;  5KYN A;  2CW0 F;  5E2Q A;  5JVE A;  3PMR A;  1JAF A;  1V74 B;  2QTV A;  2XRH A;  5GPG B;  2I15 A;  3PHF 2;  2XXA B;  5BQG A;  2HSQ A;  4I1M A;  4ULV A;  1NU7 D;  3DAG A;  1Q0M A;  1AUE A;  1W2W A;  1Z5Z A;  2LK4 A;  3H2U A;  4U5D E;  4BJ5 A;  2J0W A;  2YVK A;  3S90 A;  1YVI A;  2XM0 A;  1ORY A;  3K6B A;  3RQG A;  1LKX A;  4N6H A;  3EG9 A;  1HMD A;  3B29 A;  4Z9H A;  4YT4 A;  1LIH A;  4OIN F;  1OW8 A;  3TK0 A;  3L8I A;  4FAP B;  5T3W A;  3QZC A;  4J7T A;  4JJG A;  3RIP A;  1Y6D A;  2UUH A;  1SR2 A;  2WZL A;  5DQZ A;  3WOD F;  1RMV A;  1D0Y A;  1HE9 A;  1Q0K A;  2AWY A;  4DOZ A;  1QSP A;  1SF8 A;  1G5Z A;  4BJ6 A;  5L0F A;  3KYJ A;  3O39 A;  1WAT A;  4K7B A;  3C7J A;  1C03 A;  1QLE C;  2HFI A;  4L6R A;  4O6Y A;  3F47 A;  2XXA A;  3DM5 A;  4CS7 A;  4DBQ A;  3MFN A;  1M2V A;  2FAP B;  4GEH A;  3O55 A;  1I4Z A;  3ZTZ A;  2A1D D;  2R9R B;  4MVO A;  256B A;  1FAP B;  5B1B C;  3T4R A;  5K0I A;  1RXQ A;  5KYY B;  3U9J A;  1A0B A;  5A6B D;  1FR0 A;  3EG9 B;  2J45 A;  1H7I A;  1BR1 A;  2HV6 A;  4CSA C;  1AEP A;  4MND A;  5D92 A;  3U0C A;  2PP4 A;  2VC9 A;  1MMD A;  1Q0D A;  1HY5 A;  4DBR A;  1H6G A;  1Q0F A;  1MMA A;  1YJG A;  3C63 A;  4NQF A;  4XTK A;  1S7Z A;  4YL1 A;  5A6A A;  5L0D A;  2PBE A;  2YLD A;  2HUJ A;  3NMI A;  3B0P A;  4B6I A;  3EGD A;  2M4E A;  1OKK A;  4NY3 A;  4A2N B;  1FMW A;  1QKR A;  2HSB A;  4JEA A;  4CDY A;  4DVZ A;  1CGM E;  1VTM P;  3HKK A;  1VOM A;  2KQ9 A;  3AQC A;  5JRA A;  2CCY A;  1G4U S;  2EIK C;  2JX0 A;  4PFO A;  4XEF A;  2XS1 A;  4CX9 A;  1M2O A;  3EZI A;  3IPM O;  2MHR A;  2HKV A;  1G8X A;  4W8K A;  2HZ8 A;  2GA0 A;  4AL1 A;  4BJ6 C;  1PD0 A;  1LI5 A;  2WZF A;  1R4T A;  4ER9 A;  1IW7 F;  2J9B A;  1CPR A;  3DXJ F;  5JSL A;  1GM5 A;  2YQY A;  1OW6 A;  1Z3I X;  4J7Y A;  2NUT A;  5F5F A;  2EPO A;  3L34 A;  1RJ9 B;  4NTB A;  1NLX A;  5L0H A;  4A4A A;  3ATP A;  3SYN A;  4JC7 A;  3K66 A;  3RYL A;  2ZXW C;  2NSF A;  3CZ6 A;  5L0G A;  5B3S C;  4CS9 A;  2LFF A;  2OEX A;  3JT1 A;  3GM2 A;  2NUT B;  4U9D A;  3U8V A;  2XS8 A;  4XPX A;  4EBJ A;  4BJ1 A;  5L0J A;  2BC5 A;  3U8P A;  2Y3G A;  1T6U A;  3HNK A;  3E70 C;  2Y69 C;  3Q7G A;  4BJT A;  2GFH A;  2IM8 A;  3UMH A;  2KSF A;  2M64 A;  3CEX A;  2EPN A;  2J7P A;  4X0R A;  4WGY A;  5KYW A;  1K04 A;  2R7R A;  3FOP A;  1NFO A;  3E9V A;  2OJE D;  4JW1 A;  3DE9 A;  3I5P A;  2EIN C;  1MND A;  2J9V A;  3NYL A;  5EK0 A;  3TOL A;  5EGY A;  2QUP A;  3QMK A;  2VB6 A;  4XEV A;  1QPU A;  2R7Q A;  4WJ0 A;  5KYW B;  1O87 A;  1WGW A;  2AVK A;  3DM9 B;  4NTF A;  4UDV A;  4CBE A;  5JS5 A;  2H7O A;  2Y3B A;  1A7D A;  4NTA A;  1GS9 A;  4G78 A;  2DI3 A;  2MWQ A;  2RSE B;  2L6H A;  3L8J A;  3TOM A;  3US6 A;  2EPL X;  1YDI A;  1M2V B;  2HMQ A;  2L7A A;  3B71 A;  3FAP B;  3KYI A;  1M57 C;  2YEV A;  3O6X A;  1ZHT A;  1VLS A;  1WAS A;  3M1C B;  3U3F A;  1LS4 A;  4MVM A;  2HJM A;  4HFF B;  5KYU A;  2AP3 A;  3ZWI A;  4XWJ A;  5A69 A;  2YZS A;  3LLK A;  1U89 A;  2UUI A;  2XM4 A;  4IWB A;  1E83 A;  4C3D A;  4AK9 A;  2R02 A;  1EI7 A;  4OIO F;  2ETS A;  4FWV A;  2GWW A;  2LSE A;  4ANJ A;  3SXY A;  1V55 C;  2J7P D;  2CNW D;  3C18 A;  1MMN A;  4F4B A;  4O79 A;  1FNT c;  4JVS A;  2Y39 A;  1ORJ A;  2KYH A;  2LQG A;  2Q3T A;  3POV A;  5JT4 A;  3ABL C;  1NZE A;  3B0U X;  2IOQ A;  4CJO A;  2FGY A;  3AJM A;  3B0V C;  4G7H F;  3Q6N A;  4CS8 A;  3RW0 A;  3C8G D;  1RJ9 A;  3C8Z A;  5CI9 A;  3LNM B;  3M15 A;  3GM1 A;  2H7B A;  3NG1 A;  3NMK A;  5FCL A;  3A9C A;  2C04 A;  3T6J A;  3LNR A;  2YL1 A;  1JMW A;  1T6Q A;  3JSE O;  4PJL A;  4AE4 B;  3S0X A;  3C8G A;  1L3P A;  1J8Y F;  1VYI A;  3GOD A;  1TFO B;  2OJQ A;  3JSZ A;  4O6M A;  4WGZ A;  3RQE A;  3EGD B;  2Q4F A;  2R7S A;  5COG A;  3ZVR A;  2YHS A;  3EH2 A;  4DRI B;  1ZW2 A;  3ITF A;  1KTM A;  4JCZ A;  1G4W R;  1PD1 A;  4RBN A;  2J0X A;  4N06 A;  2A0B A;  1VB5 A;  4I1O B;  3NYJ A;  1YA9 A;  3DI5 A;  3U2L A;  3C62 A;  2R25 A;  3HJC A;  3QW1 A;  4LDQ A;  1FTS A;  4G7O F;  3SEO A;  1YA7 O;  4U5H A;  2NUP A;  4MVS A;  3FOO A;  2OKU A;  3JYH A;  1JPN A;  1F1M A;  4O6N A;  4YN0 B;  4LDR A;  3S27 A;  4KI2 A;  1T6I A;  4WAB A;  4YWQ A;  1BBH A;  3EPV A;  3GEE A;  4EWC A;  5KYY A;  2YL7 A;  2WVO A;  4NC3 A;  1B68 A;  4E7Z A;  1YYJ A;  2NUP B;  3VRC A;  4QI2 A;  4OIQ F;  3MBG A;  2OCC C;  3UMI A;  2NG1 A;  1V4A A;  2QNL A;  1TWG A;  2B0H A;  3ECS A;  2J46 A;  3H65 A;  3JCU Q;  4D4X A;  4XPY A;  4CS8 C;  1RKC A;  4HE8 D;  2LD6 A;  2OG2 A;  1I5N A;  4R32 A;  3AGU A;  4PK4 A;  1GQA A;  1MNE A;  1LI7 A;  1ZZP A;  4HFK B;  3IQ5 A;  2XLW A;  3DE8 A;  3EZH A;  1ZW3 A;  3T6G B;  1D0X A;  3TJ5 A;  3O10 A;  1OXB A;  4YT2 A;  3K1H A;  2R7X A;  4LDK A;  3S28 A;  1OCO C;  3T9O A;  3UGO A;  1Q0G A;  1K05 A;  1LS1 A;  1WN0 A;  2IBF A;  2R05 A;  1L7C A;  1NFN A;  1NSG B;  1V54 C;  3ASN C;  3JRT A;  1T5O A;  3NMJ A;  1R5I D;  4JE9 A;  4MQ9 F;  3U3B A;  4E18 A;  4AL0 A;  2XSE A;  4JIO A;  1YAU O;  1FFH A;  2DYS C;  2KC3 A;  3K1I A;  1PV3 A;  3N24 A;  3R2P A;  3FHD A;  4P9T A;  2EIJ C;  2X0C A;  3S9O A;  3UR3 C;  5F28 E;  1EKY A;  3GEH A;  1U0B B;  3EFO A;  2AWC A;  4FX5 A;  3X1O A;  1EQ1 A;  2YKZ A;  1D1B A;  4H4K C;  1TFK B;  1RKE B;  2DGJ A;  4Z9I A;  2E87 A;  3VYW A;  2OU6 A;  2XLH A;  3NRH A;  1LVK A;  4CS9 C;  2KGO A;  3IQC A;  1FFT C;  4LLE A;  5DS5 A;  5HV9 A;  4EBB A;  1E86 A;  2EPK X;  2XL4 A;  5COF A;  3RKO F;  1SZI A;  2XLD A;  3MYF A;  4U5G A;  4LLC A;  4LAC B;  2XLO A;  1ORS C;  1E85 A;  2Q00 A;  3IQ6 A;  3WG7 C;  3AG1 C;  2V3C C;  2PX3 A;  3M4C A;  1T9K A;  4EKW A;  2A6H F;  4W8P A;  1LE2 A;  2EIL C;  3M79 A;  1ZHW A;  1NBB A;  3R7C A;  2R7W A;  1A7E A;  1M6T A;  3KH2 A;  1ZU5 A;  3OWT A;  3NDB B;  3AG4 C;  3EFO B;  5JP7 A;  5BQH A;  3EHM A;  2ZXR A;  1Y4C A;  3TUL A;  4IAQ A;  3CSK A;  3ZDL A;  3V5X A;  1VYK A;  4JJF A;  2CYD A;  3ASO C;  4KNV A;  3ZQV A;  4G0H A;  4Q7C A;  1HW1 A;  1WTY A;  2G62 A;  2GDC A;  4MW8 A;  3ZIB A;  3RFY A;  4MS2 A;  2P0N A;  2W9Y A;  2VH3 A;  2ASR A;  2DYR C;  4PJN A;  5FZT A;  4P9F A;  5JLI A;  2LCH A;  2PX0 A;  3QVY A;  4ULW A;  4YK5 A;  4DXW A;  4ONS A;  2OEV A;  3TJ6 A;  4E0H A;  1HW2 A;  2V26 A;  3LLI A;  2O9X A;  4MTF A;  1TR2 A;  3DJU B;  3KKB A;  3GWL A;  2NSG A;  4N4W A;  4XQ1 A;  3RVY A;  4IJJ A;  3AG2 C;  3LAY A;  2OOC A;  3J06 A;  2J9U A;  1OR3 A;  3UGP A;  1EA8 A;  5DQT A;  3L1M A;  2KW3 C;  3SNH A;  4QI0 A;  5E3A A;  1U6H A;  4AE4 A;  4CJG A;  2G3V A;  5BQI A;  3W8H A;  3NKE A;  1SMY F;  2P6V A;  3JTL O;  3WHN A;  3KMI A;  1LM3 B;  2F22 A;  1RKE A;  2H8A A;  5CIV A;  3UMK A;  3JRM O;  1BDJ B;  1C17 M;  3WAQ A;  4EBK A;  3C8G B;  1CGO A;  1C02 A;  3SXK A;  4CDA A;  4OIP F;  4J32 B;  2R7U A;  1LPE A;  4KNW A;  2WVQ A;  2WL8 A;  4YT8 A;  3TQO A;  3N2Z B;  2A6E F;  1E84 A;  2ZPA A;  4MVQ A;  3I5Q A;  1CGN A;  2W45 A;  1YAR O;  3RVZ A;  4CIP A;  1TKN A;  4MTG A;  2A0U A;  1MQV A;  5L0I A;  1ZHY A;  2AU5 A;  2Q9C A;  1AVO B;  3FXH A;  3ZG1 A;  3NKD A;  5L0C A;  1J8M F;  5T1D B;  3U5S A;  4JZA A;  2JD3 A;  1XZP A;  3OEO A;  1YYX A;  2EPM X;  3EGX A;  3Q7L A;  3LES A;  5AGF A;  3F46 A;  1BZ4 A;  4K1O A;  2A68 F;  1JRA A;  3DD7 A;  3V5Y A;  3ABM C;  4C7O B;  2Y3H A;  3KPH A;  3EGX B;  5A6B A;  1Z63 A;  2YRF A;  4MTO A;  3U2M A;  2C03 A;  4BEJ A;  3TD7 A;  1YZC A;  1JR8 A;  3EHN A;  3FMS A;  3LS0 A;  4E0I A;  3Q6M A;  1OCR C;  3DMD A;  1HMO A;  1OQC A;  4JTC B;  1VMA A;  1ZHZ A;  4U5F E;  1MMG A;  2R7O A;  5DVW A;  1OCC C;  2GAQ A;  2IXO A;  4JCH A;  2LFD A;  4DRH B;  1HE1 A;  4BPM A;  1VLT A;  2LP4 A;  2ZD9 A;  2QY9 A;  3AOU A;  3W8I A;  1APC A;  4YJW A;  2G3K A;  3LUT B;  4YT5 A;  2L6G A;  4YL0 A;  5DS6 A;  3ZTM A;  4CSA A;  4U5E E;  2P7V A;  1OXK A;  2YWA A;  3ABK C;  2HS5 A;  1A41 A;  2BE5 F;  2WB7 A;  3ZQY A;  5IY5 C;  1I4Y A;  2X51 A;  2RD9 A;  4I44 A;  2IXN A;  3SXZ A;  1OCZ C;  1XWJ A;  3SZR A;  2WVN A;  1OW7 A;  1QVX A;  1WOL A;  2L9J A;  2OQM A;  2Q9A A;  3MLG A;  5L3Q A;  3I4U A;  4CIH A;  3EH1 A;  4PJJ A;  1QQ3 A;  1KU2 A;  2W4M A;  4IGG A;  5COM A;  4XLN F;  5AC5 A;  5EHH A;  5L3V A;  3DZA A;  3QTH A;  4IAR A;  5B1A C;  4N6C A;  3H2V A;  4FES A;  3QW0 A;  1JOG A;  2CGE A;  5DLJ A;  1S05 A;  3NYM A;  3HTK C;  4IRU A;  1NU9 C;  5JUA A;  2ICW G;  4XEK A;  3UNG C;  4C3E A;  2YL3 A;  1DOV A;  1ZU4 A;  4OIR F;  4G7Z F;  4H54 A;  1NG1 A;  3GOR A;  4MVZ A;  4D4N A;  2L6F A;  2YL0 A;  1O3U A;  4LER A;  1D1C A;  2PF4 E;  2J9W A;  2PFD A;  4XPW A;  1DOW A;  1UG7 A;  3DWW A;  4YL3 A;  5DS4 A;  2KJG A;  3G4Z A;  1BR4 A;  4KC9 A;  2VCA A;  3HNL A;  4MW3 A;  1RCP A;  4DRJ B;  2KK1 A;  1D0Z A;  1WWP A;  3N0T A;  4BJ5 C;  4CDV A;  4E7S A;  1YLM A;  2HV7 A;  4RDA A;  2VAS A;  3W2V A;  1JPJ A;  2R7V A;  2L81 A;  1TQG A;  3U9M A;  3V7O A;  3AG3 C;  4P6I C; 
#chains in the Genus database with same CATH homology
 1QKR A;  5L0G A;  5L0F A;  1YDI A;  2L7A A;  2IBF A;  1L7C A;  5FZT A;  3H2V A;  4E18 A;  2HSQ A;  5L0J A;  4ONS A;  3TJ6 A;  4DJ9 A;  3S90 A;  3H2U A;  1TR2 A;  4EHP A;  5L0I A;  4P9T A;  1DOV A;  3MYI A;  4W8P A;  2X0C A;  3RF3 A;  2B0H A;  4E17 A;  1U89 A;  5L0C A;  1ZW2 A;  1DOW A;  1RKC A;  1T01 A;  2GWW A;  1RKE B;  4K1O A;  3ZDL A;  5L0D A;  1H6G A;  1SYQ A;  1U6H A;  1XWJ A;  1ZVZ A;  2LQG A;  1ZW3 A;  2GDC A;  5L0H A;  3T6G B;  3TJ5 A;  1RKE A;  1ST6 A;  4PR9 A;  3VF0 A;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...