4J7YA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7yA00
4J7YA 3DWWA 4JCZA 2H8AA 3B29A 2Q7RA 3HKKA 4BPMA 4AL1A 5HV9A 4NTBA 2UUHA 4AL0A 2PNOA 5K0IA 5BQHA 5BQIA 2UUIA 4J7TA 4WABA 3LEOA 4JC7A 4YK5A 4YL0A 3PCVA 5BQGA 4NTFA 4JRZA 4YL1A 4NTAA 4YL3A
chains in the Genus database with same CATH superfamily
4LERA 3FXHA 4U5BE 4DRIB 1V54C 4O79A 1VLSA 1JMWA 1LI5A 1NFOA 2P1AA 3ABMC 1FNTc 1T6IA 3KYJA 5L0FA 1OCOC 3LLIA 3H65A 2A0BA 1BR1A 1CPRA 3JRMO 1ZZPA 4MS2A 4QDLA 2XL6A 3W8HA 4ER9A 1EA8A 1WGWA 5TJ5E 3NDBB 2DYSC 4QI0A 3EHNA 2HV6A 1ORSC 2L6FA 4PJNA 4K7BA 2DI3A 4A2NB 3DJUB 2IOQA 2XLWA 2A68F 4MVOA 2LFFA 3FHDA 2P6VA 2ICWG 3FAPB 3WAQA 2EPNA 3IPMO 2QY9A 1OCZC 3EPVA 3UMHA 3CAXA 1YARO 1TWGA 3EFOB 4DOZA 3E70C 1A41A 4JTAB 3W2WA 2R7VA 3AG4C 1LM3B 3GWLA 1OW8A 2YL7A 1FAPB 1HMDA 1NSGB 4MVZA 2NUPA 5KYUA 3W2VA 1WN0A 4O6YA 1NFNA 3FOOA 1APCA 2ETSA 2QNLA 3S28A 3TJ5A 3ZTMA 4D4XA 4DVYP 3GEIA 1OXBA 3MYFA 3RYLA 1LIHA 2EPKX 4KI2A 4N6HA 5JSLA 5DQZA 1XZPA 2HFIA 3HKKA 3LS1A 1VB5A 3RQEA 2ZXWC 3U3BA 5B3IA 4X0RA 3DD7A 3LAYA 2R05A 1E85A 4OIQF 3QW0A 2J7PD 3C8GD 1MNDA 3EGXB 3EH2A 3A9CA 3ABLC 3N0TA 1BZ4A 1C03A 5T1DB 5F28E 2OQMA 2E87A 1K40A 2R25A 2VC9A 3OEOA 1H9TA 4IRUA 1ZU4A 4N6CA 3J06A 2HJMA 1LE2A 2Y3BA 1V4AA 4DXWA 5AC4A 2KQ9A 3B71A 2AP3A 3ZC4A 3ZVRA 1KTMA 4CIPA 1HW2A 4YWQA 3BEHA 1TKNA 3M4CA 4CJOA 3KKBA 4IJJA 3MLGA 1I5NA 3K7DA 3UMIA 1L3PA 1OKKD 3KMIA 1EQ1A 4KC9A 1QSPA 1CPQA 4XEFA 1BR2A 2PX3A 4U5HA 3DAFA 5A6JA 2RD9A 5A6KA 1OCCC 1XZQA 3TULA 1B68A 2W9YA 3EH1A 2CNWA 4NTBA 3AQBA 4I1MA 1SMYF 1Z23A 2G3VA 2D4UA 2W45A 1W2WA 3S84A 4LLEA 2R03A 2ZXOA 4PK4A 1SF8A 5IY5C 2IXOA 3VYWA 4MTGA 2RSEB 3SXZA 4MVQA 3Q7LA 3AJMA 3ZTZA 5KYXB 1JPNA 3CSKA 1RJ9B 1R4TA 2MWQA 4OIOF 3A11A 2H7VC 2J9VA 1ZHTA 3DWWA 4EUKB 4C7OB 3DE9A 256BA 2GAQA 3AQCA 3IEEA 3NMKA 1PCXA 4MVSA 3X1OA 4ULVA 3DI5A 1WASA 4B6IA 3DXJF 4R32A 4DBRA 4K1OA 2EPOA 4MW8A 1LE4A 1OW6A 3LUTB 3ATPA 1Z7Qc 4AE4A 3T6GB 2IM8A 5A6BD 2W4MA 5BQHA 3B0VC 4JW1A 1LS4A 1QVXA 3AGUA 3QVZA 4JC7A 1JPJA 1NG1A 3G50A 3L0IA 4BEJA 1E83A 1YDIA 5EK0A 1DOVA 5T3TA 4BJ6C 2A6EF 2O9XA 4U5DE 4XPXA 2OG2A 5JP7A 2P61A 3ECSA 2R9RB 1Q0FA 2GA0A 3Q7GA 1SYQA 4MVUA 4N06A 3SYNA 3HNKA 1CGME 5L0GA 2NSGA 3L8IA 5F5HA 3C63A 5JS5A 2A6HF 2D5RB 2VCCA 2IXNA 5KYYA 4BJTA 3FMSA 5T3WA 1AUEA 2XLMA 1OQCA 1VLTA 3ZQVA 4XEVA 3JSZA 3G4XA 5D92A 3F47A 3U3FA 2A69F 2J45A 2Q9CA 2YL3A 2C03A 2DYRC 2QTVA 3I4UA 2XM4A 4GQHA 3JYYA 1OW7A 2YQYA 4JE9A 4W8PA 1Z5ZA 2XL4A 4L6RA 4ANJA 2Y3HA 1U89A 5DS4A 3LLKA 5B1AC 3T9OA 4G0HA 4PFOA 4JJFA 1TWCA 3PCVA 4FESA 3UNGC 4CS8C 2L6GA 4NTAA 5KYNA 4IAQA 1NZEA 1SR2A 5B1BC 1S7ZA 2QLAA 3Q6MA 2H8AA 1D1BA 1TFKB 3QZCA 1U0BB 5KYUB 2PF4E 2NUPB 5DVWA 3VF0A 2CGEA 1VOMA 1A7VA 2W4BA 2GDCA 4UDVA 2BL2A 3FVYA 2FGYA 4PACA 3RVYA 5JVEA 3GANA 3TK0A 1G4US 3HTKC 1ORJA 1A0BA 4W8KA 4AL0A 3DM9B 1OXKA 2XRHA 4FWVA 1I4ZA 3JRTA 2JPUA 4MW3A 4JCHA 2L9JA 5F5FA 1F1MA 3H2VA 3IQCA 4J30B 1UFBA 1YZAA 2YLIA 3JSEO 3SEOA 1YYJA 3HLZA 2B0JA 1Z63A 3DKAA 3PHF2 1MMNA 2WB7A 4E0IA 3SXKA 5L0JA 2HUJA 1CGNA 1WATA 1NU9C 3V7OA 2KYHA 4A4AA 3SZRA 2HSBA 2OEVA 4HFKB 5L3QA 3MX3A 2PP4A 2FFHA 5L0HA 2IXMA 4KBLA 3US6A 1PV3A 5L0DA 4EIYA 3UR3C 2J46A 4U9EA 2ZD9A 4BPMA 5JT4A 2YEVA 1ZHWA 2GFHA 3I5PA 3K33A 4YT2A 1KU2A 4ZLDA 2Y3GA 4D4NA 4E0HA 1QLEC 2XLHA 4BJ5A 1OR2A 3GM2A 2XL8A 4JJGA 5DLJA 1V74B 1G8XA 2F22A 1Z3IX 4I44A 1OCRC 4J32B 3ZG1A 3EQLF 2HS5A 4JZAA 2XXAA 1ZHXA 3KL4A 3U9MA 1VYIA 4BJ1A 4CJGA 1D0XA 2MYSA 2NG1A 1C02A 4C3EA 4DRHB 2BC5A 4CSAA 4NTFA 4JRZA 2VCBA 3NG1A 3R2PA 4J7YA 3RVZA 3S29A 1YVIA 3TJ6A 2LSEA 3GODA 4HFFB 4CDVA 4Q5SF 4Z9IA 4PJMA 4IWBA 4HE8D 4DJ9A 1RCPA 4WGYA 2IXPA 1L7CA 1BR4A 3AG2C 2M4EA 1WWPA 3L1MA 4AK9A 2FAPB 2P0NA 1MNEA 2YWAA 2R7XA 1T5OA 3SNHA 3V5XA 4H54A 1U6HA 3RQGA 1R5ID 1ZYRF 4YT4A 4PJJA 4P9FA 3O10A 3DE8A 3WHNA 3DAGA 4AE4B 3NMJA 4YL0A 5BQGA 4DBQA 4XLNF 2R7SA 4YL1A 2HMZA 1HE9A 2XM0A 3CQZA 3WG7C 3IQ6A 5COGA 5A69A 3F46A 4JURI 4CDAA 1MMAA 5DQTA 5L0IA 1QKRA 1FMWA 4ZLCA 3HNIA 1I4YA 2J7PA 2V3CC 3C8GA 1TR2A 2XLEA 3IQTA 4PJLA 3U8VA 5E3CA 1YA7O 2J9WA 4LLCA 3HNLA 1UG7A 1Q0MA 3ZQYA 4YJWA 4C3DA 5KYYB 2Z15A 4LDRA 4BG0A 1S05A 2HKVA 2UUIA 3QW1A 1LI7A 1VMAA 1VK5A 2AWCA 2EPLX 3EHMA 3K1HA 4IAOA 1D1CA 4I1OB 3GEHA 2H7BA 3R7CA 4MVRA 1OKKA 4XTKA 1WTYA 4F4BA 3SXYA 5DS6A 3UGOA 3PDMP 3JZ0A 3GWNA 3KYIA 1AVOB 3GM3A 4IB4A 3RF3A 4OINF 5B3SC 2AU5A 2OKUA 2B0HA 2EIKC 1DOWA 1MQVA 2J9UA 3T4RA 4BEMJ 2CDQA 5DS5A 2YL1A 4MVMA 4M63A 4AX2A 2L7AA 3H2UA 4BJ5C 3LJBA 1EKYA 1M57C 3OA1A 2EIMC 1YJGA 1M2VA 3ASNC 3POVA 4P6IC 3V5YA 3NKEA 4WJ0A 3W8IA 4CBEA 2CCYA 3V5ZA 2LIGA 2Q3TA 1MMGA 2OJQA 2YZSA 3AOUA 4CIHA 3AG1C 1LKXA 1Y6DA 2XS8A 1RKEA 3VRCA 1V55C 4CS7A 1RMVA 1JRAA 2WZLA 3FDQA 3OWTA 3K66A 3SP1A 2ZXPA 1HW1A 1NLXA 2R7RA 3CZ6A 5CI8A 4JCZA 4YT5A 2KGOA 3UGPA 3M15A 3DZAA 3C8ZA 2YLGA 2P7VA 1HE1A 3K6BA 1C17M 3O55A 1TFOB 3RKOF 3S0XA 1T6UA 3LNRA 2XLVA 2YLDA 5A6BA 2WVOA 4H4KC 4LACB 2R7WA 2DGJA 4G7ZF 4NCQA 4BJ6A 2WZFA 3LEVA 2NPUA 5EHHA 3S9OA 2XSEA 2ZPAA 4CS9C 4DVZA 1ST6A 5CIVA 2NSFA 3EGDA 1WOLA 3KH2A 4OIRF 1D0YA 2WL8A 4YK5A 4EBKA 3GEEA 1M56C 2LFDA 2ZXRA 2JD3A 1KNYA 2HV7A 2MHRA 4Q7CA 4CDYA 4YT8A 4XPYA 4G7HF 1RKCA 2X51A 1QPUA 1TWHA 3EG9A 1Q0GA 4E7SA 2I8BA 1YAUO 2XXAB 1SZIA 1LPEA 1LVKA 4FAPB 4EWCA 2LCHA 2Y69C 4IARA 1VYKA 4I3MA 1J8YF 3FAJA 3NMIA 2VB6A 2WZGA 1Y4CA 3AGTA 3GM1A 5COMA 2R02A 3TQOA 3VAYA 1OR3A 2NUTA 5KYWA 2PBEA 1GQAA 1D1AA 1Q0DA 2UUHA 3E9VA 4CS8A 1T6QA 2IBFA 4C3BA 1E86A 2KC3A 2KW3C 5K0IA 2Y39A 3DJNB 4MTFA 5AC5A 2KK1A 2CNWD 2LD6A 5JRAA 5FZTA 4XPWA 3NYJA 3JCUQ 4IGGA 3EZIA 3QVYA 1XWJA 5COFA 1A7EA 4YN0B 2Q9AA 4Z9HA 3T6JA 2WVQA 2OJED 1LS1A 4WGZA 4XEKA 3ABKC 2A0UA 4CS9A 2DB4A 4CX9A 4PFPA 4OIPF 1EI7A 1T9KA 3QMKA 1G5ZA 3RIPA 3ZIBA 2R7QA 4U5CE 4P9TA 3U0CA 4XQ1A 5CI9A 3PMRA 5FCLA 2XLDA 1AEPA 4EBJA 3EZHA 2JX0A 2J0WA 4AL1A 2YL0A 1G4WR 1JR8A 2YKZA 3VM6A 4RBNA 2XLOA 2IYLD 1A7DA 1Z6AA 1ZW2A 3EFOA 4O7GA 2A1DD 1NU7D 2ASRA 3C8GB 3C7JA 5L3VA 3RFYA 3HNJA 2V26A 4G7OF 3CEXA 1FFTC 3N2ZB 3U2MA 3B0UX 2LK4A 3LNMB 3NYMA 4RD9A 3TOMA 2PFDA 1YZCA 1T01A 3U5SA 3X2QC 1E2XA 1QQ3A 1ZU5A 3MYIA 4O6NA 4RDAA 4E7ZA 2YRFA 2TMVP 3RH3A 4DRJB 3G4ZA 1FMVA 2Q9BA 3JT1A 5HSWA 3C18A 4YL3A 3SXMA 1GS9A 2I15A 2OU6A 1FTSA 1N1CA 4JEBA 4Q4ZF 1YA9A 1JOGA 2EPMX 3B29A 3DMDA 5GPGB 4NY3A 4U5FE 3LESA 4XLPF 4KNWA 1GM5A 2WVNA 3EGXA 1PD0A 1YYXA 2VCAA 1HY5A 4KNVA 5HV9A 2L81A 1CGOA 3T6BA 3JTLO 2AVKA 2OOCA 2M64A 2Y3DA 3KPHA 3QTHA 2PX0A 2KSFA 3GORA 2J0XA 2R7TA 1O5HA 2OEXA 3I5QA 3LS0A 4O6MA 2AWYA 2LP4A 4E18A 4GEHA 1O87A 4JTCB 4K0DA 4U5GA 3TD7A 3RQFA 3U9JA 1M2OA 1M2VB 1IW7F 2G62A 2KJGA 3N24A 5EGYA 1FR0A 4MTOA 4OD4A 3Q6NA 4NC3A 3U8PA 5A6AA 4OD5A 1M6TA 3RW0A 3K1IC 1RXQA 3M79A 1RKEB 4QI2A 4JVSA 3O6XA 1H7IA 1D0ZA 4GYTA 3ZSUA 5AGFA 2G3KA 3W4YA 1FFHA 1H9GA 3L34A 2YHSA 4ONSA 1ZHZA 4PR9A 2J8WA 3BRJA 1ORYA 2CYDA 3S27A 4E17A 1BDJB 2GWWA 3S90A 5D91A 3ZWIA 4JTDB 2X0CA 4EBBA 4EHPA 3M1CB 4CSAC 2R7UA 3U2LA 4Z9JA 4HEAJ 4U5EE 5KYXA 3NYLA 3UMKA 1GGQA 1RJ9A 2HSQA 5BQIA 3NRHA 5E2QA 3ASOC 2EILC 4WABA 4C7OA 1IZMA 1YLMA 3AG3C 3JYHA 1MMDA 1J8MF 1TWAA 3NKDA 4NQFA 1E84A 2EIJC 5E3AA 1HMOA 2Q4FA 1PD1A 2HZ8A 3EGDB 3MFNA 2H7OA 2R7OA 1H6GA 3WODF 4JEAA 2EINC 3O39A 4MNDA 2OCCC 4JIOA 2HJ3A 2BE5F 3B0PA 3M4BA 4LDQA 1Q0KA 1NBBA 1ZVZA 4MQ9F 2Q7RA 1ZHYA 3EG9B 5JLIA 4FX5A 2VASA 1O3UA 3FOPA 3IHUA 2QUPA 4EKWA 2HMQA 3IQ5A 3ZDLA 3MBGA 1K04A 3B9QA 3K1IA 2VH3A 2J9BA 2XS1A 1BBHA 1TQGA 2PNOA 1QZXA 2YVKA 3L8JA 4N4WA 5BUOA 4LDKA 1VTMP 2Q00A 1K05A 1ZW3A 2C04A 2KNHA 2QE9A 4JKVA 4J7TA 2NUTB 5KYWB 4XWJA 3TOLA 3DM5A 3LEOA 3C62A 5JUAA 3ITFA 5E33A 4G78A 1JAFA 2L6HA 3EJNA 4ULWA 3HJCA 5L0CA 2CW0F 4U9DA 2LQGA
chains in the Genus database with same CATH topology
4J7YA 3DWWA 4JCZA 2H8AA 3B29A 2Q7RA 3HKKA 4BPMA 4AL1A 5HV9A 4NTBA 2UUHA 4AL0A 2PNOA 5K0IA 5BQHA 5BQIA 2UUIA 4J7TA 4WABA 3LEOA 4JC7A 4YK5A 4YL0A 3PCVA 5BQGA 4NTFA 4JRZA 4YL1A 4NTAA 4YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Y A;  3DWW A;  4JCZ A;  2H8A A;  3B29 A;  2Q7R A;  3HKK A;  4BPM A;  4AL1 A;  5HV9 A;  4NTB A;  2UUH A;  4AL0 A;  2PNO A;  5K0I A;  5BQH A;  5BQI A;  2UUI A;  4J7T A;  4WAB A;  3LEO A;  4JC7 A;  4YK5 A;  4YL0 A;  3PCV A;  5BQG A;  4NTF A;  4JRZ A;  4YL1 A;  4NTA A;  4YL3 A; 
#chains in the Genus database with same CATH topology
 4LER A;  3FXH A;  4U5B E;  4DRI B;  1V54 C;  4O79 A;  1VLS A;  1JMW A;  1LI5 A;  1NFO A;  2P1A A;  3ABM C;  1FNT c;  1T6I A;  3KYJ A;  5L0F A;  1OCO C;  3LLI A;  3H65 A;  2A0B A;  1BR1 A;  1CPR A;  3JRM O;  1ZZP A;  4MS2 A;  4QDL A;  2XL6 A;  3W8H A;  4ER9 A;  1EA8 A;  1WGW A;  5TJ5 E;  3NDB B;  2DYS C;  4QI0 A;  3EHN A;  2HV6 A;  1ORS C;  2L6F A;  4PJN A;  4K7B A;  2DI3 A;  4A2N B;  3DJU B;  2IOQ A;  2XLW A;  2A68 F;  4MVO A;  2LFF A;  3FHD A;  2P6V A;  2ICW G;  3FAP B;  3WAQ A;  2EPN A;  3IPM O;  2QY9 A;  1OCZ C;  3EPV A;  3UMH A;  3CAX A;  1YAR O;  1TWG A;  3EFO B;  4DOZ A;  3E70 C;  1A41 A;  4JTA B;  3W2W A;  2R7V A;  3AG4 C;  1LM3 B;  3GWL A;  1OW8 A;  2YL7 A;  1FAP B;  1HMD A;  1NSG B;  4MVZ A;  2NUP A;  5KYU A;  3W2V A;  1WN0 A;  4O6Y A;  1NFN A;  3FOO A;  1APC A;  2ETS A;  2QNL A;  3S28 A;  3TJ5 A;  3ZTM A;  4D4X A;  4DVY P;  3GEI A;  1OXB A;  3MYF A;  3RYL A;  1LIH A;  2EPK X;  4KI2 A;  4N6H A;  5JSL A;  5DQZ A;  1XZP A;  2HFI A;  3HKK A;  3LS1 A;  1VB5 A;  3RQE A;  2ZXW C;  3U3B A;  5B3I A;  4X0R A;  3DD7 A;  3LAY A;  2R05 A;  1E85 A;  4OIQ F;  3QW0 A;  2J7P D;  3C8G D;  1MND A;  3EGX B;  3EH2 A;  3A9C A;  3ABL C;  3N0T A;  1BZ4 A;  1C03 A;  5T1D B;  5F28 E;  2OQM A;  2E87 A;  1K40 A;  2R25 A;  2VC9 A;  3OEO A;  1H9T A;  4IRU A;  1ZU4 A;  4N6C A;  3J06 A;  2HJM A;  1LE2 A;  2Y3B A;  1V4A A;  4DXW A;  5AC4 A;  2KQ9 A;  3B71 A;  2AP3 A;  3ZC4 A;  3ZVR A;  1KTM A;  4CIP A;  1HW2 A;  4YWQ A;  3BEH A;  1TKN A;  3M4C A;  4CJO A;  3KKB A;  4IJJ A;  3MLG A;  1I5N A;  3K7D A;  3UMI A;  1L3P A;  1OKK D;  3KMI A;  1EQ1 A;  4KC9 A;  1QSP A;  1CPQ A;  4XEF A;  1BR2 A;  2PX3 A;  4U5H A;  3DAF A;  5A6J A;  2RD9 A;  5A6K A;  1OCC C;  1XZQ A;  3TUL A;  1B68 A;  2W9Y A;  3EH1 A;  2CNW A;  4NTB A;  3AQB A;  4I1M A;  1SMY F;  1Z23 A;  2G3V A;  2D4U A;  2W45 A;  1W2W A;  3S84 A;  4LLE A;  2R03 A;  2ZXO A;  4PK4 A;  1SF8 A;  5IY5 C;  2IXO A;  3VYW A;  4MTG A;  2RSE B;  3SXZ A;  4MVQ A;  3Q7L A;  3AJM A;  3ZTZ A;  5KYX B;  1JPN A;  3CSK A;  1RJ9 B;  1R4T A;  2MWQ A;  4OIO F;  3A11 A;  2H7V C;  2J9V A;  1ZHT A;  3DWW A;  4EUK B;  4C7O B;  3DE9 A;  256B A;  2GAQ A;  3AQC A;  3IEE A;  3NMK A;  1PCX A;  4MVS A;  3X1O A;  4ULV A;  3DI5 A;  1WAS A;  4B6I A;  3DXJ F;  4R32 A;  4DBR A;  4K1O A;  2EPO A;  4MW8 A;  1LE4 A;  1OW6 A;  3LUT B;  3ATP A;  1Z7Q c;  4AE4 A;  3T6G B;  2IM8 A;  5A6B D;  2W4M A;  5BQH A;  3B0V C;  4JW1 A;  1LS4 A;  1QVX A;  3AGU A;  3QVZ A;  4JC7 A;  1JPJ A;  1NG1 A;  3G50 A;  3L0I A;  4BEJ A;  1E83 A;  1YDI A;  5EK0 A;  1DOV A;  5T3T A;  4BJ6 C;  2A6E F;  2O9X A;  4U5D E;  4XPX A;  2OG2 A;  5JP7 A;  2P61 A;  3ECS A;  2R9R B;  1Q0F A;  2GA0 A;  3Q7G A;  1SYQ A;  4MVU A;  4N06 A;  3SYN A;  3HNK A;  1CGM E;  5L0G A;  2NSG A;  3L8I A;  5F5H A;  3C63 A;  5JS5 A;  2A6H F;  2D5R B;  2VCC A;  2IXN A;  5KYY A;  4BJT A;  3FMS A;  5T3W A;  1AUE A;  2XLM A;  1OQC A;  1VLT A;  3ZQV A;  4XEV A;  3JSZ A;  3G4X A;  5D92 A;  3F47 A;  3U3F A;  2A69 F;  2J45 A;  2Q9C A;  2YL3 A;  2C03 A;  2DYR C;  2QTV A;  3I4U A;  2XM4 A;  4GQH A;  3JYY A;  1OW7 A;  2YQY A;  4JE9 A;  4W8P A;  1Z5Z A;  2XL4 A;  4L6R A;  4ANJ A;  2Y3H A;  1U89 A;  5DS4 A;  3LLK A;  5B1A C;  3T9O A;  4G0H A;  4PFO A;  4JJF A;  1TWC A;  3PCV A;  4FES A;  3UNG C;  4CS8 C;  2L6G A;  4NTA A;  5KYN A;  4IAQ A;  1NZE A;  1SR2 A;  5B1B C;  1S7Z A;  2QLA A;  3Q6M A;  2H8A A;  1D1B A;  1TFK B;  3QZC A;  1U0B B;  5KYU B;  2PF4 E;  2NUP B;  5DVW A;  3VF0 A;  2CGE A;  1VOM A;  1A7V A;  2W4B A;  2GDC A;  4UDV A;  2BL2 A;  3FVY A;  2FGY A;  4PAC A;  3RVY A;  5JVE A;  3GAN A;  3TK0 A;  1G4U S;  3HTK C;  1ORJ A;  1A0B A;  4W8K A;  4AL0 A;  3DM9 B;  1OXK A;  2XRH A;  4FWV A;  1I4Z A;  3JRT A;  2JPU A;  4MW3 A;  4JCH A;  2L9J A;  5F5F A;  1F1M A;  3H2V A;  3IQC A;  4J30 B;  1UFB A;  1YZA A;  2YLI A;  3JSE O;  3SEO A;  1YYJ A;  3HLZ A;  2B0J A;  1Z63 A;  3DKA A;  3PHF 2;  1MMN A;  2WB7 A;  4E0I A;  3SXK A;  5L0J A;  2HUJ A;  1CGN A;  1WAT A;  1NU9 C;  3V7O A;  2KYH A;  4A4A A;  3SZR A;  2HSB A;  2OEV A;  4HFK B;  5L3Q A;  3MX3 A;  2PP4 A;  2FFH A;  5L0H A;  2IXM A;  4KBL A;  3US6 A;  1PV3 A;  5L0D A;  4EIY A;  3UR3 C;  2J46 A;  4U9E A;  2ZD9 A;  4BPM A;  5JT4 A;  2YEV A;  1ZHW A;  2GFH A;  3I5P A;  3K33 A;  4YT2 A;  1KU2 A;  4ZLD A;  2Y3G A;  4D4N A;  4E0H A;  1QLE C;  2XLH A;  4BJ5 A;  1OR2 A;  3GM2 A;  2XL8 A;  4JJG A;  5DLJ A;  1V74 B;  1G8X A;  2F22 A;  1Z3I X;  4I44 A;  1OCR C;  4J32 B;  3ZG1 A;  3EQL F;  2HS5 A;  4JZA A;  2XXA A;  1ZHX A;  3KL4 A;  3U9M A;  1VYI A;  4BJ1 A;  4CJG A;  1D0X A;  2MYS A;  2NG1 A;  1C02 A;  4C3E A;  4DRH B;  2BC5 A;  4CSA A;  4NTF A;  4JRZ A;  2VCB A;  3NG1 A;  3R2P A;  4J7Y A;  3RVZ A;  3S29 A;  1YVI A;  3TJ6 A;  2LSE A;  3GOD A;  4HFF B;  4CDV A;  4Q5S F;  4Z9I A;  4PJM A;  4IWB A;  4HE8 D;  4DJ9 A;  1RCP A;  4WGY A;  2IXP A;  1L7C A;  1BR4 A;  3AG2 C;  2M4E A;  1WWP A;  3L1M A;  4AK9 A;  2FAP B;  2P0N A;  1MNE A;  2YWA A;  2R7X A;  1T5O A;  3SNH A;  3V5X A;  4H54 A;  1U6H A;  3RQG A;  1R5I D;  1ZYR F;  4YT4 A;  4PJJ A;  4P9F A;  3O10 A;  3DE8 A;  3WHN A;  3DAG A;  4AE4 B;  3NMJ A;  4YL0 A;  5BQG A;  4DBQ A;  4XLN F;  2R7S A;  4YL1 A;  2HMZ A;  1HE9 A;  2XM0 A;  3CQZ A;  3WG7 C;  3IQ6 A;  5COG A;  5A69 A;  3F46 A;  4JUR I;  4CDA A;  1MMA A;  5DQT A;  5L0I A;  1QKR A;  1FMW A;  4ZLC A;  3HNI A;  1I4Y A;  2J7P A;  2V3C C;  3C8G A;  1TR2 A;  2XLE A;  3IQT A;  4PJL A;  3U8V A;  5E3C A;  1YA7 O;  2J9W A;  4LLC A;  3HNL A;  1UG7 A;  1Q0M A;  3ZQY A;  4YJW A;  4C3D A;  5KYY B;  2Z15 A;  4LDR A;  4BG0 A;  1S05 A;  2HKV A;  2UUI A;  3QW1 A;  1LI7 A;  1VMA A;  1VK5 A;  2AWC A;  2EPL X;  3EHM A;  3K1H A;  4IAO A;  1D1C A;  4I1O B;  3GEH A;  2H7B A;  3R7C A;  4MVR A;  1OKK A;  4XTK A;  1WTY A;  4F4B A;  3SXY A;  5DS6 A;  3UGO A;  3PDM P;  3JZ0 A;  3GWN A;  3KYI A;  1AVO B;  3GM3 A;  4IB4 A;  3RF3 A;  4OIN F;  5B3S C;  2AU5 A;  2OKU A;  2B0H A;  2EIK C;  1DOW A;  1MQV A;  2J9U A;  3T4R A;  4BEM J;  2CDQ A;  5DS5 A;  2YL1 A;  4MVM A;  4M63 A;  4AX2 A;  2L7A A;  3H2U A;  4BJ5 C;  3LJB A;  1EKY A;  1M57 C;  3OA1 A;  2EIM C;  1YJG A;  1M2V A;  3ASN C;  3POV A;  4P6I C;  3V5Y A;  3NKE A;  4WJ0 A;  3W8I A;  4CBE A;  2CCY A;  3V5Z A;  2LIG A;  2Q3T A;  1MMG A;  2OJQ A;  2YZS A;  3AOU A;  4CIH A;  3AG1 C;  1LKX A;  1Y6D A;  2XS8 A;  1RKE A;  3VRC A;  1V55 C;  4CS7 A;  1RMV A;  1JRA A;  2WZL A;  3FDQ A;  3OWT A;  3K66 A;  3SP1 A;  2ZXP A;  1HW1 A;  1NLX A;  2R7R A;  3CZ6 A;  5CI8 A;  4JCZ A;  4YT5 A;  2KGO A;  3UGP A;  3M15 A;  3DZA A;  3C8Z A;  2YLG A;  2P7V A;  1HE1 A;  3K6B A;  1C17 M;  3O55 A;  1TFO B;  3RKO F;  3S0X A;  1T6U A;  3LNR A;  2XLV A;  2YLD A;  5A6B A;  2WVO A;  4H4K C;  4LAC B;  2R7W A;  2DGJ A;  4G7Z F;  4NCQ A;  4BJ6 A;  2WZF A;  3LEV A;  2NPU A;  5EHH A;  3S9O A;  2XSE A;  2ZPA A;  4CS9 C;  4DVZ A;  1ST6 A;  5CIV A;  2NSF A;  3EGD A;  1WOL A;  3KH2 A;  4OIR F;  1D0Y A;  2WL8 A;  4YK5 A;  4EBK A;  3GEE A;  1M56 C;  2LFD A;  2ZXR A;  2JD3 A;  1KNY A;  2HV7 A;  2MHR A;  4Q7C A;  4CDY A;  4YT8 A;  4XPY A;  4G7H F;  1RKC A;  2X51 A;  1QPU A;  1TWH A;  3EG9 A;  1Q0G A;  4E7S A;  2I8B A;  1YAU O;  2XXA B;  1SZI A;  1LPE A;  1LVK A;  4FAP B;  4EWC A;  2LCH A;  2Y69 C;  4IAR A;  1VYK A;  4I3M A;  1J8Y F;  3FAJ A;  3NMI A;  2VB6 A;  2WZG A;  1Y4C A;  3AGT A;  3GM1 A;  5COM A;  2R02 A;  3TQO A;  3VAY A;  1OR3 A;  2NUT A;  5KYW A;  2PBE A;  1GQA A;  1D1A A;  1Q0D A;  2UUH A;  3E9V A;  4CS8 A;  1T6Q A;  2IBF A;  4C3B A;  1E86 A;  2KC3 A;  2KW3 C;  5K0I A;  2Y39 A;  3DJN B;  4MTF A;  5AC5 A;  2KK1 A;  2CNW D;  2LD6 A;  5JRA A;  5FZT A;  4XPW A;  3NYJ A;  3JCU Q;  4IGG A;  3EZI A;  3QVY A;  1XWJ A;  5COF A;  1A7E A;  4YN0 B;  2Q9A A;  4Z9H A;  3T6J A;  2WVQ A;  2OJE D;  1LS1 A;  4WGZ A;  4XEK A;  3ABK C;  2A0U A;  4CS9 A;  2DB4 A;  4CX9 A;  4PFP A;  4OIP F;  1EI7 A;  1T9K A;  3QMK A;  1G5Z A;  3RIP A;  3ZIB A;  2R7Q A;  4U5C E;  4P9T A;  3U0C A;  4XQ1 A;  5CI9 A;  3PMR A;  5FCL A;  2XLD A;  1AEP A;  4EBJ A;  3EZH A;  2JX0 A;  2J0W A;  4AL1 A;  2YL0 A;  1G4W R;  1JR8 A;  2YKZ A;  3VM6 A;  4RBN A;  2XLO A;  2IYL D;  1A7D A;  1Z6A A;  1ZW2 A;  3EFO A;  4O7G A;  2A1D D;  1NU7 D;  2ASR A;  3C8G B;  3C7J A;  5L3V A;  3RFY A;  3HNJ A;  2V26 A;  4G7O F;  3CEX A;  1FFT C;  3N2Z B;  3U2M A;  3B0U X;  2LK4 A;  3LNM B;  3NYM A;  4RD9 A;  3TOM A;  2PFD A;  1YZC A;  1T01 A;  3U5S A;  3X2Q C;  1E2X A;  1QQ3 A;  1ZU5 A;  3MYI A;  4O6N A;  4RDA A;  4E7Z A;  2YRF A;  2TMV P;  3RH3 A;  4DRJ B;  3G4Z A;  1FMV A;  2Q9B A;  3JT1 A;  5HSW A;  3C18 A;  4YL3 A;  3SXM A;  1GS9 A;  2I15 A;  2OU6 A;  1FTS A;  1N1C A;  4JEB A;  4Q4Z F;  1YA9 A;  1JOG A;  2EPM X;  3B29 A;  3DMD A;  5GPG B;  4NY3 A;  4U5F E;  3LES A;  4XLP F;  4KNW A;  1GM5 A;  2WVN A;  3EGX A;  1PD0 A;  1YYX A;  2VCA A;  1HY5 A;  4KNV A;  5HV9 A;  2L81 A;  1CGO A;  3T6B A;  3JTL O;  2AVK A;  2OOC A;  2M64 A;  2Y3D A;  3KPH A;  3QTH A;  2PX0 A;  2KSF A;  3GOR A;  2J0X A;  2R7T A;  1O5H A;  2OEX A;  3I5Q A;  3LS0 A;  4O6M A;  2AWY A;  2LP4 A;  4E18 A;  4GEH A;  1O87 A;  4JTC B;  4K0D A;  4U5G A;  3TD7 A;  3RQF A;  3U9J A;  1M2O A;  1M2V B;  1IW7 F;  2G62 A;  2KJG A;  3N24 A;  5EGY A;  1FR0 A;  4MTO A;  4OD4 A;  3Q6N A;  4NC3 A;  3U8P A;  5A6A A;  4OD5 A;  1M6T A;  3RW0 A;  3K1I C;  1RXQ A;  3M79 A;  1RKE B;  4QI2 A;  4JVS A;  3O6X A;  1H7I A;  1D0Z A;  4GYT A;  3ZSU A;  5AGF A;  2G3K A;  3W4Y A;  1FFH A;  1H9G A;  3L34 A;  2YHS A;  4ONS A;  1ZHZ A;  4PR9 A;  2J8W A;  3BRJ A;  1ORY A;  2CYD A;  3S27 A;  4E17 A;  1BDJ B;  2GWW A;  3S90 A;  5D91 A;  3ZWI A;  4JTD B;  2X0C A;  4EBB A;  4EHP A;  3M1C B;  4CSA C;  2R7U A;  3U2L A;  4Z9J A;  4HEA J;  4U5E E;  5KYX A;  3NYL A;  3UMK A;  1GGQ A;  1RJ9 A;  2HSQ A;  5BQI A;  3NRH A;  5E2Q A;  3ASO C;  2EIL C;  4WAB A;  4C7O A;  1IZM A;  1YLM A;  3AG3 C;  3JYH A;  1MMD A;  1J8M F;  1TWA A;  3NKD A;  4NQF A;  1E84 A;  2EIJ C;  5E3A A;  1HMO A;  2Q4F A;  1PD1 A;  2HZ8 A;  3EGD B;  3MFN A;  2H7O A;  2R7O A;  1H6G A;  3WOD F;  4JEA A;  2EIN C;  3O39 A;  4MND A;  2OCC C;  4JIO A;  2HJ3 A;  2BE5 F;  3B0P A;  3M4B A;  4LDQ A;  1Q0K A;  1NBB A;  1ZVZ A;  4MQ9 F;  2Q7R A;  1ZHY A;  3EG9 B;  5JLI A;  4FX5 A;  2VAS A;  1O3U A;  3FOP A;  3IHU A;  2QUP A;  4EKW A;  2HMQ A;  3IQ5 A;  3ZDL A;  3MBG A;  1K04 A;  3B9Q A;  3K1I A;  2VH3 A;  2J9B A;  2XS1 A;  1BBH A;  1TQG A;  2PNO A;  1QZX A;  2YVK A;  3L8J A;  4N4W A;  5BUO A;  4LDK A;  1VTM P;  2Q00 A;  1K05 A;  1ZW3 A;  2C04 A;  2KNH A;  2QE9 A;  4JKV A;  4J7T A;  2NUT B;  5KYW B;  4XWJ A;  3TOL A;  3DM5 A;  3LEO A;  3C62 A;  5JUA A;  3ITF A;  5E33 A;  4G78 A;  1JAF A;  2L6H A;  3EJN A;  4ULW A;  3HJC A;  5L0C A;  2CW0 F;  4U9D A;  2LQG A; 
#chains in the Genus database with same CATH homology
 4J7Y A;  3DWW A;  4JCZ A;  2H8A A;  3B29 A;  2Q7R A;  3HKK A;  4BPM A;  4AL1 A;  5HV9 A;  4NTB A;  2UUH A;  4AL0 A;  2PNO A;  5K0I A;  5BQH A;  5BQI A;  2UUI A;  4J7T A;  4WAB A;  3LEO A;  4JC7 A;  4YK5 A;  4YL0 A;  3PCV A;  5BQG A;  4NTF A;  4JRZ A;  4YL1 A;  4NTA A;  4YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...