1L7CA

Alpha-catenin fragment, residues 385-651
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
244
structure length
240
Chain Sequence
DHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDMDENEFIDASRLVYDGIRDIRKAVLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Alpha E-catenin
publication title Biochemical and structural definition of the l-afadin- and actin-binding sites of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
total genus 98
structure length 240
sequence length 244
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1l7cA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1l7cA01
2GDCA 1DOWA 3S90A 3TJ6A 1YDIA 1U6HA 5L0DA 1L7CA 4E17A 1RKEA 1XWJA 4EHPA 4K1OA 3T6GB 5L0FA 4IGGA 1ZW2A 1DOVA 1H6GA 2L7AA 1ST6A 1T01A 3H2VA 3TJ5A 2GWWA 3H2UA 1QKRA 1RKCA 1SYQA 2B0HA 2LQGA 4ONSA 4P9TA 2X0CA 5L0CA 4W8PA 1TR2A 1ZVZA 4PR9A 3ZDLA 5L0IA 1ZW3A 3RF3A 5L0GA 4DJ9A 2HSQA 2IBFA 1RKEB 1U89A 5FZTA 4E18A 3VF0A 3MYIA 5L0JA 5L0HA
chains in the Genus database with same CATH superfamily
1DOWA 3LLIA 4JE9A 1Z5ZA 3NYLA 4MVSA 2AP3A 1D0YA 3B71A 1NLXA 2J9VA 2IYLD 2YVKA 2IXPA 3C7JA 3AOUA 5CI9A 2M64A 4E17A 3A11A 4JZAA 2XLDA 4CSAA 1U0BB 2IXNA 2Y39A 4LACB 4CJOA 2ICWG 1VK5A 2KK1A 3PMRA 2QUPA 2YWAA 4JJGA 4WJ0A 1RMVA 4O6NA 3ZTZA 2Y3DA 2LQGA 3EFOA 4OD4A 4E7SA 1NFOA 3CSKA 3W8IA 4YT2A 5KYNA 3FDQA 3O6XA 4EBJA 2YKZA 3WG7C 1YYJA 3C8ZA 4BJTA 1ZHTA 1C03A 5JUAA 2HKVA 1VOMA 2R9RB 3EGXA 3T9OA 2Y3HA 3SZRA 3EG9A 3K1HA 1RJ9B 3MYFA 1R5ID 3O55A 3S28A 4NTAA 4YL3A 2UUHA 2CNWA 2LIGA 3C8GD 3SXMA 1PV3A 4LLEA 2AWYA 1FTSA 3SEOA 1OKKA 4PJMA 2QLAA 4X0RA 1TFKB 1BR2A 4XPWA 4E7ZA 2ZPAA 5B1AC 3E9VA 3EHMA 3R7CA 2YL0A 1E85A 4MVOA 4H4KC 4MVMA 4K1OA 5KYYB 3A9CA 3AQCA 4XQ1A 2O9XA 5A69A 4OIPF 3M4CA 2PF4E 3M4BA 1YZAA 4ONSA 3N24A 4KC9A 5F5HA 5L3VA 4FWVA 2BL2A 2EINC 3K7DA 4YWQA 1V74B 2XS1A 3NRHA 5BUOA 3RVYA 2R7QA 4HFKB 4J7YA 1G4WR 4JJFA 1D1BA 3GANA 3IHUA 3POVA 5L0HA 2R7SA 2F22A 2R7XA 3FMSA 2HMZA 3IQ6A 1Z23A 3RKOF 5A6AA 2DB4A 2EPNA 2PP4A 3M1CB 3HNIA 2OJQA 1M57C 2VCBA 3G4ZA 3UR3C 1LI5A 1VYIA 5DLJA 4ER9A 4U9DA 4EHPA 2JX0A 2Q00A 1V55C 4JW1A 4FAPB 2Z15A 2XM0A 3OEOA 3GODA 2KSFA 4XEKA 4PJJA 3KYJA 3DE8A 4CS9C 3UMIA 4EUKB 3JYYA 3SXKA 2R7UA 3K6BA 2B0HA 3ABMC 1HMDA 2EPOA 2XLWA 3MFNA 4G0HA 1TWAA 3C62A 4BJ5C 5A6JA 3TK0A 3X2QC 3UGPA 5EHHA 2YQYA 3N2ZB 3UGOA 4MNDA 4DJ9A 3DJUB 3HNLA 4KNWA 5KYUA 3L34A 4JCHA 4E18A 3V5YA 3KL4A 1NU9C 1ZYRF 2YLIA 5AGFA 3OWTA 3L0IA 1OCOC 4QI2A 2NSGA 5TJ5E 4U5DE 3DAFA 4F4BA 1YA7O 4KBLA 1C02A 1AUEA 1ZU5A 3TJ6A 1CPRA 1GS9A 4LERA 2MHRA 3AGTA 4EBBA 1TWCA 2EPMX 4NC3A 3CEXA 3TD7A 5DQTA 1OCRC 4G7OF 4AL1A 1ORJA 1M2VA 1T01A 4FX5A 3LEVA 1HE9A 2ASRA 2R05A 1HY5A 3KPHA 2XM4A 2I15A 2LSEA 4XEFA 3FHDA 2LCHA 2OEXA 1OCZC 1R4TA 1OQCA 1T6UA 3TOLA 3AG4C 2OKUA 2L9JA 1H9TA 4CS8A 3ZG1A 4JEAA 1K04A 1MNDA 3FAJA 3R2PA 3ABLC 4MS2A 1NU7D 2H8AA 3U9JA 2CGEA 1LI7A 4JTCB 1ZU4A 2WL8A 2QE9A 2NUPA 2W4MA 2A0UA 2KQ9A 1FMWA 2VH3A 2D4UA 4AE4A 1JPJA 1LPEA 4LDRA 4XTKA 4OIRF 1L7CA 3AQBA 3C63A 1XWJA 1L3PA 1AEPA 3LUTB 3DMDA 3L8JA 3Q7LA 4Q4ZF 4R32A 3VAYA 1Y6DA 5DS4A 1IW7F 3IPMO 2HV7A 3NYMA 1V4AA 3QVZA 2NUTA 3L8IA 4NTFA 3PHF2 2CDQA 2J45A 2L6FA 2WVQA 3FXHA 3M15A 3MLGA 4DBQA 2C04A 3V5ZA 4ULVA 5L0GA 3S0XA 2HUJA 2R7RA 3KKBA 3NYJA 1CGME 3MYIA 2IOQA 3JRTA 2HZ8A 4IAOA 2A6HF 1SZIA 3EPVA 4U5CE 4U5FE 4EKWA 1JOGA 3DKAA 5T3TA 1D1CA 2H7OA 3EFOB 4MVZA 2EPLX 4D4NA 2P7VA 3N0TA 2EIMC 2M4EA 3SYNA 1K05A 2EPKX 3LESA 2Q9AA 3EGXB 5AC4A 3EG9B 3HTKC 5A6BA 1QPUA 3Q6MA 2EILC 4I1OB 5BQHA 1VLTA 1WASA 2W9YA 4DOZA 1JAFA 4WABA 3TJ5A 2V3CC 1MMDA 3LS0A 2X0CA 4CJGA 2CNWD 2XXAA 2ZXPA 3IQ5A 2XS8A 4HEAJ 4PFPA 1G5ZA 1N1CA 1OKKD 4OIQF 5L0IA 2WB7A 4E0HA 3S27A 4JVSA 1FAPB 2J7PA 2VCAA 4JIOA 2GAQA 3NKDA 1LS4A 3GWLA 4CBEA 1HMOA 2E87A 3JSEO 2P61A 3EH1A 2YLDA 1B68A 3CQZA 2AU5A 3AGUA 4C7OA 1T6IA 1U6HA 2XL8A 4KNVA 1ORSC 1FNTc 1EI7A 3S84A 2VC9A 2IXOA 2XLVA 3UNGC 2L7AA 3EGDA 1NG1A 1NBBA 1CPQA 2X51A 3DWWA 3GEEA 1A7VA 2B0JA 4O6MA 3SP1A 1Q0DA 1NFNA 4DRHB 4DVYP 2A1DD 2ZXOA 5GPGB 1BR1A 1TWHA 1OW7A 3QW1A 4IWBA 1VMAA 3M79A 4XPYA 4YJWA 5B3IA 2LK4A 1JRAA 3HLZA 4BPMA 3QW0A 2HSQA 4BG0A 3B9QA 3U5SA 3DZAA 3U2LA 1I4ZA 2VASA 1YAUO 2WVOA 5F5FA 2FFHA 2UUIA 3FAPB 3F46A 1QQ3A 5F28E 3QVYA 3ZIBA 3DM5A 1GQAA 4JRZA 4MW3A 5T1DB 2CW0F 4HFFB 2LD6A 1XZQA 2J46A 1UFBA 2DGJA 3CAXA 1PCXA 3ECSA 4Q5SF 3C8GA 5JLIA 4YT8A 3U8PA 5KYUB 1DOVA 5JVEA 1JPNA 1Z6AA 4GQHA 4BJ6C 3RVZA 1G4US 1VB5A 4YL0A 1H7IA 4UDVA 1OCCC 1RCPA 3G50A 4P6IC 3RQGA 4PJNA 1MMNA 2XSEA 4IAQA 5E2QA 1ZHXA 3X1OA 1A7DA 2RD9A 4Z9IA 3T6BA 1SR2A 2W4BA 2XL6A 4CX9A 2P6VA 3NG1A 3UMHA 1EQ1A 3O10A 1IZMA 3AG1C 5D91A 3H65A 4ZLDA 1JMWA 2Q9CA 3O39A 3RYLA 1M2VB 3KMIA 4XLPF 2MWQA 5COGA 3V5XA 1S05A 2OQMA 3BEHA 3JRMO 1CGOA 3QTHA 2XL4A 4MTGA 3RQFA 4QI0A 4U5EE 1RKEA 256BA 2Q9BA 4BJ1A 4CS7A 1I4YA 3HJCA 4JEBA 1H6GA 4G7HF 3B0VC 1WGWA 3U3FA 1EKYA 4BEJA 2ETSA 1T5OA 3L1MA 1SYQA 4AL0A 2NUPB 1WATA 2ZD9A 1LS1A 1NZEA 3EH2A 3GM3A 3IQCA 1TR2A 4W8PA 3PDMP 4N6CA 4AE4B 2VCCA 3ATPA 3WAQA 1AVOB 1OW6A 1TQGA 1UG7A 2WZLA 2WZFA 2HMQA 2XLEA 2IBFA 3JSZA 3ZC4A 2YL3A 1YVIA 1Q0MA 3G4XA 1D0ZA 1KNYA 2H7BA 3TULA 1OXKA 4PJLA 3ZSUA 1HW1A 1QZXA 1WWPA 4ULWA 4CIPA 1PD0A 1YA9A 2NUTB 2LP4A 2PX3A 3T6JA 2YLGA 3W8HA 1YDIA 1I5NA 3JCUQ 3MBGA 3K33A 2QNLA 3RH3A 4BEMJ 4Z9HA 1FR0A 3U2MA 5DQZA 1TFOB 1A41A 2G3KA 3B0UX 2HJ3A 3H2VA 2GWWA 1RKCA 4I3MA 4KI2A 3FOPA 1E84A 3JZ0A 2R03A 4ANJA 4K0DA 1LE2A 3RF3A 1QSPA 1MMGA 2R25A 5CI8A 2EIKC 2CYDA 3NMJA 4N4WA 5FZTA 2XLMA 1YJGA 2HJMA 1QVXA 3AG3C 2NSFA 4A2NB 2XLHA 2YZSA 3B29A 2PNOA 5A6BD 3LAYA 4LDQA 2C03A 3VRCA 5JSLA 5EGYA 2XXAB 2Y3BA 4NQFA 2YEVA 3EZHA 3SNHA 3S90A 3ABKC 1TKNA 4O7GA 3VM6A 4CIHA 3UMKA 3US6A 2OJED 3IQTA 1C17M 5L0FA 3T6GB 3ZVRA 1M56C 2OEVA 4RD9A 3GORA 2HS5A 1RXQA 1ZHZA 2R7VA 2LFFA 1M6TA 4NTBA 2VB6A 2PBEA 5T3WA 3Q6NA 1HW2A 3RQEA 1A0BA 1GM5A 2HFIA 2A69F 4XLNF 4IB4A 4K7BA 4AX2A 4JTAB 3J06A 1ZHYA 2KYHA 2OCCC 2BC5A 3B0PA 3QZCA 3RIPA 4C7OB 2R7WA 1VLSA 3T4RA 1QLEC 4CSAC 4U5GA 5JRAA 1LM3B 1CGNA 2WVNA 3VF0A 2W45A 3W2VA 1MNEA 2FAPB 4YN0B 1FFTC 3EGDB 3HKKA 3S9OA 3VYWA 4P9FA 1D1AA 5B3SC 1WOLA 3I4UA 1OR3A 1YZCA 3HNJA 2G62A 3DE9A 4XPXA 2R7TA 5L0DA 3K1IA 4PK4A 5E33A 1BDJB 1FFHA 3ZQYA 5JT4A 5KYWA 1KU2A 2L6GA 3NMKA 5HSWA 2TMVP 1SF8A 2Y3GA 4PFOA 4Z9JA 2D5RB 1ZW2A 2YL1A 2L81A 1LKXA 1YARO 2FGYA 5KYXA 2KJGA 5DS6A 3LS1A 2A6EF 4QDLA 3RW0A 5L0CA 5L3QA 3GWNA 1BZ4A 1E2XA 2G3VA 2ZXWC 3E70C 3ITFA 2I8BA 1ZZPA 3PCVA 4Q7CA 5FCLA 2L6HA 4U9EA 2MYSA 4MTFA 3C8GB 4I1MA 2J8WA 5E3CA 4DXWA 3AJMA 2DI3A 2DYSC 3SXYA 3ASOC 4EIYA 3FOOA 4A4AA 2OU6A 5AC5A 4JCZA 4JTDB 4N6HA 3ZQVA 2NPUA 1ZHWA 1J8YF 3DJNB 3C18A 4W8KA 4DVZA 3Q7GA 4OIOF 1JR8A 2J0XA 1VYKA 1LVKA 3LNMB 4I44A 4MQ9F 3NKEA 4M63A 3JYHA 4E0IA 1LE4A 1RJ9A 1K40A 2A68F 2R02A 3JTLO 4MVQA 3AG2C 4U5BE 3RFYA 4G7ZF 4IJJA 1Z63A 2R7OA 1J8MF 1NSGB 2GA0A 1QKRA 1Z3IX 2ZXRA 1SMYF 4P9TA 4MVUA 4CDYA 2Q7RA 5JP7A 3DM9B 2IXMA 2QY9A 3LNRA 3JT1A 3GEIA 4JKVA 1F1MA 1W2WA 2HSBA 4IARA 5DVWA 3ZDLA 4C3EA 4DRJB 4EBKA 4DBRA 5KYYA 1RKEB 4HE8D 2LFDA 4WGYA 5BQGA 5CIVA 4GYTA 4J7TA 4YK5A 1O87A 5L0JA 3QMKA 2DYRC 1OXBA 2HV6A 2P0NA 1YYXA 2JD3A 2GFHA 3I5QA 1Y4CA 4NY3A 3WODF 1TWGA 1Q0KA 2YHSA 3EZIA 1T6QA 4N06A 4MTOA 2J9UA 2KGOA 1YLMA 3ZWIA 3MX3A 4J30B 4O79A 3KYIA 2H7VC 4IGGA 1A7EA 5D92A 3ZTMA 4CDVA 5BQIA 4CS8C 1H9GA 3NDBB 1ST6A 3WHNA 3GM2A 1MQVA 3EQLF 3K66A 5HV9A 4YT5A 3NMIA 4J32B 4L6RA 4LDKA 1Z7Qc 1PD1A 4OINF 4C3BA 1ZVZA 4PR9A 4IRUA 1LIHA 3V7OA 3BRJA 4BJ6A 1O3UA 1U89A 3S29A 1HE1A 2PX0A 4D4XA 4CS9A 4NCQA 3U9MA 3U0CA 1APCA 4H54A 5DS5A 4G78A 4RBNA 4LLCA 1KTMA 1WTYA 2GDCA 4YL1A 4OD5A 4BJ5A 1BBHA 3I5PA 2BE5F 4B6IA 5B1BC 3U8VA 2RSEB 1Q0FA 4AK9A 1ORYA 2KNHA 2YL7A 5JS5A 2AVKA 1S7ZA 3F47A 1E86A 3GEHA 2QTVA 2XLOA 3CZ6A 3LJBA 4U5HA 3TOMA 5E3AA 2Q3TA 2JPUA 4C3DA 1MMAA 2J9WA 3H2UA 4EWCA 4JURI 3IEEA 1XZPA 1FMVA 4JC7A 2J0WA 1ZW3A 4MVRA 3OA1A 3EJNA 4FESA 2P1AA 3W2WA 3EHNA 1BR4A 1GGQA 1E83A 5IY5C 1EA8A 3W4YA 4XWJA 1WN0A 2YRFA 3SXZA 4ZLCA 3GM1A 4O6YA 3KH2A 1OW8A 1M2OA 1O5HA 1G8XA 2XRHA 3LEOA 2A0BA 3DI5A 3TQOA 4XEVA 5COMA 3DD7A 1Q0GA 1OR2A 2Y69C 3FVYA 3LLKA 2J9BA 2WZGA 2EIJC 5A6KA 4DRIB 2J7PD 4GEHA 1T9KA 2IM8A 2KW3C 3HNKA 4PACA 2Q4FA 2OG2A 4MW8A 5COFA 2NG1A 1D0XA 1V54C 2AWCA 2KC3A 3ASNC 4WGZA 4CDAA 5KYWB 2CCYA 3K1IC 2OOCA 3DXJF 3DAGA 5EK0A 4RDAA 2V26A 3U3BA 5K0IA 1VTMP 4YT4A 2PFDA 5KYXB
chains in the Genus database with same CATH topology
2GDCA 1DOWA 3S90A 3TJ6A 1YDIA 1U6HA 5L0DA 1L7CA 4E17A 1RKEA 1XWJA 4EHPA 4K1OA 3T6GB 5L0FA 4IGGA 1ZW2A 1DOVA 1H6GA 2L7AA 1ST6A 1T01A 3H2VA 3TJ5A 2GWWA 3H2UA 1QKRA 1RKCA 1SYQA 2B0HA 2LQGA 4ONSA 4P9TA 2X0CA 5L0CA 4W8PA 1TR2A 1ZVZA 4PR9A 3ZDLA 5L0IA 1ZW3A 3RF3A 5L0GA 4DJ9A 2HSQA 2IBFA 1RKEB 1U89A 5FZTA 4E18A 3VF0A 3MYIA 5L0JA 5L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDC A;  1DOW A;  3S90 A;  3TJ6 A;  1YDI A;  1U6H A;  5L0D A;  1L7C A;  4E17 A;  1RKE A;  1XWJ A;  4EHP A;  4K1O A;  3T6G B;  5L0F A;  4IGG A;  1ZW2 A;  1DOV A;  1H6G A;  2L7A A;  1ST6 A;  1T01 A;  3H2V A;  3TJ5 A;  2GWW A;  3H2U A;  1QKR A;  1RKC A;  1SYQ A;  2B0H A;  2LQG A;  4ONS A;  4P9T A;  2X0C A;  5L0C A;  4W8P A;  1TR2 A;  1ZVZ A;  4PR9 A;  3ZDL A;  5L0I A;  1ZW3 A;  3RF3 A;  5L0G A;  4DJ9 A;  2HSQ A;  2IBF A;  1RKE B;  1U89 A;  5FZT A;  4E18 A;  3VF0 A;  3MYI A;  5L0J A;  5L0H A; 
#chains in the Genus database with same CATH topology
 1DOW A;  3LLI A;  4JE9 A;  1Z5Z A;  3NYL A;  4MVS A;  2AP3 A;  1D0Y A;  3B71 A;  1NLX A;  2J9V A;  2IYL D;  2YVK A;  2IXP A;  3C7J A;  3AOU A;  5CI9 A;  2M64 A;  4E17 A;  3A11 A;  4JZA A;  2XLD A;  4CSA A;  1U0B B;  2IXN A;  2Y39 A;  4LAC B;  4CJO A;  2ICW G;  1VK5 A;  2KK1 A;  3PMR A;  2QUP A;  2YWA A;  4JJG A;  4WJ0 A;  1RMV A;  4O6N A;  3ZTZ A;  2Y3D A;  2LQG A;  3EFO A;  4OD4 A;  4E7S A;  1NFO A;  3CSK A;  3W8I A;  4YT2 A;  5KYN A;  3FDQ A;  3O6X A;  4EBJ A;  2YKZ A;  3WG7 C;  1YYJ A;  3C8Z A;  4BJT A;  1ZHT A;  1C03 A;  5JUA A;  2HKV A;  1VOM A;  2R9R B;  3EGX A;  3T9O A;  2Y3H A;  3SZR A;  3EG9 A;  3K1H A;  1RJ9 B;  3MYF A;  1R5I D;  3O55 A;  3S28 A;  4NTA A;  4YL3 A;  2UUH A;  2CNW A;  2LIG A;  3C8G D;  3SXM A;  1PV3 A;  4LLE A;  2AWY A;  1FTS A;  3SEO A;  1OKK A;  4PJM A;  2QLA A;  4X0R A;  1TFK B;  1BR2 A;  4XPW A;  4E7Z A;  2ZPA A;  5B1A C;  3E9V A;  3EHM A;  3R7C A;  2YL0 A;  1E85 A;  4MVO A;  4H4K C;  4MVM A;  4K1O A;  5KYY B;  3A9C A;  3AQC A;  4XQ1 A;  2O9X A;  5A69 A;  4OIP F;  3M4C A;  2PF4 E;  3M4B A;  1YZA A;  4ONS A;  3N24 A;  4KC9 A;  5F5H A;  5L3V A;  4FWV A;  2BL2 A;  2EIN C;  3K7D A;  4YWQ A;  1V74 B;  2XS1 A;  3NRH A;  5BUO A;  3RVY A;  2R7Q A;  4HFK B;  4J7Y A;  1G4W R;  4JJF A;  1D1B A;  3GAN A;  3IHU A;  3POV A;  5L0H A;  2R7S A;  2F22 A;  2R7X A;  3FMS A;  2HMZ A;  3IQ6 A;  1Z23 A;  3RKO F;  5A6A A;  2DB4 A;  2EPN A;  2PP4 A;  3M1C B;  3HNI A;  2OJQ A;  1M57 C;  2VCB A;  3G4Z A;  3UR3 C;  1LI5 A;  1VYI A;  5DLJ A;  4ER9 A;  4U9D A;  4EHP A;  2JX0 A;  2Q00 A;  1V55 C;  4JW1 A;  4FAP B;  2Z15 A;  2XM0 A;  3OEO A;  3GOD A;  2KSF A;  4XEK A;  4PJJ A;  3KYJ A;  3DE8 A;  4CS9 C;  3UMI A;  4EUK B;  3JYY A;  3SXK A;  2R7U A;  3K6B A;  2B0H A;  3ABM C;  1HMD A;  2EPO A;  2XLW A;  3MFN A;  4G0H A;  1TWA A;  3C62 A;  4BJ5 C;  5A6J A;  3TK0 A;  3X2Q C;  3UGP A;  5EHH A;  2YQY A;  3N2Z B;  3UGO A;  4MND A;  4DJ9 A;  3DJU B;  3HNL A;  4KNW A;  5KYU A;  3L34 A;  4JCH A;  4E18 A;  3V5Y A;  3KL4 A;  1NU9 C;  1ZYR F;  2YLI A;  5AGF A;  3OWT A;  3L0I A;  1OCO C;  4QI2 A;  2NSG A;  5TJ5 E;  4U5D E;  3DAF A;  4F4B A;  1YA7 O;  4KBL A;  1C02 A;  1AUE A;  1ZU5 A;  3TJ6 A;  1CPR A;  1GS9 A;  4LER A;  2MHR A;  3AGT A;  4EBB A;  1TWC A;  2EPM X;  4NC3 A;  3CEX A;  3TD7 A;  5DQT A;  1OCR C;  4G7O F;  4AL1 A;  1ORJ A;  1M2V A;  1T01 A;  4FX5 A;  3LEV A;  1HE9 A;  2ASR A;  2R05 A;  1HY5 A;  3KPH A;  2XM4 A;  2I15 A;  2LSE A;  4XEF A;  3FHD A;  2LCH A;  2OEX A;  1OCZ C;  1R4T A;  1OQC A;  1T6U A;  3TOL A;  3AG4 C;  2OKU A;  2L9J A;  1H9T A;  4CS8 A;  3ZG1 A;  4JEA A;  1K04 A;  1MND A;  3FAJ A;  3R2P A;  3ABL C;  4MS2 A;  1NU7 D;  2H8A A;  3U9J A;  2CGE A;  1LI7 A;  4JTC B;  1ZU4 A;  2WL8 A;  2QE9 A;  2NUP A;  2W4M A;  2A0U A;  2KQ9 A;  1FMW A;  2VH3 A;  2D4U A;  4AE4 A;  1JPJ A;  1LPE A;  4LDR A;  4XTK A;  4OIR F;  1L7C A;  3AQB A;  3C63 A;  1XWJ A;  1L3P A;  1AEP A;  3LUT B;  3DMD A;  3L8J A;  3Q7L A;  4Q4Z F;  4R32 A;  3VAY A;  1Y6D A;  5DS4 A;  1IW7 F;  3IPM O;  2HV7 A;  3NYM A;  1V4A A;  3QVZ A;  2NUT A;  3L8I A;  4NTF A;  3PHF 2;  2CDQ A;  2J45 A;  2L6F A;  2WVQ A;  3FXH A;  3M15 A;  3MLG A;  4DBQ A;  2C04 A;  3V5Z A;  4ULV A;  5L0G A;  3S0X A;  2HUJ A;  2R7R A;  3KKB A;  3NYJ A;  1CGM E;  3MYI A;  2IOQ A;  3JRT A;  2HZ8 A;  4IAO A;  2A6H F;  1SZI A;  3EPV A;  4U5C E;  4U5F E;  4EKW A;  1JOG A;  3DKA A;  5T3T A;  1D1C A;  2H7O A;  3EFO B;  4MVZ A;  2EPL X;  4D4N A;  2P7V A;  3N0T A;  2EIM C;  2M4E A;  3SYN A;  1K05 A;  2EPK X;  3LES A;  2Q9A A;  3EGX B;  5AC4 A;  3EG9 B;  3HTK C;  5A6B A;  1QPU A;  3Q6M A;  2EIL C;  4I1O B;  5BQH A;  1VLT A;  1WAS A;  2W9Y A;  4DOZ A;  1JAF A;  4WAB A;  3TJ5 A;  2V3C C;  1MMD A;  3LS0 A;  2X0C A;  4CJG A;  2CNW D;  2XXA A;  2ZXP A;  3IQ5 A;  2XS8 A;  4HEA J;  4PFP A;  1G5Z A;  1N1C A;  1OKK D;  4OIQ F;  5L0I A;  2WB7 A;  4E0H A;  3S27 A;  4JVS A;  1FAP B;  2J7P A;  2VCA A;  4JIO A;  2GAQ A;  3NKD A;  1LS4 A;  3GWL A;  4CBE A;  1HMO A;  2E87 A;  3JSE O;  2P61 A;  3EH1 A;  2YLD A;  1B68 A;  3CQZ A;  2AU5 A;  3AGU A;  4C7O A;  1T6I A;  1U6H A;  2XL8 A;  4KNV A;  1ORS C;  1FNT c;  1EI7 A;  3S84 A;  2VC9 A;  2IXO A;  2XLV A;  3UNG C;  2L7A A;  3EGD A;  1NG1 A;  1NBB A;  1CPQ A;  2X51 A;  3DWW A;  3GEE A;  1A7V A;  2B0J A;  4O6M A;  3SP1 A;  1Q0D A;  1NFN A;  4DRH B;  4DVY P;  2A1D D;  2ZXO A;  5GPG B;  1BR1 A;  1TWH A;  1OW7 A;  3QW1 A;  4IWB A;  1VMA A;  3M79 A;  4XPY A;  4YJW A;  5B3I A;  2LK4 A;  1JRA A;  3HLZ A;  4BPM A;  3QW0 A;  2HSQ A;  4BG0 A;  3B9Q A;  3U5S A;  3DZA A;  3U2L A;  1I4Z A;  2VAS A;  1YAU O;  2WVO A;  5F5F A;  2FFH A;  2UUI A;  3FAP B;  3F46 A;  1QQ3 A;  5F28 E;  3QVY A;  3ZIB A;  3DM5 A;  1GQA A;  4JRZ A;  4MW3 A;  5T1D B;  2CW0 F;  4HFF B;  2LD6 A;  1XZQ A;  2J46 A;  1UFB A;  2DGJ A;  3CAX A;  1PCX A;  3ECS A;  4Q5S F;  3C8G A;  5JLI A;  4YT8 A;  3U8P A;  5KYU B;  1DOV A;  5JVE A;  1JPN A;  1Z6A A;  4GQH A;  4BJ6 C;  3RVZ A;  1G4U S;  1VB5 A;  4YL0 A;  1H7I A;  4UDV A;  1OCC C;  1RCP A;  3G50 A;  4P6I C;  3RQG A;  4PJN A;  1MMN A;  2XSE A;  4IAQ A;  5E2Q A;  1ZHX A;  3X1O A;  1A7D A;  2RD9 A;  4Z9I A;  3T6B A;  1SR2 A;  2W4B A;  2XL6 A;  4CX9 A;  2P6V A;  3NG1 A;  3UMH A;  1EQ1 A;  3O10 A;  1IZM A;  3AG1 C;  5D91 A;  3H65 A;  4ZLD A;  1JMW A;  2Q9C A;  3O39 A;  3RYL A;  1M2V B;  3KMI A;  4XLP F;  2MWQ A;  5COG A;  3V5X A;  1S05 A;  2OQM A;  3BEH A;  3JRM O;  1CGO A;  3QTH A;  2XL4 A;  4MTG A;  3RQF A;  4QI0 A;  4U5E E;  1RKE A;  256B A;  2Q9B A;  4BJ1 A;  4CS7 A;  1I4Y A;  3HJC A;  4JEB A;  1H6G A;  4G7H F;  3B0V C;  1WGW A;  3U3F A;  1EKY A;  4BEJ A;  2ETS A;  1T5O A;  3L1M A;  1SYQ A;  4AL0 A;  2NUP B;  1WAT A;  2ZD9 A;  1LS1 A;  1NZE A;  3EH2 A;  3GM3 A;  3IQC A;  1TR2 A;  4W8P A;  3PDM P;  4N6C A;  4AE4 B;  2VCC A;  3ATP A;  3WAQ A;  1AVO B;  1OW6 A;  1TQG A;  1UG7 A;  2WZL A;  2WZF A;  2HMQ A;  2XLE A;  2IBF A;  3JSZ A;  3ZC4 A;  2YL3 A;  1YVI A;  1Q0M A;  3G4X A;  1D0Z A;  1KNY A;  2H7B A;  3TUL A;  1OXK A;  4PJL A;  3ZSU A;  1HW1 A;  1QZX A;  1WWP A;  4ULW A;  4CIP A;  1PD0 A;  1YA9 A;  2NUT B;  2LP4 A;  2PX3 A;  3T6J A;  2YLG A;  3W8H A;  1YDI A;  1I5N A;  3JCU Q;  3MBG A;  3K33 A;  2QNL A;  3RH3 A;  4BEM J;  4Z9H A;  1FR0 A;  3U2M A;  5DQZ A;  1TFO B;  1A41 A;  2G3K A;  3B0U X;  2HJ3 A;  3H2V A;  2GWW A;  1RKC A;  4I3M A;  4KI2 A;  3FOP A;  1E84 A;  3JZ0 A;  2R03 A;  4ANJ A;  4K0D A;  1LE2 A;  3RF3 A;  1QSP A;  1MMG A;  2R25 A;  5CI8 A;  2EIK C;  2CYD A;  3NMJ A;  4N4W A;  5FZT A;  2XLM A;  1YJG A;  2HJM A;  1QVX A;  3AG3 C;  2NSF A;  4A2N B;  2XLH A;  2YZS A;  3B29 A;  2PNO A;  5A6B D;  3LAY A;  4LDQ A;  2C03 A;  3VRC A;  5JSL A;  5EGY A;  2XXA B;  2Y3B A;  4NQF A;  2YEV A;  3EZH A;  3SNH A;  3S90 A;  3ABK C;  1TKN A;  4O7G A;  3VM6 A;  4CIH A;  3UMK A;  3US6 A;  2OJE D;  3IQT A;  1C17 M;  5L0F A;  3T6G B;  3ZVR A;  1M56 C;  2OEV A;  4RD9 A;  3GOR A;  2HS5 A;  1RXQ A;  1ZHZ A;  2R7V A;  2LFF A;  1M6T A;  4NTB A;  2VB6 A;  2PBE A;  5T3W A;  3Q6N A;  1HW2 A;  3RQE A;  1A0B A;  1GM5 A;  2HFI A;  2A69 F;  4XLN F;  4IB4 A;  4K7B A;  4AX2 A;  4JTA B;  3J06 A;  1ZHY A;  2KYH A;  2OCC C;  2BC5 A;  3B0P A;  3QZC A;  3RIP A;  4C7O B;  2R7W A;  1VLS A;  3T4R A;  1QLE C;  4CSA C;  4U5G A;  5JRA A;  1LM3 B;  1CGN A;  2WVN A;  3VF0 A;  2W45 A;  3W2V A;  1MNE A;  2FAP B;  4YN0 B;  1FFT C;  3EGD B;  3HKK A;  3S9O A;  3VYW A;  4P9F A;  1D1A A;  5B3S C;  1WOL A;  3I4U A;  1OR3 A;  1YZC A;  3HNJ A;  2G62 A;  3DE9 A;  4XPX A;  2R7T A;  5L0D A;  3K1I A;  4PK4 A;  5E33 A;  1BDJ B;  1FFH A;  3ZQY A;  5JT4 A;  5KYW A;  1KU2 A;  2L6G A;  3NMK A;  5HSW A;  2TMV P;  1SF8 A;  2Y3G A;  4PFO A;  4Z9J A;  2D5R B;  1ZW2 A;  2YL1 A;  2L81 A;  1LKX A;  1YAR O;  2FGY A;  5KYX A;  2KJG A;  5DS6 A;  3LS1 A;  2A6E F;  4QDL A;  3RW0 A;  5L0C A;  5L3Q A;  3GWN A;  1BZ4 A;  1E2X A;  2G3V A;  2ZXW C;  3E70 C;  3ITF A;  2I8B A;  1ZZP A;  3PCV A;  4Q7C A;  5FCL A;  2L6H A;  4U9E A;  2MYS A;  4MTF A;  3C8G B;  4I1M A;  2J8W A;  5E3C A;  4DXW A;  3AJM A;  2DI3 A;  2DYS C;  3SXY A;  3ASO C;  4EIY A;  3FOO A;  4A4A A;  2OU6 A;  5AC5 A;  4JCZ A;  4JTD B;  4N6H A;  3ZQV A;  2NPU A;  1ZHW A;  1J8Y F;  3DJN B;  3C18 A;  4W8K A;  4DVZ A;  3Q7G A;  4OIO F;  1JR8 A;  2J0X A;  1VYK A;  1LVK A;  3LNM B;  4I44 A;  4MQ9 F;  3NKE A;  4M63 A;  3JYH A;  4E0I A;  1LE4 A;  1RJ9 A;  1K40 A;  2A68 F;  2R02 A;  3JTL O;  4MVQ A;  3AG2 C;  4U5B E;  3RFY A;  4G7Z F;  4IJJ A;  1Z63 A;  2R7O A;  1J8M F;  1NSG B;  2GA0 A;  1QKR A;  1Z3I X;  2ZXR A;  1SMY F;  4P9T A;  4MVU A;  4CDY A;  2Q7R A;  5JP7 A;  3DM9 B;  2IXM A;  2QY9 A;  3LNR A;  3JT1 A;  3GEI A;  4JKV A;  1F1M A;  1W2W A;  2HSB A;  4IAR A;  5DVW A;  3ZDL A;  4C3E A;  4DRJ B;  4EBK A;  4DBR A;  5KYY A;  1RKE B;  4HE8 D;  2LFD A;  4WGY A;  5BQG A;  5CIV A;  4GYT A;  4J7T A;  4YK5 A;  1O87 A;  5L0J A;  3QMK A;  2DYR C;  1OXB A;  2HV6 A;  2P0N A;  1YYX A;  2JD3 A;  2GFH A;  3I5Q A;  1Y4C A;  4NY3 A;  3WOD F;  1TWG A;  1Q0K A;  2YHS A;  3EZI A;  1T6Q A;  4N06 A;  4MTO A;  2J9U A;  2KGO A;  1YLM A;  3ZWI A;  3MX3 A;  4J30 B;  4O79 A;  3KYI A;  2H7V C;  4IGG A;  1A7E A;  5D92 A;  3ZTM A;  4CDV A;  5BQI A;  4CS8 C;  1H9G A;  3NDB B;  1ST6 A;  3WHN A;  3GM2 A;  1MQV A;  3EQL F;  3K66 A;  5HV9 A;  4YT5 A;  3NMI A;  4J32 B;  4L6R A;  4LDK A;  1Z7Q c;  1PD1 A;  4OIN F;  4C3B A;  1ZVZ A;  4PR9 A;  4IRU A;  1LIH A;  3V7O A;  3BRJ A;  4BJ6 A;  1O3U A;  1U89 A;  3S29 A;  1HE1 A;  2PX0 A;  4D4X A;  4CS9 A;  4NCQ A;  3U9M A;  3U0C A;  1APC A;  4H54 A;  5DS5 A;  4G78 A;  4RBN A;  4LLC A;  1KTM A;  1WTY A;  2GDC A;  4YL1 A;  4OD5 A;  4BJ5 A;  1BBH A;  3I5P A;  2BE5 F;  4B6I A;  5B1B C;  3U8V A;  2RSE B;  1Q0F A;  4AK9 A;  1ORY A;  2KNH A;  2YL7 A;  5JS5 A;  2AVK A;  1S7Z A;  3F47 A;  1E86 A;  3GEH A;  2QTV A;  2XLO A;  3CZ6 A;  3LJB A;  4U5H A;  3TOM A;  5E3A A;  2Q3T A;  2JPU A;  4C3D A;  1MMA A;  2J9W A;  3H2U A;  4EWC A;  4JUR I;  3IEE A;  1XZP A;  1FMV A;  4JC7 A;  2J0W A;  1ZW3 A;  4MVR A;  3OA1 A;  3EJN A;  4FES A;  2P1A A;  3W2W A;  3EHN A;  1BR4 A;  1GGQ A;  1E83 A;  5IY5 C;  1EA8 A;  3W4Y A;  4XWJ A;  1WN0 A;  2YRF A;  3SXZ A;  4ZLC A;  3GM1 A;  4O6Y A;  3KH2 A;  1OW8 A;  1M2O A;  1O5H A;  1G8X A;  2XRH A;  3LEO A;  2A0B A;  3DI5 A;  3TQO A;  4XEV A;  5COM A;  3DD7 A;  1Q0G A;  1OR2 A;  2Y69 C;  3FVY A;  3LLK A;  2J9B A;  2WZG A;  2EIJ C;  5A6K A;  4DRI B;  2J7P D;  4GEH A;  1T9K A;  2IM8 A;  2KW3 C;  3HNK A;  4PAC A;  2Q4F A;  2OG2 A;  4MW8 A;  5COF A;  2NG1 A;  1D0X A;  1V54 C;  2AWC A;  2KC3 A;  3ASN C;  4WGZ A;  4CDA A;  5KYW B;  2CCY A;  3K1I C;  2OOC A;  3DXJ F;  3DAG A;  5EK0 A;  4RDA A;  2V26 A;  3U3B A;  5K0I A;  1VTM P;  4YT4 A;  2PFD A;  5KYX B; 
#chains in the Genus database with same CATH homology
 2GDC A;  1DOW A;  3S90 A;  3TJ6 A;  1YDI A;  1U6H A;  5L0D A;  1L7C A;  4E17 A;  1RKE A;  1XWJ A;  4EHP A;  4K1O A;  3T6G B;  5L0F A;  4IGG A;  1ZW2 A;  1DOV A;  1H6G A;  2L7A A;  1ST6 A;  1T01 A;  3H2V A;  3TJ5 A;  2GWW A;  3H2U A;  1QKR A;  1RKC A;  1SYQ A;  2B0H A;  2LQG A;  4ONS A;  4P9T A;  2X0C A;  5L0C A;  4W8P A;  1TR2 A;  1ZVZ A;  4PR9 A;  3ZDL A;  5L0I A;  1ZW3 A;  3RF3 A;  5L0G A;  4DJ9 A;  2HSQ A;  2IBF A;  1RKE B;  1U89 A;  5FZT A;  4E18 A;  3VF0 A;  3MYI A;  5L0J A;  5L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...