4G0HA

Crystal structure of the n-terminal domain of helicobacter pylori caga protein
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
515
structure length
450
Chain Sequence
LMGSHNGIKVSLLYAGNGGFGDKHDWNATVGYKNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYKNVTLQGSLKHDGVMFVDYSNGFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSKNKMEAKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFSKAEETLKALKGSVKDLGIPEWISKVENLNAALNEFKNKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into Helicobacter pylori oncoprotein CagA interaction with beta 1 integrin.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Toxin
molecule keywords Cytotoxicity-associated immunodominant antigen
total genus 138
structure length 450
sequence length 515
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4g0hA02
4DVYP 4DVZA 4G0HA
chains in the Genus database with same CATH superfamily
4P6IC 1AVOB 5T3WA 256BA 4JW1A 1FNTc 2E87A 5E3CA 1Q0KA 4JC7A 2UUIA 2BL2A 4PJLA 1JRAA 3EPVA 1WASA 3EZIA 1V55C 3HLZA 4G78A 4XEVA 1TWGA 3Q6MA 3M1CB 3TD7A 3NKEA 2R25A 3U9JA 5L0DA 3DM5A 3H2UA 4CDYA 2KGOA 4XWJA 3OWTA 4N4WA 2GWWA 2D5RB 3TOLA 3X1OA 4FX5A 5DLJA 2IBFA 3CAXA 4J32B 4ULWA 2R7XA 2W4BA 4CJOA 3DZAA 2EPMX 1UFBA 2YL3A 3DXJF 4O79A 4D4XA 1OXKA 2X0CA 1MMGA 2R9RB 5JUAA 1Q0GA 1M57C 4QI2A 5B1AC 1MNDA 4DOZA 4BEJA 2AVKA 3FXHA 4DRHB 1SZIA 2P1AA 4DJ9A 5A6JA 1HW2A 3FHDA 4W8KA 1L7CA 2A6HF 3CQZA 3SYNA 2UUHA 4CDVA 3V5XA 3A9CA 2R7TA 1B68A 1OR3A 1ZHYA 2IM8A 3AG1C 3T6BA 4BJTA 3KYIA 4CS8C 4JRZA 4MVZA 4AE4A 1H9GA 5AC5A 3SXMA 2KQ9A 4J7TA 1E86A 5A6AA 4G7OF 1Q0FA 3EFOA 5KYNA 3IQ6A 2IXMA 3R2PA 4XPXA 2HMZA 2GAQA 3CSKA 2OKUA 2CDQA 2LIGA 1FMWA 3L8JA 3VRCA 1OCCC 2OJED 4CJGA 4MW3A 5KYXB 3O55A 4YJWA 2R7UA 1M56C 3RH3A 4CBEA 3W4YA 3F46A 5L0GA 2YQYA 4CIPA 2NUPA 1T6IA 4JCZA 4IAOA 3H65A 4U5CE 2J46A 4X0RA 3RIPA 3SP1A 1SMYF 1KNYA 2P7VA 4CS9C 2F22A 3EZHA 3KYJA 4IB4A 5A6KA 3TJ6A 3NYLA 3NRHA 3IEEA 1FTSA 3KL4A 3ZDLA 4GEHA 2VH3A 3KKBA 2G62A 4ONSA 3AQBA 3C7JA 4MVRA 4DRIB 4L6RA 2LFDA 2XM0A 3T6GB 5TJ5E 1T6UA 1NSGB 1PD0A 4FAPB 3S0XA 2XLDA 1ZVZA 3FAPB 1EI7A 3FVYA 2IXNA 3DE9A 3RVZA 5JRAA 2B0JA 4E0IA 4Z9IA 1IZMA 2LK4A 4O6MA 4YL0A 3V7OA 1TQGA 3L8IA 2DI3A 2J9WA 3AGTA 3LUTB 4PFOA 1YYXA 5JP7A 3S29A 4EIYA 1CGOA 4MTFA 3KH2A 2YLGA 1K40A 4HFKB 4B6IA 1U0BB 2O9XA 3CZ6A 1GM5A 1U89A 2L6FA 2CCYA 2Y3HA 3B0PA 1YJGA 2CYDA 2YL0A 4K0DA 4EBJA 4AL0A 2W45A 3DMDA 1L3PA 2G3VA 3NMIA 3JCUQ 3I4UA 5L3VA 1ORSC 3RYLA 5DQTA 2R7VA 2MHRA 1WATA 3MX3A 2HS5A 1E83A 3SXZA 2A69F 3L0IA 2W9YA 5B3IA 3G50A 1XWJA 1YDIA 1WGWA 4KNWA 4AL1A 4KC9A 1A7VA 4BEMJ 2A68F 3LS0A 1I4YA 2KW3C 4JVSA 3LLIA 2HFIA 5JLIA 1VK5A 2OEVA 3QVYA 2P6VA 4N6CA 2FFHA 1G4US 4EBBA 5KYYB 2WZGA 1HY5A 3QW1A 1FR0A 4Z9HA 1LS1A 4JIOA 1M2VB 4GYTA 1LM3B 4NTFA 4U5DE 2PP4A 4YN0B 5A6BA 4K7BA 5L3QA 1RJ9A 2MWQA 1G4WR 4U5BE 2L9JA 3ZWIA 1VMAA 3LESA 5KYUB 3EHMA 3AGUA 4U5GA 1BDJB 1BZ4A 2YVKA 1VB5A 4JEBA 2VCAA 1FMVA 1JPNA 4Z9JA 1EQ1A 3OA1A 1NFOA 2AWYA 2R05A 1YVIA 1QSPA 2XLWA 4BG0A 3FDQA 4JTAB 5JT4A 1M2VA 4ANJA 3SXYA 4WGYA 2GFHA 1T5OA 3G4XA 1OQCA 3K1IA 4OIQF 1OCZC 3UMIA 1C02A 2GA0A 1G5ZA 5A69A 1E85A 3SEOA 3WHNA 2WB7A 4DRJB 4U5EE 4Q4ZF 3E70C 1LI5A 3LLKA 5K0IA 1LS4A 3GEHA 3I5QA 2JPUA 3U2LA 2NUTB 2XLEA 1OKKA 1M2OA 1EA8A 1RJ9B 3M4BA 1ZW3A 1XZPA 2NUPB 2HJ3A 4P9TA 5JVEA 2EPOA 2XM4A 4EWCA 2X51A 2ZPAA 2KJGA 4MTOA 3TOMA 2R7QA 5L0IA 2DYRC 1OKKD 3K1HA 4PR9A 3RKOF 3POVA 3L34A 2R02A 3HJCA 5DVWA 2P61A 1IW7F 1ORJA 3JYHA 3LEOA 2I8BA 2Q4FA 3EG9B 3JRTA 5B3SC 1D1CA 2YWAA 2XL8A 1NLXA 2CNWA 3EH2A 1VLSA 3O10A 4JCHA 1ZHZA 2KSFA 1OW7A 3US6A 1OW8A 4KNVA 5E2QA 1FFHA 1CPRA 4ZLDA 4WGZA 1HMOA 1AEPA 1A7DA 3GORA 3NKDA 5B1BC 1NG1A 5EHHA 1Z63A 5GPGB 4DBQA 3RF3A 1MMDA 4YWQA 1D1BA 2XLHA 3NDBB 3RQGA 4CS8A 2YHSA 4E7SA 3GM2A 3DJUB 4LLEA 4E0HA 2B0HA 1LKXA 1NU9C 3A11A 1TR2A 1A0BA 1QKRA 1D0ZA 1S7ZA 3DI5A 3ECSA 3UGPA 1SYQA 1JAFA 1VYIA 3K33A 2LQGA 3RQFA 3S90A 4MVSA 5COGA 1Y4CA 3JSEO 3C63A 4W8PA 3K66A 4BJ5A 1N1CA 2PX3A 2YL1A 3ZTMA 4OIPF 3JZ0A 1WWPA 4CSAC 3NMKA 4C7OA 1OW6A 2Z15A 2DGJA 3IPMO 3V5YA 1E84A 5CI8A 1PCXA 3U8VA 4I1OB 5KYYA 1LI7A 3X2QC 2TMVP 4I44A 4O7GA 1QVXA 3E9VA 3JRMO 1LIHA 2XRHA 1ZHWA 4KBLA 4PJMA 3EGDA 2J9BA 3DE8A 3QTHA 2CNWD 3ZVRA 1C17M 2WL8A 3L1MA 1WN0A 2R7WA 1MMAA 2JX0A 5JS5A 2YEVA 2HV7A 3IQ5A 2KYHA 2QNLA 4XPYA 5CIVA 4NTAA 4ER9A 2W4MA 4U5HA 1VTMP 1HMDA 1AUEA 4AX2A 4OIOF 2Y69C 4IARA 4E7ZA 1FFTC 3ASNC 1VLTA 4J30B 4CS9A 3GANA 4IRUA 1Z7Qc 2C03A 1JPJA 1WOLA 3JSZA 3C18A 3NYJA 3I5PA 3LNMB 4FWVA 1CPQA 1Z6AA 4NQFA 3UMHA 5BQHA 3PHF2 5A6BD 1ZYRF 4IGGA 5DS5A 3IQCA 5AGFA 3VYWA 3B0UX 3SZRA 3AG4C 4MVMA 2QLAA 5D91A 3DD7A 2EIJC 4G0HA 1M6TA 3HNIA 3O39A 1BBHA 2A0UA 2QTVA 1YA9A 1YZCA 4AE4B 2Q9BA 1HE9A 4XLPF 1BR4A 4J7YA 1MNEA 4R32A 2CW0F 4ULVA 3UMKA 4NC3A 2AP3A 2XXAB 5E3AA 2FGYA 3AJMA 3DAGA 2RD9A 4JJFA 3MFNA 3W2WA 1NBBA 3DWWA 2IXPA 2IOQA 3QVZA 1LVKA 4HFFB 4NCQA 2LSEA 4E18A 3EGDB 5FZTA 2XSEA 2HJMA 3B9QA 1J8MF 3Q7GA 4C3EA 2AU5A 3GWNA 5T3TA 3AQCA 5JSLA 2VB6A 3JTLO 4I1MA 4P9FA 3U3BA 2H7VC 3GM3A 4RD9A 1YARO 1O87A 2LCHA 1BR1A 1GGQA 4OINF 2PNOA 4LDQA 2WVQA 3EGXB 4YT8A 2HSBA 2J9VA 3PMRA 1V4AA 2ICWG 2Y3BA 3LEVA 3RW0A 1JMWA 1R5ID 2EPNA 3NG1A 4GQHA 4WJ0A 1QLEC 1XZQA 1I4ZA 1O3UA 2XL6A 3ABKC 3ZIBA 3ZTZA 4CX9A 4DBRA 3F47A 2LD6A 3B71A 5D92A 4CS7A 3JYYA 4HEAJ 1ZU4A 2EPLX 2OU6A 3LNRA 3PDMP 3ABLC 3U2MA 2LP4A 5BQGA 3ASOC 4CSAA 2XXAA 3ABMC 3EHNA 4XEFA 3U5SA 3HNJA 1PD1A 1QPUA 3T6JA 2IXOA 3IHUA 1T9KA 2XS8A 3S28A 4QI0A 2WVNA 1RKCA 2XL4A 4JTDB 2L81A 5IY5C 1LPEA 2J8WA 2Y3GA 3TULA 4IJJA 1UG7A 4QDLA 4JTCB 4MTGA 4OIRF 1J8YF 3EFOB 3MBGA 1VYKA 1E2XA 1KU2A 1DOVA 3VAYA 1OR2A 4RBNA 3SNHA 1K05A 1NFNA 2D4UA 2GDCA 2RSEB 3IQTA 3QZCA 5BQIA 1Y6DA 3DAFA 4H54A 2M64A 2NG1A 2HMQA 4YT2A 3RFYA 2OQMA 3W8HA 3HKKA 4LACB 2ZXRA 5L0CA 2HSQA 3NMJA 1DOWA 4DVZA 1R4TA 2OEXA 2YKZA 3N24A 3UR3C 2V3CC 3C8GB 1EKYA 2J0XA 1RKEA 3PCVA 4M63A 4XQ1A 2G3KA 2J9UA 3BEHA 2YL7A 2KNHA 2OG2A 2Q3TA 1ORYA 2WZLA 3N0TA 4LLCA 3B0VC 3U3FA 2R7SA 1VOMA 3MYIA 2L7AA 4U5FE 4PJJA 4XPWA 4BJ5C 2PBEA 2BC5A 5KYWA 4C3BA 2Y39A 4PFPA 2IYLD 3ATPA 1V54C 1ZHXA 4MW8A 4Q7CA 3AG2C 3SXKA 3C8GA 3GEIA 4JE9A 4JZAA 2WVOA 2Q9AA 1ZHTA 1FAPB 2PF4E 4YL3A 4WABA 3TQOA 2LFFA 5DS6A 3K1IC 3BRJA 1T6QA 2PFDA 2Q9CA 1C03A 2PX0A 1NZEA 4N6HA 2R7OA 3VM6A 4MVQA 1GQAA 3T9OA 4MNDA 4EHPA 4XEKA 4EBKA 2DB4A 3FMSA 2EIMC 2L6HA 2A1DD 2BE5F 2H8AA 3S27A 1Z23A 3ZQYA 3LAYA 4CDAA 4E17A 5L0FA 5T1DB 2XLOA 1BR2A 1YA7O 2Q00A 3EQLF 2OCCC 4XLNF 3C62A 4BJ6A 2YLDA 4MS2A 1QQ3A 2XLVA 2EILC 4I3MA 2OOCA 2OJQA 1ZU5A 4IAQA 3NYMA 2H7OA 3HTKC 2EIKC 4MQ9F 2XLMA 2J7PD 2NSGA 1V74B 1G8XA 1D1AA 2YZSA 3S84A 4OD5A 3DJNB 4PACA 5E33A 1D0XA 2AWCA 2HV6A 3AG3C 2WZFA 3ZSUA 4C3DA 4U9DA 3Q6NA 1OCOC 4H4KC 1YYJA 2NPUA 4A4AA 5L0HA 1APCA 3UNGC 2V26A 3LJBA 3FOOA 5KYXA 5COFA 2A0BA 2Y3DA 4EKWA 4F4BA 3G4ZA 4JEAA 4FESA 1KTMA 1OXBA 4LERA 3R7CA 4BJ1A 1RXQA 3U0CA 1ST6A 2QY9A 3TJ5A 5KYUA 1PV3A 1H9TA 1F1MA 2P0NA 4U9EA 1Z5ZA 3B29A 3OEOA 1Q0DA 2ZXWC 4NTBA 5DQZA 5BUOA 4AK9A 5DS4A 2JD3A 2KC3A 3HNKA 3H2VA 1SR2A 3MLGA 2VC9A 1CGNA 1T01A 4XTKA 2EINC 1Z3IX 4CIHA 2ZD9A 2J0WA 1K04A 2J7PA 1A7EA 1LE2A 3KPHA 4YK5A 4A2NB 3S9OA 1GS9A 3EH1A 3DM9B 2M4EA 3C8ZA 1TFKB 3JT1A 3KMIA 1ZZPA 3FOPA 4MVOA 4NY3A 2NSFA 1RKEB 3QW0A 2NUTA 1TWAA 1TWHA 2XS1A 3MYFA 4N06A 4BPMA 4DXWA 3GWLA 5L0JA 1CGME 3ZQVA 1MMNA 1H6GA 3M4CA 5CI9A 1TFOB 2HUJA 3DKAA 3EGXA 3EG9A 3VF0A 2C04A 3W2VA 3GODA 1SF8A 4G7HF 1S05A 4KI2A 1H7IA 3GM1A 5KYWB 4O6YA 1Q0MA 1ZW2A 4OD4A 4LDKA 1RCPA 1HW1A 2R7RA 2Q7RA 2ETSA 4JJGA 2QE9A 5F5FA 3T4RA 5EK0A 2H7BA 4IWBA 3K7DA 4D4NA 1JR8A 1U6HA 1TKNA 2HKVA 2QUPA 3C8GD 3EJNA 2R03A 2FAPB 2VCCA 4K1OA 4PJNA 3WAQA 2KK1A 5COMA 3U9MA 3WG7C 3AOUA 1W2WA 5F5HA 2VASA 5AC4A 4RDAA 4YT5A 3HNLA 4JKVA 5HV9A 1YAUO 2ZXOA 1D0YA 2DYSC 3K6BA 3CEXA 3RVYA 2ASRA 2VCBA 2CGEA 2EPKX 1NU7D 5FCLA 4BJ6C 2I15A 4Q5SF 4PK4A 3WODF 3ZG1A 2MYSA 4ZLCA 4G7ZF 2ZXPA 1I5NA 3QMKA 3V5ZA 5EGYA 5F28E 1WTYA 4UDVA 3LS1A 3J06A 1HE1A 3Q7LA 3U8PA 1A41A 1OCRC 3FAJA 3M79A 1YLMA 4EUKB 1YZAA 2L6GA 4DVYP 3M15A 5HSWA 4MVUA 4HE8D 2YRFA 1O5HA 2J45A 1QZXA 4LDRA 1LE4A 1JOGA 3ITFA 3N2ZB 3O6XA 4O6NA 1MQVA 3RQEA 3ZC4A 3UGOA 2HZ8A 3W8IA 1TWCA 4JURI 2A6EF 3TK0A 4YL1A 3GEEA 4C7OB 2YLIA 1RMVA 4YT4A
chains in the Genus database with same CATH topology
4P6IC 5T3WA 4JW1A 2E87A 5E3CA 4PJLA 3EPVA 3EZIA 1V55C 3HLZA 1TWGA 3Q6MA 3M1CB 3TD7A 3NKEA 3DM5A 2KGOA 4XWJA 3OWTA 3X1OA 2D5RB 4FX5A 5DLJA 4J32B 4ULWA 2R7XA 2W4BA 3DZAA 3DXJF 4O79A 1MMGA 1M57C 4QI2A 5B1AC 1MNDA 4DOZA 4BEJA 1SZIA 3FHDA 4W8KA 2A6HF 3CQZA 3SYNA 2R7TA 3AG1C 1ZHYA 3T6BA 4BJTA 4CS8C 4AE4A 2KQ9A 4G7OF 3EFOA 5KYNA 2IXMA 3CSKA 2CDQA 1FMWA 1OCCC 5KYXB 4YJWA 2R7UA 1M56C 3RH3A 4CBEA 3F46A 2NUPA 4X0RA 3RIPA 4IAOA 3H65A 4U5CE 2J46A 3SP1A 1SMYF 2P7VA 4CS9C 3EZHA 3NYLA 3NRHA 3IEEA 1FTSA 3KL4A 4GEHA 2VH3A 3KKBA 2G62A 3AQBA 1PD0A 3S0XA 3FVYA 2IXNA 2B0JA 1IZMA 4O6MA 3V7OA 3S29A 2J9WA 4PFOA 3KH2A 4HFKB 4B6IA 2O9XA 3CZ6A 2Y3HA 3B0PA 4K0DA 5L3VA 2W45A 3DMDA 2G3VA 3JCUQ 3I4UA 3RYLA 5DQTA 2R7VA 3MX3A 2A69F 3L0IA 2W9YA 1WGWA 4KNWA 4KC9A 2A68F 3LS0A 2KW3C 4JVSA 3LLIA 1VK5A 4EBBA 2P6VA 2FFHA 5KYYB 2WZGA 1LS1A 1M2VB 4GYTA 4U5DE 2PP4A 4YN0B 5L3QA 4K7BA 1RJ9A 2MWQA 4U5BE 2L9JA 1VMAA 3LESA 5KYUB 3EHMA 4U5GA 1FMVA 1JPNA 3OA1A 4BG0A 3FDQA 1M2VA 4ANJA 2GFHA 4OIQF 1OCZC 3UMIA 3SEOA 2WB7A 4U5EE 4Q4ZF 3E70C 3LLKA 3I5QA 2NUTB 1OKKA 1M2OA 1RJ9B 2NUPB 4EWCA 2X51A 2ZPAA 2KJGA 2R7QA 2DYRC 1OKKD 3K1HA 3RKOF 3POVA 3L34A 3HJCA 5DVWA 1IW7F 5B3SC 3JYHA 2I8BA 3EG9B 3JRTA 1D1CA 2CNWA 3EH2A 4JCHA 1ZHZA 5E2QA 4KNVA 1FFHA 4ZLDA 5EHHA 3NKDA 1Z63A 5B1BC 1NG1A 4DBQA 1MMDA 4YWQA 1D1BA 3NDBB 4CS8A 2YHSA 4E7SA 3DJUB 4LLEA 1LKXA 1NU9C 1TR2A 1D0ZA 1S7ZA 3ECSA 3UGPA 3K33A 1VYIA 3K66A 4BJ5A 1N1CA 2PX3A 4OIPF 4C7OA 4CSAC 2Z15A 2DGJA 5CI8A 1PCXA 4I1OB 5KYYA 3X2QC 4I44A 4O7GA 3E9VA 2XRHA 4KBLA 1ZHWA 4PJMA 3EGDA 2CNWD 3ZVRA 2WL8A 2R7WA 1MMAA 2YEVA 2HV7A 2W4MA 4U5HA 4AX2A 4OIOF 2Y69C 4E7ZA 1FFTC 3ASNC 4J30B 4CS9A 4IRUA 3GANA 2C03A 1JPJA 3JSZA 3NYJA 4FWVA 4DBRA 3I5PA 3PHF2 3UMHA 1Z6AA 1ZYRF 5DS5A 3VYWA 3B0UX 3SZRA 3AG4C 5D91A 3DD7A 2EIJC 4G0HA 3O39A 2QTVA 4AE4B 2Q9BA 4XLPF 1BR4A 1MNEA 2CW0F 3UMKA 2XXAB 5E3AA 2FGYA 3DAGA 4JJFA 3W2WA 2IXPA 2IOQA 1LVKA 4HFFB 2LSEA 3EGDB 2XSEA 3Q7GA 3B9QA 1J8MF 4C3EA 5T3TA 3AQCA 2VB6A 4I1MA 2H7VC 4RD9A 1O87A 1BR1A 4OINF 2WVQA 3EGXB 4YT8A 2J9VA 3PMRA 2Y3BA 3LEVA 3NG1A 4WJ0A 1QLEC 3ZIBA 3ABKC 3F47A 5D92A 4CS7A 4HEAJ 1ZU4A 3LNRA 3ABLC 3ASOC 4CSAA 2XXAA 3ABMC 3EHNA 1PD1A 3T6JA 2IXOA 3S28A 4QI0A 2WVNA 2XL4A 2L81A 5IY5C 2Y3GA 4IJJA 4QDLA 4OIRF 1J8YF 3EFOB 1VYKA 1KU2A 3VAYA 3SNHA 4RBNA 3QZCA 3DAFA 4YT2A 2NG1A 3RFYA 3W8HA 4LACB 2ZXRA 4DVZA 3N24A 3UR3C 2V3CC 2J0XA 4M63A 2G3KA 2J9UA 3N0TA 2KNHA 2OG2A 2Q3TA 4LLCA 2WZLA 3B0VC 2R7SA 1VOMA 4U5FE 4PJJA 4BJ5C 5KYWA 4C3BA 2Y39A 4PFPA 2IYLD 4Q7CA 1V54C 1ZHXA 3AG2C 4JZAA 2WVOA 2Q9AA 1ZHTA 2PF4E 5DS6A 3K1IC 2PFDA 2Q9CA 2PX0A 1NZEA 2R7OA 4MNDA 2EIMC 3S27A 2A1DD 2BE5F 1Z23A 3LAYA 5T1DB 1BR2A 3EQLF 2OCCC 4XLNF 4BJ6A 4I3MA 2EILC 1ZU5A 3NYMA 2H7OA 3HTKC 2EIKC 4MQ9F 2J7PD 1G8XA 1D1AA 2YZSA 4OD5A 3DJNB 5E33A 1D0XA 2HV6A 3AG3C 2WZFA 3ZSUA 4C3DA 3Q6NA 1OCOC 4H4KC 3UNGC 2V26A 3LJBA 5KYXA 2Y3DA 4F4BA 4FESA 4LERA 4BJ1A 1ST6A 2QY9A 5KYUA 1Z5ZA 3OEOA 5DQZA 2ZXWC 5BUOA 4AK9A 5DS4A 2JD3A 3MLGA 4XTKA 2EINC 1Z3IX 4CIHA 2J0WA 2J7PA 4A2NB 3EH1A 3DM9B 2M4EA 3JT1A 3KMIA 4NY3A 2NUTA 1TWAA 1TWHA 4N06A 1MMNA 5CI9A 3W2VA 3EGXA 3EG9A 2C04A 4G7HF 3GODA 1SF8A 4KI2A 5KYWB 4O6YA 4OD4A 2R7RA 4JJGA 5F5FA 3T4RA 2H7BA 4IWBA 3K7DA 1TKNA 3EJNA 4PJNA 3WG7C 1W2WA 5F5HA 2VASA 4RDAA 4YT5A 2ZXOA 3K6BA 1D0YA 2DYSC 2CGEA 1NU7D 5FCLA 4BJ6C 4Q5SF 4PK4A 3WODF 3ZG1A 2MYSA 4ZLCA 4G7ZF 2ZXPA 3QMKA 5EGYA 3LS1A 3Q7LA 1OCRC 3FAJA 5HSWA 4DVYP 4HE8D 1O5HA 2J45A 1QZXA 3ITFA 3N2ZB 3O6XA 4O6NA 3UGOA 3ZC4A 3W8IA 1TWCA 4JURI 2A6EF 4C7OB 4YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DVY P;  4DVZ A;  4G0H A; 
#chains in the Genus database with same CATH topology
 4P6I C;  1AVO B;  5T3W A;  256B A;  4JW1 A;  1FNT c;  2E87 A;  5E3C A;  1Q0K A;  4JC7 A;  2UUI A;  2BL2 A;  4PJL A;  1JRA A;  3EPV A;  1WAS A;  3EZI A;  1V55 C;  3HLZ A;  4G78 A;  4XEV A;  1TWG A;  3Q6M A;  3M1C B;  3TD7 A;  3NKE A;  2R25 A;  3U9J A;  5L0D A;  3DM5 A;  3H2U A;  4CDY A;  2KGO A;  4XWJ A;  3OWT A;  4N4W A;  2GWW A;  2D5R B;  3TOL A;  3X1O A;  4FX5 A;  5DLJ A;  2IBF A;  3CAX A;  4J32 B;  4ULW A;  2R7X A;  2W4B A;  4CJO A;  3DZA A;  2EPM X;  1UFB A;  2YL3 A;  3DXJ F;  4O79 A;  4D4X A;  1OXK A;  2X0C A;  1MMG A;  2R9R B;  5JUA A;  1Q0G A;  1M57 C;  4QI2 A;  5B1A C;  1MND A;  4DOZ A;  4BEJ A;  2AVK A;  3FXH A;  4DRH B;  1SZI A;  2P1A A;  4DJ9 A;  5A6J A;  1HW2 A;  3FHD A;  4W8K A;  1L7C A;  2A6H F;  3CQZ A;  3SYN A;  2UUH A;  4CDV A;  3V5X A;  3A9C A;  2R7T A;  1B68 A;  1OR3 A;  1ZHY A;  2IM8 A;  3AG1 C;  3T6B A;  4BJT A;  3KYI A;  4CS8 C;  4JRZ A;  4MVZ A;  4AE4 A;  1H9G A;  5AC5 A;  3SXM A;  2KQ9 A;  4J7T A;  1E86 A;  5A6A A;  4G7O F;  1Q0F A;  3EFO A;  5KYN A;  3IQ6 A;  2IXM A;  3R2P A;  4XPX A;  2HMZ A;  2GAQ A;  3CSK A;  2OKU A;  2CDQ A;  2LIG A;  1FMW A;  3L8J A;  3VRC A;  1OCC C;  2OJE D;  4CJG A;  4MW3 A;  5KYX B;  3O55 A;  4YJW A;  2R7U A;  1M56 C;  3RH3 A;  4CBE A;  3W4Y A;  3F46 A;  5L0G A;  2YQY A;  4CIP A;  2NUP A;  1T6I A;  4JCZ A;  4IAO A;  3H65 A;  4U5C E;  2J46 A;  4X0R A;  3RIP A;  3SP1 A;  1SMY F;  1KNY A;  2P7V A;  4CS9 C;  2F22 A;  3EZH A;  3KYJ A;  4IB4 A;  5A6K A;  3TJ6 A;  3NYL A;  3NRH A;  3IEE A;  1FTS A;  3KL4 A;  3ZDL A;  4GEH A;  2VH3 A;  3KKB A;  2G62 A;  4ONS A;  3AQB A;  3C7J A;  4MVR A;  4DRI B;  4L6R A;  2LFD A;  2XM0 A;  3T6G B;  5TJ5 E;  1T6U A;  1NSG B;  1PD0 A;  4FAP B;  3S0X A;  2XLD A;  1ZVZ A;  3FAP B;  1EI7 A;  3FVY A;  2IXN A;  3DE9 A;  3RVZ A;  5JRA A;  2B0J A;  4E0I A;  4Z9I A;  1IZM A;  2LK4 A;  4O6M A;  4YL0 A;  3V7O A;  1TQG A;  3L8I A;  2DI3 A;  2J9W A;  3AGT A;  3LUT B;  4PFO A;  1YYX A;  5JP7 A;  3S29 A;  4EIY A;  1CGO A;  4MTF A;  3KH2 A;  2YLG A;  1K40 A;  4HFK B;  4B6I A;  1U0B B;  2O9X A;  3CZ6 A;  1GM5 A;  1U89 A;  2L6F A;  2CCY A;  2Y3H A;  3B0P A;  1YJG A;  2CYD A;  2YL0 A;  4K0D A;  4EBJ A;  4AL0 A;  2W45 A;  3DMD A;  1L3P A;  2G3V A;  3NMI A;  3JCU Q;  3I4U A;  5L3V A;  1ORS C;  3RYL A;  5DQT A;  2R7V A;  2MHR A;  1WAT A;  3MX3 A;  2HS5 A;  1E83 A;  3SXZ A;  2A69 F;  3L0I A;  2W9Y A;  5B3I A;  3G50 A;  1XWJ A;  1YDI A;  1WGW A;  4KNW A;  4AL1 A;  4KC9 A;  1A7V A;  4BEM J;  2A68 F;  3LS0 A;  1I4Y A;  2KW3 C;  4JVS A;  3LLI A;  2HFI A;  5JLI A;  1VK5 A;  2OEV A;  3QVY A;  2P6V A;  4N6C A;  2FFH A;  1G4U S;  4EBB A;  5KYY B;  2WZG A;  1HY5 A;  3QW1 A;  1FR0 A;  4Z9H A;  1LS1 A;  4JIO A;  1M2V B;  4GYT A;  1LM3 B;  4NTF A;  4U5D E;  2PP4 A;  4YN0 B;  5A6B A;  4K7B A;  5L3Q A;  1RJ9 A;  2MWQ A;  1G4W R;  4U5B E;  2L9J A;  3ZWI A;  1VMA A;  3LES A;  5KYU B;  3EHM A;  3AGU A;  4U5G A;  1BDJ B;  1BZ4 A;  2YVK A;  1VB5 A;  4JEB A;  2VCA A;  1FMV A;  1JPN A;  4Z9J A;  1EQ1 A;  3OA1 A;  1NFO A;  2AWY A;  2R05 A;  1YVI A;  1QSP A;  2XLW A;  4BG0 A;  3FDQ A;  4JTA B;  5JT4 A;  1M2V A;  4ANJ A;  3SXY A;  4WGY A;  2GFH A;  1T5O A;  3G4X A;  1OQC A;  3K1I A;  4OIQ F;  1OCZ C;  3UMI A;  1C02 A;  2GA0 A;  1G5Z A;  5A69 A;  1E85 A;  3SEO A;  3WHN A;  2WB7 A;  4DRJ B;  4U5E E;  4Q4Z F;  3E70 C;  1LI5 A;  3LLK A;  5K0I A;  1LS4 A;  3GEH A;  3I5Q A;  2JPU A;  3U2L A;  2NUT B;  2XLE A;  1OKK A;  1M2O A;  1EA8 A;  1RJ9 B;  3M4B A;  1ZW3 A;  1XZP A;  2NUP B;  2HJ3 A;  4P9T A;  5JVE A;  2EPO A;  2XM4 A;  4EWC A;  2X51 A;  2ZPA A;  2KJG A;  4MTO A;  3TOM A;  2R7Q A;  5L0I A;  2DYR C;  1OKK D;  3K1H A;  4PR9 A;  3RKO F;  3POV A;  3L34 A;  2R02 A;  3HJC A;  5DVW A;  2P61 A;  1IW7 F;  1ORJ A;  3JYH A;  3LEO A;  2I8B A;  2Q4F A;  3EG9 B;  3JRT A;  5B3S C;  1D1C A;  2YWA A;  2XL8 A;  1NLX A;  2CNW A;  3EH2 A;  1VLS A;  3O10 A;  4JCH A;  1ZHZ A;  2KSF A;  1OW7 A;  3US6 A;  1OW8 A;  4KNV A;  5E2Q A;  1FFH A;  1CPR A;  4ZLD A;  4WGZ A;  1HMO A;  1AEP A;  1A7D A;  3GOR A;  3NKD A;  5B1B C;  1NG1 A;  5EHH A;  1Z63 A;  5GPG B;  4DBQ A;  3RF3 A;  1MMD A;  4YWQ A;  1D1B A;  2XLH A;  3NDB B;  3RQG A;  4CS8 A;  2YHS A;  4E7S A;  3GM2 A;  3DJU B;  4LLE A;  4E0H A;  2B0H A;  1LKX A;  1NU9 C;  3A11 A;  1TR2 A;  1A0B A;  1QKR A;  1D0Z A;  1S7Z A;  3DI5 A;  3ECS A;  3UGP A;  1SYQ A;  1JAF A;  1VYI A;  3K33 A;  2LQG A;  3RQF A;  3S90 A;  4MVS A;  5COG A;  1Y4C A;  3JSE O;  3C63 A;  4W8P A;  3K66 A;  4BJ5 A;  1N1C A;  2PX3 A;  2YL1 A;  3ZTM A;  4OIP F;  3JZ0 A;  1WWP A;  4CSA C;  3NMK A;  4C7O A;  1OW6 A;  2Z15 A;  2DGJ A;  3IPM O;  3V5Y A;  1E84 A;  5CI8 A;  1PCX A;  3U8V A;  4I1O B;  5KYY A;  1LI7 A;  3X2Q C;  2TMV P;  4I44 A;  4O7G A;  1QVX A;  3E9V A;  3JRM O;  1LIH A;  2XRH A;  1ZHW A;  4KBL A;  4PJM A;  3EGD A;  2J9B A;  3DE8 A;  3QTH A;  2CNW D;  3ZVR A;  1C17 M;  2WL8 A;  3L1M A;  1WN0 A;  2R7W A;  1MMA A;  2JX0 A;  5JS5 A;  2YEV A;  2HV7 A;  3IQ5 A;  2KYH A;  2QNL A;  4XPY A;  5CIV A;  4NTA A;  4ER9 A;  2W4M A;  4U5H A;  1VTM P;  1HMD A;  1AUE A;  4AX2 A;  4OIO F;  2Y69 C;  4IAR A;  4E7Z A;  1FFT C;  3ASN C;  1VLT A;  4J30 B;  4CS9 A;  3GAN A;  4IRU A;  1Z7Q c;  2C03 A;  1JPJ A;  1WOL A;  3JSZ A;  3C18 A;  3NYJ A;  3I5P A;  3LNM B;  4FWV A;  1CPQ A;  1Z6A A;  4NQF A;  3UMH A;  5BQH A;  3PHF 2;  5A6B D;  1ZYR F;  4IGG A;  5DS5 A;  3IQC A;  5AGF A;  3VYW A;  3B0U X;  3SZR A;  3AG4 C;  4MVM A;  2QLA A;  5D91 A;  3DD7 A;  2EIJ C;  4G0H A;  1M6T A;  3HNI A;  3O39 A;  1BBH A;  2A0U A;  2QTV A;  1YA9 A;  1YZC A;  4AE4 B;  2Q9B A;  1HE9 A;  4XLP F;  1BR4 A;  4J7Y A;  1MNE A;  4R32 A;  2CW0 F;  4ULV A;  3UMK A;  4NC3 A;  2AP3 A;  2XXA B;  5E3A A;  2FGY A;  3AJM A;  3DAG A;  2RD9 A;  4JJF A;  3MFN A;  3W2W A;  1NBB A;  3DWW A;  2IXP A;  2IOQ A;  3QVZ A;  1LVK A;  4HFF B;  4NCQ A;  2LSE A;  4E18 A;  3EGD B;  5FZT A;  2XSE A;  2HJM A;  3B9Q A;  1J8M F;  3Q7G A;  4C3E A;  2AU5 A;  3GWN A;  5T3T A;  3AQC A;  5JSL A;  2VB6 A;  3JTL O;  4I1M A;  4P9F A;  3U3B A;  2H7V C;  3GM3 A;  4RD9 A;  1YAR O;  1O87 A;  2LCH A;  1BR1 A;  1GGQ A;  4OIN F;  2PNO A;  4LDQ A;  2WVQ A;  3EGX B;  4YT8 A;  2HSB A;  2J9V A;  3PMR A;  1V4A A;  2ICW G;  2Y3B A;  3LEV A;  3RW0 A;  1JMW A;  1R5I D;  2EPN A;  3NG1 A;  4GQH A;  4WJ0 A;  1QLE C;  1XZQ A;  1I4Z A;  1O3U A;  2XL6 A;  3ABK C;  3ZIB A;  3ZTZ A;  4CX9 A;  4DBR A;  3F47 A;  2LD6 A;  3B71 A;  5D92 A;  4CS7 A;  3JYY A;  4HEA J;  1ZU4 A;  2EPL X;  2OU6 A;  3LNR A;  3PDM P;  3ABL C;  3U2M A;  2LP4 A;  5BQG A;  3ASO C;  4CSA A;  2XXA A;  3ABM C;  3EHN A;  4XEF A;  3U5S A;  3HNJ A;  1PD1 A;  1QPU A;  3T6J A;  2IXO A;  3IHU A;  1T9K A;  2XS8 A;  3S28 A;  4QI0 A;  2WVN A;  1RKC A;  2XL4 A;  4JTD B;  2L81 A;  5IY5 C;  1LPE A;  2J8W A;  2Y3G A;  3TUL A;  4IJJ A;  1UG7 A;  4QDL A;  4JTC B;  4MTG A;  4OIR F;  1J8Y F;  3EFO B;  3MBG A;  1VYK A;  1E2X A;  1KU2 A;  1DOV A;  3VAY A;  1OR2 A;  4RBN A;  3SNH A;  1K05 A;  1NFN A;  2D4U A;  2GDC A;  2RSE B;  3IQT A;  3QZC A;  5BQI A;  1Y6D A;  3DAF A;  4H54 A;  2M64 A;  2NG1 A;  2HMQ A;  4YT2 A;  3RFY A;  2OQM A;  3W8H A;  3HKK A;  4LAC B;  2ZXR A;  5L0C A;  2HSQ A;  3NMJ A;  1DOW A;  4DVZ A;  1R4T A;  2OEX A;  2YKZ A;  3N24 A;  3UR3 C;  2V3C C;  3C8G B;  1EKY A;  2J0X A;  1RKE A;  3PCV A;  4M63 A;  4XQ1 A;  2G3K A;  2J9U A;  3BEH A;  2YL7 A;  2KNH A;  2OG2 A;  2Q3T A;  1ORY A;  2WZL A;  3N0T A;  4LLC A;  3B0V C;  3U3F A;  2R7S A;  1VOM A;  3MYI A;  2L7A A;  4U5F E;  4PJJ A;  4XPW A;  4BJ5 C;  2PBE A;  2BC5 A;  5KYW A;  4C3B A;  2Y39 A;  4PFP A;  2IYL D;  3ATP A;  1V54 C;  1ZHX A;  4MW8 A;  4Q7C A;  3AG2 C;  3SXK A;  3C8G A;  3GEI A;  4JE9 A;  4JZA A;  2WVO A;  2Q9A A;  1ZHT A;  1FAP B;  2PF4 E;  4YL3 A;  4WAB A;  3TQO A;  2LFF A;  5DS6 A;  3K1I C;  3BRJ A;  1T6Q A;  2PFD A;  2Q9C A;  1C03 A;  2PX0 A;  1NZE A;  4N6H A;  2R7O A;  3VM6 A;  4MVQ A;  1GQA A;  3T9O A;  4MND A;  4EHP A;  4XEK A;  4EBK A;  2DB4 A;  3FMS A;  2EIM C;  2L6H A;  2A1D D;  2BE5 F;  2H8A A;  3S27 A;  1Z23 A;  3ZQY A;  3LAY A;  4CDA A;  4E17 A;  5L0F A;  5T1D B;  2XLO A;  1BR2 A;  1YA7 O;  2Q00 A;  3EQL F;  2OCC C;  4XLN F;  3C62 A;  4BJ6 A;  2YLD A;  4MS2 A;  1QQ3 A;  2XLV A;  2EIL C;  4I3M A;  2OOC A;  2OJQ A;  1ZU5 A;  4IAQ A;  3NYM A;  2H7O A;  3HTK C;  2EIK C;  4MQ9 F;  2XLM A;  2J7P D;  2NSG A;  1V74 B;  1G8X A;  1D1A A;  2YZS A;  3S84 A;  4OD5 A;  3DJN B;  4PAC A;  5E33 A;  1D0X A;  2AWC A;  2HV6 A;  3AG3 C;  2WZF A;  3ZSU A;  4C3D A;  4U9D A;  3Q6N A;  1OCO C;  4H4K C;  1YYJ A;  2NPU A;  4A4A A;  5L0H A;  1APC A;  3UNG C;  2V26 A;  3LJB A;  3FOO A;  5KYX A;  5COF A;  2A0B A;  2Y3D A;  4EKW A;  4F4B A;  3G4Z A;  4JEA A;  4FES A;  1KTM A;  1OXB A;  4LER A;  3R7C A;  4BJ1 A;  1RXQ A;  3U0C A;  1ST6 A;  2QY9 A;  3TJ5 A;  5KYU A;  1PV3 A;  1H9T A;  1F1M A;  2P0N A;  4U9E A;  1Z5Z A;  3B29 A;  3OEO A;  1Q0D A;  2ZXW C;  4NTB A;  5DQZ A;  5BUO A;  4AK9 A;  5DS4 A;  2JD3 A;  2KC3 A;  3HNK A;  3H2V A;  1SR2 A;  3MLG A;  2VC9 A;  1CGN A;  1T01 A;  4XTK A;  2EIN C;  1Z3I X;  4CIH A;  2ZD9 A;  2J0W A;  1K04 A;  2J7P A;  1A7E A;  1LE2 A;  3KPH A;  4YK5 A;  4A2N B;  3S9O A;  1GS9 A;  3EH1 A;  3DM9 B;  2M4E A;  3C8Z A;  1TFK B;  3JT1 A;  3KMI A;  1ZZP A;  3FOP A;  4MVO A;  4NY3 A;  2NSF A;  1RKE B;  3QW0 A;  2NUT A;  1TWA A;  1TWH A;  2XS1 A;  3MYF A;  4N06 A;  4BPM A;  4DXW A;  3GWL A;  5L0J A;  1CGM E;  3ZQV A;  1MMN A;  1H6G A;  3M4C A;  5CI9 A;  1TFO B;  2HUJ A;  3DKA A;  3EGX A;  3EG9 A;  3VF0 A;  2C04 A;  3W2V A;  3GOD A;  1SF8 A;  4G7H F;  1S05 A;  4KI2 A;  1H7I A;  3GM1 A;  5KYW B;  4O6Y A;  1Q0M A;  1ZW2 A;  4OD4 A;  4LDK A;  1RCP A;  1HW1 A;  2R7R A;  2Q7R A;  2ETS A;  4JJG A;  2QE9 A;  5F5F A;  3T4R A;  5EK0 A;  2H7B A;  4IWB A;  3K7D A;  4D4N A;  1JR8 A;  1U6H A;  1TKN A;  2HKV A;  2QUP A;  3C8G D;  3EJN A;  2R03 A;  2FAP B;  2VCC A;  4K1O A;  4PJN A;  3WAQ A;  2KK1 A;  5COM A;  3U9M A;  3WG7 C;  3AOU A;  1W2W A;  5F5H A;  2VAS A;  5AC4 A;  4RDA A;  4YT5 A;  3HNL A;  4JKV A;  5HV9 A;  1YAU O;  2ZXO A;  1D0Y A;  2DYS C;  3K6B A;  3CEX A;  3RVY A;  2ASR A;  2VCB A;  2CGE A;  2EPK X;  1NU7 D;  5FCL A;  4BJ6 C;  2I15 A;  4Q5S F;  4PK4 A;  3WOD F;  3ZG1 A;  2MYS A;  4ZLC A;  4G7Z F;  2ZXP A;  1I5N A;  3QMK A;  3V5Z A;  5EGY A;  5F28 E;  1WTY A;  4UDV A;  3LS1 A;  3J06 A;  1HE1 A;  3Q7L A;  3U8P A;  1A41 A;  1OCR C;  3FAJ A;  3M79 A;  1YLM A;  4EUK B;  1YZA A;  2L6G A;  4DVY P;  3M15 A;  5HSW A;  4MVU A;  4HE8 D;  2YRF A;  1O5H A;  2J45 A;  1QZX A;  4LDR A;  1LE4 A;  1JOG A;  3ITF A;  3N2Z B;  3O6X A;  4O6N A;  1MQV A;  3RQE A;  3ZC4 A;  3UGO A;  2HZ8 A;  3W8I A;  1TWC A;  4JUR I;  2A6E F;  3TK0 A;  4YL1 A;  3GEE A;  4C7O B;  2YLI A;  1RMV A;  4YT4 A; 
#chains in the Genus database with same CATH homology
 4P6I C;  5T3W A;  4JW1 A;  2E87 A;  5E3C A;  4PJL A;  3EPV A;  3EZI A;  1V55 C;  3HLZ A;  1TWG A;  3Q6M A;  3M1C B;  3TD7 A;  3NKE A;  3DM5 A;  2KGO A;  4XWJ A;  3OWT A;  3X1O A;  2D5R B;  4FX5 A;  5DLJ A;  4J32 B;  4ULW A;  2R7X A;  2W4B A;  3DZA A;  3DXJ F;  4O79 A;  1MMG A;  1M57 C;  4QI2 A;  5B1A C;  1MND A;  4DOZ A;  4BEJ A;  1SZI A;  3FHD A;  4W8K A;  2A6H F;  3CQZ A;  3SYN A;  2R7T A;  3AG1 C;  1ZHY A;  3T6B A;  4BJT A;  4CS8 C;  4AE4 A;  2KQ9 A;  4G7O F;  3EFO A;  5KYN A;  2IXM A;  3CSK A;  2CDQ A;  1FMW A;  1OCC C;  5KYX B;  4YJW A;  2R7U A;  1M56 C;  3RH3 A;  4CBE A;  3F46 A;  2NUP A;  4X0R A;  3RIP A;  4IAO A;  3H65 A;  4U5C E;  2J46 A;  3SP1 A;  1SMY F;  2P7V A;  4CS9 C;  3EZH A;  3NYL A;  3NRH A;  3IEE A;  1FTS A;  3KL4 A;  4GEH A;  2VH3 A;  3KKB A;  2G62 A;  3AQB A;  1PD0 A;  3S0X A;  3FVY A;  2IXN A;  2B0J A;  1IZM A;  4O6M A;  3V7O A;  3S29 A;  2J9W A;  4PFO A;  3KH2 A;  4HFK B;  4B6I A;  2O9X A;  3CZ6 A;  2Y3H A;  3B0P A;  4K0D A;  5L3V A;  2W45 A;  3DMD A;  2G3V A;  3JCU Q;  3I4U A;  3RYL A;  5DQT A;  2R7V A;  3MX3 A;  2A69 F;  3L0I A;  2W9Y A;  1WGW A;  4KNW A;  4KC9 A;  2A68 F;  3LS0 A;  2KW3 C;  4JVS A;  3LLI A;  1VK5 A;  4EBB A;  2P6V A;  2FFH A;  5KYY B;  2WZG A;  1LS1 A;  1M2V B;  4GYT A;  4U5D E;  2PP4 A;  4YN0 B;  5L3Q A;  4K7B A;  1RJ9 A;  2MWQ A;  4U5B E;  2L9J A;  1VMA A;  3LES A;  5KYU B;  3EHM A;  4U5G A;  1FMV A;  1JPN A;  3OA1 A;  4BG0 A;  3FDQ A;  1M2V A;  4ANJ A;  2GFH A;  4OIQ F;  1OCZ C;  3UMI A;  3SEO A;  2WB7 A;  4U5E E;  4Q4Z F;  3E70 C;  3LLK A;  3I5Q A;  2NUT B;  1OKK A;  1M2O A;  1RJ9 B;  2NUP B;  4EWC A;  2X51 A;  2ZPA A;  2KJG A;  2R7Q A;  2DYR C;  1OKK D;  3K1H A;  3RKO F;  3POV A;  3L34 A;  3HJC A;  5DVW A;  1IW7 F;  5B3S C;  3JYH A;  2I8B A;  3EG9 B;  3JRT A;  1D1C A;  2CNW A;  3EH2 A;  4JCH A;  1ZHZ A;  5E2Q A;  4KNV A;  1FFH A;  4ZLD A;  5EHH A;  3NKD A;  1Z63 A;  5B1B C;  1NG1 A;  4DBQ A;  1MMD A;  4YWQ A;  1D1B A;  3NDB B;  4CS8 A;  2YHS A;  4E7S A;  3DJU B;  4LLE A;  1LKX A;  1NU9 C;  1TR2 A;  1D0Z A;  1S7Z A;  3ECS A;  3UGP A;  3K33 A;  1VYI A;  3K66 A;  4BJ5 A;  1N1C A;  2PX3 A;  4OIP F;  4C7O A;  4CSA C;  2Z15 A;  2DGJ A;  5CI8 A;  1PCX A;  4I1O B;  5KYY A;  3X2Q C;  4I44 A;  4O7G A;  3E9V A;  2XRH A;  4KBL A;  1ZHW A;  4PJM A;  3EGD A;  2CNW D;  3ZVR A;  2WL8 A;  2R7W A;  1MMA A;  2YEV A;  2HV7 A;  2W4M A;  4U5H A;  4AX2 A;  4OIO F;  2Y69 C;  4E7Z A;  1FFT C;  3ASN C;  4J30 B;  4CS9 A;  4IRU A;  3GAN A;  2C03 A;  1JPJ A;  3JSZ A;  3NYJ A;  4FWV A;  4DBR A;  3I5P A;  3PHF 2;  3UMH A;  1Z6A A;  1ZYR F;  5DS5 A;  3VYW A;  3B0U X;  3SZR A;  3AG4 C;  5D91 A;  3DD7 A;  2EIJ C;  4G0H A;  3O39 A;  2QTV A;  4AE4 B;  2Q9B A;  4XLP F;  1BR4 A;  1MNE A;  2CW0 F;  3UMK A;  2XXA B;  5E3A A;  2FGY A;  3DAG A;  4JJF A;  3W2W A;  2IXP A;  2IOQ A;  1LVK A;  4HFF B;  2LSE A;  3EGD B;  2XSE A;  3Q7G A;  3B9Q A;  1J8M F;  4C3E A;  5T3T A;  3AQC A;  2VB6 A;  4I1M A;  2H7V C;  4RD9 A;  1O87 A;  1BR1 A;  4OIN F;  2WVQ A;  3EGX B;  4YT8 A;  2J9V A;  3PMR A;  2Y3B A;  3LEV A;  3NG1 A;  4WJ0 A;  1QLE C;  3ZIB A;  3ABK C;  3F47 A;  5D92 A;  4CS7 A;  4HEA J;  1ZU4 A;  3LNR A;  3ABL C;  3ASO C;  4CSA A;  2XXA A;  3ABM C;  3EHN A;  1PD1 A;  3T6J A;  2IXO A;  3S28 A;  4QI0 A;  2WVN A;  2XL4 A;  2L81 A;  5IY5 C;  2Y3G A;  4IJJ A;  4QDL A;  4OIR F;  1J8Y F;  3EFO B;  1VYK A;  1KU2 A;  3VAY A;  3SNH A;  4RBN A;  3QZC A;  3DAF A;  4YT2 A;  2NG1 A;  3RFY A;  3W8H A;  4LAC B;  2ZXR A;  4DVZ A;  3N24 A;  3UR3 C;  2V3C C;  2J0X A;  4M63 A;  2G3K A;  2J9U A;  3N0T A;  2KNH A;  2OG2 A;  2Q3T A;  4LLC A;  2WZL A;  3B0V C;  2R7S A;  1VOM A;  4U5F E;  4PJJ A;  4BJ5 C;  5KYW A;  4C3B A;  2Y39 A;  4PFP A;  2IYL D;  4Q7C A;  1V54 C;  1ZHX A;  3AG2 C;  4JZA A;  2WVO A;  2Q9A A;  1ZHT A;  2PF4 E;  5DS6 A;  3K1I C;  2PFD A;  2Q9C A;  2PX0 A;  1NZE A;  2R7O A;  4MND A;  2EIM C;  3S27 A;  2A1D D;  2BE5 F;  1Z23 A;  3LAY A;  5T1D B;  1BR2 A;  3EQL F;  2OCC C;  4XLN F;  4BJ6 A;  4I3M A;  2EIL C;  1ZU5 A;  3NYM A;  2H7O A;  3HTK C;  2EIK C;  4MQ9 F;  2J7P D;  1G8X A;  1D1A A;  2YZS A;  4OD5 A;  3DJN B;  5E33 A;  1D0X A;  2HV6 A;  3AG3 C;  2WZF A;  3ZSU A;  4C3D A;  3Q6N A;  1OCO C;  4H4K C;  3UNG C;  2V26 A;  3LJB A;  5KYX A;  2Y3D A;  4F4B A;  4FES A;  4LER A;  4BJ1 A;  1ST6 A;  2QY9 A;  5KYU A;  1Z5Z A;  3OEO A;  5DQZ A;  2ZXW C;  5BUO A;  4AK9 A;  5DS4 A;  2JD3 A;  3MLG A;  4XTK A;  2EIN C;  1Z3I X;  4CIH A;  2J0W A;  2J7P A;  4A2N B;  3EH1 A;  3DM9 B;  2M4E A;  3JT1 A;  3KMI A;  4NY3 A;  2NUT A;  1TWA A;  1TWH A;  4N06 A;  1MMN A;  5CI9 A;  3W2V A;  3EGX A;  3EG9 A;  2C04 A;  4G7H F;  3GOD A;  1SF8 A;  4KI2 A;  5KYW B;  4O6Y A;  4OD4 A;  2R7R A;  4JJG A;  5F5F A;  3T4R A;  2H7B A;  4IWB A;  3K7D A;  1TKN A;  3EJN A;  4PJN A;  3WG7 C;  1W2W A;  5F5H A;  2VAS A;  4RDA A;  4YT5 A;  2ZXO A;  3K6B A;  1D0Y A;  2DYS C;  2CGE A;  1NU7 D;  5FCL A;  4BJ6 C;  4Q5S F;  4PK4 A;  3WOD F;  3ZG1 A;  2MYS A;  4ZLC A;  4G7Z F;  2ZXP A;  3QMK A;  5EGY A;  3LS1 A;  3Q7L A;  1OCR C;  3FAJ A;  5HSW A;  4DVY P;  4HE8 D;  1O5H A;  2J45 A;  1QZX A;  3ITF A;  3N2Z B;  3O6X A;  4O6N A;  3UGO A;  3ZC4 A;  3W8I A;  1TWC A;  4JUR I;  2A6E F;  4C7O B;  4YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...