4O79A

Crystal structure of ascorbate-bound cytochrome b561, crystal soaked in 1 m l-ascorbate for 10 minutes
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
210
structure length
210
Chain Sequence
PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transmembrane ascorbate ferrireductase 2
publication title Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 92
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 7.2.1.3: Ascorbate ferrireductase (transmembrane).
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4o79A00
4O79A 4O6YA 4O7GA
chains in the Genus database with same CATH superfamily
3E9VA 3KPHA 4MW8A 1OW8A 2WZLA 3VM6A 3W8HA 2HMZA 2YRFA 3DM9B 4PJJA 4OIRF 3LLKA 2QNLA 3AOUA 3WG7C 3ZTZA 1EI7A 1NG1A 2HV7A 2PX3A 4PJLA 2CDQA 2XLOA 1J8YF 3TJ5A 4F4BA 4ZLDA 1LI7A 2YQYA 4CS7A 5BQHA 2R7WA 4Z9HA 2YWAA 4XPXA 3RKOF 4K0DA 1NLXA 1K04A 3B0PA 2YKZA 4YT5A 4G7ZF 3T4RA 5DS6A 1QSPA 2A6EF 2HSBA 3U9MA 4CIPA 1R5ID 1YAUO 1OKKD 2CYDA 2IXMA 3SXZA 3ZQYA 2CNWD 3EFOB 4MQ9F 4ONSA 1I4ZA 1WTYA 2L6GA 4MVOA 5GPGB 3I5QA 4E18A 4KNWA 2Y3DA 2IOQA 3H65A 4JIOA 5FZTA 2R02A 3EFOA 4I44A 5CI8A 5HV9A 3ABLC 3B0VC 3E70C 3U9JA 5T3WA 3S84A 1QPUA 4YJWA 3SP1A 1N1CA 2A6HF 5A6KA 3TULA 2GDCA 3DZAA 1ORSC 2MYSA 3AJMA 2CW0F 3EJNA 3HNJA 2OEVA 3K6BA 1OW7A 2ZXOA 2UUIA 1B68A 3EHMA 3GM2A 1WASA 1QLEC 4BPMA 4ANJA 2AU5A 3QVYA 2AVKA 4IAQA 2Q3TA 2PF4E 4LDRA 4FAPB 5T1DB 2VASA 2QUPA 2VCAA 1ZYRF 2NG1A 4J32B 2HJMA 2LK4A 3FMSA 1LS4A 4PACA 5COFA 5EK0A 1T6QA 3JCUQ 2XLEA 1YDIA 3LAYA 4AK9A 2KC3A 2DYRC 3DWWA 1TWGA 2EPOA 4MS2A 1YYXA 4PK4A 2OEXA 1AVOB 2A1DD 3DM5A 4FESA 2XLVA 4YT2A 3NYMA 2KGOA 2C04A 1V74B 2HUJA 3HTKC 3LLIA 1G4WR 1R4TA 2H8AA 2LFDA 1ZHYA 2IXNA 4MW3A 2G62A 2DGJA 1S7ZA 2Y3BA 4DRHB 2OG2A 2HS5A 4YT4A 5COGA 1TFKB 4R32A 1MQVA 2L7AA 2EPNA 4DVZA 2LCHA 3HKKA 3L0IA 4XLNF 2XM4A 3U8VA 4E7SA 1ZW2A 4NTAA 3O39A 1Y4CA 2KSFA 2R7XA 3A11A 3NMIA 2A0BA 2A68F 3W8IA 2FGYA 1Y6DA 3NRHA 4XEVA 1FNTc 1JOGA 4LLEA 4A2NB 3UNGC 4EUKB 3W2VA 4CSAA 1MMDA 3RIPA 1ZU5A 2OKUA 2Y39A 2HZ8A 2H7VC 1OCZC 2A69F 4CBEA 2XSEA 3M4CA 3N24A 5CIVA 1OQCA 3CSKA 3VYWA 4QI2A 3U3BA 4XWJA 1SR2A 3R7CA 4AL1A 2L6HA 4J30B 3ABKC 3C63A 3LNRA 4ULVA 4O6YA 5JLIA 5FCLA 2YL1A 2QE9A 4U9EA 4E0IA 5L0IA 1GS9A 3JZ0A 5E2QA 2J0XA 3IPMO 1YVIA 2XM0A 4WABA 2BC5A 2O9XA 2ASRA 3AG4C 1WWPA 4G78A 3JSZA 4BEJA 3M79A 1KTMA 3QZCA 2OQMA 3L8IA 3RQEA 1E85A 1L3PA 5L0HA 2J46A 3L1MA 4N4WA 4IJJA 5TJ5E 1ZHXA 4JTAB 3WAQA 3QVZA 4OD5A 4G0HA 1ORYA 4ZLCA 1W2WA 1LKXA 1NU9C 1YA7O 2ZXRA 2J8WA 3B29A 1D1AA 3Q6MA 4JEBA 3KYJA 2YEVA 3ZIBA 3FOPA 5L0CA 1LIHA 1WGWA 2D4UA 4I1MA 4ULWA 4MVRA 1VMAA 1GQAA 2EILC 4YK5A 4CS8C 1H6GA 3M1CB 1TR2A 3K1HA 4J7TA 3FAPB 1DOWA 2EIMC 2QY9A 1CGNA 1T01A 1VYIA 5KYXA 2J9VA 1YZCA 1TWHA 2OJED 3AQBA 3FOOA 2LQGA 2P0NA 4QI0A 1G4US 4E17A 4CX9A 4HE8D 3T6BA 3PMRA 4YWQA 1RKCA 2P6VA 1LE4A 1E2XA 4M63A 4D4XA 3K66A 3KYIA 3U5SA 3O10A 4IWBA 3LNMB 3NKEA 1HMDA 3C8GD 4CJGA 4DRJB 5JP7A 4JKVA 1VOMA 2IBFA 3LESA 4BG0A 3K1IA 3MYIA 1FFTC 3DAFA 1IW7F 1HY5A 3CQZA 1Q0DA 1U89A 3PCVA 3MYFA 3M15A 4BJ5A 4JC7A 3AG3C 4NTFA 1EKYA 1MMGA 2LSEA 4HEAJ 2PX0A 4A4AA 1VB5A 3ZVRA 3SXMA 3F47A 3OA1A 4DRIB 2J9UA 4PJMA 1V54C 2YL0A 3U2MA 2OJQA 4AE4B 5BQIA 1HMOA 3QW0A 1PCXA 3CZ6A 1GM5A 1VTMP 1U6HA 4DJ9A 3MLGA 1M2OA 2GAQA 3GODA 2YLGA 1OKKA 4XEKA 2P61A 4AE4A 3EZIA 1T6IA 2CNWA 1XZQA 3C7JA 1J8MF 3CAXA 5B1AC 2H7OA 1AEPA 4AL0A 1ST6A 5L0DA 1CGME 5A69A 4O6MA 1AUEA 2KYHA 2J0WA 4I1OB 4C3DA 1QKRA 2PP4A 2Q00A 1Q0GA 1CGOA 5A6BA 3RQFA 4LDQA 3H2VA 5L3QA 1E86A 3G4ZA 2DB4A 1HE1A 1A7EA 3GEIA 3GEHA 4N06A 3IQ6A 4JEAA 3O55A 1VLSA 2GFHA 3IQTA 4B6IA 4MVSA 2ZPAA 2JD3A 3GEEA 2R03A 1A7VA 4WGYA 2IXOA 4JURI 2HV6A 3FHDA 3HNIA 1ZVZA 3T9OA 2GWWA 2XLHA 3C62A 3F46A 2YLDA 3T6GB 4JJFA 5JVEA 1YARO 1M6TA 1UFBA 1ZHWA 5BQGA 1JPJA 3EGXB 1NBBA 1D0YA 3WODF 3TD7A 2HMQA 3RVZA 3B71A 3EGXA 1JPNA 3IHUA 1C17M 2VCBA 3JYYA 2R7QA 3PHF2 3AG2C 4LERA 3SYNA 3GORA 3UMKA 1E84A 1BR1A 2Q9AA 4FWVA 1FMVA 4L6RA 4O6NA 5A6JA 5JSLA 1H7IA 2EIJC 3DAGA 2ZD9A 4O79A 4JJGA 4DOZA 2Z15A 3JYHA 3HLZA 2EPLX 2XL8A 1JAFA 4BJ6C 4BJ1A 2KQ9A 3KKBA 1Z6AA 2VB6A 2VH3A 2ZXPA 3S90A 2ICWG 2VCCA 5L3VA 5L0GA 3W2WA 3ECSA 4KNVA 3TJ6A 1ZU4A 3LS1A 4DBRA 1BR4A 3DXJF 3R2PA 1TFOB 4Z9JA 4LLCA 2R7UA 5DQTA 4GEHA 2AP3A 3SXYA 4AX2A 3S29A 1LS1A 1ZW3A 4JRZA 3GM3A 3Q6NA 4U5FE 4Q4ZF 5F28E 4PFOA 2NUTB 1E83A 4C7OB 3GANA 3ZSUA 3U3FA 4CDAA 1SYQA 2WZFA 2IXPA 3I4UA 2NUTA 3RVYA 2CCYA 4C7OA 1LE2A 1RCPA 1Z3IX 4CS9A 2NUPB 3A9CA 3RW0A 2QLAA 2R7TA 3EG9B 3IEEA 3ZC4A 4EBBA 1XZPA 1MNEA 1NU7D 4XTKA 2NUPA 1ORJA 3EG9A 1PV3A 3UR3C 2GA0A 2NSGA 2Q4FA 5JT4A 4RD9A 3TOMA 3V7OA 3DE8A 3G50A 2OCCC 1I4YA 3K33A 1OCRC 4WGZA 2NSFA 1QZXA 4YN0B 4MNDA 2AWCA 4DBQA 1TWCA 2MWQA 3TOLA 2R25A 3NG1A 3MBGA 1FMWA 1MNDA 1TQGA 1VYKA 3L8JA 4JCHA 4NTBA 1T5OA 4UDVA 4K7BA 1DOVA 3HNLA 5DS4A 1T9KA 1MMAA 2M64A 2WVQA 1KU2A 1LI5A 1EQ1A 1HW2A 2L81A 3KL4A 2J7PD 1BR2A 2Q9CA 5DVWA 4FX5A 1HW1A 1C02A 2P1AA 3GM1A 4MVZA 2X0CA 2R7SA 4P6IC 3C8GB 3UMIA 1T6UA 2MHRA 2XLWA 3QTHA 1SF8A 2XRHA 3FVYA 3U8PA 1K40A 2DYSC 1D1BA 3C8GA 3EGDB 1Z7Qc 3RF3A 5JUAA 2KK1A 3QW1A 1IZMA 2XLMA 3EGDA 1OXBA 5E3AA 3T6JA 2OU6A 3L34A 3NMJA 2XS1A 4U9DA 1H9TA 4OD4A 4NQFA 2C03A 4LDKA 4MTOA 1RMVA 4U5DE 4YL3A 4EIYA 2YVKA 1NFNA 2D5RB 2ZXWC 4GYTA 1HE9A 1OCCC 1WN0A 4KC9A 4Z9IA 4U5BE 4XPWA 2WZGA 1FR0A 3WHNA 1G5ZA 1K05A 3JRMO 5E33A 5F5HA 1D1CA 2R7OA 1GGQA 4U5CE 2Y3GA 2XL6A 5L0FA 2XXAB 5K0IA 5BUOA 1Z63A 4U5GA 4MVMA 1M57C 3C18A 2Q7RA 2KW3C 1LM3B 3KMIA 3RYLA 1OXKA 2RD9A 2FFHA 4LACB 1M2VB 3H2UA 1NZEA 1FFHA 4KBLA 4W8PA 2HSQA 1S05A 4CJOA 3SXKA 4N6HA 4K1OA 1M2VA 2B0HA 3AGTA 1VK5A 3OEOA 4JCZA 1Z23A 4Q5SF 2M4EA 4YL1A 3ITFA 1O5HA 4D4NA 4CS8A 3G4XA 3X1OA 2EINC 2Q9BA 4MVQA 5F5FA 3JT1A 4H54A 4IRUA 1JR8A 3LEOA 5AGFA 4BEMJ 2BE5F 1CPQA 3ZQVA 1BDJB 4C3BA 4DXWA 4XEFA 1YA9A 2LFFA 2JX0A 2YHSA 2I8BA 3GWNA 3ZDLA 2YZSA 4P9FA 1PD0A 4J7YA 4N6CA 2LD6A 1Z5ZA 5D92A 1U0BB 4G7OF 1SZIA 1Q0FA 2V26A 3NYLA 4IB4A 3US6A 4WJ0A 4IGGA 1V4AA 5B1BC 2E87A 1A0BA 3X2QC 2R9RB 2YLIA 3B9QA 3EZHA 1F1MA 2CGEA 2XS8A 3EH1A 4JE9A 4PR9A 1CPRA 1UG7A 1O87A 1MMNA 1PD1A 4MTGA 1A7DA 1ZZPA 2W45A 3FXHA 3V5YA 3POVA 3NDBB 5KYUB 3HNKA 3ZG1A 3LS0A 4CSAC 2R05A 3Q7GA 1O3UA 2R7RA 3RH3A 3MFNA 2HJ3A 4XQ1A 2BL2A 5KYUA 3UGPA 2RSEB 3JRTA 2KNHA 5KYWB 4DVYP 3V5XA 3LEVA 3IQ5A 4CS9C 1LPEA 256BA 2IM8A 1JMWA 3QMKA 3LUTB 4O7GA 5KYWA 4G7HF 3VAYA 1YLMA 5EGYA 3GWLA 1OCOC 4NC3A 2YL3A 3S28A 2PFDA 3ASNC 2XLDA 1RKEB 2WB7A 3EH2A 3N0TA 4PJNA 2R7VA 3AGUA 3BEHA 1XWJA 4RDAA 3TQOA 1QQ3A 5D91A 3VRCA 1I5NA 1RKEA 1NSGB 2J45A 1LVKA 4X0RA 3MX3A 3OWTA 2DI3A 2W4BA 4RBNA 3UMHA 1RXQA 4JTDB 5EHHA 2Y3HA 2L6FA 3EQLF 3FAJA 3ZTMA 4HFKB 3PDMP 3DE9A 2AWYA 2WVOA 4YL0A 3NYJA 4IARA 2B0JA 1RJ9B 1YYJA 3EHNA 1KNYA 4JW1A 4OIPF 3K7DA 5E3CA 2J9BA 2G3KA 4MVUA 2I15A 3UGOA 4EKWA 4CDYA 1RJ9A 1TKNA 1EA8A 3AG1C 1WOLA 3W4YA 5HSWA 3DI5A 3ZWIA 5KYNA 1Q0KA 3N2ZB 2IYLD 3RQGA 4JTCB 2NPUA 4ER9A 1H9GA 2F22A 1C03A 2A0UA 2UUHA 3M4BA 1BZ4A 1D0XA 4NCQA 2YL7A 4JZAA 3BRJA 2QTVA 4U5HA 4YT8A 5L0JA 2TMVP 5JS5A 5DLJA 4XPYA 4OIOF 3DJNB 1APCA 5B3SC 3Q7LA 3CEXA 2PBEA 2X51A 1VLTA 5DQZA 2J7PA 4KI2A 5AC5A 2LP4A 3K1IC 4E7ZA 1V55C 5AC4A 1L7CA 3VF0A 4IAOA 2V3CC 1A41A 3V5ZA 1OW6A 4BJ5C 1SMYF 2EPMX 1FAPB 4BJ6A 1YZAA 3S9OA 5KYYB 3ABMC 5DS5A 2HFIA 2WL8A 3AQCA 3SZRA 3LJBA 3IQCA 5A6AA 5KYYA 2G3VA 3B0UX 3NKDA 2W4MA 3O6XA 1OR2A 3SEOA 5A6BD 4EBKA 1BBHA 4OIQF 2P7VA 3EPVA 4QDLA 5IY5C 4U5EE 3S0XA 4EHPA 3TK0A 4JVSA 1QVXA 2VC9A 4XLPF 1OR3A 2OOCA 2L9JA 3U0CA 4W8KA 2EIKC 2J9WA 3ATPA 3JTLO 4OINF 2H7BA 5JRAA 5KYXB 4E0HA 3JSEO 4CDVA 3FDQA 3DKAA 2EPKX 2JPUA 2HKVA 3RFYA 5COMA 4C3EA 3SNHA 4MTFA 1D0ZA 1WATA 1M56C 2PNOA 1Q0MA 2WVNA 3HJCA 3DJUB 4P9TA 4PFPA 5T3TA 5B3IA 3ASOC 1FTSA 3NMKA 4H4KC 1JRAA 1TWAA 3KH2A 4NY3A 3C8ZA 3U2LA 4HFFB 2ETSA 4BJTA 3I5PA 4Q7CA 5CI9A 2Y69C 3J06A 2LIGA 2XL4A 2XXAA 4EWCA 2W9YA 4GQHA 4CIHA 1NFOA 1ZHTA 1ZHZA 2KJGA 3DD7A 4I3MA 3S27A 2FAPB 1G8XA 4EBJA 3DMDA 1YJGA
chains in the Genus database with same CATH topology
3E9VA 2WZLA 3W8HA 3DM9B 4OIRF 4PJJA 3LLKA 3WG7C 1NG1A 2HV7A 2PX3A 4PJLA 2CDQA 1J8YF 4F4BA 4ZLDA 2R7WA 3RKOF 4K0DA 3B0PA 4YT5A 4G7ZF 3T4RA 5DS6A 2A6EF 1OKKD 2IXMA 2CNWD 3EFOB 4MQ9F 3I5QA 4KNWA 2Y3DA 2IOQA 3H65A 3EFOA 4I44A 5CI8A 3ABLC 3B0VC 3E70C 5T3WA 4YJWA 3SP1A 1N1CA 2A6HF 3DZAA 3EJNA 2MYSA 3K6BA 2CW0F 2ZXOA 3EHMA 4ANJA 1QLEC 2Q3TA 2PF4E 5T1DB 2VASA 1ZYRF 2NG1A 4J32B 3JCUQ 3LAYA 4AK9A 2DYRC 1TWGA 4PK4A 4YT2A 2A1DD 3DM5A 4FESA 3NYMA 2KGOA 2C04A 3HTKC 3LLIA 1ZHYA 2IXNA 2G62A 2DGJA 1S7ZA 2Y3BA 2OG2A 4YT4A 4DVZA 4XLNF 3L0IA 4E7SA 3O39A 2R7XA 2A68F 3W8IA 2FGYA 3NRHA 4LLEA 4A2NB 3UNGC 3W2VA 4CSAA 1MMDA 3RIPA 1ZU5A 2Y39A 4CS7A 2H7VC 1OCZC 2A69F 4CBEA 2XSEA 4QI2A 3N24A 3CSKA 3VYWA 4XWJA 4J30B 3ABKC 3LNRA 4O6YA 5FCLA 5E2QA 2J0XA 2O9XA 3AG4C 3JSZA 3QZCA 2J46A 4IJJA 1ZHXA 4OD5A 4G0HA 4ZLCA 1W2WA 1LKXA 1NU9C 2ZXRA 3ZIBA 3Q6MA 1D1AA 2YEVA 1WGWA 4I1MA 4ULWA 1VMAA 2EILC 4CS8C 3M1CB 1TR2A 3K1HA 2EIMC 2QY9A 1VYIA 5KYXA 2J9VA 1TWHA 3AQBA 4QI0A 4HE8D 3T6BA 3PMRA 4YWQA 2P6VA 4M63A 3K66A 4IWBA 3NKEA 1VOMA 3LESA 4BG0A 1FFTC 3DAFA 1IW7F 3CQZA 4BJ5A 3AG3C 1MMGA 2LSEA 4HEAJ 2PX0A 3ZVRA 3F47A 3OA1A 2J9UA 4PJMA 1V54C 4AE4B 1PCXA 3CZ6A 3MLGA 1M2OA 3GODA 1OKKA 4AE4A 3EZIA 2CNWA 1J8MF 5B1AC 2H7OA 1ST6A 4O6MA 2J0WA 4I1OB 4C3DA 2PP4A 5L3QA 4N06A 2GFHA 4B6IA 2ZPAA 2JD3A 2IXOA 4JURI 2HV6A 3FHDA 3F46A 4JJFA 1ZHWA 1JPJA 3EGXB 1D0YA 3WODF 3TD7A 3EGXA 1JPNA 2R7QA 3PHF2 3AG2C 4LERA 3SYNA 3UMKA 1BR1A 2Q9AA 4FWVA 1FMVA 4O6NA 2EIJC 3DAGA 4O79A 4JJGA 4DOZA 2Z15A 3JYHA 3HLZA 4BJ6C 4BJ1A 2KQ9A 3KKBA 1Z6AA 2VB6A 2VH3A 2ZXPA 5L3VA 3W2WA 3ECSA 4KNVA 4DBRA 1ZU4A 3LS1A 1BR4A 3DXJF 4LLCA 2R7UA 5DQTA 4GEHA 4AX2A 3S29A 1LS1A 3Q6NA 4Q4ZF 4PFOA 2NUTB 4C7OB 3GANA 3ZSUA 2WZFA 2IXPA 3I4UA 2NUTA 4C7OA 1Z3IX 4CS9A 2NUPB 2R7TA 3EG9B 3IEEA 3ZC4A 4EBBA 1MNEA 1NU7D 4XTKA 2NUPA 3EG9A 3UR3C 4RD9A 3V7OA 2OCCC 3K33A 1OCRC 1QZXA 4YN0B 4MNDA 4DBQA 1TWCA 2MWQA 3NG1A 4JCHA 1FMWA 1MNDA 1VYKA 4K7BA 5DS4A 1MMAA 2WVQA 1KU2A 2L81A 3KL4A 2J7PD 1BR2A 2Q9CA 5DVWA 4FX5A 2R7SA 4P6IC 3UMIA 1SF8A 2XRHA 3FVYA 2DYSC 1D1BA 3EGDB 1IZMA 3EGDA 5E3AA 3T6JA 3L34A 4OD4A 2C03A 4U5DE 2D5RB 2ZXWC 4GYTA 4KC9A 1OCCC 4U5BE 2WZGA 5E33A 5F5HA 1D1CA 2R7OA 4U5CE 2Y3GA 2XXAB 5BUOA 1Z63A 4U5GA 1M57C 4BEJA 2KW3C 3RYLA 3KMIA 2FFHA 4LACB 1M2VB 1NZEA 1FFHA 4KBLA 1M2VA 1VK5A 3OEOA 4Q5SF 1Z23A 2M4EA 3ITFA 1O5HA 4CS8A 3X1OA 2EINC 2Q9BA 5F5FA 3JT1A 4IRUA 2BE5F 4C3BA 2YHSA 2I8BA 2YZSA 1PD0A 5D92A 1Z5ZA 4G7OF 1SZIA 2V26A 3NYLA 4WJ0A 5B1BC 2E87A 3X2QC 3B9QA 3EZHA 2CGEA 3EH1A 1O87A 1MMNA 1PD1A 2W45A 3POVA 3NDBB 5KYUB 3ZG1A 3LS0A 4CSAC 3Q7GA 2R7RA 3RH3A 5KYUA 3UGPA 3JRTA 2KNHA 5KYWB 4DVYP 3LEVA 4CS9C 5KYWA 3QMKA 4O7GA 4G7HF 3VAYA 5EGYA 1OCOC 3S28A 2PFDA 3ASNC 2WB7A 3EH2A 3N0TA 4PJNA 2R7VA 4RDAA 5D91A 2J45A 1LVKA 4X0RA 3MX3A 3OWTA 2W4BA 4RBNA 3UMHA 5EHHA 2Y3HA 3EQLF 3FAJA 4HFKB 2WVOA 3NYJA 2B0JA 1RJ9B 4JW1A 3EHNA 4OIPF 3K7DA 5E3CA 2G3KA 3UGOA 1RJ9A 1TKNA 5HSWA 3AG1C 5KYNA 3N2ZB 2IYLD 4U5FE 1D0XA 4JZAA 4U5HA 2QTVA 4YT8A 5DLJA 4OIOF 3DJNB 5B3SC 3Q7LA 2X51A 5DQZA 2J7PA 4KI2A 3K1IC 4E7ZA 1V55C 4IAOA 2V3CC 4BJ5C 1SMYF 4BJ6A 5KYYB 3ABMC 5DS5A 2WL8A 3AQCA 3SZRA 3LJBA 5KYYA 2G3VA 3B0UX 3NKDA 2W4MA 3O6XA 3SEOA 4OIQF 2P7VA 3EPVA 4QDLA 5IY5C 4U5EE 3S0XA 4JVSA 4XLPF 2L9JA 4W8KA 2EIKC 2J9WA 4OINF 2H7BA 5KYXB 3FDQA 3RFYA 4C3EA 3SNHA 1D0ZA 1M56C 3HJCA 2WVNA 5T3TA 4PFPA 3DJUB 3ASOC 1FTSA 4H4KC 1TWAA 3KH2A 4NY3A 4HFFB 4BJTA 3I5PA 4Q7CA 5CI9A 2Y69C 2XL4A 2XXAA 4EWCA 2W9YA 4CIHA 1ZHTA 1ZHZA 2KJGA 3DD7A 4I3MA 3S27A 1G8XA 3DMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O79 A;  4O6Y A;  4O7G A; 
#chains in the Genus database with same CATH topology
 3E9V A;  3KPH A;  4MW8 A;  1OW8 A;  2WZL A;  3VM6 A;  3W8H A;  2HMZ A;  2YRF A;  3DM9 B;  4PJJ A;  4OIR F;  3LLK A;  2QNL A;  3AOU A;  3WG7 C;  3ZTZ A;  1EI7 A;  1NG1 A;  2HV7 A;  2PX3 A;  4PJL A;  2CDQ A;  2XLO A;  1J8Y F;  3TJ5 A;  4F4B A;  4ZLD A;  1LI7 A;  2YQY A;  4CS7 A;  5BQH A;  2R7W A;  4Z9H A;  2YWA A;  4XPX A;  3RKO F;  4K0D A;  1NLX A;  1K04 A;  3B0P A;  2YKZ A;  4YT5 A;  4G7Z F;  3T4R A;  5DS6 A;  1QSP A;  2A6E F;  2HSB A;  3U9M A;  4CIP A;  1R5I D;  1YAU O;  1OKK D;  2CYD A;  2IXM A;  3SXZ A;  3ZQY A;  2CNW D;  3EFO B;  4MQ9 F;  4ONS A;  1I4Z A;  1WTY A;  2L6G A;  4MVO A;  5GPG B;  3I5Q A;  4E18 A;  4KNW A;  2Y3D A;  2IOQ A;  3H65 A;  4JIO A;  5FZT A;  2R02 A;  3EFO A;  4I44 A;  5CI8 A;  5HV9 A;  3ABL C;  3B0V C;  3E70 C;  3U9J A;  5T3W A;  3S84 A;  1QPU A;  4YJW A;  3SP1 A;  1N1C A;  2A6H F;  5A6K A;  3TUL A;  2GDC A;  3DZA A;  1ORS C;  2MYS A;  3AJM A;  2CW0 F;  3EJN A;  3HNJ A;  2OEV A;  3K6B A;  1OW7 A;  2ZXO A;  2UUI A;  1B68 A;  3EHM A;  3GM2 A;  1WAS A;  1QLE C;  4BPM A;  4ANJ A;  2AU5 A;  3QVY A;  2AVK A;  4IAQ A;  2Q3T A;  2PF4 E;  4LDR A;  4FAP B;  5T1D B;  2VAS A;  2QUP A;  2VCA A;  1ZYR F;  2NG1 A;  4J32 B;  2HJM A;  2LK4 A;  3FMS A;  1LS4 A;  4PAC A;  5COF A;  5EK0 A;  1T6Q A;  3JCU Q;  2XLE A;  1YDI A;  3LAY A;  4AK9 A;  2KC3 A;  2DYR C;  3DWW A;  1TWG A;  2EPO A;  4MS2 A;  1YYX A;  4PK4 A;  2OEX A;  1AVO B;  2A1D D;  3DM5 A;  4FES A;  2XLV A;  4YT2 A;  3NYM A;  2KGO A;  2C04 A;  1V74 B;  2HUJ A;  3HTK C;  3LLI A;  1G4W R;  1R4T A;  2H8A A;  2LFD A;  1ZHY A;  2IXN A;  4MW3 A;  2G62 A;  2DGJ A;  1S7Z A;  2Y3B A;  4DRH B;  2OG2 A;  2HS5 A;  4YT4 A;  5COG A;  1TFK B;  4R32 A;  1MQV A;  2L7A A;  2EPN A;  4DVZ A;  2LCH A;  3HKK A;  3L0I A;  4XLN F;  2XM4 A;  3U8V A;  4E7S A;  1ZW2 A;  4NTA A;  3O39 A;  1Y4C A;  2KSF A;  2R7X A;  3A11 A;  3NMI A;  2A0B A;  2A68 F;  3W8I A;  2FGY A;  1Y6D A;  3NRH A;  4XEV A;  1FNT c;  1JOG A;  4LLE A;  4A2N B;  3UNG C;  4EUK B;  3W2V A;  4CSA A;  1MMD A;  3RIP A;  1ZU5 A;  2OKU A;  2Y39 A;  2HZ8 A;  2H7V C;  1OCZ C;  2A69 F;  4CBE A;  2XSE A;  3M4C A;  3N24 A;  5CIV A;  1OQC A;  3CSK A;  3VYW A;  4QI2 A;  3U3B A;  4XWJ A;  1SR2 A;  3R7C A;  4AL1 A;  2L6H A;  4J30 B;  3ABK C;  3C63 A;  3LNR A;  4ULV A;  4O6Y A;  5JLI A;  5FCL A;  2YL1 A;  2QE9 A;  4U9E A;  4E0I A;  5L0I A;  1GS9 A;  3JZ0 A;  5E2Q A;  2J0X A;  3IPM O;  1YVI A;  2XM0 A;  4WAB A;  2BC5 A;  2O9X A;  2ASR A;  3AG4 C;  1WWP A;  4G78 A;  3JSZ A;  4BEJ A;  3M79 A;  1KTM A;  3QZC A;  2OQM A;  3L8I A;  3RQE A;  1E85 A;  1L3P A;  5L0H A;  2J46 A;  3L1M A;  4N4W A;  4IJJ A;  5TJ5 E;  1ZHX A;  4JTA B;  3WAQ A;  3QVZ A;  4OD5 A;  4G0H A;  1ORY A;  4ZLC A;  1W2W A;  1LKX A;  1NU9 C;  1YA7 O;  2ZXR A;  2J8W A;  3B29 A;  1D1A A;  3Q6M A;  4JEB A;  3KYJ A;  2YEV A;  3ZIB A;  3FOP A;  5L0C A;  1LIH A;  1WGW A;  2D4U A;  4I1M A;  4ULW A;  4MVR A;  1VMA A;  1GQA A;  2EIL C;  4YK5 A;  4CS8 C;  1H6G A;  3M1C B;  1TR2 A;  3K1H A;  4J7T A;  3FAP B;  1DOW A;  2EIM C;  2QY9 A;  1CGN A;  1T01 A;  1VYI A;  5KYX A;  2J9V A;  1YZC A;  1TWH A;  2OJE D;  3AQB A;  3FOO A;  2LQG A;  2P0N A;  4QI0 A;  1G4U S;  4E17 A;  4CX9 A;  4HE8 D;  3T6B A;  3PMR A;  4YWQ A;  1RKC A;  2P6V A;  1LE4 A;  1E2X A;  4M63 A;  4D4X A;  3K66 A;  3KYI A;  3U5S A;  3O10 A;  4IWB A;  3LNM B;  3NKE A;  1HMD A;  3C8G D;  4CJG A;  4DRJ B;  5JP7 A;  4JKV A;  1VOM A;  2IBF A;  3LES A;  4BG0 A;  3K1I A;  3MYI A;  1FFT C;  3DAF A;  1IW7 F;  1HY5 A;  3CQZ A;  1Q0D A;  1U89 A;  3PCV A;  3MYF A;  3M15 A;  4BJ5 A;  4JC7 A;  3AG3 C;  4NTF A;  1EKY A;  1MMG A;  2LSE A;  4HEA J;  2PX0 A;  4A4A A;  1VB5 A;  3ZVR A;  3SXM A;  3F47 A;  3OA1 A;  4DRI B;  2J9U A;  4PJM A;  1V54 C;  2YL0 A;  3U2M A;  2OJQ A;  4AE4 B;  5BQI A;  1HMO A;  3QW0 A;  1PCX A;  3CZ6 A;  1GM5 A;  1VTM P;  1U6H A;  4DJ9 A;  3MLG A;  1M2O A;  2GAQ A;  3GOD A;  2YLG A;  1OKK A;  4XEK A;  2P61 A;  4AE4 A;  3EZI A;  1T6I A;  2CNW A;  1XZQ A;  3C7J A;  1J8M F;  3CAX A;  5B1A C;  2H7O A;  1AEP A;  4AL0 A;  1ST6 A;  5L0D A;  1CGM E;  5A69 A;  4O6M A;  1AUE A;  2KYH A;  2J0W A;  4I1O B;  4C3D A;  1QKR A;  2PP4 A;  2Q00 A;  1Q0G A;  1CGO A;  5A6B A;  3RQF A;  4LDQ A;  3H2V A;  5L3Q A;  1E86 A;  3G4Z A;  2DB4 A;  1HE1 A;  1A7E A;  3GEI A;  3GEH A;  4N06 A;  3IQ6 A;  4JEA A;  3O55 A;  1VLS A;  2GFH A;  3IQT A;  4B6I A;  4MVS A;  2ZPA A;  2JD3 A;  3GEE A;  2R03 A;  1A7V A;  4WGY A;  2IXO A;  4JUR I;  2HV6 A;  3FHD A;  3HNI A;  1ZVZ A;  3T9O A;  2GWW A;  2XLH A;  3C62 A;  3F46 A;  2YLD A;  3T6G B;  4JJF A;  5JVE A;  1YAR O;  1M6T A;  1UFB A;  1ZHW A;  5BQG A;  1JPJ A;  3EGX B;  1NBB A;  1D0Y A;  3WOD F;  3TD7 A;  2HMQ A;  3RVZ A;  3B71 A;  3EGX A;  1JPN A;  3IHU A;  1C17 M;  2VCB A;  3JYY A;  2R7Q A;  3PHF 2;  3AG2 C;  4LER A;  3SYN A;  3GOR A;  3UMK A;  1E84 A;  1BR1 A;  2Q9A A;  4FWV A;  1FMV A;  4L6R A;  4O6N A;  5A6J A;  5JSL A;  1H7I A;  2EIJ C;  3DAG A;  2ZD9 A;  4O79 A;  4JJG A;  4DOZ A;  2Z15 A;  3JYH A;  3HLZ A;  2EPL X;  2XL8 A;  1JAF A;  4BJ6 C;  4BJ1 A;  2KQ9 A;  3KKB A;  1Z6A A;  2VB6 A;  2VH3 A;  2ZXP A;  3S90 A;  2ICW G;  2VCC A;  5L3V A;  5L0G A;  3W2W A;  3ECS A;  4KNV A;  3TJ6 A;  1ZU4 A;  3LS1 A;  4DBR A;  1BR4 A;  3DXJ F;  3R2P A;  1TFO B;  4Z9J A;  4LLC A;  2R7U A;  5DQT A;  4GEH A;  2AP3 A;  3SXY A;  4AX2 A;  3S29 A;  1LS1 A;  1ZW3 A;  4JRZ A;  3GM3 A;  3Q6N A;  4U5F E;  4Q4Z F;  5F28 E;  4PFO A;  2NUT B;  1E83 A;  4C7O B;  3GAN A;  3ZSU A;  3U3F A;  4CDA A;  1SYQ A;  2WZF A;  2IXP A;  3I4U A;  2NUT A;  3RVY A;  2CCY A;  4C7O A;  1LE2 A;  1RCP A;  1Z3I X;  4CS9 A;  2NUP B;  3A9C A;  3RW0 A;  2QLA A;  2R7T A;  3EG9 B;  3IEE A;  3ZC4 A;  4EBB A;  1XZP A;  1MNE A;  1NU7 D;  4XTK A;  2NUP A;  1ORJ A;  3EG9 A;  1PV3 A;  3UR3 C;  2GA0 A;  2NSG A;  2Q4F A;  5JT4 A;  4RD9 A;  3TOM A;  3V7O A;  3DE8 A;  3G50 A;  2OCC C;  1I4Y A;  3K33 A;  1OCR C;  4WGZ A;  2NSF A;  1QZX A;  4YN0 B;  4MND A;  2AWC A;  4DBQ A;  1TWC A;  2MWQ A;  3TOL A;  2R25 A;  3NG1 A;  3MBG A;  1FMW A;  1MND A;  1TQG A;  1VYK A;  3L8J A;  4JCH A;  4NTB A;  1T5O A;  4UDV A;  4K7B A;  1DOV A;  3HNL A;  5DS4 A;  1T9K A;  1MMA A;  2M64 A;  2WVQ A;  1KU2 A;  1LI5 A;  1EQ1 A;  1HW2 A;  2L81 A;  3KL4 A;  2J7P D;  1BR2 A;  2Q9C A;  5DVW A;  4FX5 A;  1HW1 A;  1C02 A;  2P1A A;  3GM1 A;  4MVZ A;  2X0C A;  2R7S A;  4P6I C;  3C8G B;  3UMI A;  1T6U A;  2MHR A;  2XLW A;  3QTH A;  1SF8 A;  2XRH A;  3FVY A;  3U8P A;  1K40 A;  2DYS C;  1D1B A;  3C8G A;  3EGD B;  1Z7Q c;  3RF3 A;  5JUA A;  2KK1 A;  3QW1 A;  1IZM A;  2XLM A;  3EGD A;  1OXB A;  5E3A A;  3T6J A;  2OU6 A;  3L34 A;  3NMJ A;  2XS1 A;  4U9D A;  1H9T A;  4OD4 A;  4NQF A;  2C03 A;  4LDK A;  4MTO A;  1RMV A;  4U5D E;  4YL3 A;  4EIY A;  2YVK A;  1NFN A;  2D5R B;  2ZXW C;  4GYT A;  1HE9 A;  1OCC C;  1WN0 A;  4KC9 A;  4Z9I A;  4U5B E;  4XPW A;  2WZG A;  1FR0 A;  3WHN A;  1G5Z A;  1K05 A;  3JRM O;  5E33 A;  5F5H A;  1D1C A;  2R7O A;  1GGQ A;  4U5C E;  2Y3G A;  2XL6 A;  5L0F A;  2XXA B;  5K0I A;  5BUO A;  1Z63 A;  4U5G A;  4MVM A;  1M57 C;  3C18 A;  2Q7R A;  2KW3 C;  1LM3 B;  3KMI A;  3RYL A;  1OXK A;  2RD9 A;  2FFH A;  4LAC B;  1M2V B;  3H2U A;  1NZE A;  1FFH A;  4KBL A;  4W8P A;  2HSQ A;  1S05 A;  4CJO A;  3SXK A;  4N6H A;  4K1O A;  1M2V A;  2B0H A;  3AGT A;  1VK5 A;  3OEO A;  4JCZ A;  1Z23 A;  4Q5S F;  2M4E A;  4YL1 A;  3ITF A;  1O5H A;  4D4N A;  4CS8 A;  3G4X A;  3X1O A;  2EIN C;  2Q9B A;  4MVQ A;  5F5F A;  3JT1 A;  4H54 A;  4IRU A;  1JR8 A;  3LEO A;  5AGF A;  4BEM J;  2BE5 F;  1CPQ A;  3ZQV A;  1BDJ B;  4C3B A;  4DXW A;  4XEF A;  1YA9 A;  2LFF A;  2JX0 A;  2YHS A;  2I8B A;  3GWN A;  3ZDL A;  2YZS A;  4P9F A;  1PD0 A;  4J7Y A;  4N6C A;  2LD6 A;  1Z5Z A;  5D92 A;  1U0B B;  4G7O F;  1SZI A;  1Q0F A;  2V26 A;  3NYL A;  4IB4 A;  3US6 A;  4WJ0 A;  4IGG A;  1V4A A;  5B1B C;  2E87 A;  1A0B A;  3X2Q C;  2R9R B;  2YLI A;  3B9Q A;  3EZH A;  1F1M A;  2CGE A;  2XS8 A;  3EH1 A;  4JE9 A;  4PR9 A;  1CPR A;  1UG7 A;  1O87 A;  1MMN A;  1PD1 A;  4MTG A;  1A7D A;  1ZZP A;  2W45 A;  3FXH A;  3V5Y A;  3POV A;  3NDB B;  5KYU B;  3HNK A;  3ZG1 A;  3LS0 A;  4CSA C;  2R05 A;  3Q7G A;  1O3U A;  2R7R A;  3RH3 A;  3MFN A;  2HJ3 A;  4XQ1 A;  2BL2 A;  5KYU A;  3UGP A;  2RSE B;  3JRT A;  2KNH A;  5KYW B;  4DVY P;  3V5X A;  3LEV A;  3IQ5 A;  4CS9 C;  1LPE A;  256B A;  2IM8 A;  1JMW A;  3QMK A;  3LUT B;  4O7G A;  5KYW A;  4G7H F;  3VAY A;  1YLM A;  5EGY A;  3GWL A;  1OCO C;  4NC3 A;  2YL3 A;  3S28 A;  2PFD A;  3ASN C;  2XLD A;  1RKE B;  2WB7 A;  3EH2 A;  3N0T A;  4PJN A;  2R7V A;  3AGU A;  3BEH A;  1XWJ A;  4RDA A;  3TQO A;  1QQ3 A;  5D91 A;  3VRC A;  1I5N A;  1RKE A;  1NSG B;  2J45 A;  1LVK A;  4X0R A;  3MX3 A;  3OWT A;  2DI3 A;  2W4B A;  4RBN A;  3UMH A;  1RXQ A;  4JTD B;  5EHH A;  2Y3H A;  2L6F A;  3EQL F;  3FAJ A;  3ZTM A;  4HFK B;  3PDM P;  3DE9 A;  2AWY A;  2WVO A;  4YL0 A;  3NYJ A;  4IAR A;  2B0J A;  1RJ9 B;  1YYJ A;  3EHN A;  1KNY A;  4JW1 A;  4OIP F;  3K7D A;  5E3C A;  2J9B A;  2G3K A;  4MVU A;  2I15 A;  3UGO A;  4EKW A;  4CDY A;  1RJ9 A;  1TKN A;  1EA8 A;  3AG1 C;  1WOL A;  3W4Y A;  5HSW A;  3DI5 A;  3ZWI A;  5KYN A;  1Q0K A;  3N2Z B;  2IYL D;  3RQG A;  4JTC B;  2NPU A;  4ER9 A;  1H9G A;  2F22 A;  1C03 A;  2A0U A;  2UUH A;  3M4B A;  1BZ4 A;  1D0X A;  4NCQ A;  2YL7 A;  4JZA A;  3BRJ A;  2QTV A;  4U5H A;  4YT8 A;  5L0J A;  2TMV P;  5JS5 A;  5DLJ A;  4XPY A;  4OIO F;  3DJN B;  1APC A;  5B3S C;  3Q7L A;  3CEX A;  2PBE A;  2X51 A;  1VLT A;  5DQZ A;  2J7P A;  4KI2 A;  5AC5 A;  2LP4 A;  3K1I C;  4E7Z A;  1V55 C;  5AC4 A;  1L7C A;  3VF0 A;  4IAO A;  2V3C C;  1A41 A;  3V5Z A;  1OW6 A;  4BJ5 C;  1SMY F;  2EPM X;  1FAP B;  4BJ6 A;  1YZA A;  3S9O A;  5KYY B;  3ABM C;  5DS5 A;  2HFI A;  2WL8 A;  3AQC A;  3SZR A;  3LJB A;  3IQC A;  5A6A A;  5KYY A;  2G3V A;  3B0U X;  3NKD A;  2W4M A;  3O6X A;  1OR2 A;  3SEO A;  5A6B D;  4EBK A;  1BBH A;  4OIQ F;  2P7V A;  3EPV A;  4QDL A;  5IY5 C;  4U5E E;  3S0X A;  4EHP A;  3TK0 A;  4JVS A;  1QVX A;  2VC9 A;  4XLP F;  1OR3 A;  2OOC A;  2L9J A;  3U0C A;  4W8K A;  2EIK C;  2J9W A;  3ATP A;  3JTL O;  4OIN F;  2H7B A;  5JRA A;  5KYX B;  4E0H A;  3JSE O;  4CDV A;  3FDQ A;  3DKA A;  2EPK X;  2JPU A;  2HKV A;  3RFY A;  5COM A;  4C3E A;  3SNH A;  4MTF A;  1D0Z A;  1WAT A;  1M56 C;  2PNO A;  1Q0M A;  2WVN A;  3HJC A;  3DJU B;  4P9T A;  4PFP A;  5T3T A;  5B3I A;  3ASO C;  1FTS A;  3NMK A;  4H4K C;  1JRA A;  1TWA A;  3KH2 A;  4NY3 A;  3C8Z A;  3U2L A;  4HFF B;  2ETS A;  4BJT A;  3I5P A;  4Q7C A;  5CI9 A;  2Y69 C;  3J06 A;  2LIG A;  2XL4 A;  2XXA A;  4EWC A;  2W9Y A;  4GQH A;  4CIH A;  1NFO A;  1ZHT A;  1ZHZ A;  2KJG A;  3DD7 A;  4I3M A;  3S27 A;  2FAP B;  1G8X A;  4EBJ A;  3DMD A;  1YJG A; 
#chains in the Genus database with same CATH homology
 3E9V A;  2WZL A;  3W8H A;  3DM9 B;  4OIR F;  4PJJ A;  3LLK A;  3WG7 C;  1NG1 A;  2HV7 A;  2PX3 A;  4PJL A;  2CDQ A;  1J8Y F;  4F4B A;  4ZLD A;  2R7W A;  3RKO F;  4K0D A;  3B0P A;  4YT5 A;  4G7Z F;  3T4R A;  5DS6 A;  2A6E F;  1OKK D;  2IXM A;  2CNW D;  3EFO B;  4MQ9 F;  3I5Q A;  4KNW A;  2Y3D A;  2IOQ A;  3H65 A;  3EFO A;  4I44 A;  5CI8 A;  3ABL C;  3B0V C;  3E70 C;  5T3W A;  4YJW A;  3SP1 A;  1N1C A;  2A6H F;  3DZA A;  3EJN A;  2MYS A;  3K6B A;  2CW0 F;  2ZXO A;  3EHM A;  4ANJ A;  1QLE C;  2Q3T A;  2PF4 E;  5T1D B;  2VAS A;  1ZYR F;  2NG1 A;  4J32 B;  3JCU Q;  3LAY A;  4AK9 A;  2DYR C;  1TWG A;  4PK4 A;  4YT2 A;  2A1D D;  3DM5 A;  4FES A;  3NYM A;  2KGO A;  2C04 A;  3HTK C;  3LLI A;  1ZHY A;  2IXN A;  2G62 A;  2DGJ A;  1S7Z A;  2Y3B A;  2OG2 A;  4YT4 A;  4DVZ A;  4XLN F;  3L0I A;  4E7S A;  3O39 A;  2R7X A;  2A68 F;  3W8I A;  2FGY A;  3NRH A;  4LLE A;  4A2N B;  3UNG C;  3W2V A;  4CSA A;  1MMD A;  3RIP A;  1ZU5 A;  2Y39 A;  4CS7 A;  2H7V C;  1OCZ C;  2A69 F;  4CBE A;  2XSE A;  4QI2 A;  3N24 A;  3CSK A;  3VYW A;  4XWJ A;  4J30 B;  3ABK C;  3LNR A;  4O6Y A;  5FCL A;  5E2Q A;  2J0X A;  2O9X A;  3AG4 C;  3JSZ A;  3QZC A;  2J46 A;  4IJJ A;  1ZHX A;  4OD5 A;  4G0H A;  4ZLC A;  1W2W A;  1LKX A;  1NU9 C;  2ZXR A;  3ZIB A;  3Q6M A;  1D1A A;  2YEV A;  1WGW A;  4I1M A;  4ULW A;  1VMA A;  2EIL C;  4CS8 C;  3M1C B;  1TR2 A;  3K1H A;  2EIM C;  2QY9 A;  1VYI A;  5KYX A;  2J9V A;  1TWH A;  3AQB A;  4QI0 A;  4HE8 D;  3T6B A;  3PMR A;  4YWQ A;  2P6V A;  4M63 A;  3K66 A;  4IWB A;  3NKE A;  1VOM A;  3LES A;  4BG0 A;  1FFT C;  3DAF A;  1IW7 F;  3CQZ A;  4BJ5 A;  3AG3 C;  1MMG A;  2LSE A;  4HEA J;  2PX0 A;  3ZVR A;  3F47 A;  3OA1 A;  2J9U A;  4PJM A;  1V54 C;  4AE4 B;  1PCX A;  3CZ6 A;  3MLG A;  1M2O A;  3GOD A;  1OKK A;  4AE4 A;  3EZI A;  2CNW A;  1J8M F;  5B1A C;  2H7O A;  1ST6 A;  4O6M A;  2J0W A;  4I1O B;  4C3D A;  2PP4 A;  5L3Q A;  4N06 A;  2GFH A;  4B6I A;  2ZPA A;  2JD3 A;  2IXO A;  4JUR I;  2HV6 A;  3FHD A;  3F46 A;  4JJF A;  1ZHW A;  1JPJ A;  3EGX B;  1D0Y A;  3WOD F;  3TD7 A;  3EGX A;  1JPN A;  2R7Q A;  3PHF 2;  3AG2 C;  4LER A;  3SYN A;  3UMK A;  1BR1 A;  2Q9A A;  4FWV A;  1FMV A;  4O6N A;  2EIJ C;  3DAG A;  4O79 A;  4JJG A;  4DOZ A;  2Z15 A;  3JYH A;  3HLZ A;  4BJ6 C;  4BJ1 A;  2KQ9 A;  3KKB A;  1Z6A A;  2VB6 A;  2VH3 A;  2ZXP A;  5L3V A;  3W2W A;  3ECS A;  4KNV A;  4DBR A;  1ZU4 A;  3LS1 A;  1BR4 A;  3DXJ F;  4LLC A;  2R7U A;  5DQT A;  4GEH A;  4AX2 A;  3S29 A;  1LS1 A;  3Q6N A;  4Q4Z F;  4PFO A;  2NUT B;  4C7O B;  3GAN A;  3ZSU A;  2WZF A;  2IXP A;  3I4U A;  2NUT A;  4C7O A;  1Z3I X;  4CS9 A;  2NUP B;  2R7T A;  3EG9 B;  3IEE A;  3ZC4 A;  4EBB A;  1MNE A;  1NU7 D;  4XTK A;  2NUP A;  3EG9 A;  3UR3 C;  4RD9 A;  3V7O A;  2OCC C;  3K33 A;  1OCR C;  1QZX A;  4YN0 B;  4MND A;  4DBQ A;  1TWC A;  2MWQ A;  3NG1 A;  4JCH A;  1FMW A;  1MND A;  1VYK A;  4K7B A;  5DS4 A;  1MMA A;  2WVQ A;  1KU2 A;  2L81 A;  3KL4 A;  2J7P D;  1BR2 A;  2Q9C A;  5DVW A;  4FX5 A;  2R7S A;  4P6I C;  3UMI A;  1SF8 A;  2XRH A;  3FVY A;  2DYS C;  1D1B A;  3EGD B;  1IZM A;  3EGD A;  5E3A A;  3T6J A;  3L34 A;  4OD4 A;  2C03 A;  4U5D E;  2D5R B;  2ZXW C;  4GYT A;  4KC9 A;  1OCC C;  4U5B E;  2WZG A;  5E33 A;  5F5H A;  1D1C A;  2R7O A;  4U5C E;  2Y3G A;  2XXA B;  5BUO A;  1Z63 A;  4U5G A;  1M57 C;  4BEJ A;  2KW3 C;  3RYL A;  3KMI A;  2FFH A;  4LAC B;  1M2V B;  1NZE A;  1FFH A;  4KBL A;  1M2V A;  1VK5 A;  3OEO A;  4Q5S F;  1Z23 A;  2M4E A;  3ITF A;  1O5H A;  4CS8 A;  3X1O A;  2EIN C;  2Q9B A;  5F5F A;  3JT1 A;  4IRU A;  2BE5 F;  4C3B A;  2YHS A;  2I8B A;  2YZS A;  1PD0 A;  5D92 A;  1Z5Z A;  4G7O F;  1SZI A;  2V26 A;  3NYL A;  4WJ0 A;  5B1B C;  2E87 A;  3X2Q C;  3B9Q A;  3EZH A;  2CGE A;  3EH1 A;  1O87 A;  1MMN A;  1PD1 A;  2W45 A;  3POV A;  3NDB B;  5KYU B;  3ZG1 A;  3LS0 A;  4CSA C;  3Q7G A;  2R7R A;  3RH3 A;  5KYU A;  3UGP A;  3JRT A;  2KNH A;  5KYW B;  4DVY P;  3LEV A;  4CS9 C;  5KYW A;  3QMK A;  4O7G A;  4G7H F;  3VAY A;  5EGY A;  1OCO C;  3S28 A;  2PFD A;  3ASN C;  2WB7 A;  3EH2 A;  3N0T A;  4PJN A;  2R7V A;  4RDA A;  5D91 A;  2J45 A;  1LVK A;  4X0R A;  3MX3 A;  3OWT A;  2W4B A;  4RBN A;  3UMH A;  5EHH A;  2Y3H A;  3EQL F;  3FAJ A;  4HFK B;  2WVO A;  3NYJ A;  2B0J A;  1RJ9 B;  4JW1 A;  3EHN A;  4OIP F;  3K7D A;  5E3C A;  2G3K A;  3UGO A;  1RJ9 A;  1TKN A;  5HSW A;  3AG1 C;  5KYN A;  3N2Z B;  2IYL D;  4U5F E;  1D0X A;  4JZA A;  4U5H A;  2QTV A;  4YT8 A;  5DLJ A;  4OIO F;  3DJN B;  5B3S C;  3Q7L A;  2X51 A;  5DQZ A;  2J7P A;  4KI2 A;  3K1I C;  4E7Z A;  1V55 C;  4IAO A;  2V3C C;  4BJ5 C;  1SMY F;  4BJ6 A;  5KYY B;  3ABM C;  5DS5 A;  2WL8 A;  3AQC A;  3SZR A;  3LJB A;  5KYY A;  2G3V A;  3B0U X;  3NKD A;  2W4M A;  3O6X A;  3SEO A;  4OIQ F;  2P7V A;  3EPV A;  4QDL A;  5IY5 C;  4U5E E;  3S0X A;  4JVS A;  4XLP F;  2L9J A;  4W8K A;  2EIK C;  2J9W A;  4OIN F;  2H7B A;  5KYX B;  3FDQ A;  3RFY A;  4C3E A;  3SNH A;  1D0Z A;  1M56 C;  3HJC A;  2WVN A;  5T3T A;  4PFP A;  3DJU B;  3ASO C;  1FTS A;  4H4K C;  1TWA A;  3KH2 A;  4NY3 A;  4HFF B;  4BJT A;  3I5P A;  4Q7C A;  5CI9 A;  2Y69 C;  2XL4 A;  2XXA A;  4EWC A;  2W9Y A;  4CIH A;  1ZHT A;  1ZHZ A;  2KJG A;  3DD7 A;  4I3M A;  3S27 A;  1G8X A;  3DMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...