4O79A

Crystal structure of ascorbate-bound cytochrome b561, crystal soaked in 1 m l-ascorbate for 10 minutes
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
210
structure length
210
Chain Sequence
PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable transmembrane ascorbate ferrireductase 2
publication title Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 92
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 7.2.1.3: Ascorbate ferrireductase (transmembrane).
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4o79A00
4O7GA 4O79A 4O6YA
chains in the Genus database with same CATH superfamily
4U5EE 5DQTA 1NU9C 1T6UA 1WASA 2BL2A 1H7IA 2D5RB 1LE4A 3H2UA 5KYXB 3U0CA 2XS1A 1T9KA 3EH2A 5GPGB 3U9MA 1T5OA 3RVZA 1NFOA 3H2VA 3GEHA 4CDAA 4LDQA 1FFTC 1BBHA 4ULWA 4YT5A 3ABMC 3OWTA 5JS5A 5AC4A 5EK0A 2VASA 3ITFA 1YDIA 2EPNA 2PX3A 1E83A 4RDAA 4C7OA 3B9QA 1ZVZA 1PD1A 3J06A 3LS1A 2A0BA 1EKYA 3R2PA 3K6BA 4MTFA 3T9OA 3RKOF 1OR3A 1RJ9A 5D92A 5B3IA 1W2WA 1MMAA 2NUPB 2OCCC 3U2MA 5DLJA 4J30B 3GORA 4U5HA 1TR2A 4PR9A 1IZMA 5CI8A 5KYUA 4KI2A 1JAFA 3M15A 4PJNA 2OJQA 1RKEA 3UMIA 2KNHA 1YVIA 4EBKA 5L3QA 1QQ3A 3F47A 4HE8D 3C62A 3RFYA 5BUOA 1LS4A 1RKEB 2VB6A 3C8GA 1KNYA 5L0IA 3EZIA 3DMDA 2QLAA 2DI3A 4NTFA 1D1AA 3NYJA 1E84A 1NU7D 1QPUA 3WAQA 4IWBA 1OW7A 1ORJA 2H8AA 1SZIA 2P6VA 2X51A 2CW0F 4BJ5A 2P1AA 1SR2A 4BEMJ 3M79A 3GEIA 3POVA 1XZQA 1LVKA 1TFKB 3DZAA 1UG7A 3NMIA 4O7GA 5E3CA 4CS8C 2LIGA 3TULA 1PCXA 3DKAA 4AK9A 3ASOC 4K0DA 4YL3A 1I5NA 4YT8A 2WB7A 1NBBA 1CGNA 3AG1C 2W4BA 1FNTc 4BJ1A 2H7OA 3NMKA 5DVWA 2XS8A 3EG9B 4O6YA 4WGZA 3SYNA 3AQCA 3K1IC 4QI2A 1L3PA 4YN0B 3UNGC 2XXAA 1NLXA 3S28A 3WODF 2IYLD 2YLGA 5KYXA 1O87A 3FAJA 5COGA 3DAGA 2XXAB 4XEFA 1CGME 3LEOA 3TK0A 1K04A 1ZU4A 3ABKC 3DJNB 3M4BA 4A2NB 2OJED 4CIHA 5E33A 2WVOA 3F46A 1HW2A 2YQYA 3KH2A 1WGWA 1O5HA 3C8GD 1JOGA 1XWJA 1JRAA 2XLVA 2GDCA 4D4XA 2J9WA 4XWJA 5KYYA 2EPLX 2HS5A 4Q4ZF 3DXJF 3M4CA 4E0IA 1OXBA 2L6FA 3CZ6A 4AE4A 1G4WR 1D0YA 2HMQA 4MVSA 3LLIA 2Q9AA 3ZSUA 3DM9B 1OW6A 1D0XA 2WZFA 3HTKC 1Z3IX 4AE4B 4BEJA 1Q0MA 4N6HA 4CBEA 1SMYF 3MYFA 4L6RA 2UUIA 2F22A 3QVZA 3AGUA 3JSZA 2FGYA 4U5BE 2NG1A 2QY9A 1D1CA 1G5ZA 4MTGA 4XQ1A 3TD7A 4CJOA 5E3AA 1Q0KA 2ZXRA 4YK5A 2V26A 3E9VA 3TJ6A 4MVZA 2KYHA 2XSEA 3RH3A 1M2OA 3MBGA 3KYIA 2RD9A 1H6GA 1BR1A 3ZWIA 4OD4A 4LLEA 2A1DD 3Q6MA 1E2XA 1OKKA 1MQVA 1Q0DA 2J0XA 2ZXOA 3FVYA 1YYJA 1MNDA 3MLGA 4H54A 2C03A 3JT1A 4JEBA 1JPJA 4KC9A 5FZTA 1ZHYA 2XRHA 2XLHA 2PFDA 4EHPA 3LUTB 4MVQA 5JUAA 2P61A 1FTSA 5L0DA 1U6HA 4CIPA 1EI7A 4D4NA 4K1OA 1HE9A 2YRFA 3ASNC 2LCHA 3MFNA 4Z9JA 5T1DB 1ZHZA 3W8HA 4JCZA 4C3BA 3ZTZA 2NPUA 4FWVA 4ZLDA 2J0WA 3S9OA 2L6HA 4NTBA 1FR0A 2A6EF 1OXKA 2R7TA 3HNLA 3K1HA 5L0HA 5CI9A 1ORYA 1XZPA 2CDQA 1M56C 3I5PA 3BRJA 3GEEA 2UUHA 2J9UA 4W8KA 3ZQVA 4BJ5C 5AC5A 2R7SA 4IAOA 2G62A 3DE9A 4RBNA 4OINF 4E0HA 4JE9A 1Q0GA 3L0IA 4YT2A 1Z63A 1G4US 3L1MA 1OCCC 2VCAA 3W8IA 3UGOA 3BEHA 2DB4A 4E18A 1AEPA 4DVYP 3U3BA 2L81A 2PP4A 2R7XA 4Z9IA 3T6GB 4UDVA 3CEXA 3S0XA 3FAPB 4MVUA 2PBEA 2O9XA 4NCQA 2MYSA 1OKKD 3QMKA 5IY5C 3NDBB 1FFHA 3AOUA 5L0FA 5JLIA 3O10A 3AGTA 1QKRA 4JC7A 1MMGA 2XLEA 2IBFA 1Z6AA 2M4EA 3CSKA 3RYLA 5KYNA 1G8XA 3SNHA 4QI0A 3ABLC 2KGOA 4C7OB 3B71A 1JMWA 3RVYA 3AJMA 4WABA 4A4AA 3UR3C 4CS9A 2HSBA 4LERA 1TFOB 3IQ5A 2XLMA 2MWQA 4N6CA 1ZHXA 3C7JA 1RJ9B 4CS7A 1ZW3A 4C3EA 1MMNA 3IEEA 1YA7O 4Q7CA 2R25A 3RQEA 5KYUB 3KMIA 1VTMP 4XPWA 1YZAA 2XLDA 2R02A 3NYLA 3RIPA 4MTOA 5B1BC 5KYWA 2V3CC 4DVZA 1BR2A 3AG3C 1ZHWA 2ZD9A 3EHMA 1BZ4A 1Z7Qc 5B3SC 5B1AC 4IGGA 1K40A 3ZC4A 3NKDA 4NQFA 4O6MA 3ZG1A 4BJ6A 1O3UA 3C8GB 5KYWB 2X0CA 3G4ZA 2ZPAA 3GM2A 3HNKA 1R4TA 4PFPA 5DS5A 2WL8A 2W4MA 4IJJA 2Q4FA 4IB4A 4XLPF 1RXQA 2J46A 3EQLF 3KKBA 3B29A 1OR2A 3VRCA 2Y3BA 4J7TA 1U0BB 5JP7A 3GANA 3CQZA 5T3WA 4ULVA 2IXOA 1JR8A 1LS1A 3IHUA 3T4RA 1A7VA 4E7SA 3R7CA 3HLZA 1YZCA 4IARA 2J9BA 5L0JA 1YYXA 4G7ZF 2LFDA 4JEAA 1OCRC 2B0JA 1LE2A 1OW8A 3QZCA 2CYDA 2I15A 2IXMA 2G3VA 4YJWA 1T6QA 4CSAA 1A7EA 1SF8A 256BA 2WVNA 3N0TA 4P6IC 4EBBA 2HMZA 2EPOA 2KSFA 2DYRC 3FDQA 1ZHTA 2XL6A 2ZXPA 3AQBA 1LI5A 3O6XA 1C03A 2HV6A 3N2ZB 4LLCA 1Y6DA 2YLIA 3A9CA 4B6IA 3G4XA 4C3DA 3S84A 3LEVA 3O55A 2BC5A 2YKZA 4MNDA 4EWCA 3AG4C 3IQTA 3L8JA 3E70C 5KYYB 3RW0A 1LI7A 2CNWA 1C02A 2GA0A 4DJ9A 2Q3TA 4K7BA 3RF3A 1KTMA 1HY5A 4MVRA 2L7AA 4PJJA 2DGJA 2YVKA 4MW3A 5JRAA 1VYKA 2CCYA 4M63A 4NTAA 3GM1A 3EZHA 2Q00A 2HFIA 3V7OA 4JURI 3O39A 1CGOA 5D91A 3VM6A 3SEOA 3C8ZA 3HJCA 1VOMA 1YARO 2XL4A 4FAPB 4QDLA 2YL7A 1VMAA 1GQAA 2QUPA 4MS2A 4OIOF 2NSGA 3WHNA 2PX0A 5BQGA 4OIQF 2EIJC 2EPKX 4CJGA 1VLSA 3FOOA 3JYYA 1QLEC 1H9GA 4XTKA 1GM5A 3LJBA 2L9JA 2HSQA 5TJ5E 1D1BA 1ZZPA 2VC9A 1TWCA 3N24A 4CS9C 4YL0A 4MVMA 3NG1A 5T3TA 2P0NA 3JZ0A 3VF0A 2R7QA 2HKVA 3Q6NA 4XEVA 1FMWA 2YZSA 1DOVA 2AVKA 4FX5A 3SXZA 3VYWA 1WATA 1I4YA 3U9JA 2OEXA 4P9FA 1LM3B 1PD0A 4I44A 3ZDLA 2YHSA 3JSEO 4WJ0A 4U5GA 1V4AA 2CNWD 4JVSA 1NSGB 3U3FA 3U8PA 5A6JA 1V54C 3AG2C 2H7VC 4XPXA 2OU6A 3W4YA 3X1OA 4LDKA 2FFHA 1VLTA 1HMDA 1J8MF 2JX0A 2ZXWC 1MNEA 1YJGA 1BR4A 4G7HF 3DWWA 5F5FA 4N06A 3WG7C 2VCBA 4WGYA 3K66A 2GWWA 1VYIA 1WTYA 3B0PA 5AGFA 1ZU5A 4XEKA 1N1CA 4I1MA 3TOLA 3ECSA 1OCZC 2G3KA 2Q9BA 4JIOA 2QE9A 2ICWG 2KJGA 4KNWA 2H7BA 4JCHA 3T6JA 3U8VA 5JT4A 1LKXA 1ZYRF 4FESA 5F28E 2KC3A 3UMKA 5A6AA 3DE8A 5FCLA 2WZGA 4U9EA 2XL8A 3B0VC 5BQHA 2Y69C 4PJMA 3TOMA 3I5QA 4CX9A 2D4UA 4CSAC 1D0ZA 3US6A 3C18A 2R7OA 3LNRA 1HMOA 3M1CB 4DRIB 5DS6A 3Q7GA 3HKKA 4G7OF 2Y3GA 2GFHA 4YT4A 1GGQA 2EIKC 3JRTA 4MQ9F 5F5HA 4AL1A 4IAQA 2LK4A 4HFFB 5L3VA 3IQ6A 2BE5F 4DXWA 1WWPA 2YL3A 3ZIBA 2OOCA 4ER9A 4X0RA 1CPQA 3NRHA 1U89A 1GS9A 5BQIA 1QZXA 1YA9A 2Q7RA 1SYQA 2RSEB 3B0UX 1APCA 4Z9HA 5L0CA 3V5ZA 4AL0A 2J7PA 3L34A 3UMHA 1MMDA 1AVOB 2HV7A 1QSPA 2J8WA 2R9RB 2C04A 3KL4A 5E2QA 3SXMA 1VB5A 1WN0A 3I4UA 4MW8A 1NZEA 1H9TA 4EBJA 1B68A 2NUPA 2AP3A 2NSFA 4XPYA 4AX2A 1YLMA 2EPMX 3QW1A 3LNMB 3CAXA 1VK5A 3DM5A 3GWLA 4MVOA 1PV3A 4CDYA 5A6BA 2R7RA 3H65A 2R7UA 3K33A 2QNLA 2EINC 2J45A 5JVEA 2HJMA 2KW3C 4O6NA 4R32A 2AWCA 4BPMA 5HSWA 3U2LA 5A69A 2VH3A 2LP4A 3JTLO 3W2VA 2EIMC 2Y39A 2EILC 2Y3HA 1FMVA 3PMRA 4J7YA 1BDJB 1HE1A 1HW1A 4LACB 4P9TA 4OIPF 2W9YA 4ANJA 5EHHA 3NMJA 5COFA 4EIYA 2HJ3A 5A6BD 3JYHA 3SXYA 3EGDA 1S05A 3JRMO 2YL1A 4JRZA 2AU5A 2FAPB 2R03A 4EUKB 1FAPB 1WOLA 1Z5ZA 5JSLA 3EH1A 3KYJA 1TWHA 4JZAA 3SZRA 2L6GA 3EGDB 1TKNA 3OEOA 3LS0A 1E85A 3LESA 4W8PA 1A41A 4H4KC 5DQZA 2YL0A 2JPUA 1OQCA 2J7PD 3ZQYA 4N4WA 3EG9A 1Y4CA 1EQ1A 2PF4E 2ASRA 3HNJA 3ZTMA 5HV9A 3FXHA 4DOZA 4O79A 1F1MA 3QTHA 4NY3A 3TJ5A 3FOPA 3QVYA 2VCCA 3L8IA 2KQ9A 4YL1A 3EHNA 3PCVA 1AUEA 4G78A 4PACA 1M57C 1KU2A 3LLKA 4HEAJ 1A0BA 1OCOC 1QVXA 3ATPA 4ONSA 5K0IA 4XLNF 2QTVA 1EA8A 3U5SA 3X2QC 1V55C 3HNIA 4JTAB 1R5ID 4F4BA 2XM4A 4HFKB 5COMA 3UGPA 4GQHA 3PDMP 4PK4A 2Y3DA 1ZW2A 1C17M 2WZLA 2NUTA 1CPRA 4JTDB 2A0UA 2A68F 3LAYA 4PFOA 3S90A 2A69F 2LFFA 3VAYA 1Z23A 3FMSA 2J9VA 2KK1A 3QW0A 2NUTB 4LDRA 3RQGA 4GEHA 1TWAA 5DS4A 1JPNA 4NC3A 3W2WA 2P7VA 4KNVA 2OKUA 4JJFA 1UFBA 3JCUQ 4DBQA 3V5XA 5CIVA 3V5YA 2IM8A 2GAQA 4CDVA 1NFNA 3OA1A 2OQMA 4IRUA 5A6KA 2OEVA 3Q7LA 2AWYA 1TQGA 2R7VA 3EGXA 4KBLA 2R05A 3ZVRA 4ZLCA 1YAUO 4U5DE 4EKWA 2ETSA 1T01A 4OIRF 1E86A 4JW1A 3EGXB 2W45A 3PHF2 1LIHA 1V74B 4BG0A 4CS8A 1RMVA 1I4ZA 2XLWA 1RKCA 2IOQA 1TWGA 3EPVA 3GM3A 4BJTA 2R7WA 1ST6A 2HUJA 2MHRA 1L7CA 2I8BA 4JTCB 4U5FE 3GODA 1NG1A 3DAFA 3IQCA 2IXPA 4YWQA 4J32B 4E17A 3NYMA 3S27A 2E87A 3A11A 4BJ6C 1ORSC 4DRJB 2YLDA 3T6BA 2PNOA 2CGEA 4DRHB 1T6IA 1DOWA 3K1IA 3RQFA 4DBRA 3DJUB 2XLOA 1Q0FA 2B0HA 4GYTA 4RD9A 4OD5A 3GWNA 3G50A 4U5CE 1LPEA 2HZ8A 3KPHA 3K7DA 1M2VA 1RCPA 4U9DA 2M64A 2XM0A 3MYIA 1S7ZA 4E7ZA 4I3MA 4Q5SF 1M2VB 2Q9CA 1K05A 3C63A 3SXKA 3TQOA 3DD7A 3EFOA 2DYSC 3IPMO 2YEVA 2LQGA 3MX3A 2WVQA 3EFOB 3FHDA 3EJNA 4G0HA 1IW7F 2IXNA 3DI5A 4JKVA 3S29A 1J8YF 4I1OB 2YWAA 2LD6A 1M6TA 1A7DA 4JJGA 5L0GA 4PJLA 3SP1A 2TMVP 2JD3A 2A6HF 5EGYA 2LSEA 2OG2A 2Z15A 3NKEA
chains in the Genus database with same CATH topology
4U5EE 5DQTA 1NU9C 2D5RB 5KYXB 3EH2A 1FFTC 4ULWA 4YT5A 3ABMC 3OWTA 2VASA 3ITFA 2PX3A 4RDAA 4C7OA 3B9QA 1PD1A 3LS1A 3K6BA 3RKOF 1RJ9A 5D92A 1W2WA 1MMAA 2NUPB 2OCCC 5DLJA 4J30B 4U5HA 1TR2A 5CI8A 1IZMA 5KYUA 4KI2A 4PJNA 3UMIA 2KNHA 5L3QA 3F47A 4HE8D 3RFYA 5BUOA 2VB6A 3EZIA 3DMDA 1D1AA 3NYJA 1NU7D 4IWBA 1SZIA 2P6VA 2X51A 2CW0F 4BJ5A 3POVA 1LVKA 3DZAA 4O7GA 4CS8C 5E3CA 1PCXA 4AK9A 3ASOC 4K0DA 4YT8A 2WB7A 3AG1C 2W4BA 4BJ1A 2H7OA 5DVWA 3EG9B 4O6YA 3SYNA 3AQCA 3K1IC 4QI2A 4YN0B 3UNGC 2XXAA 3WODF 3S28A 2IYLD 5KYXA 1O87A 3FAJA 3DAGA 2XXAB 4A2NB 4CIHA 1ZU4A 3ABKC 3DJNB 5E33A 2WVOA 3F46A 3KH2A 1WGWA 1O5HA 5KYYA 2J9WA 4XWJA 4Q4ZF 3DXJF 3CZ6A 4AE4A 1D0YA 3LLIA 2Q9AA 3ZSUA 3DM9B 1D0XA 2WZFA 3HTKC 1Z3IX 4AE4B 4BEJA 4CBEA 1SMYF 3JSZA 4U5BE 2FGYA 2QY9A 2NG1A 1D1CA 3TD7A 5E3AA 2ZXRA 2V26A 3E9VA 2XSEA 3RH3A 1M2OA 1BR1A 4OD4A 4LLEA 2A1DD 3Q6MA 1OKKA 2J0XA 2ZXOA 3MLGA 3FVYA 4KC9A 1MNDA 4YWQA 2C03A 3JT1A 1JPJA 1ZHYA 2XRHA 2PFDA 1FTSA 5T1DB 3ASNC 1ZHZA 3W8HA 4C3BA 4FWVA 4ZLDA 2J0WA 2A6EF 2R7TA 3K1HA 5CI9A 2CDQA 1M56C 3I5PA 4BJ5C 2J9UA 4W8KA 2R7SA 4IAOA 2G62A 4RBNA 4OINF 3L0IA 4YT2A 1Z63A 1OCCC 3W8IA 3UGOA 4DVYP 2L81A 2PP4A 2R7XA 3S0XA 2O9XA 2MYSA 1OKKD 3QMKA 5IY5C 3NDBB 1FFHA 1MMGA 3CSKA 1Z6AA 2M4EA 3RYLA 5KYNA 1G8XA 3SNHA 4QI0A 3ABLC 2KGOA 4C7OB 4CS9A 3UR3C 4LERA 2MWQA 4CS7A 1ZHXA 1RJ9B 4C3EA 1MMNA 3IEEA 4Q7CA 5KYUB 3KMIA 3RIPA 3NYLA 2V3CC 5B1BC 5KYWA 4DVZA 1BR2A 3AG3C 1ZHWA 5B3SC 3EHMA 5B1AC 3ZC4A 5KYWB 3ZG1A 3NKDA 4O6MA 4BJ6A 2ZPAA 5DS5A 4PFPA 2WL8A 2W4MA 4IJJA 4XLPF 2J46A 3EQLF 3KKBA 2Y3BA 3GANA 3CQZA 5T3WA 2IXOA 1LS1A 3T4RA 4E7SA 3HLZA 4G7ZF 1OCRC 2B0JA 3QZCA 2IXMA 2G3VA 4YJWA 4CSAA 1SF8A 4P6IC 4EBBA 2WVNA 3N0TA 2DYRC 3FDQA 1ZHTA 2ZXPA 3AQBA 3O6XA 2HV6A 3N2ZB 4LLCA 4B6IA 4C3DA 3LEVA 4MNDA 4EWCA 3AG4C 3E70C 5KYYB 2CNWA 2Q3TA 4K7BA 4PJJA 2DGJA 1VYKA 4M63A 3EZHA 3V7OA 4JURI 3O39A 5D91A 3SEOA 3HJCA 1VOMA 2XL4A 4QDLA 1VMAA 4OIOF 2PX0A 4OIQF 2EIJC 1QLEC 4XTKA 3LJBA 2L9JA 1D1BA 1TWCA 3N24A 4CS9C 3NG1A 5T3TA 2R7QA 3Q6NA 1FMWA 2YZSA 4FX5A 3VYWA 1PD0A 4I44A 2YHSA 4WJ0A 4U5GA 2CNWD 4JVSA 1V54C 3AG2C 2H7VC 3X1OA 2FFHA 1J8MF 2ZXWC 1MNEA 1BR4A 4G7HF 5F5FA 4N06A 3WG7C 3K66A 1VYIA 3B0PA 1ZU5A 1N1CA 4I1MA 3ECSA 1OCZC 2G3KA 2Q9BA 2KJGA 4KNWA 2H7BA 4JCHA 3T6JA 1LKXA 1ZYRF 4FESA 3UMKA 5FCLA 2WZGA 3B0VC 2Y69C 4PJMA 3I5QA 4CSAC 1D0ZA 3LNRA 2R7OA 3M1CB 3Q7GA 4G7OF 2Y3GA 2GFHA 4YT4A 2EIKC 3JRTA 5F5HA 4MQ9F 4HFFB 5L3VA 2BE5F 3ZIBA 4X0RA 3NRHA 1QZXA 2J7PA 3L34A 3UMHA 1MMDA 2HV7A 3KL4A 2C04A 5E2QA 3I4UA 1NZEA 2NUPA 4AX2A 1VK5A 3DM5A 2R7RA 3H65A 2R7UA 3K33A 2EINC 2J45A 5HSWA 2KW3C 4O6NA 2VH3A 3W2VA 2EIMC 2Y39A 2EILC 2Y3HA 1FMVA 3PMRA 4LACB 3B0UX 4OIPF 2W9YA 4ANJA 5EHHA 3JYHA 3EGDA 1Z5ZA 5DS6A 3EH1A 4JZAA 1TWHA 3SZRA 3OEOA 3EGDB 1TKNA 3LS0A 3LESA 5DQZA 4H4KC 2J7PD 3EG9A 2PF4E 4DOZA 4O79A 4NY3A 2KQ9A 3EHNA 1M57C 1KU2A 3LLKA 4HEAJ 1OCOC 4XLNF 2QTVA 3X2QC 1V55C 4F4BA 4HFKB 3UGPA 4PK4A 2Y3DA 2WZLA 2NUTA 4PFOA 2A68F 3LAYA 2A69F 3VAYA 1Z23A 2J9VA 2NUTB 4GEHA 1TWAA 5DS4A 1JPNA 3W2WA 2P7VA 4KNVA 4JJFA 3JCUQ 4DBQA 3OA1A 4IRUA 3Q7LA 2R7VA 3EGXA 4KBLA 3ZVRA 4ZLCA 4U5DE 4OIRF 4JW1A 3EGXB 2W45A 3PHF2 4BG0A 4CS8A 2IOQA 1TWGA 3EPVA 4BJTA 2R7WA 1ST6A 2I8BA 4U5FE 3GODA 1NG1A 3DAFA 2IXPA 4J32B 3NYMA 3S27A 2E87A 4BJ6C 3T6BA 2CGEA 4DBRA 3DJUB 4GYTA 4RD9A 4OD5A 4U5CE 3K7DA 1M2VA 1S7ZA 4E7ZA 4I3MA 4Q5SF 1M2VB 2Q9CA 3DD7A 3EFOA 2DYSC 2YEVA 3MX3A 2WVQA 3EFOB 3FHDA 3EJNA 4G0HA 1IW7F 2IXNA 3S29A 1J8YF 4I1OB 4JJGA 4PJLA 3SP1A 2JD3A 2A6HF 5EGYA 2LSEA 2OG2A 2Z15A 3NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7G A;  4O79 A;  4O6Y A; 
#chains in the Genus database with same CATH topology
 4U5E E;  5DQT A;  1NU9 C;  1T6U A;  1WAS A;  2BL2 A;  1H7I A;  2D5R B;  1LE4 A;  3H2U A;  5KYX B;  3U0C A;  2XS1 A;  1T9K A;  3EH2 A;  5GPG B;  3U9M A;  1T5O A;  3RVZ A;  1NFO A;  3H2V A;  3GEH A;  4CDA A;  4LDQ A;  1FFT C;  1BBH A;  4ULW A;  4YT5 A;  3ABM C;  3OWT A;  5JS5 A;  5AC4 A;  5EK0 A;  2VAS A;  3ITF A;  1YDI A;  2EPN A;  2PX3 A;  1E83 A;  4RDA A;  4C7O A;  3B9Q A;  1ZVZ A;  1PD1 A;  3J06 A;  3LS1 A;  2A0B A;  1EKY A;  3R2P A;  3K6B A;  4MTF A;  3T9O A;  3RKO F;  1OR3 A;  1RJ9 A;  5D92 A;  5B3I A;  1W2W A;  1MMA A;  2NUP B;  2OCC C;  3U2M A;  5DLJ A;  4J30 B;  3GOR A;  4U5H A;  1TR2 A;  4PR9 A;  1IZM A;  5CI8 A;  5KYU A;  4KI2 A;  1JAF A;  3M15 A;  4PJN A;  2OJQ A;  1RKE A;  3UMI A;  2KNH A;  1YVI A;  4EBK A;  5L3Q A;  1QQ3 A;  3F47 A;  4HE8 D;  3C62 A;  3RFY A;  5BUO A;  1LS4 A;  1RKE B;  2VB6 A;  3C8G A;  1KNY A;  5L0I A;  3EZI A;  3DMD A;  2QLA A;  2DI3 A;  4NTF A;  1D1A A;  3NYJ A;  1E84 A;  1NU7 D;  1QPU A;  3WAQ A;  4IWB A;  1OW7 A;  1ORJ A;  2H8A A;  1SZI A;  2P6V A;  2X51 A;  2CW0 F;  4BJ5 A;  2P1A A;  1SR2 A;  4BEM J;  3M79 A;  3GEI A;  3POV A;  1XZQ A;  1LVK A;  1TFK B;  3DZA A;  1UG7 A;  3NMI A;  4O7G A;  5E3C A;  4CS8 C;  2LIG A;  3TUL A;  1PCX A;  3DKA A;  4AK9 A;  3ASO C;  4K0D A;  4YL3 A;  1I5N A;  4YT8 A;  2WB7 A;  1NBB A;  1CGN A;  3AG1 C;  2W4B A;  1FNT c;  4BJ1 A;  2H7O A;  3NMK A;  5DVW A;  2XS8 A;  3EG9 B;  4O6Y A;  4WGZ A;  3SYN A;  3AQC A;  3K1I C;  4QI2 A;  1L3P A;  4YN0 B;  3UNG C;  2XXA A;  1NLX A;  3S28 A;  3WOD F;  2IYL D;  2YLG A;  5KYX A;  1O87 A;  3FAJ A;  5COG A;  3DAG A;  2XXA B;  4XEF A;  1CGM E;  3LEO A;  3TK0 A;  1K04 A;  1ZU4 A;  3ABK C;  3DJN B;  3M4B A;  4A2N B;  2OJE D;  4CIH A;  5E33 A;  2WVO A;  3F46 A;  1HW2 A;  2YQY A;  3KH2 A;  1WGW A;  1O5H A;  3C8G D;  1JOG A;  1XWJ A;  1JRA A;  2XLV A;  2GDC A;  4D4X A;  2J9W A;  4XWJ A;  5KYY A;  2EPL X;  2HS5 A;  4Q4Z F;  3DXJ F;  3M4C A;  4E0I A;  1OXB A;  2L6F A;  3CZ6 A;  4AE4 A;  1G4W R;  1D0Y A;  2HMQ A;  4MVS A;  3LLI A;  2Q9A A;  3ZSU A;  3DM9 B;  1OW6 A;  1D0X A;  2WZF A;  3HTK C;  1Z3I X;  4AE4 B;  4BEJ A;  1Q0M A;  4N6H A;  4CBE A;  1SMY F;  3MYF A;  4L6R A;  2UUI A;  2F22 A;  3QVZ A;  3AGU A;  3JSZ A;  2FGY A;  4U5B E;  2NG1 A;  2QY9 A;  1D1C A;  1G5Z A;  4MTG A;  4XQ1 A;  3TD7 A;  4CJO A;  5E3A A;  1Q0K A;  2ZXR A;  4YK5 A;  2V26 A;  3E9V A;  3TJ6 A;  4MVZ A;  2KYH A;  2XSE A;  3RH3 A;  1M2O A;  3MBG A;  3KYI A;  2RD9 A;  1H6G A;  1BR1 A;  3ZWI A;  4OD4 A;  4LLE A;  2A1D D;  3Q6M A;  1E2X A;  1OKK A;  1MQV A;  1Q0D A;  2J0X A;  2ZXO A;  3FVY A;  1YYJ A;  1MND A;  3MLG A;  4H54 A;  2C03 A;  3JT1 A;  4JEB A;  1JPJ A;  4KC9 A;  5FZT A;  1ZHY A;  2XRH A;  2XLH A;  2PFD A;  4EHP A;  3LUT B;  4MVQ A;  5JUA A;  2P61 A;  1FTS A;  5L0D A;  1U6H A;  4CIP A;  1EI7 A;  4D4N A;  4K1O A;  1HE9 A;  2YRF A;  3ASN C;  2LCH A;  3MFN A;  4Z9J A;  5T1D B;  1ZHZ A;  3W8H A;  4JCZ A;  4C3B A;  3ZTZ A;  2NPU A;  4FWV A;  4ZLD A;  2J0W A;  3S9O A;  2L6H A;  4NTB A;  1FR0 A;  2A6E F;  1OXK A;  2R7T A;  3HNL A;  3K1H A;  5L0H A;  5CI9 A;  1ORY A;  1XZP A;  2CDQ A;  1M56 C;  3I5P A;  3BRJ A;  3GEE A;  2UUH A;  2J9U A;  4W8K A;  3ZQV A;  4BJ5 C;  5AC5 A;  2R7S A;  4IAO A;  2G62 A;  3DE9 A;  4RBN A;  4OIN F;  4E0H A;  4JE9 A;  1Q0G A;  3L0I A;  4YT2 A;  1Z63 A;  1G4U S;  3L1M A;  1OCC C;  2VCA A;  3W8I A;  3UGO A;  3BEH A;  2DB4 A;  4E18 A;  1AEP A;  4DVY P;  3U3B A;  2L81 A;  2PP4 A;  2R7X A;  4Z9I A;  3T6G B;  4UDV A;  3CEX A;  3S0X A;  3FAP B;  4MVU A;  2PBE A;  2O9X A;  4NCQ A;  2MYS A;  1OKK D;  3QMK A;  5IY5 C;  3NDB B;  1FFH A;  3AOU A;  5L0F A;  5JLI A;  3O10 A;  3AGT A;  1QKR A;  4JC7 A;  1MMG A;  2XLE A;  2IBF A;  1Z6A A;  2M4E A;  3CSK A;  3RYL A;  5KYN A;  1G8X A;  3SNH A;  4QI0 A;  3ABL C;  2KGO A;  4C7O B;  3B71 A;  1JMW A;  3RVY A;  3AJM A;  4WAB A;  4A4A A;  3UR3 C;  4CS9 A;  2HSB A;  4LER A;  1TFO B;  3IQ5 A;  2XLM A;  2MWQ A;  4N6C A;  1ZHX A;  3C7J A;  1RJ9 B;  4CS7 A;  1ZW3 A;  4C3E A;  1MMN A;  3IEE A;  1YA7 O;  4Q7C A;  2R25 A;  3RQE A;  5KYU B;  3KMI A;  1VTM P;  4XPW A;  1YZA A;  2XLD A;  2R02 A;  3NYL A;  3RIP A;  4MTO A;  5B1B C;  5KYW A;  2V3C C;  4DVZ A;  1BR2 A;  3AG3 C;  1ZHW A;  2ZD9 A;  3EHM A;  1BZ4 A;  1Z7Q c;  5B3S C;  5B1A C;  4IGG A;  1K40 A;  3ZC4 A;  3NKD A;  4NQF A;  4O6M A;  3ZG1 A;  4BJ6 A;  1O3U A;  3C8G B;  5KYW B;  2X0C A;  3G4Z A;  2ZPA A;  3GM2 A;  3HNK A;  1R4T A;  4PFP A;  5DS5 A;  2WL8 A;  2W4M A;  4IJJ A;  2Q4F A;  4IB4 A;  4XLP F;  1RXQ A;  2J46 A;  3EQL F;  3KKB A;  3B29 A;  1OR2 A;  3VRC A;  2Y3B A;  4J7T A;  1U0B B;  5JP7 A;  3GAN A;  3CQZ A;  5T3W A;  4ULV A;  2IXO A;  1JR8 A;  1LS1 A;  3IHU A;  3T4R A;  1A7V A;  4E7S A;  3R7C A;  3HLZ A;  1YZC A;  4IAR A;  2J9B A;  5L0J A;  1YYX A;  4G7Z F;  2LFD A;  4JEA A;  1OCR C;  2B0J A;  1LE2 A;  1OW8 A;  3QZC A;  2CYD A;  2I15 A;  2IXM A;  2G3V A;  4YJW A;  1T6Q A;  4CSA A;  1A7E A;  1SF8 A;  256B A;  2WVN A;  3N0T A;  4P6I C;  4EBB A;  2HMZ A;  2EPO A;  2KSF A;  2DYR C;  3FDQ A;  1ZHT A;  2XL6 A;  2ZXP A;  3AQB A;  1LI5 A;  3O6X A;  1C03 A;  2HV6 A;  3N2Z B;  4LLC A;  1Y6D A;  2YLI A;  3A9C A;  4B6I A;  3G4X A;  4C3D A;  3S84 A;  3LEV A;  3O55 A;  2BC5 A;  2YKZ A;  4MND A;  4EWC A;  3AG4 C;  3IQT A;  3L8J A;  3E70 C;  5KYY B;  3RW0 A;  1LI7 A;  2CNW A;  1C02 A;  2GA0 A;  4DJ9 A;  2Q3T A;  4K7B A;  3RF3 A;  1KTM A;  1HY5 A;  4MVR A;  2L7A A;  4PJJ A;  2DGJ A;  2YVK A;  4MW3 A;  5JRA A;  1VYK A;  2CCY A;  4M63 A;  4NTA A;  3GM1 A;  3EZH A;  2Q00 A;  2HFI A;  3V7O A;  4JUR I;  3O39 A;  1CGO A;  5D91 A;  3VM6 A;  3SEO A;  3C8Z A;  3HJC A;  1VOM A;  1YAR O;  2XL4 A;  4FAP B;  4QDL A;  2YL7 A;  1VMA A;  1GQA A;  2QUP A;  4MS2 A;  4OIO F;  2NSG A;  3WHN A;  2PX0 A;  5BQG A;  4OIQ F;  2EIJ C;  2EPK X;  4CJG A;  1VLS A;  3FOO A;  3JYY A;  1QLE C;  1H9G A;  4XTK A;  1GM5 A;  3LJB A;  2L9J A;  2HSQ A;  5TJ5 E;  1D1B A;  1ZZP A;  2VC9 A;  1TWC A;  3N24 A;  4CS9 C;  4YL0 A;  4MVM A;  3NG1 A;  5T3T A;  2P0N A;  3JZ0 A;  3VF0 A;  2R7Q A;  2HKV A;  3Q6N A;  4XEV A;  1FMW A;  2YZS A;  1DOV A;  2AVK A;  4FX5 A;  3SXZ A;  3VYW A;  1WAT A;  1I4Y A;  3U9J A;  2OEX A;  4P9F A;  1LM3 B;  1PD0 A;  4I44 A;  3ZDL A;  2YHS A;  3JSE O;  4WJ0 A;  4U5G A;  1V4A A;  2CNW D;  4JVS A;  1NSG B;  3U3F A;  3U8P A;  5A6J A;  1V54 C;  3AG2 C;  2H7V C;  4XPX A;  2OU6 A;  3W4Y A;  3X1O A;  4LDK A;  2FFH A;  1VLT A;  1HMD A;  1J8M F;  2JX0 A;  2ZXW C;  1MNE A;  1YJG A;  1BR4 A;  4G7H F;  3DWW A;  5F5F A;  4N06 A;  3WG7 C;  2VCB A;  4WGY A;  3K66 A;  2GWW A;  1VYI A;  1WTY A;  3B0P A;  5AGF A;  1ZU5 A;  4XEK A;  1N1C A;  4I1M A;  3TOL A;  3ECS A;  1OCZ C;  2G3K A;  2Q9B A;  4JIO A;  2QE9 A;  2ICW G;  2KJG A;  4KNW A;  2H7B A;  4JCH A;  3T6J A;  3U8V A;  5JT4 A;  1LKX A;  1ZYR F;  4FES A;  5F28 E;  2KC3 A;  3UMK A;  5A6A A;  3DE8 A;  5FCL A;  2WZG A;  4U9E A;  2XL8 A;  3B0V C;  5BQH A;  2Y69 C;  4PJM A;  3TOM A;  3I5Q A;  4CX9 A;  2D4U A;  4CSA C;  1D0Z A;  3US6 A;  3C18 A;  2R7O A;  3LNR A;  1HMO A;  3M1C B;  4DRI B;  5DS6 A;  3Q7G A;  3HKK A;  4G7O F;  2Y3G A;  2GFH A;  4YT4 A;  1GGQ A;  2EIK C;  3JRT A;  4MQ9 F;  5F5H A;  4AL1 A;  4IAQ A;  2LK4 A;  4HFF B;  5L3V A;  3IQ6 A;  2BE5 F;  4DXW A;  1WWP A;  2YL3 A;  3ZIB A;  2OOC A;  4ER9 A;  4X0R A;  1CPQ A;  3NRH A;  1U89 A;  1GS9 A;  5BQI A;  1QZX A;  1YA9 A;  2Q7R A;  1SYQ A;  2RSE B;  3B0U X;  1APC A;  4Z9H A;  5L0C A;  3V5Z A;  4AL0 A;  2J7P A;  3L34 A;  3UMH A;  1MMD A;  1AVO B;  2HV7 A;  1QSP A;  2J8W A;  2R9R B;  2C04 A;  3KL4 A;  5E2Q A;  3SXM A;  1VB5 A;  1WN0 A;  3I4U A;  4MW8 A;  1NZE A;  1H9T A;  4EBJ A;  1B68 A;  2NUP A;  2AP3 A;  2NSF A;  4XPY A;  4AX2 A;  1YLM A;  2EPM X;  3QW1 A;  3LNM B;  3CAX A;  1VK5 A;  3DM5 A;  3GWL A;  4MVO A;  1PV3 A;  4CDY A;  5A6B A;  2R7R A;  3H65 A;  2R7U A;  3K33 A;  2QNL A;  2EIN C;  2J45 A;  5JVE A;  2HJM A;  2KW3 C;  4O6N A;  4R32 A;  2AWC A;  4BPM A;  5HSW A;  3U2L A;  5A69 A;  2VH3 A;  2LP4 A;  3JTL O;  3W2V A;  2EIM C;  2Y39 A;  2EIL C;  2Y3H A;  1FMV A;  3PMR A;  4J7Y A;  1BDJ B;  1HE1 A;  1HW1 A;  4LAC B;  4P9T A;  4OIP F;  2W9Y A;  4ANJ A;  5EHH A;  3NMJ A;  5COF A;  4EIY A;  2HJ3 A;  5A6B D;  3JYH A;  3SXY A;  3EGD A;  1S05 A;  3JRM O;  2YL1 A;  4JRZ A;  2AU5 A;  2FAP B;  2R03 A;  4EUK B;  1FAP B;  1WOL A;  1Z5Z A;  5JSL A;  3EH1 A;  3KYJ A;  1TWH A;  4JZA A;  3SZR A;  2L6G A;  3EGD B;  1TKN A;  3OEO A;  3LS0 A;  1E85 A;  3LES A;  4W8P A;  1A41 A;  4H4K C;  5DQZ A;  2YL0 A;  2JPU A;  1OQC A;  2J7P D;  3ZQY A;  4N4W A;  3EG9 A;  1Y4C A;  1EQ1 A;  2PF4 E;  2ASR A;  3HNJ A;  3ZTM A;  5HV9 A;  3FXH A;  4DOZ A;  4O79 A;  1F1M A;  3QTH A;  4NY3 A;  3TJ5 A;  3FOP A;  3QVY A;  2VCC A;  3L8I A;  2KQ9 A;  4YL1 A;  3EHN A;  3PCV A;  1AUE A;  4G78 A;  4PAC A;  1M57 C;  1KU2 A;  3LLK A;  4HEA J;  1A0B A;  1OCO C;  1QVX A;  3ATP A;  4ONS A;  5K0I A;  4XLN F;  2QTV A;  1EA8 A;  3U5S A;  3X2Q C;  1V55 C;  3HNI A;  4JTA B;  1R5I D;  4F4B A;  2XM4 A;  4HFK B;  5COM A;  3UGP A;  4GQH A;  3PDM P;  4PK4 A;  2Y3D A;  1ZW2 A;  1C17 M;  2WZL A;  2NUT A;  1CPR A;  4JTD B;  2A0U A;  2A68 F;  3LAY A;  4PFO A;  3S90 A;  2A69 F;  2LFF A;  3VAY A;  1Z23 A;  3FMS A;  2J9V A;  2KK1 A;  3QW0 A;  2NUT B;  4LDR A;  3RQG A;  4GEH A;  1TWA A;  5DS4 A;  1JPN A;  4NC3 A;  3W2W A;  2P7V A;  4KNV A;  2OKU A;  4JJF A;  1UFB A;  3JCU Q;  4DBQ A;  3V5X A;  5CIV A;  3V5Y A;  2IM8 A;  2GAQ A;  4CDV A;  1NFN A;  3OA1 A;  2OQM A;  4IRU A;  5A6K A;  2OEV A;  3Q7L A;  2AWY A;  1TQG A;  2R7V A;  3EGX A;  4KBL A;  2R05 A;  3ZVR A;  4ZLC A;  1YAU O;  4U5D E;  4EKW A;  2ETS A;  1T01 A;  4OIR F;  1E86 A;  4JW1 A;  3EGX B;  2W45 A;  3PHF 2;  1LIH A;  1V74 B;  4BG0 A;  4CS8 A;  1RMV A;  1I4Z A;  2XLW A;  1RKC A;  2IOQ A;  1TWG A;  3EPV A;  3GM3 A;  4BJT A;  2R7W A;  1ST6 A;  2HUJ A;  2MHR A;  1L7C A;  2I8B A;  4JTC B;  4U5F E;  3GOD A;  1NG1 A;  3DAF A;  3IQC A;  2IXP A;  4YWQ A;  4J32 B;  4E17 A;  3NYM A;  3S27 A;  2E87 A;  3A11 A;  4BJ6 C;  1ORS C;  4DRJ B;  2YLD A;  3T6B A;  2PNO A;  2CGE A;  4DRH B;  1T6I A;  1DOW A;  3K1I A;  3RQF A;  4DBR A;  3DJU B;  2XLO A;  1Q0F A;  2B0H A;  4GYT A;  4RD9 A;  4OD5 A;  3GWN A;  3G50 A;  4U5C E;  1LPE A;  2HZ8 A;  3KPH A;  3K7D A;  1M2V A;  1RCP A;  4U9D A;  2M64 A;  2XM0 A;  3MYI A;  1S7Z A;  4E7Z A;  4I3M A;  4Q5S F;  1M2V B;  2Q9C A;  1K05 A;  3C63 A;  3SXK A;  3TQO A;  3DD7 A;  3EFO A;  2DYS C;  3IPM O;  2YEV A;  2LQG A;  3MX3 A;  2WVQ A;  3EFO B;  3FHD A;  3EJN A;  4G0H A;  1IW7 F;  2IXN A;  3DI5 A;  4JKV A;  3S29 A;  1J8Y F;  4I1O B;  2YWA A;  2LD6 A;  1M6T A;  1A7D A;  4JJG A;  5L0G A;  4PJL A;  3SP1 A;  2TMV P;  2JD3 A;  2A6H F;  5EGY A;  2LSE A;  2OG2 A;  2Z15 A;  3NKE A; 
#chains in the Genus database with same CATH homology
 4U5E E;  5DQT A;  1NU9 C;  2D5R B;  5KYX B;  3EH2 A;  1FFT C;  4ULW A;  4YT5 A;  3ABM C;  3OWT A;  2VAS A;  3ITF A;  2PX3 A;  4RDA A;  4C7O A;  3B9Q A;  1PD1 A;  3LS1 A;  3K6B A;  3RKO F;  1RJ9 A;  5D92 A;  1W2W A;  1MMA A;  2NUP B;  2OCC C;  5DLJ A;  4J30 B;  4U5H A;  1TR2 A;  5CI8 A;  1IZM A;  5KYU A;  4KI2 A;  4PJN A;  3UMI A;  2KNH A;  5L3Q A;  3F47 A;  4HE8 D;  3RFY A;  5BUO A;  2VB6 A;  3EZI A;  3DMD A;  1D1A A;  3NYJ A;  1NU7 D;  4IWB A;  1SZI A;  2P6V A;  2X51 A;  2CW0 F;  4BJ5 A;  3POV A;  1LVK A;  3DZA A;  4O7G A;  4CS8 C;  5E3C A;  1PCX A;  4AK9 A;  3ASO C;  4K0D A;  4YT8 A;  2WB7 A;  3AG1 C;  2W4B A;  4BJ1 A;  2H7O A;  5DVW A;  3EG9 B;  4O6Y A;  3SYN A;  3AQC A;  3K1I C;  4QI2 A;  4YN0 B;  3UNG C;  2XXA A;  3WOD F;  3S28 A;  2IYL D;  5KYX A;  1O87 A;  3FAJ A;  3DAG A;  2XXA B;  4A2N B;  4CIH A;  1ZU4 A;  3ABK C;  3DJN B;  5E33 A;  2WVO A;  3F46 A;  3KH2 A;  1WGW A;  1O5H A;  5KYY A;  2J9W A;  4XWJ A;  4Q4Z F;  3DXJ F;  3CZ6 A;  4AE4 A;  1D0Y A;  3LLI A;  2Q9A A;  3ZSU A;  3DM9 B;  1D0X A;  2WZF A;  3HTK C;  1Z3I X;  4AE4 B;  4BEJ A;  4CBE A;  1SMY F;  3JSZ A;  4U5B E;  2FGY A;  2QY9 A;  2NG1 A;  1D1C A;  3TD7 A;  5E3A A;  2ZXR A;  2V26 A;  3E9V A;  2XSE A;  3RH3 A;  1M2O A;  1BR1 A;  4OD4 A;  4LLE A;  2A1D D;  3Q6M A;  1OKK A;  2J0X A;  2ZXO A;  3MLG A;  3FVY A;  4KC9 A;  1MND A;  4YWQ A;  2C03 A;  3JT1 A;  1JPJ A;  1ZHY A;  2XRH A;  2PFD A;  1FTS A;  5T1D B;  3ASN C;  1ZHZ A;  3W8H A;  4C3B A;  4FWV A;  4ZLD A;  2J0W A;  2A6E F;  2R7T A;  3K1H A;  5CI9 A;  2CDQ A;  1M56 C;  3I5P A;  4BJ5 C;  2J9U A;  4W8K A;  2R7S A;  4IAO A;  2G62 A;  4RBN A;  4OIN F;  3L0I A;  4YT2 A;  1Z63 A;  1OCC C;  3W8I A;  3UGO A;  4DVY P;  2L81 A;  2PP4 A;  2R7X A;  3S0X A;  2O9X A;  2MYS A;  1OKK D;  3QMK A;  5IY5 C;  3NDB B;  1FFH A;  1MMG A;  3CSK A;  1Z6A A;  2M4E A;  3RYL A;  5KYN A;  1G8X A;  3SNH A;  4QI0 A;  3ABL C;  2KGO A;  4C7O B;  4CS9 A;  3UR3 C;  4LER A;  2MWQ A;  4CS7 A;  1ZHX A;  1RJ9 B;  4C3E A;  1MMN A;  3IEE A;  4Q7C A;  5KYU B;  3KMI A;  3RIP A;  3NYL A;  2V3C C;  5B1B C;  5KYW A;  4DVZ A;  1BR2 A;  3AG3 C;  1ZHW A;  5B3S C;  3EHM A;  5B1A C;  3ZC4 A;  5KYW B;  3ZG1 A;  3NKD A;  4O6M A;  4BJ6 A;  2ZPA A;  5DS5 A;  4PFP A;  2WL8 A;  2W4M A;  4IJJ A;  4XLP F;  2J46 A;  3EQL F;  3KKB A;  2Y3B A;  3GAN A;  3CQZ A;  5T3W A;  2IXO A;  1LS1 A;  3T4R A;  4E7S A;  3HLZ A;  4G7Z F;  1OCR C;  2B0J A;  3QZC A;  2IXM A;  2G3V A;  4YJW A;  4CSA A;  1SF8 A;  4P6I C;  4EBB A;  2WVN A;  3N0T A;  2DYR C;  3FDQ A;  1ZHT A;  2ZXP A;  3AQB A;  3O6X A;  2HV6 A;  3N2Z B;  4LLC A;  4B6I A;  4C3D A;  3LEV A;  4MND A;  4EWC A;  3AG4 C;  3E70 C;  5KYY B;  2CNW A;  2Q3T A;  4K7B A;  4PJJ A;  2DGJ A;  1VYK A;  4M63 A;  3EZH A;  3V7O A;  4JUR I;  3O39 A;  5D91 A;  3SEO A;  3HJC A;  1VOM A;  2XL4 A;  4QDL A;  1VMA A;  4OIO F;  2PX0 A;  4OIQ F;  2EIJ C;  1QLE C;  4XTK A;  3LJB A;  2L9J A;  1D1B A;  1TWC A;  3N24 A;  4CS9 C;  3NG1 A;  5T3T A;  2R7Q A;  3Q6N A;  1FMW A;  2YZS A;  4FX5 A;  3VYW A;  1PD0 A;  4I44 A;  2YHS A;  4WJ0 A;  4U5G A;  2CNW D;  4JVS A;  1V54 C;  3AG2 C;  2H7V C;  3X1O A;  2FFH A;  1J8M F;  2ZXW C;  1MNE A;  1BR4 A;  4G7H F;  5F5F A;  4N06 A;  3WG7 C;  3K66 A;  1VYI A;  3B0P A;  1ZU5 A;  1N1C A;  4I1M A;  3ECS A;  1OCZ C;  2G3K A;  2Q9B A;  2KJG A;  4KNW A;  2H7B A;  4JCH A;  3T6J A;  1LKX A;  1ZYR F;  4FES A;  3UMK A;  5FCL A;  2WZG A;  3B0V C;  2Y69 C;  4PJM A;  3I5Q A;  4CSA C;  1D0Z A;  3LNR A;  2R7O A;  3M1C B;  3Q7G A;  4G7O F;  2Y3G A;  2GFH A;  4YT4 A;  2EIK C;  3JRT A;  5F5H A;  4MQ9 F;  4HFF B;  5L3V A;  2BE5 F;  3ZIB A;  4X0R A;  3NRH A;  1QZX A;  2J7P A;  3L34 A;  3UMH A;  1MMD A;  2HV7 A;  3KL4 A;  2C04 A;  5E2Q A;  3I4U A;  1NZE A;  2NUP A;  4AX2 A;  1VK5 A;  3DM5 A;  2R7R A;  3H65 A;  2R7U A;  3K33 A;  2EIN C;  2J45 A;  5HSW A;  2KW3 C;  4O6N A;  2VH3 A;  3W2V A;  2EIM C;  2Y39 A;  2EIL C;  2Y3H A;  1FMV A;  3PMR A;  4LAC B;  3B0U X;  4OIP F;  2W9Y A;  4ANJ A;  5EHH A;  3JYH A;  3EGD A;  1Z5Z A;  5DS6 A;  3EH1 A;  4JZA A;  1TWH A;  3SZR A;  3OEO A;  3EGD B;  1TKN A;  3LS0 A;  3LES A;  5DQZ A;  4H4K C;  2J7P D;  3EG9 A;  2PF4 E;  4DOZ A;  4O79 A;  4NY3 A;  2KQ9 A;  3EHN A;  1M57 C;  1KU2 A;  3LLK A;  4HEA J;  1OCO C;  4XLN F;  2QTV A;  3X2Q C;  1V55 C;  4F4B A;  4HFK B;  3UGP A;  4PK4 A;  2Y3D A;  2WZL A;  2NUT A;  4PFO A;  2A68 F;  3LAY A;  2A69 F;  3VAY A;  1Z23 A;  2J9V A;  2NUT B;  4GEH A;  1TWA A;  5DS4 A;  1JPN A;  3W2W A;  2P7V A;  4KNV A;  4JJF A;  3JCU Q;  4DBQ A;  3OA1 A;  4IRU A;  3Q7L A;  2R7V A;  3EGX A;  4KBL A;  3ZVR A;  4ZLC A;  4U5D E;  4OIR F;  4JW1 A;  3EGX B;  2W45 A;  3PHF 2;  4BG0 A;  4CS8 A;  2IOQ A;  1TWG A;  3EPV A;  4BJT A;  2R7W A;  1ST6 A;  2I8B A;  4U5F E;  3GOD A;  1NG1 A;  3DAF A;  2IXP A;  4J32 B;  3NYM A;  3S27 A;  2E87 A;  4BJ6 C;  3T6B A;  2CGE A;  4DBR A;  3DJU B;  4GYT A;  4RD9 A;  4OD5 A;  4U5C E;  3K7D A;  1M2V A;  1S7Z A;  4E7Z A;  4I3M A;  4Q5S F;  1M2V B;  2Q9C A;  3DD7 A;  3EFO A;  2DYS C;  2YEV A;  3MX3 A;  2WVQ A;  3EFO B;  3FHD A;  3EJN A;  4G0H A;  1IW7 F;  2IXN A;  3S29 A;  1J8Y F;  4I1O B;  4JJG A;  4PJL A;  3SP1 A;  2JD3 A;  2A6H F;  5EGY A;  2LSE A;  2OG2 A;  2Z15 A;  3NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...