1L7CA

Alpha-catenin fragment, residues 385-651
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
244
structure length
240
Chain Sequence
b'DHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDMDENEFIDASRLVYDGIRDIRKAVLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha E-catenin
publication title Biochemical and structural definition of the l-afadin- and actin-binding sites of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 98
structure length 240
sequence length 244
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1l7cA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1l7cA01
4E17A 5L0GA 4DJ9A 5L0CA 1L7CA 5L0HA 2GWWA 3VF0A 4IGGA 5FZTA 1U89A 3H2UA 1H6GA 3TJ5A 1TR2A 4W8PA 2IBFA 5L0IA 3RF3A 1ZVZA 1DOWA 3ZDLA 1QKRA 3MYIA 4E18A 4K1OA 5L0DA 2GDCA 4P9TA 4PR9A 1RKEA 1T01A 1U6HA 1ZW3A 2L7AA 2HSQA 1RKEB 3TJ6A 2LQGA 4EHPA 5L0JA 1ST6A 5L0FA 2B0HA 2X0CA 3S90A 1ZW2A 3H2VA 1SYQA 4ONSA 1RKCA 1YDIA 1XWJA 3T6GB 1DOVA
chains in the Genus database with same CATH superfamily
4XWJA 2OU6A 5T3TA 2CDQA 3RVZA 3C18A 1IZMA 2DGJA 3U9JA 4CJGA 3DZAA 1KU2A 4MVQA 4IB4A 1CGNA 4G7ZF 3GORA 4PJJA 4U5FE 3SEOA 5L0DA 3U0CA 1ZHZA 3B9QA 4K7BA 3Q6NA 4KBLA 1TWGA 3GEIA 5K0IA 4CDVA 2J7PD 3G4XA 4ULVA 1MMAA 5TJ5E 1ZYRF 2R7TA 3JT1A 3CZ6A 1HMOA 2WVQA 4EKWA 1AUEA 1OW8A 2CGEA 3JSZA 1OKKA 3W4YA 2O9XA 3GEEA 3BEHA 1BBHA 3JRTA 1CGME 4YT2A 2CYDA 3I4UA 3M1CB 2I15A 4MQ9F 2EIJC 1YJGA 3EQLF 4A2NB 4FWVA 3Q7LA 1R4TA 1VK5A 2KSFA 3GM1A 3S9OA 3SP1A 1L7CA 3OWTA 3Q6MA 4PFPA 1V4AA 1JPJA 1PCXA 2Y39A 4JKVA 2IXOA 1L3PA 4C7OA 1FR0A 2EILC 4N6CA 2VC9A 2WZLA 1NLXA 1J8MF 2J9VA 2R03A 5DVWA 3ZC4A 1WWPA 3RKOF 1A0BA 4YWQA 1MNDA 5HV9A 1H9TA 1FAPB 4IAOA 2G62A 3FVYA 4NTAA 3O10A 2AU5A 2AWYA 2YKZA 4OIRF 2KJGA 2R7QA 2W9YA 1JAFA 2OEVA 1MMDA 2MYSA 4NY3A 2XL4A 4O7GA 5DQZA 4O79A 4IRUA 2P6VA 5GPGB 4I1OB 3U9MA 1FNTc 4WGYA 2L6HA 1R5ID 4XPXA 5T1DB 3TK0A 5L3QA 1Z63A 1EQ1A 4CIPA 2KQ9A 4WABA 3QVYA 4CS9A 2R05A 1XZQA 5BQHA 3M4CA 1FFTC 1Z6AA 3ITFA 3EH1A 4PJNA 4PJLA 3UMIA 1BDJB 1V54C 2YLDA 1A7EA 1APCA 5D91A 2J8WA 1E86A 5A6BA 2JX0A 2G3VA 1OCRC 4JEBA 3QMKA 3WG7C 1VOMA 4LDQA 2GA0A 4MVRA 1FMVA 2PBEA 2Q3TA 3V5YA 3LAYA 5L0IA 5BUOA 3HTKC 3DAFA 4ZLCA 4BJTA 3WHNA 1LVKA 4DOZA 4PK4A 1YYXA 3SXYA 2MWQA 1E85A 1U6HA 1ZW3A 4DRIB 5JUAA 2HSQA 4EBJA 5A6KA 3DJUB 4IJJA 4N6HA 2LQGA 5KYNA 1OKKD 3UR3C 3F46A 3EHNA 2PX0A 3FAJA 2HMZA 4EIYA 2DYSC 2UUIA 1ZHTA 3FAPB 1SR2A 1HE1A 2ZXRA 2IXNA 4JJGA 5KYUA 4YK5A 2KYHA 1FTSA 1SF8A 4E17A 4DJ9A 1O87A 2EPNA 3U8VA 2WL8A 4U5EE 1VYIA 3DD7A 3HJCA 5AGFA 2R7RA 4EWCA 5B1AC 1Q0KA 3K1HA 1TR2A 3LESA 1LIHA 5AC4A 5T3WA 3X2QC 1GQAA 2R7XA 1G4US 1OQCA 4QI0A 2KGOA 2R7VA 4J30B 3U2LA 1QQ3A 2OCCC 4YT4A 2NSGA 4CS9C 4JTAB 3LS0A 4W8KA 2P61A 4G7OF 1H9GA 3V5ZA 3N24A 3QW1A 4EUKB 3B0PA 1I4YA 1HW1A 1LE2A 1V55C 1VLTA 2J9BA 3TD7A 1BZ4A 4AL1A 4C3DA 5CIVA 2G3KA 1M2VB 2YZSA 4MTGA 1ZU5A 2KW3C 2YL0A 3NYJA 2R7WA 1WASA 1Q0MA 1TFKB 3LLKA 1SYQA 5DS6A 3TOLA 1ZHXA 3C8GA 3JRMO 5KYYA 4JRZA 4LLCA 1NFNA 1SMYF 3AGUA 4G78A 3RQFA 5A6BD 4CDYA 2J45A 3L8IA 4U5GA 1O5HA 2XM4A 1E84A 2WZFA 4C7OB 2Q9CA 3LEOA 1D0XA 4MVZA 4BPMA 5BQIA 1H6GA 3FOPA 4YJWA 1VB5A 2CNWA 2H7OA 3I5QA 2LP4A 4GQHA 3RF3A 3T6JA 3L1MA 5JRAA 2ZXWC 1G8XA 3NMIA 2IXMA 3DM9B 3M15A 2RSEB 1ZHYA 3GODA 4JTCB 2XXAA 1TKNA 3IQCA 2OKUA 4I1MA 4YL1A 3TJ6A 1VLSA 2X0CA 2R9RB 3AG1C 3UGPA 2OOCA 4CS7A 3R7CA 1OCOC 2YL7A 1YDIA 2WVNA 3KL4A 1NG1A 4M63A 2A6EF 3T6GB 1D1BA 4D4XA 1ZZPA 3AG3C 2H7BA 2I8BA 4J32B 4N4WA 4Q4ZF 1KTMA 4AE4B 1JR8A 3EH2A 3RYLA 4MW3A 3ZSUA 5B3IA 1A7DA 1Z23A 3C7JA 2FGYA 3DE9A 4JZAA 1GS9A 1PD0A 3OEOA 4FESA 4NCQA 4W8PA 2IBFA 2YQYA 3M4BA 2FFHA 5F28E 4NQFA 4CBEA 1HW2A 3JZ0A 2Z15A 1W2WA 1YARO 3EGXA 3FHDA 3GEHA 3B71A 2QLAA 1T01A 1S05A 2WB7A 1OXKA 2YLIA 2P0NA 4RDAA 4Q5SF 1M2OA 1EA8A 4XEVA 3EHMA 5CI8A 3HNIA 3VYWA 1Q0FA 4BJ6A 4CDAA 3ZTMA 1RJ9A 3FXHA 2PNOA 4O6YA 4MNDA 5B3SC 4C3EA 3KKBA 2XLWA 3J06A 1YVIA 3NKEA 4ANJA 1EI7A 2C03A 3C8GD 4JW1A 2Q4FA 1YLMA 3AJMA 1I5NA 2E87A 2PP4A 3PDMP 3DI5A 2NUPB 1JMWA 5E2QA 5F5HA 1WN0A 4U5BE 2C04A 5COFA 5JS5A 5HSWA 3SNHA 3PCVA 3LNMB 2IXPA 3L8JA 2PF4E 3G4ZA 4MTOA 4MW8A 3T6BA 4PACA 4Z9IA 2CNWD 4U5HA 2JD3A 1RCPA 2DI3A 3ASNC 4WJ0A 2EPMX 3GWNA 2L6FA 3U3BA 1XZPA 2GAQA 2XLOA 2QTVA 5DS4A 1T5OA 5COMA 5L0FA 2HSBA 2AP3A 4U5DE 4AX2A 3SZRA 3LS1A 1B68A 1QLEC 4WGZA 1YAUO 3DMDA 3C63A 3QVZA 2YL3A 3K66A 4JC7A 1YYJA 2XLHA 4NTBA 4CSAA 1A41A 3O55A 1RKCA 2GFHA 4DVZA 1ORYA 4MVOA 5KYWA 2YHSA 2ASRA 2Q00A 3PMRA 4KC9A 4DVYP 2GWWA 2YEVA 1A7VA 2KC3A 3R2PA 2HJMA 3DE8A 4EBBA 1OCCC 2CW0F 4C3BA 1YA7O 1EKYA 4BJ6C 2A69F 2XL6A 1F1MA 3LEVA 4PR9A 2V26A 3ATPA 2VCCA 1RKEB 4IWBA 3EFOA 2B0HA 3CQZA 1MNEA 3E70C 1T9KA 2BE5F 2YLGA 1S7ZA 4IARA 4XLPF 2ZPAA 256BA 4CIHA 2D5RB 1Y4CA 2BC5A 3DJNB 2Y3BA 4JTDB 1LS4A 1V74B 3A9CA 3W2VA 2VCAA 4YT5A 2ICWG 3O39A 4XQ1A 3T4RA 5D92A 3VF0A 2XM0A 4HFFB 1YZAA 3LJBA 3WAQA 2L6GA 4JEAA 1Q0DA 4XLNF 4D4NA 4JJFA 3ZG1A 4E0HA 2LSEA 1D1CA 4MS2A 1HMDA 4F4BA 2LCHA 1J8YF 1MMGA 2XLMA 4CX9A 3CEXA 1BR2A 2QNLA 4CSAC 2Y3HA 1K04A 1RJ9B 4RD9A 4MTFA 3L0IA 3NMKA 4MVUA 2UUHA 1HE9A 4ONSA 4OIPF 2J0XA 1Z3IX 2KK1A 2XLVA 1RMVA 3GANA 3X1OA 2YRFA 2Y69C 3L34A 4X0RA 5BQGA 4YT8A 2EIKC 3DAGA 5JT4A 2QY9A 3TOMA 3RVYA 5FZTA 2J9WA 2YL1A 3WODF 2PFDA 2IOQA 3H2UA 2MHRA 4CJOA 4L6RA 3AOUA 1ZU4A 3TULA 2XL8A 1PD1A 1WGWA 2BL2A 2OG2A 1VMAA 3FMSA 4K1OA 1JRAA 2L7AA 1K05A 1VYKA 2R7UA 4OINF 4DXWA 4O6NA 4QDLA 2XS8A 4BJ5A 5EGYA 1E83A 2Y3GA 1TWAA 4CS8A 1TFOB 1Q0GA 3N0TA 5E33A 3NYLA 4BEMJ 5KYWB 2HZ8A 3PHF2 4XPYA 2XLDA 4I3MA 3ABMC 3W8IA 1QPUA 2KNHA 3U5SA 1D0ZA 5JLIA 1T6UA 1NU9C 3JCUQ 4LACB 4A4AA 2DYRC 3ECSA 1T6IA 3K1IA 2Q7RA 3RQGA 4E18A 3S0XA 3VAYA 3U3FA 3OA1A 2HKVA 2W4BA 3JSEO 3EG9A 4E7ZA 4OIOF 3K7DA 3FDQA 2LIGA 4EHPA 3EFOB 2M4EA 4JCHA 3C62A 4G0HA 2AVKA 1VTMP 4ZLDA 5A6AA 1OW7A 5DS5A 2A0UA 4U9EA 4UDVA 3GM2A 3N2ZB 2HUJA 2X51A 3AQCA 3SYNA 1LKXA 3S29A 2EPKX 1XWJA 5KYUB 3RFYA 2TMVP 5L0CA 3NRHA 2M64A 1LS1A 4DRJB 1UG7A 2XLEA 4JURI 3AG4C 2J0WA 3ZIBA 3V5XA 3HLZA 3T9OA 1NSGB 4Q7CA 2VB6A 3O6XA 2LFFA 4GEHA 1N1CA 1QZXA 4U5CE 4HFKB 4YL3A 3S27A 3QW0A 1ZVZA 2IM8A 2VCBA 3FOOA 4BJ5C 1QKRA 4Z9HA 1D0YA 4P9TA 1CGOA 3C8ZA 4CS8C 1NBBA 3KH2A 3LUTB 2NUTA 1D1AA 3S84A 1Z5ZA 3UMHA 1C02A 5IY5C 4P6IC 3V7OA 4LDKA 2L81A 4IAQA 3F47A 1M2VA 1E2XA 3DWWA 3K33A 5F5FA 1Z7Qc 3CSKA 3NDBB 3IPMO 3IQTA 3KPHA 3GM3A 1OXBA 1Y6DA 5E3CA 4AL0A 3AQBA 3NMJA 3ABLC 3G50A 3SXKA 2LFDA 1JOGA 4LERA 4AK9A 3C8GB 1OCZC 2Q9BA 2YVKA 3EPVA 3HNJA 2CCYA 5COGA 5KYYB 3K1IC 4KNVA 1FFHA 4XTKA 2J46A 3U8PA 3ASOC 1MMNA 3EGDA 3VRCA 3DKAA 4J7TA 5KYXA 3GWLA 1BR1A 3EJNA 1M56C 1SZIA 3DM5A 3E9VA 4PFOA 4OIQF 4JIOA 2OJQA 3MYFA 1DOWA 4I44A 4B6IA 1WATA 2OEXA 3MYIA 1TWCA 2EIMC 2GDCA 2Y3DA 5EHHA 3B29A 2R7SA 5DQTA 3KYIA 3A11A 4RBNA 1NU7D 2XXAB 1QVXA 4LLEA 2V3CC 3IEEA 3JTLO 1WOLA 4YL0A 5L3VA 1LM3B 3NKDA 2HJ3A 4HE8D 1C03A 2AWCA 2JPUA 1TWHA 2OQMA 1K40A 1ORJA 2LD6A 2ZD9A 3K6BA 1TQGA 3MBGA 4DBQA 4AE4A 3TQOA 1FMWA 5L0HA 1BR4A 3US6A 4OD5A 1M57C 1WTYA 2HS5A 2ZXOA 3KYJA 4IGGA 1M6TA 1H7IA 1U89A 2A1DD 2D4UA 2WVOA 1UFBA 2YWAA 2DB4A 2ETSA 2VASA 3LLIA 3SXMA 4O6MA 3ZDLA 4XEKA 3NYMA 4MVSA 5JP7A 3HNLA 3UGOA 4BEJA 3EGXB 3ZQYA 5AC5A 3RH3A 4E0IA 4XPWA 3EG9B 1I4ZA 4NC3A 1LI7A 2NG1A 5CI9A 4U9DA 1OR3A 1OW6A 3ZTZA 2LK4A 1NFOA 2RD9A 4J7YA 3JYHA 4N06A 5JVEA 1O3UA 1GM5A 3B0UX 3UNGC 2L9JA 1ORSC 1QSPA 3CAXA 4ER9A 5E3AA 2P7VA 1OR2A 2W45A 3MFNA 3MX3A 4JCZA 2EINC 3UMKA 2OJED 4LDRA 1ZHWA 3ZWIA 4ULWA 1AEPA 2WZGA 3EZHA 2NUPA 3RW0A 3QZCA 1MQVA 2VH3A 2QUPA 2Q9AA 4YN0B 3ZQVA 5A69A 2EPLX 1C17M 2XS1A 3NG1A 3W2WA 1IW7F 4NTFA 3VM6A 2F22A 2R7OA 3TJ5A 3H65A 3W8HA 1AVOB 2A68F 2H7VC 2ZXPA 2IYLD 4P9FA 1YZCA 2R25A 1LI5A 2HV6A 3MLGA 2J7PA 5EK0A 2HMQA 2NUTB 1GGQA 3RIPA 4QI2A 1HY5A 3IHUA 3HKKA 4FAPB 2B0JA 3IQ5A 3POVA 1JPNA 1LPEA 5L0JA 2XRHA 1G5ZA 4H54A 1T6QA 3U2MA 3RQEA 4KNWA 4FX5A 4H4KC 3LNRA 5JSLA 2XSEA 5DLJA 3B0VC 3H2VA 3QTHA 3EZIA 4G7HF 4GYTA 3BRJA 4JVSA 4K0DA 1DOVA 4KI2A 2NPUA 5L0GA 3I5PA 3S28A 1LE4A 4XEFA 4DRHB 4E7SA 4R32A 5B1BC 1NZEA 1CPQA 1G4WR 3ABKC 3EGDB 1PV3A 3DXJF 2FAPB 1CPRA 2J9UA 4OD4A 5KYXB 1U0BB 2P1AA 1RXQA 4MVMA 3KMIA 5A6JA 2HV7A 3AG2C 2QE9A 3IQ6A 4JE9A 1RKEA 3HNKA 3Q7GA 2W4MA 4HEAJ 2R02A 3JYYA 1ST6A 2PX3A 3S90A 4Z9JA 4BG0A 2HFIA 3M79A 4EBKA 2EPOA 1ZW2A 3SXZA 4DBRA 3AGTA 1KNYA 2A0BA 2NSFA 4BJ1A 1YA9A 4PJMA 5FCLA 3ZVRA 2A6HF 2H8AA
chains in the Genus database with same CATH topology
4E17A 5L0GA 4DJ9A 5L0CA 1L7CA 5L0HA 2GWWA 3VF0A 4IGGA 5FZTA 1U89A 3H2UA 1H6GA 3TJ5A 1TR2A 4W8PA 2IBFA 5L0IA 3RF3A 1ZVZA 1DOWA 3ZDLA 1QKRA 3MYIA 4E18A 4K1OA 5L0DA 2GDCA 4P9TA 4PR9A 1RKEA 1T01A 1U6HA 1ZW3A 2L7AA 2HSQA 1RKEB 3TJ6A 2LQGA 4EHPA 5L0JA 1ST6A 5L0FA 2B0HA 2X0CA 3S90A 1ZW2A 3H2VA 1SYQA 4ONSA 1RKCA 1YDIA 1XWJA 3T6GB 1DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E17 A;  5L0G A;  4DJ9 A;  5L0C A;  1L7C A;  5L0H A;  2GWW A;  3VF0 A;  4IGG A;  5FZT A;  1U89 A;  3H2U A;  1H6G A;  3TJ5 A;  1TR2 A;  4W8P A;  2IBF A;  5L0I A;  3RF3 A;  1ZVZ A;  1DOW A;  3ZDL A;  1QKR A;  3MYI A;  4E18 A;  4K1O A;  5L0D A;  2GDC A;  4P9T A;  4PR9 A;  1RKE A;  1T01 A;  1U6H A;  1ZW3 A;  2L7A A;  2HSQ A;  1RKE B;  3TJ6 A;  2LQG A;  4EHP A;  5L0J A;  1ST6 A;  5L0F A;  2B0H A;  2X0C A;  3S90 A;  1ZW2 A;  3H2V A;  1SYQ A;  4ONS A;  1RKC A;  1YDI A;  1XWJ A;  3T6G B;  1DOV A; 
#chains in the Genus database with same CATH topology
 4XWJ A;  2OU6 A;  5T3T A;  2CDQ A;  3RVZ A;  3C18 A;  1IZM A;  2DGJ A;  3U9J A;  4CJG A;  3DZA A;  1KU2 A;  4MVQ A;  4IB4 A;  1CGN A;  4G7Z F;  3GOR A;  4PJJ A;  4U5F E;  3SEO A;  5L0D A;  3U0C A;  1ZHZ A;  3B9Q A;  4K7B A;  3Q6N A;  4KBL A;  1TWG A;  3GEI A;  5K0I A;  4CDV A;  2J7P D;  3G4X A;  4ULV A;  1MMA A;  5TJ5 E;  1ZYR F;  2R7T A;  3JT1 A;  3CZ6 A;  1HMO A;  2WVQ A;  4EKW A;  1AUE A;  1OW8 A;  2CGE A;  3JSZ A;  1OKK A;  3W4Y A;  2O9X A;  3GEE A;  3BEH A;  1BBH A;  3JRT A;  1CGM E;  4YT2 A;  2CYD A;  3I4U A;  3M1C B;  2I15 A;  4MQ9 F;  2EIJ C;  1YJG A;  3EQL F;  4A2N B;  4FWV A;  3Q7L A;  1R4T A;  1VK5 A;  2KSF A;  3GM1 A;  3S9O A;  3SP1 A;  1L7C A;  3OWT A;  3Q6M A;  4PFP A;  1V4A A;  1JPJ A;  1PCX A;  2Y39 A;  4JKV A;  2IXO A;  1L3P A;  4C7O A;  1FR0 A;  2EIL C;  4N6C A;  2VC9 A;  2WZL A;  1NLX A;  1J8M F;  2J9V A;  2R03 A;  5DVW A;  3ZC4 A;  1WWP A;  3RKO F;  1A0B A;  4YWQ A;  1MND A;  5HV9 A;  1H9T A;  1FAP B;  4IAO A;  2G62 A;  3FVY A;  4NTA A;  3O10 A;  2AU5 A;  2AWY A;  2YKZ A;  4OIR F;  2KJG A;  2R7Q A;  2W9Y A;  1JAF A;  2OEV A;  1MMD A;  2MYS A;  4NY3 A;  2XL4 A;  4O7G A;  5DQZ A;  4O79 A;  4IRU A;  2P6V A;  5GPG B;  4I1O B;  3U9M A;  1FNT c;  4WGY A;  2L6H A;  1R5I D;  4XPX A;  5T1D B;  3TK0 A;  5L3Q A;  1Z63 A;  1EQ1 A;  4CIP A;  2KQ9 A;  4WAB A;  3QVY A;  4CS9 A;  2R05 A;  1XZQ A;  5BQH A;  3M4C A;  1FFT C;  1Z6A A;  3ITF A;  3EH1 A;  4PJN A;  4PJL A;  3UMI A;  1BDJ B;  1V54 C;  2YLD A;  1A7E A;  1APC A;  5D91 A;  2J8W A;  1E86 A;  5A6B A;  2JX0 A;  2G3V A;  1OCR C;  4JEB A;  3QMK A;  3WG7 C;  1VOM A;  4LDQ A;  2GA0 A;  4MVR A;  1FMV A;  2PBE A;  2Q3T A;  3V5Y A;  3LAY A;  5L0I A;  5BUO A;  3HTK C;  3DAF A;  4ZLC A;  4BJT A;  3WHN A;  1LVK A;  4DOZ A;  4PK4 A;  1YYX A;  3SXY A;  2MWQ A;  1E85 A;  1U6H A;  1ZW3 A;  4DRI B;  5JUA A;  2HSQ A;  4EBJ A;  5A6K A;  3DJU B;  4IJJ A;  4N6H A;  2LQG A;  5KYN A;  1OKK D;  3UR3 C;  3F46 A;  3EHN A;  2PX0 A;  3FAJ A;  2HMZ A;  4EIY A;  2DYS C;  2UUI A;  1ZHT A;  3FAP B;  1SR2 A;  1HE1 A;  2ZXR A;  2IXN A;  4JJG A;  5KYU A;  4YK5 A;  2KYH A;  1FTS A;  1SF8 A;  4E17 A;  4DJ9 A;  1O87 A;  2EPN A;  3U8V A;  2WL8 A;  4U5E E;  1VYI A;  3DD7 A;  3HJC A;  5AGF A;  2R7R A;  4EWC A;  5B1A C;  1Q0K A;  3K1H A;  1TR2 A;  3LES A;  1LIH A;  5AC4 A;  5T3W A;  3X2Q C;  1GQA A;  2R7X A;  1G4U S;  1OQC A;  4QI0 A;  2KGO A;  2R7V A;  4J30 B;  3U2L A;  1QQ3 A;  2OCC C;  4YT4 A;  2NSG A;  4CS9 C;  4JTA B;  3LS0 A;  4W8K A;  2P61 A;  4G7O F;  1H9G A;  3V5Z A;  3N24 A;  3QW1 A;  4EUK B;  3B0P A;  1I4Y A;  1HW1 A;  1LE2 A;  1V55 C;  1VLT A;  2J9B A;  3TD7 A;  1BZ4 A;  4AL1 A;  4C3D A;  5CIV A;  2G3K A;  1M2V B;  2YZS A;  4MTG A;  1ZU5 A;  2KW3 C;  2YL0 A;  3NYJ A;  2R7W A;  1WAS A;  1Q0M A;  1TFK B;  3LLK A;  1SYQ A;  5DS6 A;  3TOL A;  1ZHX A;  3C8G A;  3JRM O;  5KYY A;  4JRZ A;  4LLC A;  1NFN A;  1SMY F;  3AGU A;  4G78 A;  3RQF A;  5A6B D;  4CDY A;  2J45 A;  3L8I A;  4U5G A;  1O5H A;  2XM4 A;  1E84 A;  2WZF A;  4C7O B;  2Q9C A;  3LEO A;  1D0X A;  4MVZ A;  4BPM A;  5BQI A;  1H6G A;  3FOP A;  4YJW A;  1VB5 A;  2CNW A;  2H7O A;  3I5Q A;  2LP4 A;  4GQH A;  3RF3 A;  3T6J A;  3L1M A;  5JRA A;  2ZXW C;  1G8X A;  3NMI A;  2IXM A;  3DM9 B;  3M15 A;  2RSE B;  1ZHY A;  3GOD A;  4JTC B;  2XXA A;  1TKN A;  3IQC A;  2OKU A;  4I1M A;  4YL1 A;  3TJ6 A;  1VLS A;  2X0C A;  2R9R B;  3AG1 C;  3UGP A;  2OOC A;  4CS7 A;  3R7C A;  1OCO C;  2YL7 A;  1YDI A;  2WVN A;  3KL4 A;  1NG1 A;  4M63 A;  2A6E F;  3T6G B;  1D1B A;  4D4X A;  1ZZP A;  3AG3 C;  2H7B A;  2I8B A;  4J32 B;  4N4W A;  4Q4Z F;  1KTM A;  4AE4 B;  1JR8 A;  3EH2 A;  3RYL A;  4MW3 A;  3ZSU A;  5B3I A;  1A7D A;  1Z23 A;  3C7J A;  2FGY A;  3DE9 A;  4JZA A;  1GS9 A;  1PD0 A;  3OEO A;  4FES A;  4NCQ A;  4W8P A;  2IBF A;  2YQY A;  3M4B A;  2FFH A;  5F28 E;  4NQF A;  4CBE A;  1HW2 A;  3JZ0 A;  2Z15 A;  1W2W A;  1YAR O;  3EGX A;  3FHD A;  3GEH A;  3B71 A;  2QLA A;  1T01 A;  1S05 A;  2WB7 A;  1OXK A;  2YLI A;  2P0N A;  4RDA A;  4Q5S F;  1M2O A;  1EA8 A;  4XEV A;  3EHM A;  5CI8 A;  3HNI A;  3VYW A;  1Q0F A;  4BJ6 A;  4CDA A;  3ZTM A;  1RJ9 A;  3FXH A;  2PNO A;  4O6Y A;  4MND A;  5B3S C;  4C3E A;  3KKB A;  2XLW A;  3J06 A;  1YVI A;  3NKE A;  4ANJ A;  1EI7 A;  2C03 A;  3C8G D;  4JW1 A;  2Q4F A;  1YLM A;  3AJM A;  1I5N A;  2E87 A;  2PP4 A;  3PDM P;  3DI5 A;  2NUP B;  1JMW A;  5E2Q A;  5F5H A;  1WN0 A;  4U5B E;  2C04 A;  5COF A;  5JS5 A;  5HSW A;  3SNH A;  3PCV A;  3LNM B;  2IXP A;  3L8J A;  2PF4 E;  3G4Z A;  4MTO A;  4MW8 A;  3T6B A;  4PAC A;  4Z9I A;  2CNW D;  4U5H A;  2JD3 A;  1RCP A;  2DI3 A;  3ASN C;  4WJ0 A;  2EPM X;  3GWN A;  2L6F A;  3U3B A;  1XZP A;  2GAQ A;  2XLO A;  2QTV A;  5DS4 A;  1T5O A;  5COM A;  5L0F A;  2HSB A;  2AP3 A;  4U5D E;  4AX2 A;  3SZR A;  3LS1 A;  1B68 A;  1QLE C;  4WGZ A;  1YAU O;  3DMD A;  3C63 A;  3QVZ A;  2YL3 A;  3K66 A;  4JC7 A;  1YYJ A;  2XLH A;  4NTB A;  4CSA A;  1A41 A;  3O55 A;  1RKC A;  2GFH A;  4DVZ A;  1ORY A;  4MVO A;  5KYW A;  2YHS A;  2ASR A;  2Q00 A;  3PMR A;  4KC9 A;  4DVY P;  2GWW A;  2YEV A;  1A7V A;  2KC3 A;  3R2P A;  2HJM A;  3DE8 A;  4EBB A;  1OCC C;  2CW0 F;  4C3B A;  1YA7 O;  1EKY A;  4BJ6 C;  2A69 F;  2XL6 A;  1F1M A;  3LEV A;  4PR9 A;  2V26 A;  3ATP A;  2VCC A;  1RKE B;  4IWB A;  3EFO A;  2B0H A;  3CQZ A;  1MNE A;  3E70 C;  1T9K A;  2BE5 F;  2YLG A;  1S7Z A;  4IAR A;  4XLP F;  2ZPA A;  256B A;  4CIH A;  2D5R B;  1Y4C A;  2BC5 A;  3DJN B;  2Y3B A;  4JTD B;  1LS4 A;  1V74 B;  3A9C A;  3W2V A;  2VCA A;  4YT5 A;  2ICW G;  3O39 A;  4XQ1 A;  3T4R A;  5D92 A;  3VF0 A;  2XM0 A;  4HFF B;  1YZA A;  3LJB A;  3WAQ A;  2L6G A;  4JEA A;  1Q0D A;  4XLN F;  4D4N A;  4JJF A;  3ZG1 A;  4E0H A;  2LSE A;  1D1C A;  4MS2 A;  1HMD A;  4F4B A;  2LCH A;  1J8Y F;  1MMG A;  2XLM A;  4CX9 A;  3CEX A;  1BR2 A;  2QNL A;  4CSA C;  2Y3H A;  1K04 A;  1RJ9 B;  4RD9 A;  4MTF A;  3L0I A;  3NMK A;  4MVU A;  2UUH A;  1HE9 A;  4ONS A;  4OIP F;  2J0X A;  1Z3I X;  2KK1 A;  2XLV A;  1RMV A;  3GAN A;  3X1O A;  2YRF A;  2Y69 C;  3L34 A;  4X0R A;  5BQG A;  4YT8 A;  2EIK C;  3DAG A;  5JT4 A;  2QY9 A;  3TOM A;  3RVY A;  5FZT A;  2J9W A;  2YL1 A;  3WOD F;  2PFD A;  2IOQ A;  3H2U A;  2MHR A;  4CJO A;  4L6R A;  3AOU A;  1ZU4 A;  3TUL A;  2XL8 A;  1PD1 A;  1WGW A;  2BL2 A;  2OG2 A;  1VMA A;  3FMS A;  4K1O A;  1JRA A;  2L7A A;  1K05 A;  1VYK A;  2R7U A;  4OIN F;  4DXW A;  4O6N A;  4QDL A;  2XS8 A;  4BJ5 A;  5EGY A;  1E83 A;  2Y3G A;  1TWA A;  4CS8 A;  1TFO B;  1Q0G A;  3N0T A;  5E33 A;  3NYL A;  4BEM J;  5KYW B;  2HZ8 A;  3PHF 2;  4XPY A;  2XLD A;  4I3M A;  3ABM C;  3W8I A;  1QPU A;  2KNH A;  3U5S A;  1D0Z A;  5JLI A;  1T6U A;  1NU9 C;  3JCU Q;  4LAC B;  4A4A A;  2DYR C;  3ECS A;  1T6I A;  3K1I A;  2Q7R A;  3RQG A;  4E18 A;  3S0X A;  3VAY A;  3U3F A;  3OA1 A;  2HKV A;  2W4B A;  3JSE O;  3EG9 A;  4E7Z A;  4OIO F;  3K7D A;  3FDQ A;  2LIG A;  4EHP A;  3EFO B;  2M4E A;  4JCH A;  3C62 A;  4G0H A;  2AVK A;  1VTM P;  4ZLD A;  5A6A A;  1OW7 A;  5DS5 A;  2A0U A;  4U9E A;  4UDV A;  3GM2 A;  3N2Z B;  2HUJ A;  2X51 A;  3AQC A;  3SYN A;  1LKX A;  3S29 A;  2EPK X;  1XWJ A;  5KYU B;  3RFY A;  2TMV P;  5L0C A;  3NRH A;  2M64 A;  1LS1 A;  4DRJ B;  1UG7 A;  2XLE A;  4JUR I;  3AG4 C;  2J0W A;  3ZIB A;  3V5X A;  3HLZ A;  3T9O A;  1NSG B;  4Q7C A;  2VB6 A;  3O6X A;  2LFF A;  4GEH A;  1N1C A;  1QZX A;  4U5C E;  4HFK B;  4YL3 A;  3S27 A;  3QW0 A;  1ZVZ A;  2IM8 A;  2VCB A;  3FOO A;  4BJ5 C;  1QKR A;  4Z9H A;  1D0Y A;  4P9T A;  1CGO A;  3C8Z A;  4CS8 C;  1NBB A;  3KH2 A;  3LUT B;  2NUT A;  1D1A A;  3S84 A;  1Z5Z A;  3UMH A;  1C02 A;  5IY5 C;  4P6I C;  3V7O A;  4LDK A;  2L81 A;  4IAQ A;  3F47 A;  1M2V A;  1E2X A;  3DWW A;  3K33 A;  5F5F A;  1Z7Q c;  3CSK A;  3NDB B;  3IPM O;  3IQT A;  3KPH A;  3GM3 A;  1OXB A;  1Y6D A;  5E3C A;  4AL0 A;  3AQB A;  3NMJ A;  3ABL C;  3G50 A;  3SXK A;  2LFD A;  1JOG A;  4LER A;  4AK9 A;  3C8G B;  1OCZ C;  2Q9B A;  2YVK A;  3EPV A;  3HNJ A;  2CCY A;  5COG A;  5KYY B;  3K1I C;  4KNV A;  1FFH A;  4XTK A;  2J46 A;  3U8P A;  3ASO C;  1MMN A;  3EGD A;  3VRC A;  3DKA A;  4J7T A;  5KYX A;  3GWL A;  1BR1 A;  3EJN A;  1M56 C;  1SZI A;  3DM5 A;  3E9V A;  4PFO A;  4OIQ F;  4JIO A;  2OJQ A;  3MYF A;  1DOW A;  4I44 A;  4B6I A;  1WAT A;  2OEX A;  3MYI A;  1TWC A;  2EIM C;  2GDC A;  2Y3D A;  5EHH A;  3B29 A;  2R7S A;  5DQT A;  3KYI A;  3A11 A;  4RBN A;  1NU7 D;  2XXA B;  1QVX A;  4LLE A;  2V3C C;  3IEE A;  3JTL O;  1WOL A;  4YL0 A;  5L3V A;  1LM3 B;  3NKD A;  2HJ3 A;  4HE8 D;  1C03 A;  2AWC A;  2JPU A;  1TWH A;  2OQM A;  1K40 A;  1ORJ A;  2LD6 A;  2ZD9 A;  3K6B A;  1TQG A;  3MBG A;  4DBQ A;  4AE4 A;  3TQO A;  1FMW A;  5L0H A;  1BR4 A;  3US6 A;  4OD5 A;  1M57 C;  1WTY A;  2HS5 A;  2ZXO A;  3KYJ A;  4IGG A;  1M6T A;  1H7I A;  1U89 A;  2A1D D;  2D4U A;  2WVO A;  1UFB A;  2YWA A;  2DB4 A;  2ETS A;  2VAS A;  3LLI A;  3SXM A;  4O6M A;  3ZDL A;  4XEK A;  3NYM A;  4MVS A;  5JP7 A;  3HNL A;  3UGO A;  4BEJ A;  3EGX B;  3ZQY A;  5AC5 A;  3RH3 A;  4E0I A;  4XPW A;  3EG9 B;  1I4Z A;  4NC3 A;  1LI7 A;  2NG1 A;  5CI9 A;  4U9D A;  1OR3 A;  1OW6 A;  3ZTZ A;  2LK4 A;  1NFO A;  2RD9 A;  4J7Y A;  3JYH A;  4N06 A;  5JVE A;  1O3U A;  1GM5 A;  3B0U X;  3UNG C;  2L9J A;  1ORS C;  1QSP A;  3CAX A;  4ER9 A;  5E3A A;  2P7V A;  1OR2 A;  2W45 A;  3MFN A;  3MX3 A;  4JCZ A;  2EIN C;  3UMK A;  2OJE D;  4LDR A;  1ZHW A;  3ZWI A;  4ULW A;  1AEP A;  2WZG A;  3EZH A;  2NUP A;  3RW0 A;  3QZC A;  1MQV A;  2VH3 A;  2QUP A;  2Q9A A;  4YN0 B;  3ZQV A;  5A69 A;  2EPL X;  1C17 M;  2XS1 A;  3NG1 A;  3W2W A;  1IW7 F;  4NTF A;  3VM6 A;  2F22 A;  2R7O A;  3TJ5 A;  3H65 A;  3W8H A;  1AVO B;  2A68 F;  2H7V C;  2ZXP A;  2IYL D;  4P9F A;  1YZC A;  2R25 A;  1LI5 A;  2HV6 A;  3MLG A;  2J7P A;  5EK0 A;  2HMQ A;  2NUT B;  1GGQ A;  3RIP A;  4QI2 A;  1HY5 A;  3IHU A;  3HKK A;  4FAP B;  2B0J A;  3IQ5 A;  3POV A;  1JPN A;  1LPE A;  5L0J A;  2XRH A;  1G5Z A;  4H54 A;  1T6Q A;  3U2M A;  3RQE A;  4KNW A;  4FX5 A;  4H4K C;  3LNR A;  5JSL A;  2XSE A;  5DLJ A;  3B0V C;  3H2V A;  3QTH A;  3EZI A;  4G7H F;  4GYT A;  3BRJ A;  4JVS A;  4K0D A;  1DOV A;  4KI2 A;  2NPU A;  5L0G A;  3I5P A;  3S28 A;  1LE4 A;  4XEF A;  4DRH B;  4E7S A;  4R32 A;  5B1B C;  1NZE A;  1CPQ A;  1G4W R;  3ABK C;  3EGD B;  1PV3 A;  3DXJ F;  2FAP B;  1CPR A;  2J9U A;  4OD4 A;  5KYX B;  1U0B B;  2P1A A;  1RXQ A;  4MVM A;  3KMI A;  5A6J A;  2HV7 A;  3AG2 C;  2QE9 A;  3IQ6 A;  4JE9 A;  1RKE A;  3HNK A;  3Q7G A;  2W4M A;  4HEA J;  2R02 A;  3JYY A;  1ST6 A;  2PX3 A;  3S90 A;  4Z9J A;  4BG0 A;  2HFI A;  3M79 A;  4EBK A;  2EPO A;  1ZW2 A;  3SXZ A;  4DBR A;  3AGT A;  1KNY A;  2A0B A;  2NSF A;  4BJ1 A;  1YA9 A;  4PJM A;  5FCL A;  3ZVR A;  2A6H F;  2H8A A; 
#chains in the Genus database with same CATH homology
 4E17 A;  5L0G A;  4DJ9 A;  5L0C A;  1L7C A;  5L0H A;  2GWW A;  3VF0 A;  4IGG A;  5FZT A;  1U89 A;  3H2U A;  1H6G A;  3TJ5 A;  1TR2 A;  4W8P A;  2IBF A;  5L0I A;  3RF3 A;  1ZVZ A;  1DOW A;  3ZDL A;  1QKR A;  3MYI A;  4E18 A;  4K1O A;  5L0D A;  2GDC A;  4P9T A;  4PR9 A;  1RKE A;  1T01 A;  1U6H A;  1ZW3 A;  2L7A A;  2HSQ A;  1RKE B;  3TJ6 A;  2LQG A;  4EHP A;  5L0J A;  1ST6 A;  5L0F A;  2B0H A;  2X0C A;  3S90 A;  1ZW2 A;  3H2V A;  1SYQ A;  4ONS A;  1RKC A;  1YDI A;  1XWJ A;  3T6G B;  1DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...