4G0HA

Crystal structure of the n-terminal domain of helicobacter pylori caga protein
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
515
structure length
450
Chain Sequence
LMGSHNGIKVSLLYAGNGGFGDKHDWNATVGYKNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYKNVTLQGSLKHDGVMFVDYSNGFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSKNKMEAKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFSKAEETLKALKGSVKDLGIPEWISKVENLNAALNEFKNKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxicity-associated immunodominant antigen
publication title Structural insights into Helicobacter pylori oncoprotein CagA interaction with beta 1 integrin.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Toxin
total genus 138
structure length 450
sequence length 515
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4g0hA02
4G0HA 4DVYP 4DVZA
chains in the Genus database with same CATH superfamily
4MTOA 4H54A 2BC5A 3LAYA 3RQFA 3CSKA 2KNHA 4O6YA 1LE4A 2FFHA 2PNOA 4FESA 2J7PA 2IXNA 2GAQA 5D91A 1U89A 4Q5SF 3TJ5A 3PMRA 5F28E 1CGNA 2XXAB 2R7UA 3OWTA 3EFOA 4PJLA 4CX9A 2HJ3A 3KPHA 3S9OA 2J9VA 1AEPA 2PFDA 4IB4A 2VASA 3E70C 5L3QA 4BPMA 3HNLA 2Y3HA 4CJOA 5DQZA 4D4XA 2VH3A 3EZHA 1YAUO 3I5QA 3HLZA 2YHSA 3JSZA 2R7VA 3U2MA 5E2QA 5DS4A 5COMA 3T6JA 4OD4A 3V5ZA 1E2XA 2ETSA 2XXAA 4C7OB 4CBEA 2LQGA 3EG9B 3EH1A 3AQBA 4LACB 1OW6A 2J46A 2LP4A 4LERA 3QZCA 4W8KA 4FWVA 1ORYA 1S7ZA 3LLIA 2XLDA 1YA9A 4JCZA 3O55A 4WABA 4BG0A 4EBKA 3FVYA 3H2VA 2G3VA 3U3BA 2KC3A 4DRIB 1TQGA 2ZXOA 4YT5A 1KU2A 2HS5A 1VOMA 4O7GA 2J45A 1XZQA 2C03A 3T9OA 4ZLCA 4U9DA 4DBQA 1FR0A 4E17A 4AE4B 3GWLA 1FMWA 3B0PA 2A1DD 2A68F 3U3FA 4OIOF 2JD3A 1RKEB 3H2UA 1D0ZA 2AP3A 3Q7LA 1Y6DA 2OJED 2OQMA 4CS7A 3I4UA 2Y3DA 3N0TA 5A6AA 3F46A 2XS1A 2YKZA 3GODA 4Z9IA 1DOWA 3EGDA 2JX0A 1R5ID 4PJMA 1OXKA 1GS9A 2DYRC 1SF8A 1QPUA 1A7DA 4HEAJ 4CIPA 1EA8A 3KL4A 1ZHTA 4MS2A 5BQIA 4PJJA 2KSFA 1BBHA 2X51A 3GWNA 3IEEA 2YL7A 2LFFA 2CYDA 4NQFA 3HKKA 4HE8D 4HFKB 2EPLX 1FFTC 2EPMX 2LSEA 3B71A 3K6BA 4HFFB 2YL1A 4XPWA 3T6BA 3X1OA 3NKEA 3SXYA 4XLPF 3ASNC 2CNWD 2W4BA 4C3DA 5COGA 5JLIA 3KMIA 1AUEA 3RH3A 3EGXB 1TWGA 1T6QA 3NDBB 1T9KA 3O39A 4IJJA 2IM8A 3HJCA 4JEAA 2R7WA 1EI7A 2XM4A 3IQCA 2NUPB 1E85A 3B0VC 3TD7A 3DI5A 3IHUA 2HMQA 4QI0A 2AWCA 5CI9A 2Q9CA 4Z9JA 3TQOA 2PBEA 3K7DA 1NLXA 3RFYA 1PD0A 5JS5A 2A0UA 1ZHZA 1MMDA 2ICWG 3PHF2 4PK4A 1T6IA 2A6HF 3JYHA 3S84A 3B29A 2OKUA 2PX0A 2A69F 2LFDA 1HE1A 4A2NB 2V26A 4DJ9A 1KNYA 3K1HA 4GYTA 4YJWA 4XLNF 1GQAA 5CI8A 3TOLA 5JT4A 2LCHA 3JTLO 1HW1A 1O3UA 4GEHA 5EHHA 1N1CA 1O5HA 1V54C 5E3CA 3SP1A 3UGOA 2R25A 4CDAA 1TWHA 1RMVA 3DE8A 1VYKA 2XLWA 3RQEA 1LIHA 3ATPA 3W8IA 3BEHA 3ZVRA 2LD6A 3FOPA 4MVQA 2R7SA 3CZ6A 2AVKA 2HV7A 1OW7A 2XL6A 1D0XA 2EPNA 3NYMA 5FZTA 3T6GB 1ZHXA 3KH2A 3L1MA 3C7JA 3W2WA 2YWAA 3ITFA 5BUOA 2H7OA 4X0RA 1E83A 4ER9A 3S90A 4E7SA 3SXKA 3W8HA 3JCUQ 4C3EA 1WASA 2HUJA 1AVOB 3JT1A 4IRUA 1LI7A 4OINF 1QVXA 4P6IC 2QLAA 2EINC 2DB4A 3LUTB 5A6BD 1A0BA 3EJNA 3NMIA 4Z9HA 2VCCA 1NG1A 3EHMA 4MQ9F 3M4BA 4JTAB 1WGWA 4EWCA 4MVMA 1XZPA 4LDRA 2VCBA 1T5OA 2QTVA 3AG4C 1S05A 4G78A 4EKWA 3CEXA 4CS9C 4WGZA 1IW7F 1BR2A 3AOUA 3SZRA 4CS8C 4BJ6C 2UUIA 4EBJA 1JMWA 3QMKA 4C7OA 4J30B 4J7TA 4MTFA 2KJGA 3W4YA 4YT8A 2Y3GA 3DZAA 2XM0A 3U2LA 3QVYA 4BEJA 1YZAA 4XTKA 1D0YA 2NG1A 4ULWA 4CJGA 1R4TA 3LEOA 2YRFA 2O9XA 3V7OA 3FAJA 4P9FA 5L0FA 3AG3C 2NUTB 3IPMO 5AGFA 4KNWA 2P7VA 3LLKA 2GA0A 5DS6A 1K40A 4MVUA 5F5FA 5GPGB 5E3AA 2OOCA 1G5ZA 3DE9A 3HTKC 4JURI 1GGQA 2MHRA 3GEEA 3IQ5A 1H6GA 4AE4A 4OIQF 1JR8A 2NSGA 3GM2A 3PCVA 2ZXWC 5T1DB 1RKEA 1WATA 4IWBA 4JZAA 2W9YA 3N24A 4Q7CA 1WOLA 1VK5A 4EIYA 3MYIA 5T3TA 3WHNA 4BJTA 1ZYRF 5A6JA 3J06A 1EQ1A 3Q6MA 1YLMA 2HFIA 1LKXA 3LS0A 1KTMA 2P6VA 3Q7GA 4MVZA 2X0CA 2XLOA 3GORA 1APCA 3DJUB 3DM9B 1U6HA 3EH2A 3ECSA 1RKCA 4H4KC 4DBRA 4CS9A 1FNTc 2L6HA 2LK4A 1LM3B 4PJNA 3Q6NA 1LI5A 1OKKA 1OR2A 2G62A 2ZD9A 1K04A 3JYYA 1SZIA 5E33A 3V5XA 4DXWA 5L0JA 3SNHA 2YEVA 3UMKA 4YL0A 1M57C 4RBNA 3ABLC 5K0IA 3TK0A 3E9VA 3L34A 2P61A 3EGXA 4N06A 4XWJA 2Z15A 1D1AA 2EPKX 4DVYP 1TFKB 4YT2A 1M2VB 5AC5A 1LE2A 5B1AC 4G0HA 2H7BA 2GDCA 3GEHA 3HNIA 4U5GA 3I5PA 3V5YA 2CNWA 1OKKD 4KC9A 3U5SA 5KYUB 3AQCA 2JPUA 3FOOA 1YA7O 3GANA 4JTCB 4WGYA 1OCZC 4BEMJ 1MMNA 1NFNA 3CAXA 3QW1A 2QUPA 4N6HA 1Q0KA 2FAPB 3UGPA 4I3MA 1ZW2A 3U9JA 1EKYA 2XLVA 1MQVA 2I8BA 1PCXA 1YDIA 1CPRA 1PD1A 2VC9A 4PFPA 4BJ5C 1UG7A 2L9JA 1WTYA 5CIVA 4U5BE 5KYWB 2HKVA 3WAQA 1OCCC 3TOMA 2ZXRA 2KW3C 3G4ZA 5KYYB 2H7VC 1NBBA 2OEVA 2H8AA 3EPVA 2EILC 4KI2A 5T3WA 1ZHWA 1VTMP 1Z23A 5COFA 2AWYA 2QE9A 1MNEA 3ABMC 3DWWA 4U9EA 1Z63A 2D4UA 1ST6A 4AK9A 1HY5A 1G4US 5L0IA 4Q4ZF 4O79A 1TKNA 3JZ0A 4YN0B 1L7CA 4BJ1A 4ANJA 3O10A 2V3CC 1ORJA 1NU9C 2KYHA 3GM3A 4PACA 1HMDA 3ZWIA 3K1IC 2ASRA 3M4CA 5B3IA 4ZLDA 2R05A 3JRMO 2J0XA 4YK5A 4YT4A 1H9TA 1HW2A 3ZQYA 1ORSC 1LS1A 4JKVA 1JRAA 3C8GD 2MYSA 3DM5A 5EGYA 3OA1A 5JP7A 3IQTA 2WZLA 1RJ9B 2L6GA 3FHDA 4XQ1A 1V74B 4E0HA 1LPEA 4N4WA 5DVWA 4K7BA 3S0XA 1G8XA 3KYJA 1ZVZA 3NYJA 4IAQA 2J9WA 5A6BA 1BDJB 1M2OA 3VRCA 3NG1A 4I1OB 4IARA 3C8GB 4FAPB 1J8MF 4G7HF 1JPJA 5JVEA 2CW0F 4U5HA 4FX5A 4LDQA 2XLMA 1NSGB 3AGUA 4WJ0A 2OCCC 4AL0A 3AG2C 2LIGA 4F4BA 3NMJA 3RKOF 2B0HA 1BR4A 2WZGA 3R2PA 2HV6A 4LLCA 2J9UA 3TJ6A 3T4RA 1OQCA 2R9RB 2Y69C 3ABKC 1SMYF 4KBLA 2PP4A 1FAPB 3HNKA 4DOZA 1HE9A 1QZXA 2PF4E 2NUTA 1VB5A 3LS1A 1L3PA 4JIOA 4G7OF 1V55C 1A41A 2R03A 1WWPA 2L6FA 3ZIBA 4DVZA 3K33A 3M79A 3RQGA 1QLEC 1Z3IX 2WVQA 2GFHA 4P9TA 1RCPA 1ZZPA 3F47A 2XLEA 3EG9A 3QTHA 1YYJA 1W2WA 1Q0MA 3DD7A 4MNDA 2EIJC 3LNRA 3EZIA 4O6MA 3WODF 3B0UX 1JOGA 4NTBA 1FTSA 2OJQA 1I4ZA 2Q9BA 3C8ZA 1MNDA 2UUHA 5BQHA 4G7ZF 3ASOC 3RF3A 3NRHA 5A69A 4XPYA 3ZTMA 1OCOC 2WB7A 4GQHA 3RVZA 3PDMP 3FDQA 1IZMA 2BE5F 2OEXA 3NMKA 1GM5A 4JE9A 2E87A 3KKBA 3M15A 1DOVA 1HMOA 4R32A 3POVA 3A11A 3MBGA 1LVKA 4MVOA 4MTGA 4PFOA 2XSEA 3X2QC 5L0DA 1FFHA 1BZ4A 1U0BB 1H7IA 2IXPA 2FGYA 4MW8A 2R7RA 1M2VA 5TJ5E 3SYNA 1G4WR 1LS4A 5D92A 4I44A 1YVIA 1YYXA 3ZDLA 5B3SC 5KYUA 3N2ZB 1F1MA 3EQLF 3IQ6A 1D1BA 4RD9A 1T01A 2Y39A 2Q7RA 1ZU5A 1QQ3A 4NY3A 3O6XA 2IXMA 4QI2A 1ZW3A 2CGEA 2XRHA 3DAGA 4MVRA 5JSLA 4B6IA 4MW3A 1VMAA 3MX3A 1CPQA 4AX2A 4CS8A 4J7YA 4BJ6A 2HSQA 5L0HA 3WG7C 4JW1A 2J7PD 5DQTA 1J8YF 2J8WA 5KYXB 4CDYA 2R02A 5JUAA 1NZEA 5KYWA 2YLGA 3LJBA 1C17M 3LESA 5KYYA 1NFOA 5AC4A 3MLGA 3SXZA 3L0IA 3L8IA 1FMVA 4JJGA 4CIHA 5L0GA 3TULA 2L7AA 2R7XA 2DYSC 2NUPA 3DAFA 1Y4CA 4C3BA 1JAFA 3ZG1A 1CGME 2OG2A 4RDAA 3EFOB 3VM6A 1YJGA 2HMZA 3H65A 3CQZA 3B9QA 3OEOA 1Q0FA 4EUKB 2D5RB 4W8PA 4A4AA 3S29A 4KNVA 2EIKC 1MMGA 3ZTZA 4DRHB 1C03A 4NCQA 2EIMC 3R7CA 2A0BA 2YVKA 2XS8A 2YL0A 2W4MA 3S27A 2J9BA 2QNLA 2Q00A 3GEIA 2Q4FA 1YARO 2R7QA 2AU5A 4N6CA 5F5HA 1M6TA 4IGGA 4LLEA 3VF0A 4ONSA 4UDVA 1H9GA 4XEFA 4NTAA 1RJ9A 2QY9A 3LEVA 2Q9AA 3UR3C 4U5DE 4OD5A 4NC3A 5BQGA 4EHPA 2TMVP 4JC7A 4O6NA 1VLSA 2HJMA 1E86A 3ZQVA 3C8GA 1Q0DA 2KGOA 3UNGC 1NU7D 2I15A 2G3KA 3C18A 3MFNA 4JRZA 4U5EE 3U8VA 5IY5C 5L0CA 1OXBA 2HZ8A 2CCYA 3AG1C 3EHNA 3UMHA 4YL1A 3RIPA 2NPUA 5HSWA 2PX3A 1MMAA 4MVSA 2ZPAA 3U9MA 1VYIA 4NTFA 2DGJA 2F22A 3VAYA 3BRJA 2EPOA 3S28A 5A6KA 2OU6A 3SXMA 4D4NA 3K66A 1A7EA 2DI3A 2IXOA 1A7VA 4JJFA 4CSAC 4OIPF 1E84A 3VYWA 2YLIA 5HV9A 4PR9A 3US6A 5DS5A 1TFOB 1PV3A 2CDQA 2GWWA 2W45A 3DXJF 3EGDB 4I1MA 3C62A 1BR1A 1YZCA 1M56C 3G4XA 2M4EA 4IAOA 1VLTA 2HSBA 4XEVA 2YQYA 2WL8A 3A9CA 3FMSA 4JEBA 2R7TA 2RD9A 1TWAA 1TR2A 2P1AA 3QVZA 4LDKA 4BJ5A 2KQ9A 4CDVA 1ZU4A 5JRAA 1RXQA 1CGOA 3SEOA 4ULVA 2J0WA 3JRTA 4K0DA 1OCRC 3G50A 1OW8A 1Z7Qc 1ZHYA 2NSFA 1TWCA 256BA 4YWQA 3AGTA 2C04A 3LNMB 2VCAA 2BL2A 4L6RA 2XL4A 2Y3BA 1O87A 2YL3A 5B1BC 1B68A 5DLJA 3GM1A 4AL1A 4OIRF 1Q0GA 2YLDA 3DMDA 2KK1A 2XLHA 3RW0A 1UFBA 2ZXPA 4E7ZA 2M64A 1V4AA 2WVNA 2L81A 3C63A 3JSEO 1SR2A 3MYFA 3DKAA 3NYLA 4K1OA 1K05A 2A6EF 5L3VA 4JVSA 2VB6A 2B0JA 1Z5ZA 1QSPA 4U5CE 3UMIA 2YZSA 2P0NA 3DJNB 3K1IA 5EK0A 2IOQA 3U8PA 2WZFA 1XWJA 2Q3TA 3FXHA 4YL3A 1I5NA 1Z6AA 4E0IA 3U0CA 1I4YA 2R7OA 3ZSUA 5KYNA 4XEKA 1WN0A 4CSAA 3HNJA 3RVYA 3AJMA 1OR3A 2RSEB 5FCLA 4EBBA 4QDLA 4JCHA 2XL8A 1JPNA 4M63A 2IYLD 2WVOA 1SYQA 1QKRA 4U5FE 4XPXA 1D1CA 3KYIA 4E18A 3RYLA 3W2VA 1C02A 3L8JA 3M1CB 3NKDA 2MWQA 4JTDB 3ZC4A 3QW0A 1T6UA 2IBFA 5KYXA 4J32B 3FAPB 4DRJB
chains in the Genus database with same CATH topology
3LAYA 3CSKA 2KNHA 4O6YA 2FFHA 4FESA 2J7PA 2IXNA 5D91A 4Q5SF 3PMRA 2XXAB 2R7UA 3OWTA 3EFOA 4PJLA 2J9VA 2PFDA 2VASA 3E70C 5L3QA 2Y3HA 5DQZA 2VH3A 3EZHA 3I5QA 3HLZA 2YHSA 3JSZA 2R7VA 5E2QA 5DS4A 3T6JA 4OD4A 4C7OB 4CBEA 3EG9B 3EH1A 3AQBA 4LACB 2J46A 4LERA 3QZCA 4W8KA 4FWVA 1S7ZA 3LLIA 4BG0A 3FVYA 2G3VA 2ZXOA 4YT5A 1KU2A 1VOMA 4O7GA 2J45A 2C03A 4ZLCA 4DBQA 4AE4B 1FMWA 3B0PA 2A1DD 2A68F 4OIOF 2JD3A 1D0ZA 3Q7LA 4CS7A 3I4UA 2Y3DA 3N0TA 3F46A 3GODA 3EGDA 4PJMA 2DYRC 1SF8A 4HEAJ 3KL4A 1ZHTA 4PJJA 2X51A 3IEEA 4HE8D 4HFKB 1FFTC 4HFFB 2LSEA 3K6BA 3T6BA 3X1OA 4XLPF 3NKEA 3ASNC 2CNWD 2W4BA 4C3DA 3KMIA 3RH3A 3EGXB 1TWGA 3NDBB 3O39A 4IJJA 3HJCA 2R7WA 3B0VC 2NUPB 3TD7A 4QI0A 5CI9A 2Q9CA 3K7DA 3RFYA 1PD0A 1ZHZA 1MMDA 3PHF2 4PK4A 2A6HF 3JYHA 2PX0A 2A69F 4A2NB 2V26A 4E7ZA 4XLNF 3K1HA 4GYTA 4YJWA 5CI8A 5EHHA 4GEHA 3UGOA 1N1CA 1O5HA 1V54C 5E3CA 3SP1A 1TWHA 1VYKA 3W8IA 3ZVRA 2R7SA 3CZ6A 2HV7A 1D0XA 3NYMA 1ZHXA 3KH2A 3W2WA 3ITFA 2H7OA 4X0RA 4E7SA 3W8HA 3JCUQ 4C3EA 4OINF 3JT1A 4IRUA 4P6IC 2EINC 3EJNA 1NG1A 3EHMA 4MQ9F 4EWCA 1WGWA 2QTVA 3AG4C 4CS9C 1IW7F 1BR2A 3SZRA 4CS8C 4BJ6C 3QMKA 4C7OA 4J30B 2KJGA 2Y3GA 3DZAA 4BEJA 4XTKA 1D0YA 2NG1A 4ULWA 3V7OA 2O9XA 3FAJA 3AG3C 2NUTB 4KNWA 2P7VA 3LLKA 5DS6A 5F5FA 5E3AA 3HTKC 4JURI 4AE4A 4OIQF 2ZXWC 5T1DB 4IWBA 4JZAA 2W9YA 3N24A 4Q7CA 1VK5A 5T3TA 4BJTA 1ZYRF 3Q6MA 1LKXA 3LS0A 2P6VA 3Q7GA 3DJUB 3DM9B 3EH2A 3ECSA 4H4KC 4DBRA 4CS9A 4PJNA 3Q6NA 1OKKA 2G62A 5E33A 1SZIA 3SNHA 2YEVA 3UMKA 1M57C 4RBNA 3ABLC 3E9VA 3L34A 3EGXA 4N06A 4XWJA 2Z15A 1D1AA 4DVYP 4YT2A 1M2VB 5B1AC 4G0HA 2H7BA 4U5GA 3I5PA 2CNWA 1OKKD 4KC9A 5KYUB 3AQCA 3GANA 1OCZC 1MMNA 3UGPA 4I3MA 2I8BA 1PCXA 1PD1A 4PFPA 4BJ5C 2L9JA 4U5BE 5KYWB 1OCCC 2ZXRA 2KW3C 5KYYB 2H7VC 3EPVA 2EILC 4KI2A 5T3WA 1ZHWA 1Z23A 1MNEA 3ABMC 1Z63A 1ST6A 4AK9A 4Q4ZF 4O79A 1TKNA 4YN0B 4BJ1A 4ANJA 2V3CC 1NU9C 3K1IC 4ZLDA 2J0XA 4YT4A 1LS1A 5EGYA 3DM5A 2MYSA 3OA1A 2WZLA 1RJ9B 3FHDA 3S0XA 5DVWA 4K7BA 1G8XA 3NYJA 2J9WA 1M2OA 3NG1A 4I1OB 1J8MF 4G7HF 1JPJA 2CW0F 4U5HA 4FX5A 4WJ0A 2OCCC 3AG2C 4F4BA 3RKOF 1BR4A 2WZGA 2HV6A 4LLCA 2J9UA 3T4RA 2XXAA 2Y69C 3ABKC 1SMYF 4KBLA 2PP4A 4DOZA 1QZXA 2PF4E 2NUTA 3LS1A 4G7OF 1V55C 3ZIBA 4DVZA 3K33A 1QLEC 1Z3IX 2WVQA 2GFHA 3F47A 3EG9A 1W2WA 3DD7A 4MNDA 2EIJC 3LNRA 3EZIA 4O6MA 3WODF 3B0UX 1FTSA 2Q9BA 1MNDA 4G7ZF 3ASOC 3NRHA 1OCOC 2WB7A 3FDQA 1IZMA 2BE5F 2E87A 3KKBA 3POVA 1LVKA 4PFOA 2XSEA 3X2QC 1FFHA 2IXPA 2FGYA 2R7RA 1M2VA 3SYNA 5D92A 5B3SC 4I44A 5KYUA 3N2ZB 3EQLF 1D1BA 4RD9A 2Y39A 1ZU5A 4NY3A 3O6XA 2IXMA 4QI2A 2CGEA 2XRHA 3DAGA 4B6IA 4CS8A 1VMAA 3MX3A 4AX2A 4BJ6A 3WG7C 4JW1A 2J7PD 5DQTA 1J8YF 5KYXB 1NZEA 5KYWA 3LJBA 3LESA 5KYYA 3MLGA 3L0IA 4CIHA 1FMVA 4JJGA 2R7XA 2DYSC 2NUPA 3DAFA 4C3BA 3ZG1A 2OG2A 4RDAA 3EFOB 3H65A 3CQZA 3B9QA 3OEOA 2D5RB 3S29A 4KNVA 2EIKC 1MMGA 2EIMC 2W4MA 3S27A 5F5HA 2R7QA 4LLEA 1RJ9A 2QY9A 3LEVA 2Q9AA 3UR3C 4U5DE 4OD5A 4O6NA 2KGOA 3UNGC 1NU7D 5IY5C 2G3KA 4U5EE 3UMHA 3AG1C 3EHNA 3RIPA 5HSWA 2PX3A 1MMAA 2ZPAA 1VYIA 2DGJA 3VAYA 3S28A 3K66A 2IXOA 4JJFA 4CSAC 4OIPF 3VYWA 5DS5A 2CDQA 2W45A 3DXJF 4I1MA 3EGDB 1BR1A 4IAOA 1M56C 2M4EA 2WL8A 2R7TA 1TWAA 1TR2A 4BJ5A 2KQ9A 1ZU4A 3SEOA 2J0WA 3JRTA 4K0DA 1OCRC 1ZHYA 1TWCA 4YWQA 2C04A 2XL4A 2Y3BA 1O87A 5B1BC 5DLJA 4OIRF 3DMDA 2ZXPA 2WVNA 2L81A 3NYLA 2A6EF 5L3VA 4JVSA 2VB6A 2B0JA 1Z5ZA 4U5CE 3UMIA 2YZSA 3DJNB 2IOQA 4YT8A 2WZFA 5BUOA 2Q3TA 1Z6AA 2R7OA 3ZSUA 5KYNA 4CSAA 5FCLA 4EBBA 4QDLA 4JCHA 4M63A 1JPNA 2IYLD 2WVOA 4U5FE 1D1CA 3RYLA 3W2VA 3M1CB 3NKDA 2MWQA 3ZC4A 5KYXA 4J32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0H A;  4DVY P;  4DVZ A; 
#chains in the Genus database with same CATH topology
 4MTO A;  4H54 A;  2BC5 A;  3LAY A;  3RQF A;  3CSK A;  2KNH A;  4O6Y A;  1LE4 A;  2FFH A;  2PNO A;  4FES A;  2J7P A;  2IXN A;  2GAQ A;  5D91 A;  1U89 A;  4Q5S F;  3TJ5 A;  3PMR A;  5F28 E;  1CGN A;  2XXA B;  2R7U A;  3OWT A;  3EFO A;  4PJL A;  4CX9 A;  2HJ3 A;  3KPH A;  3S9O A;  2J9V A;  1AEP A;  2PFD A;  4IB4 A;  2VAS A;  3E70 C;  5L3Q A;  4BPM A;  3HNL A;  2Y3H A;  4CJO A;  5DQZ A;  4D4X A;  2VH3 A;  3EZH A;  1YAU O;  3I5Q A;  3HLZ A;  2YHS A;  3JSZ A;  2R7V A;  3U2M A;  5E2Q A;  5DS4 A;  5COM A;  3T6J A;  4OD4 A;  3V5Z A;  1E2X A;  2ETS A;  2XXA A;  4C7O B;  4CBE A;  2LQG A;  3EG9 B;  3EH1 A;  3AQB A;  4LAC B;  1OW6 A;  2J46 A;  2LP4 A;  4LER A;  3QZC A;  4W8K A;  4FWV A;  1ORY A;  1S7Z A;  3LLI A;  2XLD A;  1YA9 A;  4JCZ A;  3O55 A;  4WAB A;  4BG0 A;  4EBK A;  3FVY A;  3H2V A;  2G3V A;  3U3B A;  2KC3 A;  4DRI B;  1TQG A;  2ZXO A;  4YT5 A;  1KU2 A;  2HS5 A;  1VOM A;  4O7G A;  2J45 A;  1XZQ A;  2C03 A;  3T9O A;  4ZLC A;  4U9D A;  4DBQ A;  1FR0 A;  4E17 A;  4AE4 B;  3GWL A;  1FMW A;  3B0P A;  2A1D D;  2A68 F;  3U3F A;  4OIO F;  2JD3 A;  1RKE B;  3H2U A;  1D0Z A;  2AP3 A;  3Q7L A;  1Y6D A;  2OJE D;  2OQM A;  4CS7 A;  3I4U A;  2Y3D A;  3N0T A;  5A6A A;  3F46 A;  2XS1 A;  2YKZ A;  3GOD A;  4Z9I A;  1DOW A;  3EGD A;  2JX0 A;  1R5I D;  4PJM A;  1OXK A;  1GS9 A;  2DYR C;  1SF8 A;  1QPU A;  1A7D A;  4HEA J;  4CIP A;  1EA8 A;  3KL4 A;  1ZHT A;  4MS2 A;  5BQI A;  4PJJ A;  2KSF A;  1BBH A;  2X51 A;  3GWN A;  3IEE A;  2YL7 A;  2LFF A;  2CYD A;  4NQF A;  3HKK A;  4HE8 D;  4HFK B;  2EPL X;  1FFT C;  2EPM X;  2LSE A;  3B71 A;  3K6B A;  4HFF B;  2YL1 A;  4XPW A;  3T6B A;  3X1O A;  3NKE A;  3SXY A;  4XLP F;  3ASN C;  2CNW D;  2W4B A;  4C3D A;  5COG A;  5JLI A;  3KMI A;  1AUE A;  3RH3 A;  3EGX B;  1TWG A;  1T6Q A;  3NDB B;  1T9K A;  3O39 A;  4IJJ A;  2IM8 A;  3HJC A;  4JEA A;  2R7W A;  1EI7 A;  2XM4 A;  3IQC A;  2NUP B;  1E85 A;  3B0V C;  3TD7 A;  3DI5 A;  3IHU A;  2HMQ A;  4QI0 A;  2AWC A;  5CI9 A;  2Q9C A;  4Z9J A;  3TQO A;  2PBE A;  3K7D A;  1NLX A;  3RFY A;  1PD0 A;  5JS5 A;  2A0U A;  1ZHZ A;  1MMD A;  2ICW G;  3PHF 2;  4PK4 A;  1T6I A;  2A6H F;  3JYH A;  3S84 A;  3B29 A;  2OKU A;  2PX0 A;  2A69 F;  2LFD A;  1HE1 A;  4A2N B;  2V26 A;  4DJ9 A;  1KNY A;  3K1H A;  4GYT A;  4YJW A;  4XLN F;  1GQA A;  5CI8 A;  3TOL A;  5JT4 A;  2LCH A;  3JTL O;  1HW1 A;  1O3U A;  4GEH A;  5EHH A;  1N1C A;  1O5H A;  1V54 C;  5E3C A;  3SP1 A;  3UGO A;  2R25 A;  4CDA A;  1TWH A;  1RMV A;  3DE8 A;  1VYK A;  2XLW A;  3RQE A;  1LIH A;  3ATP A;  3W8I A;  3BEH A;  3ZVR A;  2LD6 A;  3FOP A;  4MVQ A;  2R7S A;  3CZ6 A;  2AVK A;  2HV7 A;  1OW7 A;  2XL6 A;  1D0X A;  2EPN A;  3NYM A;  5FZT A;  3T6G B;  1ZHX A;  3KH2 A;  3L1M A;  3C7J A;  3W2W A;  2YWA A;  3ITF A;  5BUO A;  2H7O A;  4X0R A;  1E83 A;  4ER9 A;  3S90 A;  4E7S A;  3SXK A;  3W8H A;  3JCU Q;  4C3E A;  1WAS A;  2HUJ A;  1AVO B;  3JT1 A;  4IRU A;  1LI7 A;  4OIN F;  1QVX A;  4P6I C;  2QLA A;  2EIN C;  2DB4 A;  3LUT B;  5A6B D;  1A0B A;  3EJN A;  3NMI A;  4Z9H A;  2VCC A;  1NG1 A;  3EHM A;  4MQ9 F;  3M4B A;  4JTA B;  1WGW A;  4EWC A;  4MVM A;  1XZP A;  4LDR A;  2VCB A;  1T5O A;  2QTV A;  3AG4 C;  1S05 A;  4G78 A;  4EKW A;  3CEX A;  4CS9 C;  4WGZ A;  1IW7 F;  1BR2 A;  3AOU A;  3SZR A;  4CS8 C;  4BJ6 C;  2UUI A;  4EBJ A;  1JMW A;  3QMK A;  4C7O A;  4J30 B;  4J7T A;  4MTF A;  2KJG A;  3W4Y A;  4YT8 A;  2Y3G A;  3DZA A;  2XM0 A;  3U2L A;  3QVY A;  4BEJ A;  1YZA A;  4XTK A;  1D0Y A;  2NG1 A;  4ULW A;  4CJG A;  1R4T A;  3LEO A;  2YRF A;  2O9X A;  3V7O A;  3FAJ A;  4P9F A;  5L0F A;  3AG3 C;  2NUT B;  3IPM O;  5AGF A;  4KNW A;  2P7V A;  3LLK A;  2GA0 A;  5DS6 A;  1K40 A;  4MVU A;  5F5F A;  5GPG B;  5E3A A;  2OOC A;  1G5Z A;  3DE9 A;  3HTK C;  4JUR I;  1GGQ A;  2MHR A;  3GEE A;  3IQ5 A;  1H6G A;  4AE4 A;  4OIQ F;  1JR8 A;  2NSG A;  3GM2 A;  3PCV A;  2ZXW C;  5T1D B;  1RKE A;  1WAT A;  4IWB A;  4JZA A;  2W9Y A;  3N24 A;  4Q7C A;  1WOL A;  1VK5 A;  4EIY A;  3MYI A;  5T3T A;  3WHN A;  4BJT A;  1ZYR F;  5A6J A;  3J06 A;  1EQ1 A;  3Q6M A;  1YLM A;  2HFI A;  1LKX A;  3LS0 A;  1KTM A;  2P6V A;  3Q7G A;  4MVZ A;  2X0C A;  2XLO A;  3GOR A;  1APC A;  3DJU B;  3DM9 B;  1U6H A;  3EH2 A;  3ECS A;  1RKC A;  4H4K C;  4DBR A;  4CS9 A;  1FNT c;  2L6H A;  2LK4 A;  1LM3 B;  4PJN A;  3Q6N A;  1LI5 A;  1OKK A;  1OR2 A;  2G62 A;  2ZD9 A;  1K04 A;  3JYY A;  1SZI A;  5E33 A;  3V5X A;  4DXW A;  5L0J A;  3SNH A;  2YEV A;  3UMK A;  4YL0 A;  1M57 C;  4RBN A;  3ABL C;  5K0I A;  3TK0 A;  3E9V A;  3L34 A;  2P61 A;  3EGX A;  4N06 A;  4XWJ A;  2Z15 A;  1D1A A;  2EPK X;  4DVY P;  1TFK B;  4YT2 A;  1M2V B;  5AC5 A;  1LE2 A;  5B1A C;  4G0H A;  2H7B A;  2GDC A;  3GEH A;  3HNI A;  4U5G A;  3I5P A;  3V5Y A;  2CNW A;  1OKK D;  4KC9 A;  3U5S A;  5KYU B;  3AQC A;  2JPU A;  3FOO A;  1YA7 O;  3GAN A;  4JTC B;  4WGY A;  1OCZ C;  4BEM J;  1MMN A;  1NFN A;  3CAX A;  3QW1 A;  2QUP A;  4N6H A;  1Q0K A;  2FAP B;  3UGP A;  4I3M A;  1ZW2 A;  3U9J A;  1EKY A;  2XLV A;  1MQV A;  2I8B A;  1PCX A;  1YDI A;  1CPR A;  1PD1 A;  2VC9 A;  4PFP A;  4BJ5 C;  1UG7 A;  2L9J A;  1WTY A;  5CIV A;  4U5B E;  5KYW B;  2HKV A;  3WAQ A;  1OCC C;  3TOM A;  2ZXR A;  2KW3 C;  3G4Z A;  5KYY B;  2H7V C;  1NBB A;  2OEV A;  2H8A A;  3EPV A;  2EIL C;  4KI2 A;  5T3W A;  1ZHW A;  1VTM P;  1Z23 A;  5COF A;  2AWY A;  2QE9 A;  1MNE A;  3ABM C;  3DWW A;  4U9E A;  1Z63 A;  2D4U A;  1ST6 A;  4AK9 A;  1HY5 A;  1G4U S;  5L0I A;  4Q4Z F;  4O79 A;  1TKN A;  3JZ0 A;  4YN0 B;  1L7C A;  4BJ1 A;  4ANJ A;  3O10 A;  2V3C C;  1ORJ A;  1NU9 C;  2KYH A;  3GM3 A;  4PAC A;  1HMD A;  3ZWI A;  3K1I C;  2ASR A;  3M4C A;  5B3I A;  4ZLD A;  2R05 A;  3JRM O;  2J0X A;  4YK5 A;  4YT4 A;  1H9T A;  1HW2 A;  3ZQY A;  1ORS C;  1LS1 A;  4JKV A;  1JRA A;  3C8G D;  2MYS A;  3DM5 A;  5EGY A;  3OA1 A;  5JP7 A;  3IQT A;  2WZL A;  1RJ9 B;  2L6G A;  3FHD A;  4XQ1 A;  1V74 B;  4E0H A;  1LPE A;  4N4W A;  5DVW A;  4K7B A;  3S0X A;  1G8X A;  3KYJ A;  1ZVZ A;  3NYJ A;  4IAQ A;  2J9W A;  5A6B A;  1BDJ B;  1M2O A;  3VRC A;  3NG1 A;  4I1O B;  4IAR A;  3C8G B;  4FAP B;  1J8M F;  4G7H F;  1JPJ A;  5JVE A;  2CW0 F;  4U5H A;  4FX5 A;  4LDQ A;  2XLM A;  1NSG B;  3AGU A;  4WJ0 A;  2OCC C;  4AL0 A;  3AG2 C;  2LIG A;  4F4B A;  3NMJ A;  3RKO F;  2B0H A;  1BR4 A;  2WZG A;  3R2P A;  2HV6 A;  4LLC A;  2J9U A;  3TJ6 A;  3T4R A;  1OQC A;  2R9R B;  2Y69 C;  3ABK C;  1SMY F;  4KBL A;  2PP4 A;  1FAP B;  3HNK A;  4DOZ A;  1HE9 A;  1QZX A;  2PF4 E;  2NUT A;  1VB5 A;  3LS1 A;  1L3P A;  4JIO A;  4G7O F;  1V55 C;  1A41 A;  2R03 A;  1WWP A;  2L6F A;  3ZIB A;  4DVZ A;  3K33 A;  3M79 A;  3RQG A;  1QLE C;  1Z3I X;  2WVQ A;  2GFH A;  4P9T A;  1RCP A;  1ZZP A;  3F47 A;  2XLE A;  3EG9 A;  3QTH A;  1YYJ A;  1W2W A;  1Q0M A;  3DD7 A;  4MND A;  2EIJ C;  3LNR A;  3EZI A;  4O6M A;  3WOD F;  3B0U X;  1JOG A;  4NTB A;  1FTS A;  2OJQ A;  1I4Z A;  2Q9B A;  3C8Z A;  1MND A;  2UUH A;  5BQH A;  4G7Z F;  3ASO C;  3RF3 A;  3NRH A;  5A69 A;  4XPY A;  3ZTM A;  1OCO C;  2WB7 A;  4GQH A;  3RVZ A;  3PDM P;  3FDQ A;  1IZM A;  2BE5 F;  2OEX A;  3NMK A;  1GM5 A;  4JE9 A;  2E87 A;  3KKB A;  3M15 A;  1DOV A;  1HMO A;  4R32 A;  3POV A;  3A11 A;  3MBG A;  1LVK A;  4MVO A;  4MTG A;  4PFO A;  2XSE A;  3X2Q C;  5L0D A;  1FFH A;  1BZ4 A;  1U0B B;  1H7I A;  2IXP A;  2FGY A;  4MW8 A;  2R7R A;  1M2V A;  5TJ5 E;  3SYN A;  1G4W R;  1LS4 A;  5D92 A;  4I44 A;  1YVI A;  1YYX A;  3ZDL A;  5B3S C;  5KYU A;  3N2Z B;  1F1M A;  3EQL F;  3IQ6 A;  1D1B A;  4RD9 A;  1T01 A;  2Y39 A;  2Q7R A;  1ZU5 A;  1QQ3 A;  4NY3 A;  3O6X A;  2IXM A;  4QI2 A;  1ZW3 A;  2CGE A;  2XRH A;  3DAG A;  4MVR A;  5JSL A;  4B6I A;  4MW3 A;  1VMA A;  3MX3 A;  1CPQ A;  4AX2 A;  4CS8 A;  4J7Y A;  4BJ6 A;  2HSQ A;  5L0H A;  3WG7 C;  4JW1 A;  2J7P D;  5DQT A;  1J8Y F;  2J8W A;  5KYX B;  4CDY A;  2R02 A;  5JUA A;  1NZE A;  5KYW A;  2YLG A;  3LJB A;  1C17 M;  3LES A;  5KYY A;  1NFO A;  5AC4 A;  3MLG A;  3SXZ A;  3L0I A;  3L8I A;  1FMV A;  4JJG A;  4CIH A;  5L0G A;  3TUL A;  2L7A A;  2R7X A;  2DYS C;  2NUP A;  3DAF A;  1Y4C A;  4C3B A;  1JAF A;  3ZG1 A;  1CGM E;  2OG2 A;  4RDA A;  3EFO B;  3VM6 A;  1YJG A;  2HMZ A;  3H65 A;  3CQZ A;  3B9Q A;  3OEO A;  1Q0F A;  4EUK B;  2D5R B;  4W8P A;  4A4A A;  3S29 A;  4KNV A;  2EIK C;  1MMG A;  3ZTZ A;  4DRH B;  1C03 A;  4NCQ A;  2EIM C;  3R7C A;  2A0B A;  2YVK A;  2XS8 A;  2YL0 A;  2W4M A;  3S27 A;  2J9B A;  2QNL A;  2Q00 A;  3GEI A;  2Q4F A;  1YAR O;  2R7Q A;  2AU5 A;  4N6C A;  5F5H A;  1M6T A;  4IGG A;  4LLE A;  3VF0 A;  4ONS A;  4UDV A;  1H9G A;  4XEF A;  4NTA A;  1RJ9 A;  2QY9 A;  3LEV A;  2Q9A A;  3UR3 C;  4U5D E;  4OD5 A;  4NC3 A;  5BQG A;  4EHP A;  2TMV P;  4JC7 A;  4O6N A;  1VLS A;  2HJM A;  1E86 A;  3ZQV A;  3C8G A;  1Q0D A;  2KGO A;  3UNG C;  1NU7 D;  2I15 A;  2G3K A;  3C18 A;  3MFN A;  4JRZ A;  4U5E E;  3U8V A;  5IY5 C;  5L0C A;  1OXB A;  2HZ8 A;  2CCY A;  3AG1 C;  3EHN A;  3UMH A;  4YL1 A;  3RIP A;  2NPU A;  5HSW A;  2PX3 A;  1MMA A;  4MVS A;  2ZPA A;  3U9M A;  1VYI A;  4NTF A;  2DGJ A;  2F22 A;  3VAY A;  3BRJ A;  2EPO A;  3S28 A;  5A6K A;  2OU6 A;  3SXM A;  4D4N A;  3K66 A;  1A7E A;  2DI3 A;  2IXO A;  1A7V A;  4JJF A;  4CSA C;  4OIP F;  1E84 A;  3VYW A;  2YLI A;  5HV9 A;  4PR9 A;  3US6 A;  5DS5 A;  1TFO B;  1PV3 A;  2CDQ A;  2GWW A;  2W45 A;  3DXJ F;  3EGD B;  4I1M A;  3C62 A;  1BR1 A;  1YZC A;  1M56 C;  3G4X A;  2M4E A;  4IAO A;  1VLT A;  2HSB A;  4XEV A;  2YQY A;  2WL8 A;  3A9C A;  3FMS A;  4JEB A;  2R7T A;  2RD9 A;  1TWA A;  1TR2 A;  2P1A A;  3QVZ A;  4LDK A;  4BJ5 A;  2KQ9 A;  4CDV A;  1ZU4 A;  5JRA A;  1RXQ A;  1CGO A;  3SEO A;  4ULV A;  2J0W A;  3JRT A;  4K0D A;  1OCR C;  3G50 A;  1OW8 A;  1Z7Q c;  1ZHY A;  2NSF A;  1TWC A;  256B A;  4YWQ A;  3AGT A;  2C04 A;  3LNM B;  2VCA A;  2BL2 A;  4L6R A;  2XL4 A;  2Y3B A;  1O87 A;  2YL3 A;  5B1B C;  1B68 A;  5DLJ A;  3GM1 A;  4AL1 A;  4OIR F;  1Q0G A;  2YLD A;  3DMD A;  2KK1 A;  2XLH A;  3RW0 A;  1UFB A;  2ZXP A;  4E7Z A;  2M64 A;  1V4A A;  2WVN A;  2L81 A;  3C63 A;  3JSE O;  1SR2 A;  3MYF A;  3DKA A;  3NYL A;  4K1O A;  1K05 A;  2A6E F;  5L3V A;  4JVS A;  2VB6 A;  2B0J A;  1Z5Z A;  1QSP A;  4U5C E;  3UMI A;  2YZS A;  2P0N A;  3DJN B;  3K1I A;  5EK0 A;  2IOQ A;  3U8P A;  2WZF A;  1XWJ A;  2Q3T A;  3FXH A;  4YL3 A;  1I5N A;  1Z6A A;  4E0I A;  3U0C A;  1I4Y A;  2R7O A;  3ZSU A;  5KYN A;  4XEK A;  1WN0 A;  4CSA A;  3HNJ A;  3RVY A;  3AJM A;  1OR3 A;  2RSE B;  5FCL A;  4EBB A;  4QDL A;  4JCH A;  2XL8 A;  1JPN A;  4M63 A;  2IYL D;  2WVO A;  1SYQ A;  1QKR A;  4U5F E;  4XPX A;  1D1C A;  3KYI A;  4E18 A;  3RYL A;  3W2V A;  1C02 A;  3L8J A;  3M1C B;  3NKD A;  2MWQ A;  4JTD B;  3ZC4 A;  3QW0 A;  1T6U A;  2IBF A;  5KYX A;  4J32 B;  3FAP B;  4DRJ B; 
#chains in the Genus database with same CATH homology
 3LAY A;  3CSK A;  2KNH A;  4O6Y A;  2FFH A;  4FES A;  2J7P A;  2IXN A;  5D91 A;  4Q5S F;  3PMR A;  2XXA B;  2R7U A;  3OWT A;  3EFO A;  4PJL A;  2J9V A;  2PFD A;  2VAS A;  3E70 C;  5L3Q A;  2Y3H A;  5DQZ A;  2VH3 A;  3EZH A;  3I5Q A;  3HLZ A;  2YHS A;  3JSZ A;  2R7V A;  5E2Q A;  5DS4 A;  3T6J A;  4OD4 A;  4C7O B;  4CBE A;  3EG9 B;  3EH1 A;  3AQB A;  4LAC B;  2J46 A;  4LER A;  3QZC A;  4W8K A;  4FWV A;  1S7Z A;  3LLI A;  4BG0 A;  3FVY A;  2G3V A;  2ZXO A;  4YT5 A;  1KU2 A;  1VOM A;  4O7G A;  2J45 A;  2C03 A;  4ZLC A;  4DBQ A;  4AE4 B;  1FMW A;  3B0P A;  2A1D D;  2A68 F;  4OIO F;  2JD3 A;  1D0Z A;  3Q7L A;  4CS7 A;  3I4U A;  2Y3D A;  3N0T A;  3F46 A;  3GOD A;  3EGD A;  4PJM A;  2DYR C;  1SF8 A;  4HEA J;  3KL4 A;  1ZHT A;  4PJJ A;  2X51 A;  3IEE A;  4HE8 D;  4HFK B;  1FFT C;  4HFF B;  2LSE A;  3K6B A;  3T6B A;  3X1O A;  4XLP F;  3NKE A;  3ASN C;  2CNW D;  2W4B A;  4C3D A;  3KMI A;  3RH3 A;  3EGX B;  1TWG A;  3NDB B;  3O39 A;  4IJJ A;  3HJC A;  2R7W A;  3B0V C;  2NUP B;  3TD7 A;  4QI0 A;  5CI9 A;  2Q9C A;  3K7D A;  3RFY A;  1PD0 A;  1ZHZ A;  1MMD A;  3PHF 2;  4PK4 A;  2A6H F;  3JYH A;  2PX0 A;  2A69 F;  4A2N B;  2V26 A;  4E7Z A;  4XLN F;  3K1H A;  4GYT A;  4YJW A;  5CI8 A;  5EHH A;  4GEH A;  3UGO A;  1N1C A;  1O5H A;  1V54 C;  5E3C A;  3SP1 A;  1TWH A;  1VYK A;  3W8I A;  3ZVR A;  2R7S A;  3CZ6 A;  2HV7 A;  1D0X A;  3NYM A;  1ZHX A;  3KH2 A;  3W2W A;  3ITF A;  2H7O A;  4X0R A;  4E7S A;  3W8H A;  3JCU Q;  4C3E A;  4OIN F;  3JT1 A;  4IRU A;  4P6I C;  2EIN C;  3EJN A;  1NG1 A;  3EHM A;  4MQ9 F;  4EWC A;  1WGW A;  2QTV A;  3AG4 C;  4CS9 C;  1IW7 F;  1BR2 A;  3SZR A;  4CS8 C;  4BJ6 C;  3QMK A;  4C7O A;  4J30 B;  2KJG A;  2Y3G A;  3DZA A;  4BEJ A;  4XTK A;  1D0Y A;  2NG1 A;  4ULW A;  3V7O A;  2O9X A;  3FAJ A;  3AG3 C;  2NUT B;  4KNW A;  2P7V A;  3LLK A;  5DS6 A;  5F5F A;  5E3A A;  3HTK C;  4JUR I;  4AE4 A;  4OIQ F;  2ZXW C;  5T1D B;  4IWB A;  4JZA A;  2W9Y A;  3N24 A;  4Q7C A;  1VK5 A;  5T3T A;  4BJT A;  1ZYR F;  3Q6M A;  1LKX A;  3LS0 A;  2P6V A;  3Q7G A;  3DJU B;  3DM9 B;  3EH2 A;  3ECS A;  4H4K C;  4DBR A;  4CS9 A;  4PJN A;  3Q6N A;  1OKK A;  2G62 A;  5E33 A;  1SZI A;  3SNH A;  2YEV A;  3UMK A;  1M57 C;  4RBN A;  3ABL C;  3E9V A;  3L34 A;  3EGX A;  4N06 A;  4XWJ A;  2Z15 A;  1D1A A;  4DVY P;  4YT2 A;  1M2V B;  5B1A C;  4G0H A;  2H7B A;  4U5G A;  3I5P A;  2CNW A;  1OKK D;  4KC9 A;  5KYU B;  3AQC A;  3GAN A;  1OCZ C;  1MMN A;  3UGP A;  4I3M A;  2I8B A;  1PCX A;  1PD1 A;  4PFP A;  4BJ5 C;  2L9J A;  4U5B E;  5KYW B;  1OCC C;  2ZXR A;  2KW3 C;  5KYY B;  2H7V C;  3EPV A;  2EIL C;  4KI2 A;  5T3W A;  1ZHW A;  1Z23 A;  1MNE A;  3ABM C;  1Z63 A;  1ST6 A;  4AK9 A;  4Q4Z F;  4O79 A;  1TKN A;  4YN0 B;  4BJ1 A;  4ANJ A;  2V3C C;  1NU9 C;  3K1I C;  4ZLD A;  2J0X A;  4YT4 A;  1LS1 A;  5EGY A;  3DM5 A;  2MYS A;  3OA1 A;  2WZL A;  1RJ9 B;  3FHD A;  3S0X A;  5DVW A;  4K7B A;  1G8X A;  3NYJ A;  2J9W A;  1M2O A;  3NG1 A;  4I1O B;  1J8M F;  4G7H F;  1JPJ A;  2CW0 F;  4U5H A;  4FX5 A;  4WJ0 A;  2OCC C;  3AG2 C;  4F4B A;  3RKO F;  1BR4 A;  2WZG A;  2HV6 A;  4LLC A;  2J9U A;  3T4R A;  2XXA A;  2Y69 C;  3ABK C;  1SMY F;  4KBL A;  2PP4 A;  4DOZ A;  1QZX A;  2PF4 E;  2NUT A;  3LS1 A;  4G7O F;  1V55 C;  3ZIB A;  4DVZ A;  3K33 A;  1QLE C;  1Z3I X;  2WVQ A;  2GFH A;  3F47 A;  3EG9 A;  1W2W A;  3DD7 A;  4MND A;  2EIJ C;  3LNR A;  3EZI A;  4O6M A;  3WOD F;  3B0U X;  1FTS A;  2Q9B A;  1MND A;  4G7Z F;  3ASO C;  3NRH A;  1OCO C;  2WB7 A;  3FDQ A;  1IZM A;  2BE5 F;  2E87 A;  3KKB A;  3POV A;  1LVK A;  4PFO A;  2XSE A;  3X2Q C;  1FFH A;  2IXP A;  2FGY A;  2R7R A;  1M2V A;  3SYN A;  5D92 A;  5B3S C;  4I44 A;  5KYU A;  3N2Z B;  3EQL F;  1D1B A;  4RD9 A;  2Y39 A;  1ZU5 A;  4NY3 A;  3O6X A;  2IXM A;  4QI2 A;  2CGE A;  2XRH A;  3DAG A;  4B6I A;  4CS8 A;  1VMA A;  3MX3 A;  4AX2 A;  4BJ6 A;  3WG7 C;  4JW1 A;  2J7P D;  5DQT A;  1J8Y F;  5KYX B;  1NZE A;  5KYW A;  3LJB A;  3LES A;  5KYY A;  3MLG A;  3L0I A;  4CIH A;  1FMV A;  4JJG A;  2R7X A;  2DYS C;  2NUP A;  3DAF A;  4C3B A;  3ZG1 A;  2OG2 A;  4RDA A;  3EFO B;  3H65 A;  3CQZ A;  3B9Q A;  3OEO A;  2D5R B;  3S29 A;  4KNV A;  2EIK C;  1MMG A;  2EIM C;  2W4M A;  3S27 A;  5F5H A;  2R7Q A;  4LLE A;  1RJ9 A;  2QY9 A;  3LEV A;  2Q9A A;  3UR3 C;  4U5D E;  4OD5 A;  4O6N A;  2KGO A;  3UNG C;  1NU7 D;  5IY5 C;  2G3K A;  4U5E E;  3UMH A;  3AG1 C;  3EHN A;  3RIP A;  5HSW A;  2PX3 A;  1MMA A;  2ZPA A;  1VYI A;  2DGJ A;  3VAY A;  3S28 A;  3K66 A;  2IXO A;  4JJF A;  4CSA C;  4OIP F;  3VYW A;  5DS5 A;  2CDQ A;  2W45 A;  3DXJ F;  4I1M A;  3EGD B;  1BR1 A;  4IAO A;  1M56 C;  2M4E A;  2WL8 A;  2R7T A;  1TWA A;  1TR2 A;  4BJ5 A;  2KQ9 A;  1ZU4 A;  3SEO A;  2J0W A;  3JRT A;  4K0D A;  1OCR C;  1ZHY A;  1TWC A;  4YWQ A;  2C04 A;  2XL4 A;  2Y3B A;  1O87 A;  5B1B C;  5DLJ A;  4OIR F;  3DMD A;  2ZXP A;  2WVN A;  2L81 A;  3NYL A;  2A6E F;  5L3V A;  4JVS A;  2VB6 A;  2B0J A;  1Z5Z A;  4U5C E;  3UMI A;  2YZS A;  3DJN B;  2IOQ A;  4YT8 A;  2WZF A;  5BUO A;  2Q3T A;  1Z6A A;  2R7O A;  3ZSU A;  5KYN A;  4CSA A;  5FCL A;  4EBB A;  4QDL A;  4JCH A;  4M63 A;  1JPN A;  2IYL D;  2WVO A;  4U5F E;  1D1C A;  3RYL A;  3W2V A;  3M1C B;  3NKD A;  2MWQ A;  3ZC4 A;  5KYX A;  4J32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...