4G0HA

Crystal structure of the n-terminal domain of helicobacter pylori caga protein
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
515
structure length
450
Chain Sequence
b'LMGSHNGIKVSLLYAGNGGFGDKHDWNATVGYKNVATLINVHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNTKLDNLSEKEKEKFQNEIEDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFNNGDLSYTLKDYKNVTLQGSLKHDGVMFVDYSNGFNKVAVFNLPDLNNLAITSFVRRNLENKLTAKGLSLQEANKLIKDFLSSNKELAGKALNFNKAVAEAKSTGNYDEVKKAQKDLEKSLRKREHLEKEVEKKLESKSKNKMEAKAQANSQKDEIFALINKEANRDARAIAYTQNLKGIKRELSDKLEKISKDLKDFSKSFSKAEETLKALKGSVKDLGIPEWISKVENLNAALNEFKNKVTQAKSDLENSVKDVIINQKVTDKVDNLNQAVSVAKAMGDFSRVEQVLADLKNFSKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxicity-associated immunodominant antigen
molecule tags Toxin
source organism Helicobacter pylori
publication title Structural insights into Helicobacter pylori oncoprotein CagA interaction with beta 1 integrin.
pubmed doi rcsb
total genus 138
structure length 450
sequence length 515
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1270 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4g0hA02
4G0HA 4DVZA 4DVYP
chains in the Genus database with same CATH superfamily
2AVKA 4G7HF 3DJNB 4JCZA 4OIRF 5JS5A 5EHHA 1QQ3A 3ITFA 1QPUA 2V26A 3R2PA 3EH2A 3K33A 3T6GB 3O10A 4KNVA 3UGOA 3U3BA 1GGQA 4N06A 2C04A 2GFHA 1FNTc 2GA0A 1AEPA 2ZXPA 4MTFA 2J9BA 1ZU4A 2D5RB 2VB6A 2JD3A 1M57C 3VF0A 3GM3A 1T5OA 4Z9HA 3F46A 3H2VA 5KYYA 2TMVP 1T6QA 4E0HA 2XXAB 3O6XA 4XPWA 3S9OA 3TJ5A 3TOLA 4CBEA 2A6EF 3GANA 5COGA 4CS8C 1CGNA 3AGUA 4FX5A 2R7UA 1M2VA 3ZTMA 4WABA 2R9RB 4BJ6A 1SZIA 3G4ZA 2EILC 1TWGA 3IEEA 2A69F 2L81A 2WZLA 2YL0A 4DVZA 3T9OA 4R32A 2EPMX 5GPGB 1C02A 4ONSA 3KH2A 3L34A 2NUTB 1D1AA 1S05A 1G8XA 3FDQA 2HSQA 3BEHA 4YT5A 4XPXA 2A6HF 3KYJA 1ZU5A 2XLEA 2JPUA 3JZ0A 3Q7LA 4JJFA 4JURI 2XL4A 2KC3A 3JRTA 2L7AA 1OKKA 2AP3A 3OEOA 3PMRA 2YLGA 4FESA 3KKBA 4I1MA 4LLCA 4PFOA 4C3EA 4I3MA 4EBJA 3A9CA 1B68A 2FGYA 1T6IA 4JJGA 1NU7D 1GM5A 3MLGA 3V5ZA 1QVXA 1U6HA 2NPUA 3OWTA 4MVUA 3FOPA 3RH3A 3PHF2 3I5PA 2OG2A 2J46A 5TJ5E 5DQZA 4CSAA 4I1OB 3K7DA 1F1MA 1IZMA 1Q0KA 3RF3A 3SEOA 2MHRA 3NKEA 3S0XA 3IQCA 4KBLA 4KI2A 2OCCC 3TK0A 2ZD9A 1ORYA 1VK5A 2EPKX 3DZAA 4ULVA 5FZTA 1L3PA 2Y3HA 1NSGB 2ZPAA 2J45A 2PBEA 4P9TA 4CJOA 4Q4ZF 4CS7A 3EQLF 2HJ3A 3N0TA 1BBHA 4MVRA 1FTSA 3W2WA 2KGOA 3H65A 3EPVA 3GODA 3LJBA 2CW0F 3QVZA 1QZXA 5BQIA 4D4XA 5L0JA 3DE9A 4O79A 2V3CC 3NRHA 4C3BA 1I5NA 4NTAA 1SR2A 3ECSA 4DRJB 2R25A 5A6KA 3A11A 3VRCA 3SNHA 1JPJA 2J0WA 3EG9B 3LS0A 3FMSA 4LDRA 1G4US 1YZCA 3M15A 3POVA 5JVEA 2YL7A 4E17A 1H7IA 2LSEA 3LNRA 3ZG1A 4Z9JA 3LLKA 4WJ0A 1O87A 2C03A 3OA1A 1U0BB 3IQ6A 5COMA 4L6RA 4F4BA 2XLHA 1JOGA 1WTYA 1Z6AA 3MX3A 2MYSA 1D0ZA 3FXHA 3KMIA 4YN0B 3NYLA 4NQFA 5L0IA 1LVKA 4Q7CA 4ULWA 1AUEA 3UMHA 3LNMB 4AL0A 5F5FA 3PDMP 2BC5A 2EPLX 3US6A 5A6BA 1QKRA 1D1CA 2XM0A 1IW7F 1FMVA 2YQYA 3EZHA 1V74B 2R7WA 4U5BE 3HLZA 3HNLA 3RQEA 3V7OA 3MYIA 4HEAJ 3HKKA 3W4YA 1NU9C 1V4AA 2VCAA 3TJ6A 3QTHA 4OIPF 1V55C 2ZXOA 1FAPB 2HMQA 3MYFA 4IAOA 1YA7O 1OR3A 2OU6A 1OXBA 4YWQA 1MMNA 3DJUB 3U0CA 2LCHA 1APCA 3SXZA 3EJNA 5D91A 3ZVRA 2P1AA 5DS4A 4DVYP 2PP4A 1MMGA 3FHDA 2R05A 1H6GA 3JSZA 4C7OA 1PCXA 1HW2A 1ZW3A 3TOMA 2D4UA 4JEBA 4IB4A 1RCPA 2OEVA 3IHUA 1FFTC 3N24A 1ZYRF 1YJGA 4LACB 2EIMC 4P9FA 3U3FA 1OKKD 5BQHA 2G62A 2IXPA 3M4BA 1DOWA 3K66A 4JEAA 1TQGA 5FCLA 4DBRA 5HSWA 2DI3A 1NFNA 4IAQA 4ANJA 2G3VA 3EHMA 3JT1A 1I4ZA 2WVNA 4RBNA 1HE1A 1OCOC 1Q0DA 4OINF 4EIYA 1YLMA 2NG1A 3AG1C 2CCYA 3BRJA 3FVYA 4BJ5A 4CIPA 3DAFA 3LUTB 2Y39A 2L6GA 3S29A 4BPMA 4DJ9A 5L0GA 3RQGA 1RMVA 4ZLDA 1LIHA 1BR4A 2QE9A 2OJED 2YZSA 3GM2A 1XZQA 4LLEA 4N4WA 2J8WA 2PX0A 2Z15A 2Y69C 3SXYA 2PNOA 1PD1A 1OXKA 2R7OA 2XS8A 3WHNA 4CS9C 2YEVA 5KYNA 3K1HA 1L7CA 2QTVA 3DMDA 3B29A 3ZDLA 1C03A 2PFDA 5DVWA 3TULA 3NYJA 4XLNF 5L0FA 4E7SA 2QUPA 5CI9A 2HFIA 3DXJF 2LIGA 1NZEA 4X0RA 4C3DA 4JRZA 1O5HA 2Q3TA 3HTKC 4GEHA 3U2MA 3CZ6A 4EUKB 4LDKA 3NG1A 1GQAA 4J30B 4O7GA 5JP7A 3Q6MA 1D0XA 1E85A 4JTDB 2WZFA 2GAQA 3AQBA 3LLIA 2NUTA 1OCRC 1T6UA 2Q9CA 3HJCA 3I4UA 3ABKC 1A7VA 5T3WA 4OIQF 4DBQA 4MVZA 3U5SA 1TWHA 3CAXA 1LS1A 4CX9A 3LESA 2HS5A 4JCHA 3TQOA 3TD7A 1Q0MA 3E70C 3ZIBA 4AL1A 2KSFA 1E84A 2IOQA 2Y3BA 1HMOA 4FWVA 2ZXRA 1NFOA 1NG1A 2EIJC 4U9DA 1OQCA 5F28E 4BJ5C 1VLSA 2LD6A 3NMKA 3S27A 3RVZA 5IY5C 2P7VA 2L6FA 4YK5A 4DXWA 4YL1A 4EKWA 2XLWA 1V54C 2A68F 1A41A 1EA8A 3WAQA 2R7SA 4MVMA 3EFOB 3U9JA 1A7DA 3S84A 1J8YF 3B0VC 1SMYF 4KNWA 1YARO 3C8GB 4PACA 5T3TA 4K0DA 4RDAA 1JAFA 1UG7A 3ASOC 4IJJA 4IWBA 5B1AC 5B1BC 3QVYA 2IXOA 2KJGA 5E33A 2XLVA 2WVQA 3IQTA 1H9TA 4RD9A 1XZPA 1CPRA 2XS1A 4D4NA 4QI2A 2ICWG 4MVSA 2XSEA 2AU5A 3GORA 3L1MA 3CQZA 4G7ZF 4P6IC 2YLDA 3ATPA 5AGFA 1ZVZA 1Y6DA 3L0IA 1ZHYA 3ZWIA 1Y4CA 2Q4FA 4E7ZA 3EGXB 3AGTA 1T9KA 2ETSA 4OIOF 3B0UX 4U5FE 5DS6A 2QNLA 1LI5A 4HFFB 2IYLD 3LAYA 1WASA 4NC3A 4PR9A 4NY3A 1LKXA 2KYHA 4XEVA 3RW0A 4Q5SF 2IXMA 1YYXA 2YKZA 2YL1A 3C8GD 4JVSA 2IBFA 3W8HA 2WZGA 5A6BD 4KC9A 1E86A 5EK0A 2DYSC 4NTFA 2P0NA 3SYNA 3ASNC 4BEJA 1BR2A 2KK1A 1HW1A 1Z3IX 2YVKA 4MVOA 3VAYA 3UR3C 3X1OA 3QW1A 2R7VA 1M2OA 2YWAA 4MW3A 1CPQA 3QW0A 3EGDB 3C8GA 2H7OA 2H7VC 2J7PA 2QLAA 3V5XA 1U89A 1OCZC 2VASA 2WVOA 5L0DA 4HFKB 2L6HA 4EBKA 4XPYA 2P61A 4NCQA 3GEEA 3SZRA 3E9VA 5AC5A 3JRMO 1R4TA 1WGWA 3M79A 4AE4B 3JSEO 4EBBA 5E3AA 3VM6A 2HMZA 1OW7A 3IQ5A 2QY9A 4WGZA 2J9UA 1MMDA 1RKEB 2NSGA 4U5GA 2W4BA 1JPNA 1UFBA 4MS2A 3AG2C 5CIVA 1VMAA 1M56C 5KYUA 2OQMA 3R7CA 4U5HA 5L0CA 5JRAA 4J32B 4IARA 4MQ9F 4ZLCA 3DD7A 3HNJA 2JX0A 2EPOA 4PJLA 3U8VA 2VCBA 3S28A 2M64A 1CGOA 2MWQA 1EI7A 2W9YA 5BUOA 1EKYA 4G7OF 4AE4A 3X2QC 4O6YA 4A2NB 5JUAA 2XLDA 2EINC 1AVOB 1NBBA 3B0PA 5JLIA 3G4XA 4H54A 2HZ8A 3EGDA 4CJGA 3DI5A 3O55A 4JTCB 3M1CB 4N6CA 3JYYA 3NDBB 3DWWA 4DRHB 1VB5A 2DGJA 4H4KC 5F5HA 1TKNA 1KNYA 2WL8A 1G5ZA 3C7JA 3ABLC 4C7OB 1XWJA 2NUPB 4PFPA 2Y3DA 4CS8A 4XTKA 3SP1A 2X0CA 3AG4C 3UGPA 2W45A 3DKAA 3U8PA 3RIPA 4BJTA 5KYWB 2J0XA 4U5CE 2ASRA 1M6TA 2YHSA 2HSBA 2CNWA 2HJMA 3KYIA 3AJMA 3GEHA 4G78A 4MNDA 3J06A 2IXNA 3FAPB 2LK4A 4CIHA 2B0HA 3PCVA 2R02A 5A6AA 1K05A 1VYKA 1VOMA 3MBGA 4J7TA 5DQTA 5D92A 4IRUA 3GWLA 4YT4A 2I15A 5KYWA 4PJJA 3V5YA 4JW1A 4JIOA 1WATA 2CNWD 1QLEC 4XLPF 3W8IA 3QMKA 4YL0A 1LM3B 4AK9A 4CDYA 3MFNA 2A0UA 3UMKA 2W4MA 4BJ1A 4PJNA 3JYHA 2LQGA 2AWCA 2Y3GA 3CSKA 3RVYA 2XL6A 1H9GA 3C63A 2YLIA 1LPEA 1LE4A 2XRHA 3KL4A 2CDQA 1YVIA 4GYTA 2VCCA 4LERA 2AWYA 1Z5ZA 3LEOA 4GQHA 3N2ZB 1OW8A 1Z63A 3K1IA 1BZ4A 5KYXA 1SF8A 4WGYA 256BA 3EGXA 4MTOA 3WODF 1MMAA 4PJMA 2OEXA 1HE9A 3NYMA 1ZHXA 4O6MA 1OR2A 3HNIA 4XEFA 2J9WA 5COFA 1A7EA 4B6IA 3GM1A 5K0IA 3JCUQ 2DB4A 4HE8D 3L8IA 1O3UA 1ZHTA 1E83A 4MVQA 1MQVA 1PD0A 1YDIA 1VLTA 1T01A 1WWPA 1FMWA 1RJ9A 2Q9BA 1KU2A 1TWAA 2HV6A 1W2WA 3I5QA 4EWCA 1TFOB 2M4EA 2UUIA 2LFFA 1K04A 3KPHA 3AOUA 5B3SC 1Z23A 3SXKA 1I4YA 2GWWA 1N1CA 2H7BA 1MNDA 2CGEA 5JSLA 2Q7RA 2R03A 4CDVA 3RFYA 3Q7GA 1RJ9B 1WOLA 2RD9A 4JTAB 4BJ6C 2NSFA 3EFOA 1D0YA 3UNGC 2B0JA 3HNKA 3M4CA 2I8BA 3DAGA 4U9EA 1YAUO 1M2VB 2FFHA 5BQGA 5HV9A 2XLOA 2XXAA 4YL3A 1J8MF 2ZXWC 3EH1A 3F47A 5E3CA 1JR8A 3SXMA 4J7YA 3AQCA 3T6JA 5KYUB 2Q00A 2A1DD 3K1IC 1RKEA 3DM9B 4MW8A 4Z9IA 4AX2A 3S90A 1BDJB 3EHNA 3DE8A 2X51A 2VC9A 2J7PD 1BR1A 1SYQA 1K40A 2BL2A 5DS5A 2OKUA 2A0BA 1ORSC 2Q9AA 2XLMA 1A0BA 3U2LA 4G0HA 3ZSUA 1Q0GA 2XM4A 2R7RA 3B9QA 1YYJA 2PX3A 3ZTZA 3CEXA 3QZCA 3B71A 4E0IA 4BG0A 2G3KA 1VYIA 1CGME 1S7ZA 4K1OA 1NLXA 2L9JA 4A4AA 1TR2A 1TWCA 1LS4A 4FAPB 4U5DE 4YJWA 2P6VA 3O39A 3NKDA 2KW3C 4O6NA 1EQ1A 2F22A 1G4WR 3LEVA 3C62A 2HUJA 4E18A 2KQ9A 2PF4E 2R7QA 1LE2A 3ZQYA 5AC4A 3C18A 2DYRC 2UUHA 1HMDA 2EPNA 3ABMC 4LDQA 4CS9A 1JRAA 3DM5A 3NMIA 4JZAA 4JE9A 2OJQA 3JTLO 2H8AA 4M63A 5EGYA 3GWNA 2FAPB 4CSAC 3T6BA 2R7XA 1R5ID 5E2QA 1VTMP 1E2XA 4BEMJ 4OD4A 4YT2A 4XQ1A 4W8PA 3K6BA 1Q0FA 2NUPA 4K7BA 2CYDA 4NTBA 5CI8A 3ZC4A 4DOZA 4ER9A 1MNEA 1FFHA 2LFDA 3WG7C 2KNHA 1ORJA 1YZAA 3VYWA 5A69A 4I44A 2J9VA 5L3VA 2XL8A 1C17M 2YRFA 1PV3A 1ST6A 1ZHZA 3RKOF 1QSPA 1YA9A 3L8JA 2WB7A 1DOVA 2O9XA 2HKVA 1HY5A 1LI7A 2YL3A 3U9MA 4W8KA 1WN0A 5L0HA 1RKCA 3ZQVA 1FR0A 3T4RA 3FAJA 2E87A 2IM8A 4CDAA 1ZW2A 2GDCA 1ZHWA 1GS9A 4QDLA 4EHPA 2R7TA 3EZIA 3FOOA 4UDVA 1KTMA 4QI0A 2OOCA 2EIKC 1RXQA 5A6JA 2HV7A 4MTGA 3Q6NA 1Z7Qc 4JC7A 2LP4A 3RQFA 5KYXB 3GEIA 3C8ZA 3H2UA 1OW6A 4N6HA 1D1BA 4OD5A 4PK4A 2BE5F 1TFKB 3EG9A 4XEKA 3RYLA 3UMIA 5KYYB 5L3QA 4IGGA 4JKVA 4U5EE 4YT8A 5B3IA 4XWJA 1OCCC 2RSEB 5DLJA 5T1DB 3IPMO 3NMJA 3G50A 4DRIB 3LS1A 3W2VA 1ZZPA 3AG3C 2VH3A 1JMWA 5JT4A
chains in the Genus database with same CATH topology
4G7HF 3DJNB 4OIRF 5EHHA 3ITFA 2V26A 3EH2A 3K33A 4KNVA 3UGOA 4N06A 2C04A 2GFHA 2ZXPA 1ZU4A 2D5RB 2VB6A 2JD3A 1M57C 3F46A 5KYYA 2XXAB 3O6XA 4CBEA 2A6EF 3GANA 4CS8C 4FX5A 1M2VA 4BJ6A 1SZIA 3IEEA 2EILC 1TWGA 2A69F 2L81A 2WZLA 4DVZA 3KH2A 3L34A 2NUTB 1D1AA 3FDQA 1G8XA 4YT5A 2A6HF 4JJFA 1ZU5A 4JURI 3Q7LA 2XL4A 3JRTA 3OEOA 3PMRA 1OKKA 4I1MA 4FESA 4PFOA 4LLCA 3KKBA 4C3EA 4I3MA 2FGYA 4JJGA 1NU7D 3MLGA 3OWTA 3RH3A 3PHF2 3I5PA 2OG2A 2J46A 5DQZA 4CSAA 4I1OB 3K7DA 1IZMA 3SEOA 3NKEA 3S0XA 4KBLA 4KI2A 2OCCC 1VK5A 3DZAA 2Y3HA 2ZPAA 2J45A 4Q4ZF 4CS7A 3EQLF 3W2WA 3N0TA 1FTSA 2KGOA 3H65A 3EPVA 3GODA 3LJBA 2CW0F 1QZXA 4O79A 2V3CC 3NRHA 4C3BA 3ECSA 3SNHA 1JPJA 2J0WA 3EG9B 3LS0A 3POVA 2LSEA 3LNRA 3ZG1A 3LLKA 4WJ0A 1O87A 2C03A 3OA1A 4F4BA 1Z6AA 3MX3A 2MYSA 1D0ZA 3KMIA 4YN0B 3NYLA 1LVKA 4Q7CA 4ULWA 3UMHA 5F5FA 1D1CA 1IW7F 1FMVA 3EZHA 2R7WA 4U5BE 3HLZA 3V7OA 4HEAJ 1NU9C 4OIPF 1V55C 2ZXOA 4IAOA 4YWQA 1MMNA 3DJUB 3EJNA 5D91A 3ZVRA 5DS4A 4DVYP 2PP4A 1MMGA 3FHDA 3JSZA 4C7OA 1PCXA 3N24A 1FFTC 1ZYRF 4LACB 2EIMC 1OKKD 2G62A 2IXPA 5HSWA 3K66A 5FCLA 4DBRA 4ANJA 2G3VA 3EHMA 3JT1A 4RBNA 2WVNA 4OINF 1OCOC 5DS6A 2NG1A 3AG1C 3FVYA 4BJ5A 3DAFA 4ZLDA 2Y39A 3S29A 4LLEA 1BR4A 2YZSA 2PX0A 2Z15A 2Y69C 2R7OA 1PD1A 4CS9C 5KYNA 2YEVA 3K1HA 2QTVA 3DMDA 2PFDA 5DVWA 3NYJA 4XLNF 4E7SA 5CI9A 3DXJF 4X0RA 1NZEA 4C3DA 1O5HA 2Q3TA 3HTKC 4GEHA 3CZ6A 3NG1A 4J30B 4O7GA 3Q6MA 1D0XA 2WZFA 3AQBA 3LLIA 2NUTA 1OCRC 2Q9CA 3HJCA 3I4UA 3ABKC 5T3WA 4OIQF 4DBQA 1TWHA 1LS1A 3LESA 4JCHA 3ZIBA 3TD7A 3E70C 2IOQA 2Y3BA 4FWVA 2ZXRA 1NG1A 2EIJC 4BJ5C 3S27A 5IY5C 2P7VA 1V54C 2A68F 2R7SA 3EFOB 1J8YF 3B0VC 1SMYF 4KNWA 5T3TA 4K0DA 4RDAA 4IJJA 4IWBA 3ASOC 5B1AC 5B1BC 2IXOA 2KJGA 5E33A 2WVQA 4RD9A 4QI2A 2XSEA 3CQZA 4G7ZF 4P6IC 3L0IA 1ZHYA 4E7ZA 3B0UX 3EGXB 4OIOF 4U5FE 4HFFB 2XXAA 2IYLD 3LAYA 4NY3A 1LKXA 4Q5SF 2IXMA 4JVSA 3W8HA 2WZGA 4KC9A 2DYSC 3SYNA 3ASNC 4BEJA 1BR2A 3VAYA 3X1OA 1Z3IX 3UR3C 2R7VA 1M2OA 3EGDB 2H7OA 2H7VC 2J7PA 1OCZC 2VASA 2WVOA 4HFKB 3SZRA 3E9VA 4AE4B 1WGWA 4EBBA 5E3AA 2QY9A 2J9UA 1MMDA 4U5GA 2W4BA 1JPNA 3AG2C 1VMAA 1M56C 5KYUA 4U5HA 4J32B 4MQ9F 4ZLCA 3DD7A 4PJLA 3S28A 2MWQA 5BUOA 2W9YA 4G7OF 4AE4A 3X2QC 4O6YA 4A2NB 2EINC 3B0PA 3EGDA 3M1CB 3NDBB 2DGJA 4H4KC 5F5HA 1TKNA 2WL8A 3ABLC 4C7OB 2NUPB 4PFPA 2Y3DA 4CS8A 4XTKA 3SP1A 3AG4C 3UGPA 2W45A 4BJTA 5KYWB 3RIPA 2J0XA 4U5CE 2YHSA 2CNWA 4MNDA 2IXNA 4CIHA 1VYKA 1VOMA 5DQTA 5D92A 4IRUA 4YT4A 5KYWA 4PJJA 4JW1A 2CNWD 1QLEC 4XLPF 3W8IA 3QMKA 4AK9A 3UMKA 2W4MA 4BJ1A 4PJNA 3JYHA 2Y3GA 3CSKA 2XRHA 3KL4A 2CDQA 4GYTA 4LERA 1Z5ZA 3N2ZB 1Z63A 5KYXA 1SF8A 3EGXA 3WODF 1MMAA 4PJMA 3NYMA 1ZHXA 4O6MA 4B6IA 2J9WA 3JCUQ 4HE8D 1ZHTA 1PD0A 2Q9BA 1FMWA 1RJ9A 1KU2A 1TWAA 2HV6A 1W2WA 3I5QA 4EWCA 2M4EA 5B3SC 1Z23A 1N1CA 2H7BA 1MNDA 2CGEA 3RFYA 3Q7GA 1RJ9B 4BJ6C 2R7UA 3EFOA 1D0YA 3UNGC 2B0JA 2I8BA 3DAGA 2FFHA 1M2VB 1J8MF 2ZXWC 3EH1A 3F47A 5E3CA 5KYUB 3AQCA 3T6JA 3K1IC 2A1DD 3DM9B 4AX2A 3EHNA 2X51A 2J7PD 1BR1A 5DS5A 2Q9AA 4G0HA 3ZSUA 2R7RA 3B9QA 2PX3A 3QZCA 4BG0A 2G3KA 1VYIA 1S7ZA 2L9JA 1TR2A 1TWCA 4U5DE 4YJWA 2P6VA 3O39A 3NKDA 2KW3C 4O6NA 3LEVA 2KQ9A 2PF4E 2R7QA 2DYRC 3ABMC 4CS9A 3DM5A 4JZAA 4M63A 5EGYA 4CSAC 3T6BA 2R7XA 5E2QA 4OD4A 4YT2A 3K6BA 2NUPA 4K7BA 5CI8A 3ZC4A 4DOZA 1MNEA 1FFHA 3WG7C 2KNHA 3VYWA 4I44A 2J9VA 5L3VA 1ZHZA 1ST6A 3RKOF 2WB7A 2O9XA 4W8KA 3T4RA 3FAJA 2E87A 1ZHWA 4QDLA 2R7TA 3EZIA 4QI0A 2EIKC 2HV7A 3Q6NA 5KYXB 4OD5A 1D1BA 4PK4A 2BE5F 3EG9A 3RYLA 3UMIA 5KYYB 5L3QA 4U5EE 4YT8A 4XWJA 1OCCC 5DLJA 5T1DB 3LS1A 3W2VA 3AG3C 2VH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G0H A;  4DVZ A;  4DVY P; 
#chains in the Genus database with same CATH topology
 2AVK A;  4G7H F;  3DJN B;  4JCZ A;  4OIR F;  5JS5 A;  5EHH A;  1QQ3 A;  3ITF A;  1QPU A;  2V26 A;  3R2P A;  3EH2 A;  3K33 A;  3T6G B;  3O10 A;  4KNV A;  3UGO A;  3U3B A;  1GGQ A;  4N06 A;  2C04 A;  2GFH A;  1FNT c;  2GA0 A;  1AEP A;  2ZXP A;  4MTF A;  2J9B A;  1ZU4 A;  2D5R B;  2VB6 A;  2JD3 A;  1M57 C;  3VF0 A;  3GM3 A;  1T5O A;  4Z9H A;  3F46 A;  3H2V A;  5KYY A;  2TMV P;  1T6Q A;  4E0H A;  2XXA B;  3O6X A;  4XPW A;  3S9O A;  3TJ5 A;  3TOL A;  4CBE A;  2A6E F;  3GAN A;  5COG A;  4CS8 C;  1CGN A;  3AGU A;  4FX5 A;  2R7U A;  1M2V A;  3ZTM A;  4WAB A;  2R9R B;  4BJ6 A;  1SZI A;  3G4Z A;  2EIL C;  1TWG A;  3IEE A;  2A69 F;  2L81 A;  2WZL A;  2YL0 A;  4DVZ A;  3T9O A;  4R32 A;  2EPM X;  5GPG B;  1C02 A;  4ONS A;  3KH2 A;  3L34 A;  2NUT B;  1D1A A;  1S05 A;  1G8X A;  3FDQ A;  2HSQ A;  3BEH A;  4YT5 A;  4XPX A;  2A6H F;  3KYJ A;  1ZU5 A;  2XLE A;  2JPU A;  3JZ0 A;  3Q7L A;  4JJF A;  4JUR I;  2XL4 A;  2KC3 A;  3JRT A;  2L7A A;  1OKK A;  2AP3 A;  3OEO A;  3PMR A;  2YLG A;  4FES A;  3KKB A;  4I1M A;  4LLC A;  4PFO A;  4C3E A;  4I3M A;  4EBJ A;  3A9C A;  1B68 A;  2FGY A;  1T6I A;  4JJG A;  1NU7 D;  1GM5 A;  3MLG A;  3V5Z A;  1QVX A;  1U6H A;  2NPU A;  3OWT A;  4MVU A;  3FOP A;  3RH3 A;  3PHF 2;  3I5P A;  2OG2 A;  2J46 A;  5TJ5 E;  5DQZ A;  4CSA A;  4I1O B;  3K7D A;  1F1M A;  1IZM A;  1Q0K A;  3RF3 A;  3SEO A;  2MHR A;  3NKE A;  3S0X A;  3IQC A;  4KBL A;  4KI2 A;  2OCC C;  3TK0 A;  2ZD9 A;  1ORY A;  1VK5 A;  2EPK X;  3DZA A;  4ULV A;  5FZT A;  1L3P A;  2Y3H A;  1NSG B;  2ZPA A;  2J45 A;  2PBE A;  4P9T A;  4CJO A;  4Q4Z F;  4CS7 A;  3EQL F;  2HJ3 A;  3N0T A;  1BBH A;  4MVR A;  1FTS A;  3W2W A;  2KGO A;  3H65 A;  3EPV A;  3GOD A;  3LJB A;  2CW0 F;  3QVZ A;  1QZX A;  5BQI A;  4D4X A;  5L0J A;  3DE9 A;  4O79 A;  2V3C C;  3NRH A;  4C3B A;  1I5N A;  4NTA A;  1SR2 A;  3ECS A;  4DRJ B;  2R25 A;  5A6K A;  3A11 A;  3VRC A;  3SNH A;  1JPJ A;  2J0W A;  3EG9 B;  3LS0 A;  3FMS A;  4LDR A;  1G4U S;  1YZC A;  3M15 A;  3POV A;  5JVE A;  2YL7 A;  4E17 A;  1H7I A;  2LSE A;  3LNR A;  3ZG1 A;  4Z9J A;  3LLK A;  4WJ0 A;  1O87 A;  2C03 A;  3OA1 A;  1U0B B;  3IQ6 A;  5COM A;  4L6R A;  4F4B A;  2XLH A;  1JOG A;  1WTY A;  1Z6A A;  3MX3 A;  2MYS A;  1D0Z A;  3FXH A;  3KMI A;  4YN0 B;  3NYL A;  4NQF A;  5L0I A;  1LVK A;  4Q7C A;  4ULW A;  1AUE A;  3UMH A;  3LNM B;  4AL0 A;  5F5F A;  3PDM P;  2BC5 A;  2EPL X;  3US6 A;  5A6B A;  1QKR A;  1D1C A;  2XM0 A;  1IW7 F;  1FMV A;  2YQY A;  3EZH A;  1V74 B;  2R7W A;  4U5B E;  3HLZ A;  3HNL A;  3RQE A;  3V7O A;  3MYI A;  4HEA J;  3HKK A;  3W4Y A;  1NU9 C;  1V4A A;  2VCA A;  3TJ6 A;  3QTH A;  4OIP F;  1V55 C;  2ZXO A;  1FAP B;  2HMQ A;  3MYF A;  4IAO A;  1YA7 O;  1OR3 A;  2OU6 A;  1OXB A;  4YWQ A;  1MMN A;  3DJU B;  3U0C A;  2LCH A;  1APC A;  3SXZ A;  3EJN A;  5D91 A;  3ZVR A;  2P1A A;  5DS4 A;  4DVY P;  2PP4 A;  1MMG A;  3FHD A;  2R05 A;  1H6G A;  3JSZ A;  4C7O A;  1PCX A;  1HW2 A;  1ZW3 A;  3TOM A;  2D4U A;  4JEB A;  4IB4 A;  1RCP A;  2OEV A;  3IHU A;  1FFT C;  3N24 A;  1ZYR F;  1YJG A;  4LAC B;  2EIM C;  4P9F A;  3U3F A;  1OKK D;  5BQH A;  2G62 A;  2IXP A;  3M4B A;  1DOW A;  3K66 A;  4JEA A;  1TQG A;  5FCL A;  4DBR A;  5HSW A;  2DI3 A;  1NFN A;  4IAQ A;  4ANJ A;  2G3V A;  3EHM A;  3JT1 A;  1I4Z A;  2WVN A;  4RBN A;  1HE1 A;  1OCO C;  1Q0D A;  4OIN F;  4EIY A;  1YLM A;  2NG1 A;  3AG1 C;  2CCY A;  3BRJ A;  3FVY A;  4BJ5 A;  4CIP A;  3DAF A;  3LUT B;  2Y39 A;  2L6G A;  3S29 A;  4BPM A;  4DJ9 A;  5L0G A;  3RQG A;  1RMV A;  4ZLD A;  1LIH A;  1BR4 A;  2QE9 A;  2OJE D;  2YZS A;  3GM2 A;  1XZQ A;  4LLE A;  4N4W A;  2J8W A;  2PX0 A;  2Z15 A;  2Y69 C;  3SXY A;  2PNO A;  1PD1 A;  1OXK A;  2R7O A;  2XS8 A;  3WHN A;  4CS9 C;  2YEV A;  5KYN A;  3K1H A;  1L7C A;  2QTV A;  3DMD A;  3B29 A;  3ZDL A;  1C03 A;  2PFD A;  5DVW A;  3TUL A;  3NYJ A;  4XLN F;  5L0F A;  4E7S A;  2QUP A;  5CI9 A;  2HFI A;  3DXJ F;  2LIG A;  1NZE A;  4X0R A;  4C3D A;  4JRZ A;  1O5H A;  2Q3T A;  3HTK C;  4GEH A;  3U2M A;  3CZ6 A;  4EUK B;  4LDK A;  3NG1 A;  1GQA A;  4J30 B;  4O7G A;  5JP7 A;  3Q6M A;  1D0X A;  1E85 A;  4JTD B;  2WZF A;  2GAQ A;  3AQB A;  3LLI A;  2NUT A;  1OCR C;  1T6U A;  2Q9C A;  3HJC A;  3I4U A;  3ABK C;  1A7V A;  5T3W A;  4OIQ F;  4DBQ A;  4MVZ A;  3U5S A;  1TWH A;  3CAX A;  1LS1 A;  4CX9 A;  3LES A;  2HS5 A;  4JCH A;  3TQO A;  3TD7 A;  1Q0M A;  3E70 C;  3ZIB A;  4AL1 A;  2KSF A;  1E84 A;  2IOQ A;  2Y3B A;  1HMO A;  4FWV A;  2ZXR A;  1NFO A;  1NG1 A;  2EIJ C;  4U9D A;  1OQC A;  5F28 E;  4BJ5 C;  1VLS A;  2LD6 A;  3NMK A;  3S27 A;  3RVZ A;  5IY5 C;  2P7V A;  2L6F A;  4YK5 A;  4DXW A;  4YL1 A;  4EKW A;  2XLW A;  1V54 C;  2A68 F;  1A41 A;  1EA8 A;  3WAQ A;  2R7S A;  4MVM A;  3EFO B;  3U9J A;  1A7D A;  3S84 A;  1J8Y F;  3B0V C;  1SMY F;  4KNW A;  1YAR O;  3C8G B;  4PAC A;  5T3T A;  4K0D A;  4RDA A;  1JAF A;  1UG7 A;  3ASO C;  4IJJ A;  4IWB A;  5B1A C;  5B1B C;  3QVY A;  2IXO A;  2KJG A;  5E33 A;  2XLV A;  2WVQ A;  3IQT A;  1H9T A;  4RD9 A;  1XZP A;  1CPR A;  2XS1 A;  4D4N A;  4QI2 A;  2ICW G;  4MVS A;  2XSE A;  2AU5 A;  3GOR A;  3L1M A;  3CQZ A;  4G7Z F;  4P6I C;  2YLD A;  3ATP A;  5AGF A;  1ZVZ A;  1Y6D A;  3L0I A;  1ZHY A;  3ZWI A;  1Y4C A;  2Q4F A;  4E7Z A;  3EGX B;  3AGT A;  1T9K A;  2ETS A;  4OIO F;  3B0U X;  4U5F E;  5DS6 A;  2QNL A;  1LI5 A;  4HFF B;  2IYL D;  3LAY A;  1WAS A;  4NC3 A;  4PR9 A;  4NY3 A;  1LKX A;  2KYH A;  4XEV A;  3RW0 A;  4Q5S F;  2IXM A;  1YYX A;  2YKZ A;  2YL1 A;  3C8G D;  4JVS A;  2IBF A;  3W8H A;  2WZG A;  5A6B D;  4KC9 A;  1E86 A;  5EK0 A;  2DYS C;  4NTF A;  2P0N A;  3SYN A;  3ASN C;  4BEJ A;  1BR2 A;  2KK1 A;  1HW1 A;  1Z3I X;  2YVK A;  4MVO A;  3VAY A;  3UR3 C;  3X1O A;  3QW1 A;  2R7V A;  1M2O A;  2YWA A;  4MW3 A;  1CPQ A;  3QW0 A;  3EGD B;  3C8G A;  2H7O A;  2H7V C;  2J7P A;  2QLA A;  3V5X A;  1U89 A;  1OCZ C;  2VAS A;  2WVO A;  5L0D A;  4HFK B;  2L6H A;  4EBK A;  4XPY A;  2P61 A;  4NCQ A;  3GEE A;  3SZR A;  3E9V A;  5AC5 A;  3JRM O;  1R4T A;  1WGW A;  3M79 A;  4AE4 B;  3JSE O;  4EBB A;  5E3A A;  3VM6 A;  2HMZ A;  1OW7 A;  3IQ5 A;  2QY9 A;  4WGZ A;  2J9U A;  1MMD A;  1RKE B;  2NSG A;  4U5G A;  2W4B A;  1JPN A;  1UFB A;  4MS2 A;  3AG2 C;  5CIV A;  1VMA A;  1M56 C;  5KYU A;  2OQM A;  3R7C A;  4U5H A;  5L0C A;  5JRA A;  4J32 B;  4IAR A;  4MQ9 F;  4ZLC A;  3DD7 A;  3HNJ A;  2JX0 A;  2EPO A;  4PJL A;  3U8V A;  2VCB A;  3S28 A;  2M64 A;  1CGO A;  2MWQ A;  1EI7 A;  2W9Y A;  5BUO A;  1EKY A;  4G7O F;  4AE4 A;  3X2Q C;  4O6Y A;  4A2N B;  5JUA A;  2XLD A;  2EIN C;  1AVO B;  1NBB A;  3B0P A;  5JLI A;  3G4X A;  4H54 A;  2HZ8 A;  3EGD A;  4CJG A;  3DI5 A;  3O55 A;  4JTC B;  3M1C B;  4N6C A;  3JYY A;  3NDB B;  3DWW A;  4DRH B;  1VB5 A;  2DGJ A;  4H4K C;  5F5H A;  1TKN A;  1KNY A;  2WL8 A;  1G5Z A;  3C7J A;  3ABL C;  4C7O B;  1XWJ A;  2NUP B;  4PFP A;  2Y3D A;  4CS8 A;  4XTK A;  3SP1 A;  2X0C A;  3AG4 C;  3UGP A;  2W45 A;  3DKA A;  3U8P A;  3RIP A;  4BJT A;  5KYW B;  2J0X A;  4U5C E;  2ASR A;  1M6T A;  2YHS A;  2HSB A;  2CNW A;  2HJM A;  3KYI A;  3AJM A;  3GEH A;  4G78 A;  4MND A;  3J06 A;  2IXN A;  3FAP B;  2LK4 A;  4CIH A;  2B0H A;  3PCV A;  2R02 A;  5A6A A;  1K05 A;  1VYK A;  1VOM A;  3MBG A;  4J7T A;  5DQT A;  5D92 A;  4IRU A;  3GWL A;  4YT4 A;  2I15 A;  5KYW A;  4PJJ A;  3V5Y A;  4JW1 A;  4JIO A;  1WAT A;  2CNW D;  1QLE C;  4XLP F;  3W8I A;  3QMK A;  4YL0 A;  1LM3 B;  4AK9 A;  4CDY A;  3MFN A;  2A0U A;  3UMK A;  2W4M A;  4BJ1 A;  4PJN A;  3JYH A;  2LQG A;  2AWC A;  2Y3G A;  3CSK A;  3RVY A;  2XL6 A;  1H9G A;  3C63 A;  2YLI A;  1LPE A;  1LE4 A;  2XRH A;  3KL4 A;  2CDQ A;  1YVI A;  4GYT A;  2VCC A;  4LER A;  2AWY A;  1Z5Z A;  3LEO A;  4GQH A;  3N2Z B;  1OW8 A;  1Z63 A;  3K1I A;  1BZ4 A;  5KYX A;  1SF8 A;  4WGY A;  256B A;  3EGX A;  4MTO A;  3WOD F;  1MMA A;  4PJM A;  2OEX A;  1HE9 A;  3NYM A;  1ZHX A;  4O6M A;  1OR2 A;  3HNI A;  4XEF A;  2J9W A;  5COF A;  1A7E A;  4B6I A;  3GM1 A;  5K0I A;  3JCU Q;  2DB4 A;  4HE8 D;  3L8I A;  1O3U A;  1ZHT A;  1E83 A;  4MVQ A;  1MQV A;  1PD0 A;  1YDI A;  1VLT A;  1T01 A;  1WWP A;  1FMW A;  1RJ9 A;  2Q9B A;  1KU2 A;  1TWA A;  2HV6 A;  1W2W A;  3I5Q A;  4EWC A;  1TFO B;  2M4E A;  2UUI A;  2LFF A;  1K04 A;  3KPH A;  3AOU A;  5B3S C;  1Z23 A;  3SXK A;  1I4Y A;  2GWW A;  1N1C A;  2H7B A;  1MND A;  2CGE A;  5JSL A;  2Q7R A;  2R03 A;  4CDV A;  3RFY A;  3Q7G A;  1RJ9 B;  1WOL A;  2RD9 A;  4JTA B;  4BJ6 C;  2NSF A;  3EFO A;  1D0Y A;  3UNG C;  2B0J A;  3HNK A;  3M4C A;  2I8B A;  3DAG A;  4U9E A;  1YAU O;  1M2V B;  2FFH A;  5BQG A;  5HV9 A;  2XLO A;  2XXA A;  4YL3 A;  1J8M F;  2ZXW C;  3EH1 A;  3F47 A;  5E3C A;  1JR8 A;  3SXM A;  4J7Y A;  3AQC A;  3T6J A;  5KYU B;  2Q00 A;  2A1D D;  3K1I C;  1RKE A;  3DM9 B;  4MW8 A;  4Z9I A;  4AX2 A;  3S90 A;  1BDJ B;  3EHN A;  3DE8 A;  2X51 A;  2VC9 A;  2J7P D;  1BR1 A;  1SYQ A;  1K40 A;  2BL2 A;  5DS5 A;  2OKU A;  2A0B A;  1ORS C;  2Q9A A;  2XLM A;  1A0B A;  3U2L A;  4G0H A;  3ZSU A;  1Q0G A;  2XM4 A;  2R7R A;  3B9Q A;  1YYJ A;  2PX3 A;  3ZTZ A;  3CEX A;  3QZC A;  3B71 A;  4E0I A;  4BG0 A;  2G3K A;  1VYI A;  1CGM E;  1S7Z A;  4K1O A;  1NLX A;  2L9J A;  4A4A A;  1TR2 A;  1TWC A;  1LS4 A;  4FAP B;  4U5D E;  4YJW A;  2P6V A;  3O39 A;  3NKD A;  2KW3 C;  4O6N A;  1EQ1 A;  2F22 A;  1G4W R;  3LEV A;  3C62 A;  2HUJ A;  4E18 A;  2KQ9 A;  2PF4 E;  2R7Q A;  1LE2 A;  3ZQY A;  5AC4 A;  3C18 A;  2DYR C;  2UUH A;  1HMD A;  2EPN A;  3ABM C;  4LDQ A;  4CS9 A;  1JRA A;  3DM5 A;  3NMI A;  4JZA A;  4JE9 A;  2OJQ A;  3JTL O;  2H8A A;  4M63 A;  5EGY A;  3GWN A;  2FAP B;  4CSA C;  3T6B A;  2R7X A;  1R5I D;  5E2Q A;  1VTM P;  1E2X A;  4BEM J;  4OD4 A;  4YT2 A;  4XQ1 A;  4W8P A;  3K6B A;  1Q0F A;  2NUP A;  4K7B A;  2CYD A;  4NTB A;  5CI8 A;  3ZC4 A;  4DOZ A;  4ER9 A;  1MNE A;  1FFH A;  2LFD A;  3WG7 C;  2KNH A;  1ORJ A;  1YZA A;  3VYW A;  5A69 A;  4I44 A;  2J9V A;  5L3V A;  2XL8 A;  1C17 M;  2YRF A;  1PV3 A;  1ST6 A;  1ZHZ A;  3RKO F;  1QSP A;  1YA9 A;  3L8J A;  2WB7 A;  1DOV A;  2O9X A;  2HKV A;  1HY5 A;  1LI7 A;  2YL3 A;  3U9M A;  4W8K A;  1WN0 A;  5L0H A;  1RKC A;  3ZQV A;  1FR0 A;  3T4R A;  3FAJ A;  2E87 A;  2IM8 A;  4CDA A;  1ZW2 A;  2GDC A;  1ZHW A;  1GS9 A;  4QDL A;  4EHP A;  2R7T A;  3EZI A;  3FOO A;  4UDV A;  1KTM A;  4QI0 A;  2OOC A;  2EIK C;  1RXQ A;  5A6J A;  2HV7 A;  4MTG A;  3Q6N A;  1Z7Q c;  4JC7 A;  2LP4 A;  3RQF A;  5KYX B;  3GEI A;  3C8Z A;  3H2U A;  1OW6 A;  4N6H A;  1D1B A;  4OD5 A;  4PK4 A;  2BE5 F;  1TFK B;  3EG9 A;  4XEK A;  3RYL A;  3UMI A;  5KYY B;  5L3Q A;  4IGG A;  4JKV A;  4U5E E;  4YT8 A;  5B3I A;  4XWJ A;  1OCC C;  2RSE B;  5DLJ A;  5T1D B;  3IPM O;  3NMJ A;  3G50 A;  4DRI B;  3LS1 A;  3W2V A;  1ZZP A;  3AG3 C;  2VH3 A;  1JMW A;  5JT4 A; 
#chains in the Genus database with same CATH homology
 4G7H F;  3DJN B;  4OIR F;  5EHH A;  3ITF A;  2V26 A;  3EH2 A;  3K33 A;  4KNV A;  3UGO A;  4N06 A;  2C04 A;  2GFH A;  2ZXP A;  1ZU4 A;  2D5R B;  2VB6 A;  2JD3 A;  1M57 C;  3F46 A;  5KYY A;  2XXA B;  3O6X A;  4CBE A;  2A6E F;  3GAN A;  4CS8 C;  4FX5 A;  1M2V A;  4BJ6 A;  1SZI A;  3IEE A;  2EIL C;  1TWG A;  2A69 F;  2L81 A;  2WZL A;  4DVZ A;  3KH2 A;  3L34 A;  2NUT B;  1D1A A;  3FDQ A;  1G8X A;  4YT5 A;  2A6H F;  4JJF A;  1ZU5 A;  4JUR I;  3Q7L A;  2XL4 A;  3JRT A;  3OEO A;  3PMR A;  1OKK A;  4I1M A;  4FES A;  4PFO A;  4LLC A;  3KKB A;  4C3E A;  4I3M A;  2FGY A;  4JJG A;  1NU7 D;  3MLG A;  3OWT A;  3RH3 A;  3PHF 2;  3I5P A;  2OG2 A;  2J46 A;  5DQZ A;  4CSA A;  4I1O B;  3K7D A;  1IZM A;  3SEO A;  3NKE A;  3S0X A;  4KBL A;  4KI2 A;  2OCC C;  1VK5 A;  3DZA A;  2Y3H A;  2ZPA A;  2J45 A;  4Q4Z F;  4CS7 A;  3EQL F;  3W2W A;  3N0T A;  1FTS A;  2KGO A;  3H65 A;  3EPV A;  3GOD A;  3LJB A;  2CW0 F;  1QZX A;  4O79 A;  2V3C C;  3NRH A;  4C3B A;  3ECS A;  3SNH A;  1JPJ A;  2J0W A;  3EG9 B;  3LS0 A;  3POV A;  2LSE A;  3LNR A;  3ZG1 A;  3LLK A;  4WJ0 A;  1O87 A;  2C03 A;  3OA1 A;  4F4B A;  1Z6A A;  3MX3 A;  2MYS A;  1D0Z A;  3KMI A;  4YN0 B;  3NYL A;  1LVK A;  4Q7C A;  4ULW A;  3UMH A;  5F5F A;  1D1C A;  1IW7 F;  1FMV A;  3EZH A;  2R7W A;  4U5B E;  3HLZ A;  3V7O A;  4HEA J;  1NU9 C;  4OIP F;  1V55 C;  2ZXO A;  4IAO A;  4YWQ A;  1MMN A;  3DJU B;  3EJN A;  5D91 A;  3ZVR A;  5DS4 A;  4DVY P;  2PP4 A;  1MMG A;  3FHD A;  3JSZ A;  4C7O A;  1PCX A;  3N24 A;  1FFT C;  1ZYR F;  4LAC B;  2EIM C;  1OKK D;  2G62 A;  2IXP A;  5HSW A;  3K66 A;  5FCL A;  4DBR A;  4ANJ A;  2G3V A;  3EHM A;  3JT1 A;  4RBN A;  2WVN A;  4OIN F;  1OCO C;  5DS6 A;  2NG1 A;  3AG1 C;  3FVY A;  4BJ5 A;  3DAF A;  4ZLD A;  2Y39 A;  3S29 A;  4LLE A;  1BR4 A;  2YZS A;  2PX0 A;  2Z15 A;  2Y69 C;  2R7O A;  1PD1 A;  4CS9 C;  5KYN A;  2YEV A;  3K1H A;  2QTV A;  3DMD A;  2PFD A;  5DVW A;  3NYJ A;  4XLN F;  4E7S A;  5CI9 A;  3DXJ F;  4X0R A;  1NZE A;  4C3D A;  1O5H A;  2Q3T A;  3HTK C;  4GEH A;  3CZ6 A;  3NG1 A;  4J30 B;  4O7G A;  3Q6M A;  1D0X A;  2WZF A;  3AQB A;  3LLI A;  2NUT A;  1OCR C;  2Q9C A;  3HJC A;  3I4U A;  3ABK C;  5T3W A;  4OIQ F;  4DBQ A;  1TWH A;  1LS1 A;  3LES A;  4JCH A;  3ZIB A;  3TD7 A;  3E70 C;  2IOQ A;  2Y3B A;  4FWV A;  2ZXR A;  1NG1 A;  2EIJ C;  4BJ5 C;  3S27 A;  5IY5 C;  2P7V A;  1V54 C;  2A68 F;  2R7S A;  3EFO B;  1J8Y F;  3B0V C;  1SMY F;  4KNW A;  5T3T A;  4K0D A;  4RDA A;  4IJJ A;  4IWB A;  3ASO C;  5B1A C;  5B1B C;  2IXO A;  2KJG A;  5E33 A;  2WVQ A;  4RD9 A;  4QI2 A;  2XSE A;  3CQZ A;  4G7Z F;  4P6I C;  3L0I A;  1ZHY A;  4E7Z A;  3B0U X;  3EGX B;  4OIO F;  4U5F E;  4HFF B;  2XXA A;  2IYL D;  3LAY A;  4NY3 A;  1LKX A;  4Q5S F;  2IXM A;  4JVS A;  3W8H A;  2WZG A;  4KC9 A;  2DYS C;  3SYN A;  3ASN C;  4BEJ A;  1BR2 A;  3VAY A;  3X1O A;  1Z3I X;  3UR3 C;  2R7V A;  1M2O A;  3EGD B;  2H7O A;  2H7V C;  2J7P A;  1OCZ C;  2VAS A;  2WVO A;  4HFK B;  3SZR A;  3E9V A;  4AE4 B;  1WGW A;  4EBB A;  5E3A A;  2QY9 A;  2J9U A;  1MMD A;  4U5G A;  2W4B A;  1JPN A;  3AG2 C;  1VMA A;  1M56 C;  5KYU A;  4U5H A;  4J32 B;  4MQ9 F;  4ZLC A;  3DD7 A;  4PJL A;  3S28 A;  2MWQ A;  5BUO A;  2W9Y A;  4G7O F;  4AE4 A;  3X2Q C;  4O6Y A;  4A2N B;  2EIN C;  3B0P A;  3EGD A;  3M1C B;  3NDB B;  2DGJ A;  4H4K C;  5F5H A;  1TKN A;  2WL8 A;  3ABL C;  4C7O B;  2NUP B;  4PFP A;  2Y3D A;  4CS8 A;  4XTK A;  3SP1 A;  3AG4 C;  3UGP A;  2W45 A;  4BJT A;  5KYW B;  3RIP A;  2J0X A;  4U5C E;  2YHS A;  2CNW A;  4MND A;  2IXN A;  4CIH A;  1VYK A;  1VOM A;  5DQT A;  5D92 A;  4IRU A;  4YT4 A;  5KYW A;  4PJJ A;  4JW1 A;  2CNW D;  1QLE C;  4XLP F;  3W8I A;  3QMK A;  4AK9 A;  3UMK A;  2W4M A;  4BJ1 A;  4PJN A;  3JYH A;  2Y3G A;  3CSK A;  2XRH A;  3KL4 A;  2CDQ A;  4GYT A;  4LER A;  1Z5Z A;  3N2Z B;  1Z63 A;  5KYX A;  1SF8 A;  3EGX A;  3WOD F;  1MMA A;  4PJM A;  3NYM A;  1ZHX A;  4O6M A;  4B6I A;  2J9W A;  3JCU Q;  4HE8 D;  1ZHT A;  1PD0 A;  2Q9B A;  1FMW A;  1RJ9 A;  1KU2 A;  1TWA A;  2HV6 A;  1W2W A;  3I5Q A;  4EWC A;  2M4E A;  5B3S C;  1Z23 A;  1N1C A;  2H7B A;  1MND A;  2CGE A;  3RFY A;  3Q7G A;  1RJ9 B;  4BJ6 C;  2R7U A;  3EFO A;  1D0Y A;  3UNG C;  2B0J A;  2I8B A;  3DAG A;  2FFH A;  1M2V B;  1J8M F;  2ZXW C;  3EH1 A;  3F47 A;  5E3C A;  5KYU B;  3AQC A;  3T6J A;  3K1I C;  2A1D D;  3DM9 B;  4AX2 A;  3EHN A;  2X51 A;  2J7P D;  1BR1 A;  5DS5 A;  2Q9A A;  4G0H A;  3ZSU A;  2R7R A;  3B9Q A;  2PX3 A;  3QZC A;  4BG0 A;  2G3K A;  1VYI A;  1S7Z A;  2L9J A;  1TR2 A;  1TWC A;  4U5D E;  4YJW A;  2P6V A;  3O39 A;  3NKD A;  2KW3 C;  4O6N A;  3LEV A;  2KQ9 A;  2PF4 E;  2R7Q A;  2DYR C;  3ABM C;  4CS9 A;  3DM5 A;  4JZA A;  4M63 A;  5EGY A;  4CSA C;  3T6B A;  2R7X A;  5E2Q A;  4OD4 A;  4YT2 A;  3K6B A;  2NUP A;  4K7B A;  5CI8 A;  3ZC4 A;  4DOZ A;  1MNE A;  1FFH A;  3WG7 C;  2KNH A;  3VYW A;  4I44 A;  2J9V A;  5L3V A;  1ZHZ A;  1ST6 A;  3RKO F;  2WB7 A;  2O9X A;  4W8K A;  3T4R A;  3FAJ A;  2E87 A;  1ZHW A;  4QDL A;  2R7T A;  3EZI A;  4QI0 A;  2EIK C;  2HV7 A;  3Q6N A;  5KYX B;  4OD5 A;  1D1B A;  4PK4 A;  2BE5 F;  3EG9 A;  3RYL A;  3UMI A;  5KYY B;  5L3Q A;  4U5E E;  4YT8 A;  4XWJ A;  1OCC C;  5DLJ A;  5T1D B;  3LS1 A;  3W2V A;  3AG3 C;  2VH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...