2GDCA

Structure of vinculin vd1 / ipaa560-633 complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
249
structure length
238
Chain Sequence
b'PVFHTRTIESILEPVAQQISHGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Cell invasion
source organism Gallus gallus
publication title Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
pubmed doi rcsb
total genus 99
structure length 238
sequence length 249
ec nomenclature
pdb deposition date 2006-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gdcA01
2LQGA 5FZTA 1L7CA 1U89A 1ZVZA 1H6GA 4E18A 5L0GA 4DJ9A 3VF0A 1T01A 1TR2A 2B0HA 1ZW3A 2X0CA 4ONSA 4EHPA 1U6HA 3T6GB 2GDCA 1RKEB 1SYQA 5L0JA 4PR9A 2HSQA 1YDIA 5L0IA 2L7AA 4E17A 3H2VA 5L0HA 4P9TA 1ZW2A 4W8PA 3RF3A 5L0CA 1QKRA 1DOVA 2GWWA 3H2UA 1RKCA 4IGGA 4K1OA 3TJ6A 5L0FA 1RKEA 1ST6A 2IBFA 3S90A 3ZDLA 1XWJA 5L0DA 3MYIA 3TJ5A 1DOWA
chains in the Genus database with same CATH superfamily
1ORSC 3EG9B 4E7ZA 3IQ5A 2WVOA 2KGOA 5A6BA 3GEEA 5FZTA 4CJGA 1I4ZA 3AQCA 1JOGA 1LM3B 3LLKA 5EK0A 4PK4A 1VYKA 1LE4A 1QQ3A 3AQBA 2YL3A 5T3WA 2G3KA 3NMIA 3ABLC 3DXJF 4I1OB 3A9CA 2LD6A 3DAFA 4U5DE 5T3TA 2GAQA 2J9VA 2P61A 3IHUA 3EGXA 4JKVA 1YYXA 4XEVA 2R7SA 4LDQA 5L0CA 1RCPA 3HJCA 2QTVA 4WGYA 3R2PA 4IRUA 3SZRA 4AX2A 3M79A 5COFA 5KYUB 1PCXA 1M2OA 4E7SA 2YKZA 2RD9A 3OEOA 1A7EA 2A68F 5B1AC 1FFHA 3K1IA 3C63A 1NBBA 4N6HA 3RVZA 1IW7F 2R9RB 4E0IA 2NG1A 4J7YA 4E18A 3RKOF 2EPLX 2OEVA 4GQHA 3L1MA 2QLAA 1I5NA 4MVRA 1J8MF 3GORA 4JEBA 4OD4A 3ZWIA 2YQYA 4JJGA 3E9VA 4U5CE 3M1CB 3QZCA 4JURI 1ZHWA 1TFKB 2MYSA 3C8ZA 3AG1C 1TWCA 1CGME 2OU6A 1LE2A 2EPKX 2W4MA 1NLXA 1LS1A 3TQOA 3EZIA 3U3FA 3AGUA 4C3BA 4JZAA 4OIPF 1XZQA 2PFDA 3V5YA 2GA0A 3X2QC 1OXKA 3V7OA 2XSEA 1OR3A 2CNWD 3ATPA 1NU9C 3IQCA 2H7OA 5E2QA 4OIRF 4JC7A 4BEJA 2TMVP 2ZXWC 2J8WA 5JLIA 3DMDA 4YT2A 5A6AA 3JRTA 1HW1A 3S29A 5KYWB 1E84A 4UDVA 2KW3C 2Q9BA 3E70C 4YL1A 4ULWA 2AWCA 3S28A 4BJ5C 1QPUA 1H7IA 2YLGA 3GANA 3JTLO 3RQGA 2L6GA 4EHPA 5JP7A 4LLCA 3K1HA 1VLSA 3U9MA 2OCCC 3V5ZA 1JMWA 4CBEA 2C04A 4FX5A 3L0IA 2R05A 3JYHA 5TJ5E 3CQZA 3CSKA 1Z5ZA 3EJNA 3LUTB 2PNOA 1NG1A 3N0TA 3UNGC 2IYLD 1PV3A 4DBQA 1RKCA 3ABMC 4XLPF 1F1MA 3GWNA 3WAQA 2Q3TA 1ZU5A 4LDRA 3FXHA 3B0UX 3C7JA 2ZXOA 3ZTZA 4XWJA 4EBBA 3EPVA 4AE4A 1OW6A 4FESA 1VOMA 4O79A 1OKKD 4JIOA 4WGZA 3ECSA 4CX9A 4IB4A 4J30B 2CCYA 2KK1A 1R5ID 3DM9B 4QI2A 1OR2A 5CI8A 3VF0A 1D1CA 1JAFA 1PD0A 4KBLA 3ZQVA 5BUOA 2Y69C 3EHMA 1LVKA 2HKVA 4U5FE 5E3AA 2GDCA 2C03A 4U9EA 3N24A 4ANJA 4A4AA 2LP4A 2G3VA 2JX0A 2QNLA 3RQEA 3H2VA 2A6HF 1RJ9A 1S05A 2EPMX 2IXMA 3IPMO 4I1MA 3J06A 4MTGA 2AWYA 2OEXA 2J46A 5CI9A 3DE9A 2GWWA 3JYYA 4EBJA 1Z7Qc 2UUIA 3HLZA 1LS4A 1NSGB 1WGWA 3UGPA 3JSZA 2Q4FA 3DAGA 4OINF 4XPYA 5L0DA 3ABKC 4WJ0A 4OIOF 4CIHA 1MQVA 1A7VA 1B68A 2NSGA 2NUTB 5AC4A 4G7ZF 2VCAA 1VYIA 2HSBA 4LACB 4CS7A 2CDQA 4D4XA 2E87A 3GEIA 1NFOA 1ZVZA 3UGOA 3KMIA 4BJ6A 2J7PA 3GWLA 3ZIBA 1G5ZA 2KC3A 2I15A 2CNWA 1K40A 1TWGA 1ZW3A 2B0HA 3EGDA 3IEEA 3LAYA 4EWCA 4YJWA 2DB4A 3RFYA 4NTAA 2DI3A 2YEVA 4FWVA 2PBEA 4Z9JA 2KSFA 3W8IA 1Y6DA 2YRFA 4L6RA 3MYFA 2P0NA 3LNRA 4PACA 3UMIA 3QVZA 4JEAA 1SF8A 4BJ5A 2QE9A 3T9OA 3JRMO 2EINC 1M6TA 2Y3GA 3NKEA 4F4BA 3LESA 3AG3C 3FOPA 4CS9C 1HY5A 2R7RA 3SYNA 3KH2A 2ETSA 1YAUO 2LQGA 4AL0A 3FAJA 2W45A 1OCZC 3M4CA 3EH1A 3SXZA 3F46A 2XS1A 2IOQA 2YLDA 2HMQA 3U3BA 5BQIA 4DBRA 4O6NA 4JTCB 4XEKA 1T01A 5DLJA 2KJGA 1GM5A 2X0CA 3RQFA 3HTKC 3HNJA 1K05A 2CGEA 3GM2A 1GS9A 2Y3HA 5EHHA 4O7GA 2L9JA 2DYSC 2IXPA 2V26A 4M63A 3HNLA 5GPGB 1UFBA 2OOCA 5CIVA 5F5FA 2H7VC 4NTBA 3QTHA 2V3CC 2R7UA 1O5HA 2LFFA 3U5SA 1Z63A 1M2VB 2J0WA 2AVKA 2YL1A 3R7CA 5F5HA 1DOVA 2YVKA 1ZHYA 4NY3A 5COMA 2XXAA 2QUPA 2PF4E 2LK4A 4YT8A 4MVUA 1I4YA 3LJBA 3KL4A 4JCZA 1HE1A 1Q0FA 2LFDA 4XLNF 3TOMA 4G7HF 3M4BA 3WHNA 1Z23A 1U89A 4YK5A 3U0CA 5COGA 2H7BA 3GEHA 1SR2A 5B3SC 4DJ9A 4BG0A 4PJLA 2J45A 1YA9A 4CDVA 3DJNB 4DRJB 4DXWA 5DQZA 1JPNA 3IQTA 3KPHA 3ZTMA 3FOOA 3HKKA 1HW2A 1VK5A 3SXYA 3FAPB 2EIKC 2ASRA 4BJ6C 2A0BA 3JCUQ 4DVYP 1FFTC 5L0HA 1LKXA 2J9UA 3DD7A 2P6VA 1IZMA 3U2LA 2WL8A 5DQTA 3POVA 3B9QA 2VCBA 3DM5A 2CW0F 4IGGA 4BJTA 3ZC4A 4PJMA 1UG7A 4P9FA 1ZZPA 5BQHA 2L81A 2MWQA 1RKEA 3NKDA 1EA8A 3NMKA 5AGFA 2XXAB 2HZ8A 2XS8A 3NYMA 3LS0A 4H4KC 3KKBA 3UMKA 2EIMC 5JUAA 3DE8A 2EILC 1Q0MA 3UMHA 5KYXA 4XPWA 3K33A 3L8IA 2YL7A 4Z9HA 5EGYA 1OCCC 5DS4A 3L34A 3US6A 1VB5A 3SXMA 4DOZA 1TWAA 1A0BA 1G4US 3JZ0A 1S7ZA 2HJMA 4LDKA 4A2NB 2IXNA 4NTFA 2YL0A 3K1IC 2R7XA 1M57C 2HJ3A 3S9OA 3QMKA 2Q9CA 3M15A 4YL0A 4C7OB 1SMYF 3B71A 2XLMA 3VYWA 3A11A 3B29A 3EGXB 3I5PA 4MTOA 4I3MA 2WB7A 3GM3A 4MW8A 4P6IC 2R03A 1AUEA 1WTYA 4DRIB 2KQ9A 1YLMA 3TULA 1BDJB 2P7VA 3DZAA 1Q0GA 1JR8A 2WZLA 3ITFA 3MX3A 2BE5F 2XLDA 3KYJA 1T5OA 2GFHA 1OXBA 2PX0A 2R02A 4G78A 1H9GA 2D4UA 4MVSA 3Q6MA 3DKAA 4ER9A 1G8XA 3G50A 2F22A 3ZVRA 1KNYA 4W8KA 4DVZA 2A6EF 1A7DA 1WWPA 2Y39A 3K7DA 3I4UA 3T6GB 3RH3A 3AGTA 2HMZA 2XM4A 2JPUA 2R7OA 5DVWA 5KYUA 2XL6A 2LSEA 1JRAA 4K0DA 1C17M 1D0XA 1LI5A 2EIJC 3AJMA 3G4ZA 4MS2A 4NCQA 4QDLA 1TKNA 4U5HA 1FNTc 4K7BA 3MBGA 1BBHA 1BR4A 3Q7GA 1V74B 3AOUA 1QKRA 4XPXA 3ASOC 3C18A 4IAQA 2RSEB 4ULVA 2IBFA 4U5GA 3B0PA 4GEHA 5BQGA 3SEOA 3NYJA 5L0GA 1FTSA 4ZLDA 4H54A 3EG9A 3WODF 4PFPA 2NUPA 4U5BE 4Q4ZF 3QVYA 3EFOB 5E33A 4B6IA 1BZ4A 1L3PA 1O87A 2PX3A 3C8GA 2Y3DA 2I8BA 1VLTA 2KYHA 5KYYA 2YHSA 3PDMP 5B1BC 3ASNC 1ZHXA 1FAPB 3GODA 4YL3A 1SYQA 2ZXPA 3I5QA 1Q0KA 5JVEA 5A6JA 3EQLF 1LI7A 1QZXA 2AU5A 1YYJA 3EH2A 5F28E 1BR1A 2NUPB 3MFNA 2L7AA 4E17A 3EFOA 3UR3C 3WG7C 4EUKB 3C8GD 2ZXRA 3HNKA 3LEOA 1Y4CA 2YLIA 5KYWA 1SZIA 2WVNA 4N06A 3FMSA 2FGYA 4IWBA 4CJOA 3Q6NA 5L3VA 1R4TA 4MVOA 4MVQA 4MVZA 4HEAJ 3ZDLA 3EZHA 3S90A 1XWJA 4AE4B 2XRHA 1ORJA 4YT4A 3O10A 3VRCA 1T6UA 3JT1A 2P1AA 2XLVA 4O6MA 5KYNA 1WN0A 3JSEO 3SXKA 3VAYA 5DS5A 4OIQF 3AG2C 4ZLCA 3C62A 1D0YA 1CPQA 5AC5A 1CGOA 1LIHA 2B0JA 2VASA 1TR2A 2WVQA 1K04A 2WZFA 4ONSA 3T4RA 1QSPA 1ORYA 2YWAA 2VCCA 4RDAA 2HV7A 1VMAA 1CPRA 4KNVA 4KI2A 3SP1A 4CS8A 1MNEA 3K66A 2R7VA 3RF3A 2J7PD 1C03A 3RW0A 2OJQA 4K1OA 4LLEA 2IXOA 4J7TA 1AEPA 4KC9A 2JD3A 2NPUA 2OKUA 1GGQA 1CGNA 1RXQA 4BEMJ 1OCOC 2ZD9A 1Z3IX 2HV6A 2D5RB 1MNDA 3B0VC 3LLIA 2IM8A 1Z6AA 1D0ZA 4BPMA 1PD1A 4U5EE 1H6GA 1YJGA 4FAPB 4MTFA 4CSAA 2A0UA 1RJ9B 3EGDB 1V4AA 1NFNA 1TWHA 3KYIA 4WABA 3IQ6A 5B3IA 1ZHTA 3O6XA 5D91A 3U9JA 1U6HA 4CDAA 5KYYB 1D1AA 1EI7A 2EPNA 2QY9A 1ZU4A 3DJUB 3NYLA 3Q7LA 4JE9A 1NU7D 2FFHA 1HMDA 1C02A 3HNIA 5A6BD 1YDIA 2L6FA 5KYXB 2HUJA 4KNWA 4C3DA 3FVYA 1E86A 2HS5A 1VTMP 1OW8A 2XLOA 3W4YA 2XLHA 4PFOA 3RIPA 4NQFA 3EHNA 5FCLA 3BRJA 4CIPA 3O55A 2KNHA 2L6HA 1GQAA 5L3QA 5L0JA 4Q5SF 3TJ5A 1G4WR 2O9XA 4C7OA 2OQMA 3CEXA 5HSWA 2OG2A 3OWTA 4R32A 1RMVA 2DYRC 3LEVA 5JSLA 2BL2A 4GYTA 3W2WA 1MMGA 4Z9IA 4DRHB 4J32B 1T6QA 5IY5C 3NRHA 5JRAA 1D1BA 3CAXA 3QW1A 3T6JA 4EIYA 3FDQA 2J9BA 2VB6A 4HE8D 4IAOA 4YN0B 2FAPB 3W2VA 3U8VA 1LPEA 1M2VA 2A1DD 2Z15A 2H8AA 3PHF2 2LIGA 3RVYA 2ZPAA 4W8PA 4EBKA 1Q0DA 4N4WA 2A69F 3V5XA 2R7WA 3ZQYA 2W4BA 3BEHA 2MHRA 2Q00A 4JW1A 1ST6A 3U8PA 3NG1A 3TD7A 2R7QA 1DOWA 4HFFB 4MVMA 4NC3A 4CS8C 3S84A 3U2MA 1WOLA 1L7CA 1AVOB 4JTDB 4AL1A 2XL8A 2VC9A 1J8YF 4MNDA 3ZSUA 2ICWG 5D92A 1BR2A 3OA1A 4JRZA 3CZ6A 4PR9A 2HSQA 1FMWA 3T6BA 4CSAC 5A69A 4I44A 2UUHA 3LS1A 1YZAA 5A6KA 1OKKA 3PMRA 3X1OA 4JJFA 1KU2A 4QI0A 3L8JA 2LCHA 4CDYA 2BC5A 4AK9A 2EPOA 3H65A 4JCHA 5T1DB 1T9KA 3ZG1A 1YVIA 1E83A 1XZPA 1O3UA 3GM1A 2XLEA 1EKYA 1E2XA 1TQGA 1JPJA 1M56C 1WASA 4Q7CA 1QLEC 2VH3A 3DI5A 2Y3BA 3NDBB 2M4EA 1MMDA 2CYDA 4BJ1A 1V55C 2G62A 4PJNA 4HFKB 4N6CA 3MLGA 1N1CA 2M64A 1RKEB 2Q9AA 4U9DA 1E85A 1OQCA 4D4NA 1HE9A 3LNMB 3G4XA 1QVXA 4C3EA 2HFIA 1NZEA 2OJED 4X0RA 4CS9A 3PCVA 1MMAA 4MW3A 1U0BB 4YWQA 4P9TA 1ZW2A 1T6IA 4EKWA 2Q7RA 5K0IA 2W9YA 1W2WA 3H2UA 4G0HA 3TJ6A 2AP3A 1A41A 3AG4C 3O39A 1KTMA 3N2ZB 4IARA 1H9TA 2PP4A 1YA7O 2XM0A 3K6BA 4JTAB 4YT5A 1HMOA 1ZHZA 3MYIA 5JS5A 4RD9A 5E3CA 1YZCA 2YZSA 2XLWA 2WZGA 3VM6A 4XEFA 1OCRC 3C8GB 3QW0A 4E0HA 3TOLA 5HV9A 1TFOB 4G7OF 2XL4A 4O6YA 3TK0A 3DWWA 2R7TA 1OW7A 2J9WA 4XQ1A 4IJJA 1WATA 3RYLA 3SNHA 3S0XA 2NUTA 1YARO 5L0IA 1EQ1A 2R25A 5JT4A 4PJJA 1APCA 2J0XA 1V54C 2X51A 1FMVA 4XTKA 3S27A 3W8HA 2DGJA 3F47A 2NSFA 5L0FA 4RBNA 5DS6A 3FHDA 4MQ9F 256BA 4JVSA 1ZYRF 3NMJA 1FR0A 4LERA 4OD5A 1MMNA
chains in the Genus database with same CATH topology
2LQGA 5FZTA 1L7CA 1U89A 1ZVZA 1H6GA 4E18A 5L0GA 4DJ9A 3VF0A 1T01A 1TR2A 2B0HA 1ZW3A 2X0CA 4ONSA 4EHPA 1U6HA 3T6GB 2GDCA 1RKEB 1SYQA 5L0JA 4PR9A 2HSQA 1YDIA 5L0IA 2L7AA 4E17A 3H2VA 5L0HA 4P9TA 1ZW2A 4W8PA 3RF3A 5L0CA 1QKRA 1DOVA 2GWWA 3H2UA 1RKCA 4IGGA 4K1OA 3TJ6A 5L0FA 1RKEA 1ST6A 2IBFA 3S90A 3ZDLA 1XWJA 5L0DA 3MYIA 3TJ5A 1DOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQG A;  5FZT A;  1L7C A;  1U89 A;  1ZVZ A;  1H6G A;  4E18 A;  5L0G A;  4DJ9 A;  3VF0 A;  1T01 A;  1TR2 A;  2B0H A;  1ZW3 A;  2X0C A;  4ONS A;  4EHP A;  1U6H A;  3T6G B;  2GDC A;  1RKE B;  1SYQ A;  5L0J A;  4PR9 A;  2HSQ A;  1YDI A;  5L0I A;  2L7A A;  4E17 A;  3H2V A;  5L0H A;  4P9T A;  1ZW2 A;  4W8P A;  3RF3 A;  5L0C A;  1QKR A;  1DOV A;  2GWW A;  3H2U A;  1RKC A;  4IGG A;  4K1O A;  3TJ6 A;  5L0F A;  1RKE A;  1ST6 A;  2IBF A;  3S90 A;  3ZDL A;  1XWJ A;  5L0D A;  3MYI A;  3TJ5 A;  1DOW A; 
#chains in the Genus database with same CATH topology
 1ORS C;  3EG9 B;  4E7Z A;  3IQ5 A;  2WVO A;  2KGO A;  5A6B A;  3GEE A;  5FZT A;  4CJG A;  1I4Z A;  3AQC A;  1JOG A;  1LM3 B;  3LLK A;  5EK0 A;  4PK4 A;  1VYK A;  1LE4 A;  1QQ3 A;  3AQB A;  2YL3 A;  5T3W A;  2G3K A;  3NMI A;  3ABL C;  3DXJ F;  4I1O B;  3A9C A;  2LD6 A;  3DAF A;  4U5D E;  5T3T A;  2GAQ A;  2J9V A;  2P61 A;  3IHU A;  3EGX A;  4JKV A;  1YYX A;  4XEV A;  2R7S A;  4LDQ A;  5L0C A;  1RCP A;  3HJC A;  2QTV A;  4WGY A;  3R2P A;  4IRU A;  3SZR A;  4AX2 A;  3M79 A;  5COF A;  5KYU B;  1PCX A;  1M2O A;  4E7S A;  2YKZ A;  2RD9 A;  3OEO A;  1A7E A;  2A68 F;  5B1A C;  1FFH A;  3K1I A;  3C63 A;  1NBB A;  4N6H A;  3RVZ A;  1IW7 F;  2R9R B;  4E0I A;  2NG1 A;  4J7Y A;  4E18 A;  3RKO F;  2EPL X;  2OEV A;  4GQH A;  3L1M A;  2QLA A;  1I5N A;  4MVR A;  1J8M F;  3GOR A;  4JEB A;  4OD4 A;  3ZWI A;  2YQY A;  4JJG A;  3E9V A;  4U5C E;  3M1C B;  3QZC A;  4JUR I;  1ZHW A;  1TFK B;  2MYS A;  3C8Z A;  3AG1 C;  1TWC A;  1CGM E;  2OU6 A;  1LE2 A;  2EPK X;  2W4M A;  1NLX A;  1LS1 A;  3TQO A;  3EZI A;  3U3F A;  3AGU A;  4C3B A;  4JZA A;  4OIP F;  1XZQ A;  2PFD A;  3V5Y A;  2GA0 A;  3X2Q C;  1OXK A;  3V7O A;  2XSE A;  1OR3 A;  2CNW D;  3ATP A;  1NU9 C;  3IQC A;  2H7O A;  5E2Q A;  4OIR F;  4JC7 A;  4BEJ A;  2TMV P;  2ZXW C;  2J8W A;  5JLI A;  3DMD A;  4YT2 A;  5A6A A;  3JRT A;  1HW1 A;  3S29 A;  5KYW B;  1E84 A;  4UDV A;  2KW3 C;  2Q9B A;  3E70 C;  4YL1 A;  4ULW A;  2AWC A;  3S28 A;  4BJ5 C;  1QPU A;  1H7I A;  2YLG A;  3GAN A;  3JTL O;  3RQG A;  2L6G A;  4EHP A;  5JP7 A;  4LLC A;  3K1H A;  1VLS A;  3U9M A;  2OCC C;  3V5Z A;  1JMW A;  4CBE A;  2C04 A;  4FX5 A;  3L0I A;  2R05 A;  3JYH A;  5TJ5 E;  3CQZ A;  3CSK A;  1Z5Z A;  3EJN A;  3LUT B;  2PNO A;  1NG1 A;  3N0T A;  3UNG C;  2IYL D;  1PV3 A;  4DBQ A;  1RKC A;  3ABM C;  4XLP F;  1F1M A;  3GWN A;  3WAQ A;  2Q3T A;  1ZU5 A;  4LDR A;  3FXH A;  3B0U X;  3C7J A;  2ZXO A;  3ZTZ A;  4XWJ A;  4EBB A;  3EPV A;  4AE4 A;  1OW6 A;  4FES A;  1VOM A;  4O79 A;  1OKK D;  4JIO A;  4WGZ A;  3ECS A;  4CX9 A;  4IB4 A;  4J30 B;  2CCY A;  2KK1 A;  1R5I D;  3DM9 B;  4QI2 A;  1OR2 A;  5CI8 A;  3VF0 A;  1D1C A;  1JAF A;  1PD0 A;  4KBL A;  3ZQV A;  5BUO A;  2Y69 C;  3EHM A;  1LVK A;  2HKV A;  4U5F E;  5E3A A;  2GDC A;  2C03 A;  4U9E A;  3N24 A;  4ANJ A;  4A4A A;  2LP4 A;  2G3V A;  2JX0 A;  2QNL A;  3RQE A;  3H2V A;  2A6H F;  1RJ9 A;  1S05 A;  2EPM X;  2IXM A;  3IPM O;  4I1M A;  3J06 A;  4MTG A;  2AWY A;  2OEX A;  2J46 A;  5CI9 A;  3DE9 A;  2GWW A;  3JYY A;  4EBJ A;  1Z7Q c;  2UUI A;  3HLZ A;  1LS4 A;  1NSG B;  1WGW A;  3UGP A;  3JSZ A;  2Q4F A;  3DAG A;  4OIN F;  4XPY A;  5L0D A;  3ABK C;  4WJ0 A;  4OIO F;  4CIH A;  1MQV A;  1A7V A;  1B68 A;  2NSG A;  2NUT B;  5AC4 A;  4G7Z F;  2VCA A;  1VYI A;  2HSB A;  4LAC B;  4CS7 A;  2CDQ A;  4D4X A;  2E87 A;  3GEI A;  1NFO A;  1ZVZ A;  3UGO A;  3KMI A;  4BJ6 A;  2J7P A;  3GWL A;  3ZIB A;  1G5Z A;  2KC3 A;  2I15 A;  2CNW A;  1K40 A;  1TWG A;  1ZW3 A;  2B0H A;  3EGD A;  3IEE A;  3LAY A;  4EWC A;  4YJW A;  2DB4 A;  3RFY A;  4NTA A;  2DI3 A;  2YEV A;  4FWV A;  2PBE A;  4Z9J A;  2KSF A;  3W8I A;  1Y6D A;  2YRF A;  4L6R A;  3MYF A;  2P0N A;  3LNR A;  4PAC A;  3UMI A;  3QVZ A;  4JEA A;  1SF8 A;  4BJ5 A;  2QE9 A;  3T9O A;  3JRM O;  2EIN C;  1M6T A;  2Y3G A;  3NKE A;  4F4B A;  3LES A;  3AG3 C;  3FOP A;  4CS9 C;  1HY5 A;  2R7R A;  3SYN A;  3KH2 A;  2ETS A;  1YAU O;  2LQG A;  4AL0 A;  3FAJ A;  2W45 A;  1OCZ C;  3M4C A;  3EH1 A;  3SXZ A;  3F46 A;  2XS1 A;  2IOQ A;  2YLD A;  2HMQ A;  3U3B A;  5BQI A;  4DBR A;  4O6N A;  4JTC B;  4XEK A;  1T01 A;  5DLJ A;  2KJG A;  1GM5 A;  2X0C A;  3RQF A;  3HTK C;  3HNJ A;  1K05 A;  2CGE A;  3GM2 A;  1GS9 A;  2Y3H A;  5EHH A;  4O7G A;  2L9J A;  2DYS C;  2IXP A;  2V26 A;  4M63 A;  3HNL A;  5GPG B;  1UFB A;  2OOC A;  5CIV A;  5F5F A;  2H7V C;  4NTB A;  3QTH A;  2V3C C;  2R7U A;  1O5H A;  2LFF A;  3U5S A;  1Z63 A;  1M2V B;  2J0W A;  2AVK A;  2YL1 A;  3R7C A;  5F5H A;  1DOV A;  2YVK A;  1ZHY A;  4NY3 A;  5COM A;  2XXA A;  2QUP A;  2PF4 E;  2LK4 A;  4YT8 A;  4MVU A;  1I4Y A;  3LJB A;  3KL4 A;  4JCZ A;  1HE1 A;  1Q0F A;  2LFD A;  4XLN F;  3TOM A;  4G7H F;  3M4B A;  3WHN A;  1Z23 A;  1U89 A;  4YK5 A;  3U0C A;  5COG A;  2H7B A;  3GEH A;  1SR2 A;  5B3S C;  4DJ9 A;  4BG0 A;  4PJL A;  2J45 A;  1YA9 A;  4CDV A;  3DJN B;  4DRJ B;  4DXW A;  5DQZ A;  1JPN A;  3IQT A;  3KPH A;  3ZTM A;  3FOO A;  3HKK A;  1HW2 A;  1VK5 A;  3SXY A;  3FAP B;  2EIK C;  2ASR A;  4BJ6 C;  2A0B A;  3JCU Q;  4DVY P;  1FFT C;  5L0H A;  1LKX A;  2J9U A;  3DD7 A;  2P6V A;  1IZM A;  3U2L A;  2WL8 A;  5DQT A;  3POV A;  3B9Q A;  2VCB A;  3DM5 A;  2CW0 F;  4IGG A;  4BJT A;  3ZC4 A;  4PJM A;  1UG7 A;  4P9F A;  1ZZP A;  5BQH A;  2L81 A;  2MWQ A;  1RKE A;  3NKD A;  1EA8 A;  3NMK A;  5AGF A;  2XXA B;  2HZ8 A;  2XS8 A;  3NYM A;  3LS0 A;  4H4K C;  3KKB A;  3UMK A;  2EIM C;  5JUA A;  3DE8 A;  2EIL C;  1Q0M A;  3UMH A;  5KYX A;  4XPW A;  3K33 A;  3L8I A;  2YL7 A;  4Z9H A;  5EGY A;  1OCC C;  5DS4 A;  3L34 A;  3US6 A;  1VB5 A;  3SXM A;  4DOZ A;  1TWA A;  1A0B A;  1G4U S;  3JZ0 A;  1S7Z A;  2HJM A;  4LDK A;  4A2N B;  2IXN A;  4NTF A;  2YL0 A;  3K1I C;  2R7X A;  1M57 C;  2HJ3 A;  3S9O A;  3QMK A;  2Q9C A;  3M15 A;  4YL0 A;  4C7O B;  1SMY F;  3B71 A;  2XLM A;  3VYW A;  3A11 A;  3B29 A;  3EGX B;  3I5P A;  4MTO A;  4I3M A;  2WB7 A;  3GM3 A;  4MW8 A;  4P6I C;  2R03 A;  1AUE A;  1WTY A;  4DRI B;  2KQ9 A;  1YLM A;  3TUL A;  1BDJ B;  2P7V A;  3DZA A;  1Q0G A;  1JR8 A;  2WZL A;  3ITF A;  3MX3 A;  2BE5 F;  2XLD A;  3KYJ A;  1T5O A;  2GFH A;  1OXB A;  2PX0 A;  2R02 A;  4G78 A;  1H9G A;  2D4U A;  4MVS A;  3Q6M A;  3DKA A;  4ER9 A;  1G8X A;  3G50 A;  2F22 A;  3ZVR A;  1KNY A;  4W8K A;  4DVZ A;  2A6E F;  1A7D A;  1WWP A;  2Y39 A;  3K7D A;  3I4U A;  3T6G B;  3RH3 A;  3AGT A;  2HMZ A;  2XM4 A;  2JPU A;  2R7O A;  5DVW A;  5KYU A;  2XL6 A;  2LSE A;  1JRA A;  4K0D A;  1C17 M;  1D0X A;  1LI5 A;  2EIJ C;  3AJM A;  3G4Z A;  4MS2 A;  4NCQ A;  4QDL A;  1TKN A;  4U5H A;  1FNT c;  4K7B A;  3MBG A;  1BBH A;  1BR4 A;  3Q7G A;  1V74 B;  3AOU A;  1QKR A;  4XPX A;  3ASO C;  3C18 A;  4IAQ A;  2RSE B;  4ULV A;  2IBF A;  4U5G A;  3B0P A;  4GEH A;  5BQG A;  3SEO A;  3NYJ A;  5L0G A;  1FTS A;  4ZLD A;  4H54 A;  3EG9 A;  3WOD F;  4PFP A;  2NUP A;  4U5B E;  4Q4Z F;  3QVY A;  3EFO B;  5E33 A;  4B6I A;  1BZ4 A;  1L3P A;  1O87 A;  2PX3 A;  3C8G A;  2Y3D A;  2I8B A;  1VLT A;  2KYH A;  5KYY A;  2YHS A;  3PDM P;  5B1B C;  3ASN C;  1ZHX A;  1FAP B;  3GOD A;  4YL3 A;  1SYQ A;  2ZXP A;  3I5Q A;  1Q0K A;  5JVE A;  5A6J A;  3EQL F;  1LI7 A;  1QZX A;  2AU5 A;  1YYJ A;  3EH2 A;  5F28 E;  1BR1 A;  2NUP B;  3MFN A;  2L7A A;  4E17 A;  3EFO A;  3UR3 C;  3WG7 C;  4EUK B;  3C8G D;  2ZXR A;  3HNK A;  3LEO A;  1Y4C A;  2YLI A;  5KYW A;  1SZI A;  2WVN A;  4N06 A;  3FMS A;  2FGY A;  4IWB A;  4CJO A;  3Q6N A;  5L3V A;  1R4T A;  4MVO A;  4MVQ A;  4MVZ A;  4HEA J;  3ZDL A;  3EZH A;  3S90 A;  1XWJ A;  4AE4 B;  2XRH A;  1ORJ A;  4YT4 A;  3O10 A;  3VRC A;  1T6U A;  3JT1 A;  2P1A A;  2XLV A;  4O6M A;  5KYN A;  1WN0 A;  3JSE O;  3SXK A;  3VAY A;  5DS5 A;  4OIQ F;  3AG2 C;  4ZLC A;  3C62 A;  1D0Y A;  1CPQ A;  5AC5 A;  1CGO A;  1LIH A;  2B0J A;  2VAS A;  1TR2 A;  2WVQ A;  1K04 A;  2WZF A;  4ONS A;  3T4R A;  1QSP A;  1ORY A;  2YWA A;  2VCC A;  4RDA A;  2HV7 A;  1VMA A;  1CPR A;  4KNV A;  4KI2 A;  3SP1 A;  4CS8 A;  1MNE A;  3K66 A;  2R7V A;  3RF3 A;  2J7P D;  1C03 A;  3RW0 A;  2OJQ A;  4K1O A;  4LLE A;  2IXO A;  4J7T A;  1AEP A;  4KC9 A;  2JD3 A;  2NPU A;  2OKU A;  1GGQ A;  1CGN A;  1RXQ A;  4BEM J;  1OCO C;  2ZD9 A;  1Z3I X;  2HV6 A;  2D5R B;  1MND A;  3B0V C;  3LLI A;  2IM8 A;  1Z6A A;  1D0Z A;  4BPM A;  1PD1 A;  4U5E E;  1H6G A;  1YJG A;  4FAP B;  4MTF A;  4CSA A;  2A0U A;  1RJ9 B;  3EGD B;  1V4A A;  1NFN A;  1TWH A;  3KYI A;  4WAB A;  3IQ6 A;  5B3I A;  1ZHT A;  3O6X A;  5D91 A;  3U9J A;  1U6H A;  4CDA A;  5KYY B;  1D1A A;  1EI7 A;  2EPN A;  2QY9 A;  1ZU4 A;  3DJU B;  3NYL A;  3Q7L A;  4JE9 A;  1NU7 D;  2FFH A;  1HMD A;  1C02 A;  3HNI A;  5A6B D;  1YDI A;  2L6F A;  5KYX B;  2HUJ A;  4KNW A;  4C3D A;  3FVY A;  1E86 A;  2HS5 A;  1VTM P;  1OW8 A;  2XLO A;  3W4Y A;  2XLH A;  4PFO A;  3RIP A;  4NQF A;  3EHN A;  5FCL A;  3BRJ A;  4CIP A;  3O55 A;  2KNH A;  2L6H A;  1GQA A;  5L3Q A;  5L0J A;  4Q5S F;  3TJ5 A;  1G4W R;  2O9X A;  4C7O A;  2OQM A;  3CEX A;  5HSW A;  2OG2 A;  3OWT A;  4R32 A;  1RMV A;  2DYR C;  3LEV A;  5JSL A;  2BL2 A;  4GYT A;  3W2W A;  1MMG A;  4Z9I A;  4DRH B;  4J32 B;  1T6Q A;  5IY5 C;  3NRH A;  5JRA A;  1D1B A;  3CAX A;  3QW1 A;  3T6J A;  4EIY A;  3FDQ A;  2J9B A;  2VB6 A;  4HE8 D;  4IAO A;  4YN0 B;  2FAP B;  3W2V A;  3U8V A;  1LPE A;  1M2V A;  2A1D D;  2Z15 A;  2H8A A;  3PHF 2;  2LIG A;  3RVY A;  2ZPA A;  4W8P A;  4EBK A;  1Q0D A;  4N4W A;  2A69 F;  3V5X A;  2R7W A;  3ZQY A;  2W4B A;  3BEH A;  2MHR A;  2Q00 A;  4JW1 A;  1ST6 A;  3U8P A;  3NG1 A;  3TD7 A;  2R7Q A;  1DOW A;  4HFF B;  4MVM A;  4NC3 A;  4CS8 C;  3S84 A;  3U2M A;  1WOL A;  1L7C A;  1AVO B;  4JTD B;  4AL1 A;  2XL8 A;  2VC9 A;  1J8Y F;  4MND A;  3ZSU A;  2ICW G;  5D92 A;  1BR2 A;  3OA1 A;  4JRZ A;  3CZ6 A;  4PR9 A;  2HSQ A;  1FMW A;  3T6B A;  4CSA C;  5A69 A;  4I44 A;  2UUH A;  3LS1 A;  1YZA A;  5A6K A;  1OKK A;  3PMR A;  3X1O A;  4JJF A;  1KU2 A;  4QI0 A;  3L8J A;  2LCH A;  4CDY A;  2BC5 A;  4AK9 A;  2EPO A;  3H65 A;  4JCH A;  5T1D B;  1T9K A;  3ZG1 A;  1YVI A;  1E83 A;  1XZP A;  1O3U A;  3GM1 A;  2XLE A;  1EKY A;  1E2X A;  1TQG A;  1JPJ A;  1M56 C;  1WAS A;  4Q7C A;  1QLE C;  2VH3 A;  3DI5 A;  2Y3B A;  3NDB B;  2M4E A;  1MMD A;  2CYD A;  4BJ1 A;  1V55 C;  2G62 A;  4PJN A;  4HFK B;  4N6C A;  3MLG A;  1N1C A;  2M64 A;  1RKE B;  2Q9A A;  4U9D A;  1E85 A;  1OQC A;  4D4N A;  1HE9 A;  3LNM B;  3G4X A;  1QVX A;  4C3E A;  2HFI A;  1NZE A;  2OJE D;  4X0R A;  4CS9 A;  3PCV A;  1MMA A;  4MW3 A;  1U0B B;  4YWQ A;  4P9T A;  1ZW2 A;  1T6I A;  4EKW A;  2Q7R A;  5K0I A;  2W9Y A;  1W2W A;  3H2U A;  4G0H A;  3TJ6 A;  2AP3 A;  1A41 A;  3AG4 C;  3O39 A;  1KTM A;  3N2Z B;  4IAR A;  1H9T A;  2PP4 A;  1YA7 O;  2XM0 A;  3K6B A;  4JTA B;  4YT5 A;  1HMO A;  1ZHZ A;  3MYI A;  5JS5 A;  4RD9 A;  5E3C A;  1YZC A;  2YZS A;  2XLW A;  2WZG A;  3VM6 A;  4XEF A;  1OCR C;  3C8G B;  3QW0 A;  4E0H A;  3TOL A;  5HV9 A;  1TFO B;  4G7O F;  2XL4 A;  4O6Y A;  3TK0 A;  3DWW A;  2R7T A;  1OW7 A;  2J9W A;  4XQ1 A;  4IJJ A;  1WAT A;  3RYL A;  3SNH A;  3S0X A;  2NUT A;  1YAR O;  5L0I A;  1EQ1 A;  2R25 A;  5JT4 A;  4PJJ A;  1APC A;  2J0X A;  1V54 C;  2X51 A;  1FMV A;  4XTK A;  3S27 A;  3W8H A;  2DGJ A;  3F47 A;  2NSF A;  5L0F A;  4RBN A;  5DS6 A;  3FHD A;  4MQ9 F;  256B A;  4JVS A;  1ZYR F;  3NMJ A;  1FR0 A;  4LER A;  4OD5 A;  1MMN A; 
#chains in the Genus database with same CATH homology
 2LQG A;  5FZT A;  1L7C A;  1U89 A;  1ZVZ A;  1H6G A;  4E18 A;  5L0G A;  4DJ9 A;  3VF0 A;  1T01 A;  1TR2 A;  2B0H A;  1ZW3 A;  2X0C A;  4ONS A;  4EHP A;  1U6H A;  3T6G B;  2GDC A;  1RKE B;  1SYQ A;  5L0J A;  4PR9 A;  2HSQ A;  1YDI A;  5L0I A;  2L7A A;  4E17 A;  3H2V A;  5L0H A;  4P9T A;  1ZW2 A;  4W8P A;  3RF3 A;  5L0C A;  1QKR A;  1DOV A;  2GWW A;  3H2U A;  1RKC A;  4IGG A;  4K1O A;  3TJ6 A;  5L0F A;  1RKE A;  1ST6 A;  2IBF A;  3S90 A;  3ZDL A;  1XWJ A;  5L0D A;  3MYI A;  3TJ5 A;  1DOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...