2GDCA

Structure of vinculin vd1 / ipaa560-633 complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
249
structure length
238
Chain Sequence
PVFHTRTIESILEPVAQQISHGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Vinculin
publication title Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
pubmed doi rcsb
source organism Gallus gallus
total genus 99
structure length 238
sequence length 249
ec nomenclature
pdb deposition date 2006-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA01
4IGGA 4PR9A 2GWWA 2GDCA 1RKEA 3H2VA 1T01A 2IBFA 4P9TA 2X0CA 3RF3A 4E17A 1YDIA 4DJ9A 2HSQA 3VF0A 4ONSA 3H2UA 4W8PA 1DOVA 4E18A 1RKCA 1ZW2A 5FZTA 5L0GA 1H6GA 2L7AA 4K1OA 3TJ5A 2B0HA 1ZW3A 1U89A 3MYIA 5L0HA 1U6HA 1L7CA 5L0CA 4EHPA 1QKRA 3TJ6A 5L0IA 2LQGA 3ZDLA 3S90A 3T6GB 5L0DA 1ST6A 1XWJA 1DOWA 5L0JA 5L0FA 1SYQA 1TR2A 1RKEB 1ZVZA
chains in the Genus database with same CATH superfamily
2R7WA 3ZSUA 2IXPA 2PFDA 2X0CA 4YL3A 5L0FA 3DXJF 2A69F 4D4NA 4NCQA 3DE8A 4YL0A 2YHSA 4MTGA 4XLPF 3EFOA 3DE9A 4O79A 4C3DA 1BR4A 3FXHA 2WZLA 3NYMA 4IWBA 2DGJA 5AC4A 4CIHA 1Z5ZA 2CW0F 2G3VA 2DB4A 3Q6NA 1R5ID 2EPLX 2L81A 4LDQA 5A6KA 1S05A 3IHUA 5DQTA 4C7OB 3PHF2 4LLEA 1L7CA 4ANJA 1A7EA 2Y3GA 2ZXPA 1MNDA 1NU7D 1HE1A 2IM8A 3L1MA 3L34A 3OWTA 4U5EE 5EHHA 4AL0A 1WOLA 3RFYA 5L0DA 3TULA 3GEIA 3VRCA 3NDBB 4ULVA 1ST6A 1VK5A 3HKKA 3M4CA 1Z7Qc 1Q0FA 4JIOA 3RKOF 1NFOA 3S29A 2AU5A 2KK1A 3GM3A 2P0NA 3K7DA 4KBLA 2HKVA 2P1AA 4JZAA 3QMKA 5GPGB 4OIPF 1ORSC 1A7VA 3FVYA 4CS7A 4PJJA 4Q5SF 3GANA 1MMAA 3AG2C 3L0IA 1E84A 4OIRF 5T1DB 3K1IC 5DQZA 4F4BA 1I5NA 2HMQA 4B6IA 3N0TA 2P7VA 3ITFA 4JE9A 4R32A 4QDLA 2R7VA 2YWAA 4WGYA 3N24A 4LLCA 3TJ5A 4O6MA 4XWJA 4LDRA 1SR2A 3JRTA 4C3EA 2QNLA 4RBNA 1HY5A 1QKRA 4NTFA 3IQ5A 3QW1A 3GEHA 4PJNA 5D92A 3FDQA 3G50A 1ZZPA 3CAXA 2R7OA 5COMA 1NLXA 2KNHA 1KTMA 1M2VB 4YT2A 4Q7CA 4XPYA 2R7SA 1G4US 1ZHTA 3ASOC 4U5DE 5L0JA 3EZHA 3V7OA 4DBRA 2Q3TA 2YLDA 4A2NB 1Q0MA 1EI7A 3DAGA 2YKZA 4K0DA 2DYSC 1NZEA 3A11A 4AE4A 3PDMP 1SZIA 1K04A 5A6AA 2JD3A 2Z15A 1FFHA 3KMIA 3NKDA 3MYFA 1H9TA 2R25A 2O9XA 3LLKA 3KL4A 5KYXB 3S84A 2GAQA 3UGPA 4W8KA 3JTLO 2XLMA 3UNGC 2W4MA 2CNWD 1T6QA 2J46A 2PBEA 2XM4A 3WG7C 2HJ3A 3GODA 4MVZA 2V3CC 1ZU4A 1FAPB 5L0IA 2XXAA 2KQ9A 3EG9A 4PJLA 4WABA 3ZIBA 2AP3A 4MQ9F 1XZQA 1APCA 4XPWA 3CEXA 3V5YA 1Z63A 2EPOA 4MW8A 3JRMO 3OEOA 4IAQA 1RKEB 3B0VC 3RQFA 1ZHWA 1J8YF 1D1CA 1Y6DA 2KC3A 3SXKA 4P9TA 3W2VA 1BZ4A 2YL0A 5BQGA 4NTAA 4E17A 3NYJA 4KI2A 2Y69C 2CGEA 1H7IA 3SEOA 4A4AA 4HE8D 1GGQA 3ECSA 3CZ6A 1C02A 2KJGA 2PX3A 4U9EA 2EIMC 1OW6A 3JZ0A 3T6JA 4G7OF 3AG3C 3Q7LA 4BJ5C 2XL8A 2LFFA 1RCPA 3S27A 2J0WA 3DJNB 3ZWIA 2PNOA 2DI3A 2QUPA 3IPMO 4ZLCA 2NSGA 4QI2A 1HMDA 2J0XA 3EH1A 5B1BC 4CIPA 3QZCA 1T6IA 3IQCA 3UGOA 3NKEA 1JPJA 3J06A 3Q7GA 1D0ZA 4IAOA 1PD0A 1E86A 1JOGA 2L6HA 4U5HA 3LNMB 3RVZA 2XS8A 3U9JA 3AGUA 4U5GA 5A69A 3H2VA 4KNWA 1R4TA 4N06A 1E2XA 4U9DA 1EKYA 3U2MA 4BG0A 3VF0A 2A68F 2CYDA 3DM5A 3O6XA 3TQOA 3QVZA 2EPNA 2R7TA 1YJGA 5COFA 4H4KC 3ZQVA 2HV7A 4YWQA 3ATPA 2LD6A 2XS1A 4HEAJ 4AL1A 5E3CA 4JCZA 4OINF 5B3IA 2XXAB 1F1MA 3B9QA 1I4ZA 1LVKA 2ETSA 3I4UA 1Y4CA 4X0RA 3SNHA 3KYJA 1GS9A 2WVQA 4EBJA 5KYWB 3K66A 5HV9A 3KH2A 3LUTB 1M2VA 1VB5A 1QQ3A 4ULWA 2OKUA 1IZMA 3M4BA 4CSAA 1T6UA 2A6HF 2CCYA 3V5XA 5CIVA 2YQYA 2D5RB 2GWWA 4JEBA 2UUHA 1OW7A 2Y3HA 3RF3A 5JS5A 3SZRA 3C8GB 4DJ9A 1E83A 3AG1C 3SYNA 3LJBA 4W8PA 5KYXA 3ABKC 2AVKA 2M64A 5CI9A 1FMWA 1YZCA 4DRJB 1TWCA 2IYLD 2XLWA 2EINC 5JSLA 1U89A 3X2QC 1YYXA 2HUJA 2NUTB 4MS2A 4N6CA 3ABLC 2HJMA 2QTVA 4EBBA 1IW7F 3EGDB 4MNDA 2HMZA 4CJOA 1BR1A 2WVNA 1K05A 1KNYA 5B3SC 4AX2A 2WL8A 4U5FE 1YA7O 4MTFA 4XQ1A 3SXYA 3LS1A 4I1OB 1YLMA 3RIPA 3HNKA 4MVOA 1ZVZA 1TQGA 3B0PA 3W2WA 2LK4A 1RKEA 4YK5A 3MBGA 4G7HF 1YDIA 4ER9A 1TWHA 2Q9BA 4JJFA 2Y3DA 1QLEC 2F22A 3KYIA 3LESA 3T4RA 4JTDB 1G5ZA 3C62A 2Q9AA 4YL1A 5KYYB 5HSWA 1RJ9A 3AQBA 1D1BA 2YRFA 4WGZA 4K1OA 3H65A 3GWNA 4YN0B 3CQZA 1A41A 4FESA 4EWCA 5E33A 2AWCA 3Q6MA 4U5CE 3C63A 2J9UA 4GEHA 5COGA 3LS0A 4D4XA 3C18A 3S90A 2OOCA 2VH3A 4G0HA 4O6YA 5F5HA 1PV3A 3CSKA 4J7YA 4G7ZF 2YL3A 2BL2A 4CS9A 1OQCA 1WWPA 1AEPA 1OCZC 1ORJA 1AVOB 3EHNA 1C03A 2YZSA 1T01A 1OXBA 5F28E 4EBKA 1JR8A 3K33A 2LCHA 3EPVA 3WAQA 2OCCC 5FCLA 5DVWA 5KYUB 2LFDA 2HSQA 5KYWA 4PACA 1J8MF 1UFBA 4XEVA 1W2WA 3KKBA 3X1OA 1OCOC 1ZW2A 3EHMA 3EZIA 3M15A 3MX3A 4IARA 3T6BA 5DS6A 3WODF 1LM3B 5AC5A 4E0HA 2R02A 2R03A 3L8IA 3RQGA 3TJ6A 3SXMA 4JKVA 4JVSA 4YT5A 3I5QA 2DYRC 2LQGA 3C8ZA 1EQ1A 1OKKD 1JRAA 5L3VA 4J32B 5K0IA 2ICWG 2A1DD 1I4YA 2G62A 2ZXRA 4E0IA 2HSBA 2HS5A 2EPKX 2J9VA 2X51A 2PP4A 3FAJA 1VLTA 2Q9CA 4MW3A 4MVUA 5CI8A 4OIOF 3QTHA 1AUEA 5A6BA 2XLHA 4P9FA 5L3QA 3GWLA 1S7ZA 4HFFB 4MTOA 3B29A 1WTYA 4I1MA 3PCVA 3A9CA 5E2QA 4ONSA 5F5FA 2CDQA 4BJ1A 1DOVA 3K1IA 1RJ9B 1RKCA 5TJ5E 1ZYRF 3C8GA 4BJ6C 4CDVA 1H6GA 1V55C 3DAFA 2WB7A 2KGOA 2YL1A 3LAYA 5JP7A 3DWWA 3BEHA 4FWVA 2R7XA 3NYLA 3TD7A 3K1HA 3UMKA 2NUTA 3EGXB 5JLIA 1YARO 4CX9A 3ASNC 3B71A 3EGDA 2QE9A 3T6GB 2VASA 3U9MA 3ZTMA 4KC9A 1BBHA 1ZHZA 1Q0KA 1QVXA 2LSEA 2MHRA 2NG1A 3EQLF 3LEVA 1TKNA 2P6VA 2UUIA 4P6IC 1SYQA 4CS8C 4DRIB 3TOLA 3M79A 1D1AA 1M56C 2GFHA 3EH2A 4O7GA 4MVSA 1JAFA 2BE5F 4NY3A 4E7SA 1Q0GA 2ZXWC 4WJ0A 3S9OA 1V74B 3FOPA 1MMGA 3DJUB 3RVYA 2OQMA 2KW3C 3W8HA 5JRAA 4JCHA 4Z9IA 1OW8A 3JCUQ 1O87A 1A7DA 1OR2A 2NSFA 4GYTA 1G8XA 3UMHA 4BJTA 1N1CA 2H8AA 1ZW3A 2PF4E 3DZAA 3DMDA 4NQFA 5KYYA 1YZAA 2VB6A 1Q0DA 1Z6AA 1V4AA 2HZ8A 1NSGB 4I44A 1H9GA 5L0GA 2ASRA 4IB4A 4CDYA 3O55A 2R7QA 1ZHXA 2W9YA 2Q7RA 4FX5A 2XLDA 3OA1A 5E3AA 3SXZA 4JJGA 1A0BA 4MVMA 5KYNA 4LERA 1ORYA 3GM1A 4ZLDA 1SF8A 1QZXA 2A0BA 2Y39A 3QVYA 3HNJA 1E85A 4MVRA 4OIQF 1BDJB 1PCXA 4EUKB 5T3TA 2OG2A 2QY9A 5KYUA 2J45A 1YAUO 3L8JA 5FZTA 1T9KA 4G78A 5D91A 2L9JA 1VYIA 2HV6A 4EHPA 5JUAA 2LIGA 2J8WA 3VAYA 1V54C 4BJ5A 3B0UX 1YYJA 2XM0A 1VYKA 2V26A 2C04A 4FAPB 3AGTA 2TMVP 2OEVA 1LE4A 1TFOB 2G3KA 3E70C 1MMNA 1DOWA 4RDAA 1YA9A 3ZG1A 3O39A 2JPUA 4PFOA 3IQTA 3HTKC 2GA0A 2XL6A 2P61A 1RMVA 2IOQA 3JT1A 3G4ZA 1XZPA 4JRZA 2IBFA 2HFIA 2PX0A 2CNWA 3AQCA 4RD9A 4U5BE 1QSPA 2ZD9A 2L6GA 3MFNA 5IY5C 4N4WA 2J7PD 1LKXA 3IEEA 2JX0A 4PK4A 1PD1A 2IXOA 1WASA 3S28A 1OKKA 3FOOA 5L0HA 2Q4FA 4IRUA 4QI0A 4Z9HA 3W8IA 4E7ZA 3HNLA 3RQEA 3ZTZA 4OD5A 4UDVA 3U3FA 4H54A 3R2PA 4M63A 1LIHA 3F46A 3WHNA 1WN0A 4PFPA 1KU2A 1SMYF 3EGXA 1XWJA 4HFKB 3RH3A 2YEVA 1L3PA 2XLEA 4YJWA 3DM9B 4XTKA 1TR2A 3S0XA 3U2LA 2WZGA 4AK9A 1CPQA 2KYHA 4IGGA 5T3WA 3U0CA 3LLIA 3VYWA 2J9BA 1GM5A 4JEAA 2RSEB 3T9OA 3UR3C 1ZU5A 5DLJA 4DVYP 1CGME 1O3UA 1FMVA 2YL7A 3U5SA 1LPEA 1D0XA 1LS4A 1MNEA 3ABMC 3LNRA 5BUOA 2BC5A 3ZC4A 3U8PA 3RYLA 3AJMA 4JTAB 5BQIA 2NUPB 4N6HA 2E87A 2W4BA 2H7BA 1FR0A 4JURI 4DBQA 3POVA 2J9WA 2C03A 5DS4A 1FNTc 2ZXOA 3FAPB 1JPNA 3NRHA 2AWYA 5JVEA 1GQAA 2EILC 3G4XA 3LEOA 3HNIA 1TWAA 1YVIA 3UMIA 2H7VC 1RXQA 3C7JA 4JTCB 2XL4A 4PR9A 2D4UA 3EFOB 4PJMA 2RD9A 4J7TA 4NC3A 1UG7A 2MYSA 1EA8A 1LE2A 4DVZA 2VCBA 1HW1A 4BEMJ 3PMRA 4EKWA 2OJQA 3O10A 3BRJA 4EIYA 2R05A 4JW1A 1QPUA 3KPHA 1NBBA 2OJED 1WATA 2IXMA 2FGYA 4XPXA 3ZVRA 5DS5A 2B0HA 5EGYA 5BQHA 2KSFA 1MQVA 2XLVA 3M1CB 1OXKA 3VM6A 1HMOA 3TOMA 1TWGA 4CDAA 1VTMP 3TK0A 1K40A 4NTBA 2XRHA 2R7RA 2R7UA 2VCAA 1C17M 2OEXA 4BPMA 1LS1A 2YLGA 2FFHA 4CSAC 4DOZA 3N2ZB 1U0BB 1MMDA 4O6NA 1FTSA 5B1AC 1FFTC 2GDCA 4LDKA 1NG1A 4XEFA 1CGOA 2OU6A 2I8BA 3RW0A 2XLOA 3H2UA 3EJNA 4E18A 3DD7A 2WZFA 5AGFA 4MVQA 5A6BD 2NPUA 2EPMX 2A0UA 2ZPAA 3I5PA 1Z23A 3W4YA 3MYIA 3ZQYA 5EK0A 5L0CA 4C7OA 2WVOA 3JSEO 3F47A 4CBEA 5A6JA 4DRHB 1JMWA 4BEJA 1M2OA 4XEKA 3FMSA 2M4EA 2H7OA 4OD4A 5JT4A 4Q4ZF 2LP4A 4J30B 1ZHYA 1B68A 3MLGA 2FAPB 4AE4B 2Q00A 1G4WR 4GQHA 1HW2A 3NMKA 4DXWA 4KNVA 2EIKC 4CJGA 1O5HA 2J7PA 3NMJA 1NFNA 2L6FA 2W45A 2QLAA 2YVKA 3E9VA 4JC7A 4Z9JA 3DI5A 1VMAA 1HE9A 3SP1A 3HLZA 2XSEA 1M6TA 1Z3IX 1BR2A 2YLIA 2MWQA 3NMIA 4K7BA 3R7CA 4XLNF 1OCRC 2I15A 2A6EF 3GEEA 2VCCA 1OR3A 3DKAA 3GM2A 4IJJA 3FHDA 2IXNA 1VLSA 3JSZA 3V5ZA 4BJ6A 1LI5A 2L7AA 1VOMA 3JYYA 3NG1A 2B0JA 4I3MA 1WGWA 3U8VA 3AOUA 3QW0A 1U6HA 3EG9B 2NUPA 1NU9C 3C8GD 2R9RB 1TFKB 4C3BA 3U3BA 3ZDLA 1T5OA 3IQ6A 1CPRA 3AG4C 1OCCC 2VC9A 1LI7A 4L6RA 3US6A 3GORA 4YT8A 4CS9C 2EIJC 4LACB 3HJCA 1D0YA 2Y3BA 4YT4A 1CGNA 1M57C 3K6BA 3JYHA 4CS8A 256BA
chains in the Genus database with same CATH topology
4IGGA 4PR9A 2GWWA 2GDCA 1RKEA 3H2VA 1T01A 2IBFA 4P9TA 2X0CA 3RF3A 4E17A 1YDIA 4DJ9A 2HSQA 3VF0A 4ONSA 3H2UA 4W8PA 1DOVA 4E18A 1RKCA 1ZW2A 5FZTA 5L0GA 1H6GA 2L7AA 4K1OA 3TJ5A 2B0HA 1ZW3A 1U89A 3MYIA 5L0HA 1U6HA 1L7CA 5L0CA 4EHPA 1QKRA 3TJ6A 5L0IA 2LQGA 3ZDLA 3S90A 3T6GB 5L0DA 1ST6A 1XWJA 1DOWA 5L0JA 5L0FA 1SYQA 1TR2A 1RKEB 1ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGG A;  4PR9 A;  2GWW A;  2GDC A;  1RKE A;  3H2V A;  1T01 A;  2IBF A;  4P9T A;  2X0C A;  3RF3 A;  4E17 A;  1YDI A;  4DJ9 A;  2HSQ A;  3VF0 A;  4ONS A;  3H2U A;  4W8P A;  1DOV A;  4E18 A;  1RKC A;  1ZW2 A;  5FZT A;  5L0G A;  1H6G A;  2L7A A;  4K1O A;  3TJ5 A;  2B0H A;  1ZW3 A;  1U89 A;  3MYI A;  5L0H A;  1U6H A;  1L7C A;  5L0C A;  4EHP A;  1QKR A;  3TJ6 A;  5L0I A;  2LQG A;  3ZDL A;  3S90 A;  3T6G B;  5L0D A;  1ST6 A;  1XWJ A;  1DOW A;  5L0J A;  5L0F A;  1SYQ A;  1TR2 A;  1RKE B;  1ZVZ A; 
#chains in the Genus database with same CATH topology
 2R7W A;  3ZSU A;  2IXP A;  2PFD A;  2X0C A;  4YL3 A;  5L0F A;  3DXJ F;  2A69 F;  4D4N A;  4NCQ A;  3DE8 A;  4YL0 A;  2YHS A;  4MTG A;  4XLP F;  3EFO A;  3DE9 A;  4O79 A;  4C3D A;  1BR4 A;  3FXH A;  2WZL A;  3NYM A;  4IWB A;  2DGJ A;  5AC4 A;  4CIH A;  1Z5Z A;  2CW0 F;  2G3V A;  2DB4 A;  3Q6N A;  1R5I D;  2EPL X;  2L81 A;  4LDQ A;  5A6K A;  1S05 A;  3IHU A;  5DQT A;  4C7O B;  3PHF 2;  4LLE A;  1L7C A;  4ANJ A;  1A7E A;  2Y3G A;  2ZXP A;  1MND A;  1NU7 D;  1HE1 A;  2IM8 A;  3L1M A;  3L34 A;  3OWT A;  4U5E E;  5EHH A;  4AL0 A;  1WOL A;  3RFY A;  5L0D A;  3TUL A;  3GEI A;  3VRC A;  3NDB B;  4ULV A;  1ST6 A;  1VK5 A;  3HKK A;  3M4C A;  1Z7Q c;  1Q0F A;  4JIO A;  3RKO F;  1NFO A;  3S29 A;  2AU5 A;  2KK1 A;  3GM3 A;  2P0N A;  3K7D A;  4KBL A;  2HKV A;  2P1A A;  4JZA A;  3QMK A;  5GPG B;  4OIP F;  1ORS C;  1A7V A;  3FVY A;  4CS7 A;  4PJJ A;  4Q5S F;  3GAN A;  1MMA A;  3AG2 C;  3L0I A;  1E84 A;  4OIR F;  5T1D B;  3K1I C;  5DQZ A;  4F4B A;  1I5N A;  2HMQ A;  4B6I A;  3N0T A;  2P7V A;  3ITF A;  4JE9 A;  4R32 A;  4QDL A;  2R7V A;  2YWA A;  4WGY A;  3N24 A;  4LLC A;  3TJ5 A;  4O6M A;  4XWJ A;  4LDR A;  1SR2 A;  3JRT A;  4C3E A;  2QNL A;  4RBN A;  1HY5 A;  1QKR A;  4NTF A;  3IQ5 A;  3QW1 A;  3GEH A;  4PJN A;  5D92 A;  3FDQ A;  3G50 A;  1ZZP A;  3CAX A;  2R7O A;  5COM A;  1NLX A;  2KNH A;  1KTM A;  1M2V B;  4YT2 A;  4Q7C A;  4XPY A;  2R7S A;  1G4U S;  1ZHT A;  3ASO C;  4U5D E;  5L0J A;  3EZH A;  3V7O A;  4DBR A;  2Q3T A;  2YLD A;  4A2N B;  1Q0M A;  1EI7 A;  3DAG A;  2YKZ A;  4K0D A;  2DYS C;  1NZE A;  3A11 A;  4AE4 A;  3PDM P;  1SZI A;  1K04 A;  5A6A A;  2JD3 A;  2Z15 A;  1FFH A;  3KMI A;  3NKD A;  3MYF A;  1H9T A;  2R25 A;  2O9X A;  3LLK A;  3KL4 A;  5KYX B;  3S84 A;  2GAQ A;  3UGP A;  4W8K A;  3JTL O;  2XLM A;  3UNG C;  2W4M A;  2CNW D;  1T6Q A;  2J46 A;  2PBE A;  2XM4 A;  3WG7 C;  2HJ3 A;  3GOD A;  4MVZ A;  2V3C C;  1ZU4 A;  1FAP B;  5L0I A;  2XXA A;  2KQ9 A;  3EG9 A;  4PJL A;  4WAB A;  3ZIB A;  2AP3 A;  4MQ9 F;  1XZQ A;  1APC A;  4XPW A;  3CEX A;  3V5Y A;  1Z63 A;  2EPO A;  4MW8 A;  3JRM O;  3OEO A;  4IAQ A;  1RKE B;  3B0V C;  3RQF A;  1ZHW A;  1J8Y F;  1D1C A;  1Y6D A;  2KC3 A;  3SXK A;  4P9T A;  3W2V A;  1BZ4 A;  2YL0 A;  5BQG A;  4NTA A;  4E17 A;  3NYJ A;  4KI2 A;  2Y69 C;  2CGE A;  1H7I A;  3SEO A;  4A4A A;  4HE8 D;  1GGQ A;  3ECS A;  3CZ6 A;  1C02 A;  2KJG A;  2PX3 A;  4U9E A;  2EIM C;  1OW6 A;  3JZ0 A;  3T6J A;  4G7O F;  3AG3 C;  3Q7L A;  4BJ5 C;  2XL8 A;  2LFF A;  1RCP A;  3S27 A;  2J0W A;  3DJN B;  3ZWI A;  2PNO A;  2DI3 A;  2QUP A;  3IPM O;  4ZLC A;  2NSG A;  4QI2 A;  1HMD A;  2J0X A;  3EH1 A;  5B1B C;  4CIP A;  3QZC A;  1T6I A;  3IQC A;  3UGO A;  3NKE A;  1JPJ A;  3J06 A;  3Q7G A;  1D0Z A;  4IAO A;  1PD0 A;  1E86 A;  1JOG A;  2L6H A;  4U5H A;  3LNM B;  3RVZ A;  2XS8 A;  3U9J A;  3AGU A;  4U5G A;  5A69 A;  3H2V A;  4KNW A;  1R4T A;  4N06 A;  1E2X A;  4U9D A;  1EKY A;  3U2M A;  4BG0 A;  3VF0 A;  2A68 F;  2CYD A;  3DM5 A;  3O6X A;  3TQO A;  3QVZ A;  2EPN A;  2R7T A;  1YJG A;  5COF A;  4H4K C;  3ZQV A;  2HV7 A;  4YWQ A;  3ATP A;  2LD6 A;  2XS1 A;  4HEA J;  4AL1 A;  5E3C A;  4JCZ A;  4OIN F;  5B3I A;  2XXA B;  1F1M A;  3B9Q A;  1I4Z A;  1LVK A;  2ETS A;  3I4U A;  1Y4C A;  4X0R A;  3SNH A;  3KYJ A;  1GS9 A;  2WVQ A;  4EBJ A;  5KYW B;  3K66 A;  5HV9 A;  3KH2 A;  3LUT B;  1M2V A;  1VB5 A;  1QQ3 A;  4ULW A;  2OKU A;  1IZM A;  3M4B A;  4CSA A;  1T6U A;  2A6H F;  2CCY A;  3V5X A;  5CIV A;  2YQY A;  2D5R B;  2GWW A;  4JEB A;  2UUH A;  1OW7 A;  2Y3H A;  3RF3 A;  5JS5 A;  3SZR A;  3C8G B;  4DJ9 A;  1E83 A;  3AG1 C;  3SYN A;  3LJB A;  4W8P A;  5KYX A;  3ABK C;  2AVK A;  2M64 A;  5CI9 A;  1FMW A;  1YZC A;  4DRJ B;  1TWC A;  2IYL D;  2XLW A;  2EIN C;  5JSL A;  1U89 A;  3X2Q C;  1YYX A;  2HUJ A;  2NUT B;  4MS2 A;  4N6C A;  3ABL C;  2HJM A;  2QTV A;  4EBB A;  1IW7 F;  3EGD B;  4MND A;  2HMZ A;  4CJO A;  1BR1 A;  2WVN A;  1K05 A;  1KNY A;  5B3S C;  4AX2 A;  2WL8 A;  4U5F E;  1YA7 O;  4MTF A;  4XQ1 A;  3SXY A;  3LS1 A;  4I1O B;  1YLM A;  3RIP A;  3HNK A;  4MVO A;  1ZVZ A;  1TQG A;  3B0P A;  3W2W A;  2LK4 A;  1RKE A;  4YK5 A;  3MBG A;  4G7H F;  1YDI A;  4ER9 A;  1TWH A;  2Q9B A;  4JJF A;  2Y3D A;  1QLE C;  2F22 A;  3KYI A;  3LES A;  3T4R A;  4JTD B;  1G5Z A;  3C62 A;  2Q9A A;  4YL1 A;  5KYY B;  5HSW A;  1RJ9 A;  3AQB A;  1D1B A;  2YRF A;  4WGZ A;  4K1O A;  3H65 A;  3GWN A;  4YN0 B;  3CQZ A;  1A41 A;  4FES A;  4EWC A;  5E33 A;  2AWC A;  3Q6M A;  4U5C E;  3C63 A;  2J9U A;  4GEH A;  5COG A;  3LS0 A;  4D4X A;  3C18 A;  3S90 A;  2OOC A;  2VH3 A;  4G0H A;  4O6Y A;  5F5H A;  1PV3 A;  3CSK A;  4J7Y A;  4G7Z F;  2YL3 A;  2BL2 A;  4CS9 A;  1OQC A;  1WWP A;  1AEP A;  1OCZ C;  1ORJ A;  1AVO B;  3EHN A;  1C03 A;  2YZS A;  1T01 A;  1OXB A;  5F28 E;  4EBK A;  1JR8 A;  3K33 A;  2LCH A;  3EPV A;  3WAQ A;  2OCC C;  5FCL A;  5DVW A;  5KYU B;  2LFD A;  2HSQ A;  5KYW A;  4PAC A;  1J8M F;  1UFB A;  4XEV A;  1W2W A;  3KKB A;  3X1O A;  1OCO C;  1ZW2 A;  3EHM A;  3EZI A;  3M15 A;  3MX3 A;  4IAR A;  3T6B A;  5DS6 A;  3WOD F;  1LM3 B;  5AC5 A;  4E0H A;  2R02 A;  2R03 A;  3L8I A;  3RQG A;  3TJ6 A;  3SXM A;  4JKV A;  4JVS A;  4YT5 A;  3I5Q A;  2DYR C;  2LQG A;  3C8Z A;  1EQ1 A;  1OKK D;  1JRA A;  5L3V A;  4J32 B;  5K0I A;  2ICW G;  2A1D D;  1I4Y A;  2G62 A;  2ZXR A;  4E0I A;  2HSB A;  2HS5 A;  2EPK X;  2J9V A;  2X51 A;  2PP4 A;  3FAJ A;  1VLT A;  2Q9C A;  4MW3 A;  4MVU A;  5CI8 A;  4OIO F;  3QTH A;  1AUE A;  5A6B A;  2XLH A;  4P9F A;  5L3Q A;  3GWL A;  1S7Z A;  4HFF B;  4MTO A;  3B29 A;  1WTY A;  4I1M A;  3PCV A;  3A9C A;  5E2Q A;  4ONS A;  5F5F A;  2CDQ A;  4BJ1 A;  1DOV A;  3K1I A;  1RJ9 B;  1RKC A;  5TJ5 E;  1ZYR F;  3C8G A;  4BJ6 C;  4CDV A;  1H6G A;  1V55 C;  3DAF A;  2WB7 A;  2KGO A;  2YL1 A;  3LAY A;  5JP7 A;  3DWW A;  3BEH A;  4FWV A;  2R7X A;  3NYL A;  3TD7 A;  3K1H A;  3UMK A;  2NUT A;  3EGX B;  5JLI A;  1YAR O;  4CX9 A;  3ASN C;  3B71 A;  3EGD A;  2QE9 A;  3T6G B;  2VAS A;  3U9M A;  3ZTM A;  4KC9 A;  1BBH A;  1ZHZ A;  1Q0K A;  1QVX A;  2LSE A;  2MHR A;  2NG1 A;  3EQL F;  3LEV A;  1TKN A;  2P6V A;  2UUI A;  4P6I C;  1SYQ A;  4CS8 C;  4DRI B;  3TOL A;  3M79 A;  1D1A A;  1M56 C;  2GFH A;  3EH2 A;  4O7G A;  4MVS A;  1JAF A;  2BE5 F;  4NY3 A;  4E7S A;  1Q0G A;  2ZXW C;  4WJ0 A;  3S9O A;  1V74 B;  3FOP A;  1MMG A;  3DJU B;  3RVY A;  2OQM A;  2KW3 C;  3W8H A;  5JRA A;  4JCH A;  4Z9I A;  1OW8 A;  3JCU Q;  1O87 A;  1A7D A;  1OR2 A;  2NSF A;  4GYT A;  1G8X A;  3UMH A;  4BJT A;  1N1C A;  2H8A A;  1ZW3 A;  2PF4 E;  3DZA A;  3DMD A;  4NQF A;  5KYY A;  1YZA A;  2VB6 A;  1Q0D A;  1Z6A A;  1V4A A;  2HZ8 A;  1NSG B;  4I44 A;  1H9G A;  5L0G A;  2ASR A;  4IB4 A;  4CDY A;  3O55 A;  2R7Q A;  1ZHX A;  2W9Y A;  2Q7R A;  4FX5 A;  2XLD A;  3OA1 A;  5E3A A;  3SXZ A;  4JJG A;  1A0B A;  4MVM A;  5KYN A;  4LER A;  1ORY A;  3GM1 A;  4ZLD A;  1SF8 A;  1QZX A;  2A0B A;  2Y39 A;  3QVY A;  3HNJ A;  1E85 A;  4MVR A;  4OIQ F;  1BDJ B;  1PCX A;  4EUK B;  5T3T A;  2OG2 A;  2QY9 A;  5KYU A;  2J45 A;  1YAU O;  3L8J A;  5FZT A;  1T9K A;  4G78 A;  5D91 A;  2L9J A;  1VYI A;  2HV6 A;  4EHP A;  5JUA A;  2LIG A;  2J8W A;  3VAY A;  1V54 C;  4BJ5 A;  3B0U X;  1YYJ A;  2XM0 A;  1VYK A;  2V26 A;  2C04 A;  4FAP B;  3AGT A;  2TMV P;  2OEV A;  1LE4 A;  1TFO B;  2G3K A;  3E70 C;  1MMN A;  1DOW A;  4RDA A;  1YA9 A;  3ZG1 A;  3O39 A;  2JPU A;  4PFO A;  3IQT A;  3HTK C;  2GA0 A;  2XL6 A;  2P61 A;  1RMV A;  2IOQ A;  3JT1 A;  3G4Z A;  1XZP A;  4JRZ A;  2IBF A;  2HFI A;  2PX0 A;  2CNW A;  3AQC A;  4RD9 A;  4U5B E;  1QSP A;  2ZD9 A;  2L6G A;  3MFN A;  5IY5 C;  4N4W A;  2J7P D;  1LKX A;  3IEE A;  2JX0 A;  4PK4 A;  1PD1 A;  2IXO A;  1WAS A;  3S28 A;  1OKK A;  3FOO A;  5L0H A;  2Q4F A;  4IRU A;  4QI0 A;  4Z9H A;  3W8I A;  4E7Z A;  3HNL A;  3RQE A;  3ZTZ A;  4OD5 A;  4UDV A;  3U3F A;  4H54 A;  3R2P A;  4M63 A;  1LIH A;  3F46 A;  3WHN A;  1WN0 A;  4PFP A;  1KU2 A;  1SMY F;  3EGX A;  1XWJ A;  4HFK B;  3RH3 A;  2YEV A;  1L3P A;  2XLE A;  4YJW A;  3DM9 B;  4XTK A;  1TR2 A;  3S0X A;  3U2L A;  2WZG A;  4AK9 A;  1CPQ A;  2KYH A;  4IGG A;  5T3W A;  3U0C A;  3LLI A;  3VYW A;  2J9B A;  1GM5 A;  4JEA A;  2RSE B;  3T9O A;  3UR3 C;  1ZU5 A;  5DLJ A;  4DVY P;  1CGM E;  1O3U A;  1FMV A;  2YL7 A;  3U5S A;  1LPE A;  1D0X A;  1LS4 A;  1MNE A;  3ABM C;  3LNR A;  5BUO A;  2BC5 A;  3ZC4 A;  3U8P A;  3RYL A;  3AJM A;  4JTA B;  5BQI A;  2NUP B;  4N6H A;  2E87 A;  2W4B A;  2H7B A;  1FR0 A;  4JUR I;  4DBQ A;  3POV A;  2J9W A;  2C03 A;  5DS4 A;  1FNT c;  2ZXO A;  3FAP B;  1JPN A;  3NRH A;  2AWY A;  5JVE A;  1GQA A;  2EIL C;  3G4X A;  3LEO A;  3HNI A;  1TWA A;  1YVI A;  3UMI A;  2H7V C;  1RXQ A;  3C7J A;  4JTC B;  2XL4 A;  4PR9 A;  2D4U A;  3EFO B;  4PJM A;  2RD9 A;  4J7T A;  4NC3 A;  1UG7 A;  2MYS A;  1EA8 A;  1LE2 A;  4DVZ A;  2VCB A;  1HW1 A;  4BEM J;  3PMR A;  4EKW A;  2OJQ A;  3O10 A;  3BRJ A;  4EIY A;  2R05 A;  4JW1 A;  1QPU A;  3KPH A;  1NBB A;  2OJE D;  1WAT A;  2IXM A;  2FGY A;  4XPX A;  3ZVR A;  5DS5 A;  2B0H A;  5EGY A;  5BQH A;  2KSF A;  1MQV A;  2XLV A;  3M1C B;  1OXK A;  3VM6 A;  1HMO A;  3TOM A;  1TWG A;  4CDA A;  1VTM P;  3TK0 A;  1K40 A;  4NTB A;  2XRH A;  2R7R A;  2R7U A;  2VCA A;  1C17 M;  2OEX A;  4BPM A;  1LS1 A;  2YLG A;  2FFH A;  4CSA C;  4DOZ A;  3N2Z B;  1U0B B;  1MMD A;  4O6N A;  1FTS A;  5B1A C;  1FFT C;  2GDC A;  4LDK A;  1NG1 A;  4XEF A;  1CGO A;  2OU6 A;  2I8B A;  3RW0 A;  2XLO A;  3H2U A;  3EJN A;  4E18 A;  3DD7 A;  2WZF A;  5AGF A;  4MVQ A;  5A6B D;  2NPU A;  2EPM X;  2A0U A;  2ZPA A;  3I5P A;  1Z23 A;  3W4Y A;  3MYI A;  3ZQY A;  5EK0 A;  5L0C A;  4C7O A;  2WVO A;  3JSE O;  3F47 A;  4CBE A;  5A6J A;  4DRH B;  1JMW A;  4BEJ A;  1M2O A;  4XEK A;  3FMS A;  2M4E A;  2H7O A;  4OD4 A;  5JT4 A;  4Q4Z F;  2LP4 A;  4J30 B;  1ZHY A;  1B68 A;  3MLG A;  2FAP B;  4AE4 B;  2Q00 A;  1G4W R;  4GQH A;  1HW2 A;  3NMK A;  4DXW A;  4KNV A;  2EIK C;  4CJG A;  1O5H A;  2J7P A;  3NMJ A;  1NFN A;  2L6F A;  2W45 A;  2QLA A;  2YVK A;  3E9V A;  4JC7 A;  4Z9J A;  3DI5 A;  1VMA A;  1HE9 A;  3SP1 A;  3HLZ A;  2XSE A;  1M6T A;  1Z3I X;  1BR2 A;  2YLI A;  2MWQ A;  3NMI A;  4K7B A;  3R7C A;  4XLN F;  1OCR C;  2I15 A;  2A6E F;  3GEE A;  2VCC A;  1OR3 A;  3DKA A;  3GM2 A;  4IJJ A;  3FHD A;  2IXN A;  1VLS A;  3JSZ A;  3V5Z A;  4BJ6 A;  1LI5 A;  2L7A A;  1VOM A;  3JYY A;  3NG1 A;  2B0J A;  4I3M A;  1WGW A;  3U8V A;  3AOU A;  3QW0 A;  1U6H A;  3EG9 B;  2NUP A;  1NU9 C;  3C8G D;  2R9R B;  1TFK B;  4C3B A;  3U3B A;  3ZDL A;  1T5O A;  3IQ6 A;  1CPR A;  3AG4 C;  1OCC C;  2VC9 A;  1LI7 A;  4L6R A;  3US6 A;  3GOR A;  4YT8 A;  4CS9 C;  2EIJ C;  4LAC B;  3HJC A;  1D0Y A;  2Y3B A;  4YT4 A;  1CGN A;  1M57 C;  3K6B A;  3JYH A;  4CS8 A;  256B A; 
#chains in the Genus database with same CATH homology
 4IGG A;  4PR9 A;  2GWW A;  2GDC A;  1RKE A;  3H2V A;  1T01 A;  2IBF A;  4P9T A;  2X0C A;  3RF3 A;  4E17 A;  1YDI A;  4DJ9 A;  2HSQ A;  3VF0 A;  4ONS A;  3H2U A;  4W8P A;  1DOV A;  4E18 A;  1RKC A;  1ZW2 A;  5FZT A;  5L0G A;  1H6G A;  2L7A A;  4K1O A;  3TJ5 A;  2B0H A;  1ZW3 A;  1U89 A;  3MYI A;  5L0H A;  1U6H A;  1L7C A;  5L0C A;  4EHP A;  1QKR A;  3TJ6 A;  5L0I A;  2LQG A;  3ZDL A;  3S90 A;  3T6G B;  5L0D A;  1ST6 A;  1XWJ A;  1DOW A;  5L0J A;  5L0F A;  1SYQ A;  1TR2 A;  1RKE B;  1ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...