4J7YA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 58
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7yA00
5BQHA 4WABA 3DWWA 2Q7RA 2UUHA 5BQGA 5K0IA 4NTFA 4BPMA 3PCVA 4YK5A 4NTBA 2UUIA 4JCZA 4YL1A 4AL0A 3B29A 4J7TA 4JC7A 4NTAA 4AL1A 4J7YA 4JRZA 5BQIA 4YL0A 2H8AA 5HV9A 3HKKA 3LEOA 2PNOA 4YL3A
chains in the Genus database with same CATH superfamily
4U5HA 4CJGA 1ZHYA 3E70C 1OQCA 2HMZA 4WABA 3FDQA 1VTMP 2YHSA 4BJ6A 1IW7F 3U2LA 2YVKA 3X1OA 2ASRA 2OJQA 2Q00A 5FZTA 4JTDB 5IY5C 5K0IA 1Q0MA 3K1HA 4CDYA 3LLKA 2M64A 2X51A 3FOPA 4AL0A 2R7UA 1DOWA 4KC9A 1T6IA 4N06A 5CI9A 3RVYA 3Q7GA 5JRAA 1VYIA 2X0CA 4JURI 2Y3DA 4X0RA 3NG1A 2RSEB 4EKWA 5L0HA 1OCZC 2PX3A 4BJ5A 1A7EA 3JRMO 3LUTB 1H9GA 4PR9A 2J8WA 2HJ3A 2IBFA 2QNLA 1T6UA 3UMHA 4C3EA 1T01A 4NC3A 5BQHA 4PJNA 3ABLC 4YJWA 2KSFA 3UR3C 3KMIA 3DE8A 1LKXA 4MVQA 1OR3A 1A41A 3NDBB 2G62A 3VRCA 1NU7D 1HMDA 2A68F 1PD1A 1OXBA 3ABKC 4DVYP 4BJ6C 5JLIA 5A6BD 2R02A 2PX0A 3K66A 1VMAA 1LM3B 3UNGC 3B29A 5JVEA 1YYJA 4A4AA 4MTGA 4P6IC 3M4BA 4LERA 3U5SA 2QUPA 3VYWA 1QVXA 3UMIA 5KYUB 2JPUA 4O6MA 1CPQA 2VB6A 4H54A 3R7CA 5JSLA 3KL4A 4XEVA 5AC4A 5COGA 1U89A 1LE4A 1ZU4A 3MX3A 2A0UA 2I15A 3GWLA 3NYMA 1YAUO 4U5EE 3EQLF 4GYTA 3TQOA 4BJ5C 4JTCB 1ZW2A 4GEHA 2PBEA 1OKKA 4W8PA 3POVA 1JPJA 4O6NA 5F28E 1R5ID 1NFNA 4J30B 4DOZA 4E17A 3NRHA 1CGOA 4BPMA 3L8IA 2ZXWC 3VF0A 5L0IA 4U5CE 2RD9A 1NLXA 2D5RB 3QW1A 1S05A 3L8JA 4F4BA 4ONSA 4PFPA 1M2VB 3BEHA 4MVMA 3K1IA 4FWVA 1VLTA 3NMIA 1RMVA 2GDCA 3E9VA 5JP7A 3S0XA 1AEPA 2EIKC 3ECSA 3O39A 4MS2A 2NPUA 2VASA 5E2QA 4MQ9F 4MVZA 3C8GB 5L3QA 4IARA 1N1CA 2A1DD 2XL4A 3K33A 1A0BA 2YWAA 4MW3A 4BEJA 1V54C 3GEIA 4CSAA 3H2VA 3ITFA 4DBQA 1BR1A 4AE4A 4MTFA 5T1DB 4E18A 1FAPB 3B0VC 2WB7A 4HFKB 3QVZA 3L0IA 5B3SC 2P0NA 4YWQA 1PV3A 2DYSC 3ZDLA 1D1CA 1Y4CA 2P61A 4I1MA 1EI7A 4DVZA 3HNJA 2CW0F 3ABMC 3U8VA 3OEOA 3EGDB 5GPGB 3OA1A 1CGME 3IEEA 2EPLX 1C03A 3LESA 2WL8A 3K1IC 3EH2A 4RBNA 2J7PA 1O3UA 2V26A 1T9KA 3F46A 2VCCA 5DS5A 3GM2A 5KYYB 4YT5A 3AG3C 2H7OA 2W4BA 1TWCA 3BRJA 3DWWA 3TOLA 1U6HA 4JEBA 1VK5A 2QLAA 5BQGA 2LP4A 3AQCA 4JW1A 4CSAC 1MMGA 1OCRC 1ORJA 3QTHA 5KYNA 2GAQA 1GS9A 1NSGB 4DRJB 2R7XA 4CJOA 1AVOB 1Y6DA 2AU5A 4DBRA 2OKUA 4U5GA 1OW7A 1JRAA 2YL1A 5AC5A 3Q6NA 4PACA 1OCOC 3MLGA 2HMQA 4IB4A 4MVRA 4IRUA 2H8AA 2AWCA 5L3VA 1ZW3A 1R4TA 5A6AA 2DI3A 2ZD9A 2XLDA 3KPHA 1WOLA 1LI7A 1O87A 3TD7A 3EG9B 1VOMA 2PP4A 1I4ZA 3RQFA 1M56C 4Z9IA 4NY3A 1YLMA 1SZIA 4YT4A 1WASA 3O10A 3DMDA 4HFFB 3LS1A 1I5NA 3VAYA 1NBBA 1LS1A 1SF8A 4FX5A 1GGQA 1HMOA 3OWTA 3U3BA 2Q9AA 3VM6A 2CCYA 1V74B 2HUJA 2XS1A 1JR8A 3RQGA 3EPVA 3ZVRA 2XRHA 1Q0GA 1G4US 5DQZA 5B3IA 3HTKC 1YARO 3DXJF 3LEVA 4AL1A 2PFDA 5L0DA 4OIOF 3IHUA 4BJ1A 2L6HA 5COFA 4EBKA 2NSGA 2EINC 3HNLA 1VB5A 2XLMA 4RDAA 2KGOA 2Q4FA 5COMA 3HKKA 5FCLA 1K04A 3L1MA 1CPRA 4CS7A 3GEEA 3NMJA 2NSFA 2TMVP 2PNOA 4YL3A 5EK0A 1APCA 1E86A 3C8ZA 3U9MA 2YEVA 3M15A 1J8MF 5F5FA 2FGYA 1RCPA 2DGJA 2GFHA 3TJ5A 4OD4A 3WODF 3EHMA 1UFBA 2XM4A 3CAXA 4IAOA 3U9JA 5L0JA 3ZSUA 4C7OB 1RKEA 1C17M 2LFFA 3SNHA 1F1MA 2R05A 2J0WA 2YZSA 2EILC 3JZ0A 3WG7C 5DVWA 3NMKA 3FHDA 5T3WA 4YK5A 3Q6MA 4WGZA 3LS0A 3DKAA 3EZHA 4N6HA 3UMKA 4EHPA 3W2WA 2LIGA 2VCBA 3C18A 3QMKA 3CSKA 4MVUA 3I4UA 4RD9A 4K0DA 3EFOA 3GODA 3DE9A 4MTOA 3SXYA 1ZHZA 4O7GA 3SXZA 4ZLCA 2XLEA 3SZRA 3SYNA 3X2QC 5L0FA 2EPMX 2J46A 3H2UA 3PDMP 3HNIA 4YL0A 1ZHTA 3TJ6A 4QI2A 4FAPB 1FNTc 256BA 3W8HA 1E2XA 2G3KA 4XPYA 4L6RA 4XQ1A 4Q4ZF 2R7WA 2YL3A 3GEHA 1IZMA 3MFNA 3ZC4A 1GM5A 3QZCA 1BR4A 3UGPA 4Q7CA 2NUTB 4K1OA 2Q9BA 3FMSA 2EPOA 1FFHA 1G5ZA 1LE2A 3DAGA 1XZPA 1LIHA 1D1AA 5D92A 1Z7Qc 2HV7A 3S9OA 2I8BA 1A7VA 2VC9A 3LAYA 3LLIA 3S27A 3IQTA 1ZZPA 3V5YA 4PJLA 1U0BB 2R03A 1YDIA 4PK4A 1ZU5A 1OR2A 1HY5A 1M57C 1T5OA 2J9VA 1V4AA 1YZAA 4ULWA 5F5HA 1OCCC 2EPNA 1B68A 1ZYRF 2IXPA 1RKCA 4JEAA 3AG1C 3C7JA 4OD5A 4XEFA 3EGXB 2XXAA 1CGNA 3IPMO 2VCAA 3RIPA 4N6CA 4EWCA 1MMNA 4PJJA 3KKBA 1V55C 2BL2A 2MYSA 4JZAA 2XL8A 5TJ5E 3ZTMA 2B0JA 2QE9A 2WVNA 2XL6A 3EFOB 3JSEO 4H4KC 4OINF 3RYLA 1FR0A 1YVIA 2LK4A 4JJFA 3WAQA 3RQEA 2ETSA 3B9QA 5A6BA 2A69F 3U0CA 3LNMB 2KYHA 2OU6A 5KYUA 2J7PD 1D0XA 2YL0A 4R32A 1E85A 4OIPF 4KI2A 4NTBA 1J8YF 3DJNB 1MMAA 2C03A 3KYJA 5JUAA 4BEMJ 5A69A 2CNWA 2O9XA 3EH1A 2BE5F 2YLIA 4HE8D 1HE1A 4XLPF 3US6A 4YT2A 4KBLA 4IJJA 5DLJA 4KNWA 1JPNA 4K7BA 5T3TA 3CQZA 4FESA 3SEOA 1S7ZA 1WN0A 2HSQA 1Z6AA 2Q9CA 4LDQA 3SXMA 3W8IA 5BUOA 5KYXB 3B0UX 3LNRA 1MQVA 1EA8A 1TFKB 2HKVA 3W4YA 1Q0FA 4CIPA 2WZFA 5A6JA 4U5BE 2J0XA 2WZGA 1NFOA 1M2OA 1AUEA 3L34A 4LLEA 5A6KA 2DYRC 3I5QA 1OW6A 1ORYA 3JYHA 2Q7RA 3RVZA 3AG4C 3WHNA 4BG0A 2P6VA 1XZQA 1ST6A 3DI5A 2IXOA 5HSWA 3EGDA 3C8GD 3M1CB 4P9FA 4P9TA 4UDVA 5KYYA 3N24A 4O6YA 4U5DE 1LI5A 4JC7A 1VLSA 2G3VA 4E7ZA 1WTYA 3ZTZA 3GORA 4G7HF 1TKNA 1NU9C 5E3AA 3G50A 4CS9C 1C02A 1Z3IX 4Z9HA 4OIRF 2PF4E 4AK9A 4QI0A 4D4NA 3T9OA 4WGYA 2R7SA 3PHF2 4JJGA 1RJ9B 3JTLO 3R2PA 1FMVA 2W9YA 4D4XA 2DB4A 3HLZA 3I5PA 4DRHB 3S84A 2J9UA 4XPWA 1SR2A 3EG9A 2KQ9A 3NKDA 1M6TA 4HEAJ 3DZAA 2IYLD 3C8GA 3B71A 5CI8A 3KYIA 2KNHA 1MNDA 1UG7A 1BDJB 2Q3TA 4I44A 4JTAB 1QPUA 4E0IA 2HV6A 2MHRA 4JE9A 3S28A 3N2ZB 1FFTC 1RKEB 2HJMA 1ZVZA 2EIMC 2L6FA 3EHNA 4NTFA 4AX2A 4CX9A 2YQYA 2HSBA 1RXQA 1QLEC 1KNYA 2A6EF 4YL1A 4JIOA 2ZXPA 2NG1A 4E0HA 2AVKA 3QVYA 2FAPB 3GM3A 3HNKA 2WVOA 4Z9JA 3JSZA 4DXWA 3EZIA 4EBBA 2F22A 2L6GA 2XLVA 1HW2A 3NKEA 1GQAA 2Y3HA 5L0CA 2AWYA 3G4ZA 1QSPA 1K05A 3LEOA 4W8KA 2L81A 2OG2A 3T6BA 4DRIB 1BBHA 3AQBA 3QW0A 4CS9A 3UGOA 2CYDA 2KW3C 4PJMA 2KK1A 2LSEA 3C63A 2NUPB 3Q7LA 2L9JA 4CDVA 4XTKA 1PCXA 2LD6A 2L7AA 1XWJA 2JX0A 2ZPAA 1D0YA 4G0HA 4BJTA 4CIHA 1HE9A 2W45A 4CBEA 1A7DA 3JYYA 2XS8A 3FAPB 4MVOA 1E84A 4ULVA 2YLGA 2UUIA 1YA9A 3RH3A 2R7VA 4ZLDA 1OKKD 1EKYA 2D4UA 2H7VC 1TWGA 4PFOA 2OEXA 3FXHA 4NCQA 3C62A 4M63A 3G4XA 2IM8A 1TWHA 4NTAA 3O55A 1E83A 1TFOB 3ASOC 3AGUA 3U3FA 1BZ4A 2BC5A 1DOVA 1OW8A 4QDLA 1ORSC 3JT1A 1TQGA 4JKVA 3ZIBA 2NUTA 4YT8A 3DM9B 4C3BA 5HV9A 2XLOA 1H7IA 5B1AC 1W2WA 2GA0A 3T6GB 3TULA 1G4WR 2H7BA 1KTMA 2KJGA 3EJNA 2R7RA 2J45A 1M2VA 3S90A 1RJ9A 4GQHA 4LACB 1MNEA 1HW1A 1ZHWA 5KYWA 2ZXOA 2UUHA 3JRTA 2Z15A 3U8PA 2OQMA 5B1BC 4OIQF 4U5FE 4U9DA 4I1OB 3J06A 5DQTA 3PCVA 4U9EA 1SYQA 2HS5A 2EPKX 2IXNA 2OCCC 3K6BA 3T4RA 2NUPA 4XLNF 1BR2A 1QKRA 2XM0A 3SP1A 1FMWA 3K7DA 2B0HA 5JT4A 3H65A 3ZQYA 3FAJA 1O5HA 4G78A 1H9TA 3IQ5A 3SXKA 2XLWA 3AGTA 3M79A 2HFIA 1QQ3A 2QY9A 1NZEA 4Q5SF 5D91A 2Y69C 3W2VA 3U2MA 4LDKA 4N4WA 3MYFA 2C04A 4LLCA 3ZWIA 5L0GA 2HZ8A 2AP3A 2W4MA 2R7QA 3DD7A 1Z5ZA 2YLDA 3DM5A 3EGXA 4NQFA 4MVSA 3TOMA 1L7CA 2XXAB 3JCUQ 1PD0A 1YZCA 1I4YA 2ZXRA 4DJ9A 1VYKA 3O6XA 2CDQA 3ATPA 4XPXA 2OOCA 2EIJC 3FOOA 3B0PA 2R9RB 4JCHA 4CS8A 3AJMA 1Z63A 2MWQA 1WATA 3MBGA 4IWBA 2IOQA 2OJED 4I3MA 1LPEA 3V5XA 5KYXA 2V3CC 3MYIA 2Y39A 2FFHA 5AGFA 4IGGA 5EGYA 3NYJA 1WGWA 3RW0A 3CZ6A 2OEVA 3DJUB 4WJ0A 1QZXA 3V7OA 4IAQA 2VH3A 2XSEA 4XWJA 5E3CA 4J32B 1TWAA 3S29A 3PMRA 3F47A 2P1AA 1D1BA 1OXKA 1Z23A 4ANJA 1YA7O 3ZQVA 3AG2C 2E87A 3ASNC 3IQ6A 3N0TA 5DS4A 2WVQA 3RKOF 5KYWB 4JVSA 2GWWA 2WZLA 2JD3A 4JCZA 3AOUA 2R7OA 2Y3GA 2J9BA 4J7TA 4G7ZF 4J7YA 2R7TA 1MMDA 2ICWG 2LCHA 2R25A 4C3DA 1KU2A 4ER9A 4LDRA 1L3PA 4CS8C 2A0BA 2LQGA 3GM1A 1D0ZA 2A6HF 4EIYA 5E33A 1G8XA 2XLHA 4MNDA 3RF3A 3V5ZA 2YKZA 4MW8A 3GWNA 3A11A 1T6QA 3HJCA 3LJBA 2QTVA 5DS6A 3IQCA 3M4CA 3TK0A 5CIVA 1ZHXA 3DAFA 2KC3A 2M4EA 4O79A 5JS5A 4G7OF 1H6GA 1TR2A 3T6JA 2CNWD 3CEXA 1JAFA 1Q0KA 1YYXA 3RFYA 1EQ1A 2J9WA 2YRFA 3ZG1A 3A9CA 4B6IA 1LS4A 4KNVA 2P7VA 1Q0DA 4EBJA 1FTSA 1JMWA 1LVKA 1WWPA 1YJGA 4A2NB 4JRZA 4C7OA 2LFDA 5BQIA 2IXMA 3NYLA 3GANA 3FVYA 4AE4B 1JOGA 2YL7A 4YN0B 4E7SA 1K40A 1NG1A 5EHHA 2Y3BA 4EUKB 2CGEA 1SMYF 4XEKA 4CDAA 3KH2A
chains in the Genus database with same CATH topology
5BQHA 4WABA 3DWWA 2Q7RA 2UUHA 5BQGA 5K0IA 4NTFA 4BPMA 3PCVA 4YK5A 4NTBA 2UUIA 4JCZA 4YL1A 4AL0A 3B29A 4J7TA 4JC7A 4NTAA 4AL1A 4J7YA 4JRZA 5BQIA 4YL0A 2H8AA 5HV9A 3HKKA 3LEOA 2PNOA 4YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQH A;  4WAB A;  3DWW A;  2Q7R A;  2UUH A;  5BQG A;  5K0I A;  4NTF A;  4BPM A;  3PCV A;  4YK5 A;  4NTB A;  2UUI A;  4JCZ A;  4YL1 A;  4AL0 A;  3B29 A;  4J7T A;  4JC7 A;  4NTA A;  4AL1 A;  4J7Y A;  4JRZ A;  5BQI A;  4YL0 A;  2H8A A;  5HV9 A;  3HKK A;  3LEO A;  2PNO A;  4YL3 A; 
#chains in the Genus database with same CATH topology
 4U5H A;  4CJG A;  1ZHY A;  3E70 C;  1OQC A;  2HMZ A;  4WAB A;  3FDQ A;  1VTM P;  2YHS A;  4BJ6 A;  1IW7 F;  3U2L A;  2YVK A;  3X1O A;  2ASR A;  2OJQ A;  2Q00 A;  5FZT A;  4JTD B;  5IY5 C;  5K0I A;  1Q0M A;  3K1H A;  4CDY A;  3LLK A;  2M64 A;  2X51 A;  3FOP A;  4AL0 A;  2R7U A;  1DOW A;  4KC9 A;  1T6I A;  4N06 A;  5CI9 A;  3RVY A;  3Q7G A;  5JRA A;  1VYI A;  2X0C A;  4JUR I;  2Y3D A;  4X0R A;  3NG1 A;  2RSE B;  4EKW A;  5L0H A;  1OCZ C;  2PX3 A;  4BJ5 A;  1A7E A;  3JRM O;  3LUT B;  1H9G A;  4PR9 A;  2J8W A;  2HJ3 A;  2IBF A;  2QNL A;  1T6U A;  3UMH A;  4C3E A;  1T01 A;  4NC3 A;  5BQH A;  4PJN A;  3ABL C;  4YJW A;  2KSF A;  3UR3 C;  3KMI A;  3DE8 A;  1LKX A;  4MVQ A;  1OR3 A;  1A41 A;  3NDB B;  2G62 A;  3VRC A;  1NU7 D;  1HMD A;  2A68 F;  1PD1 A;  1OXB A;  3ABK C;  4DVY P;  4BJ6 C;  5JLI A;  5A6B D;  2R02 A;  2PX0 A;  3K66 A;  1VMA A;  1LM3 B;  3UNG C;  3B29 A;  5JVE A;  1YYJ A;  4A4A A;  4MTG A;  4P6I C;  3M4B A;  4LER A;  3U5S A;  2QUP A;  3VYW A;  1QVX A;  3UMI A;  5KYU B;  2JPU A;  4O6M A;  1CPQ A;  2VB6 A;  4H54 A;  3R7C A;  5JSL A;  3KL4 A;  4XEV A;  5AC4 A;  5COG A;  1U89 A;  1LE4 A;  1ZU4 A;  3MX3 A;  2A0U A;  2I15 A;  3GWL A;  3NYM A;  1YAU O;  4U5E E;  3EQL F;  4GYT A;  3TQO A;  4BJ5 C;  4JTC B;  1ZW2 A;  4GEH A;  2PBE A;  1OKK A;  4W8P A;  3POV A;  1JPJ A;  4O6N A;  5F28 E;  1R5I D;  1NFN A;  4J30 B;  4DOZ A;  4E17 A;  3NRH A;  1CGO A;  4BPM A;  3L8I A;  2ZXW C;  3VF0 A;  5L0I A;  4U5C E;  2RD9 A;  1NLX A;  2D5R B;  3QW1 A;  1S05 A;  3L8J A;  4F4B A;  4ONS A;  4PFP A;  1M2V B;  3BEH A;  4MVM A;  3K1I A;  4FWV A;  1VLT A;  3NMI A;  1RMV A;  2GDC A;  3E9V A;  5JP7 A;  3S0X A;  1AEP A;  2EIK C;  3ECS A;  3O39 A;  4MS2 A;  2NPU A;  2VAS A;  5E2Q A;  4MQ9 F;  4MVZ A;  3C8G B;  5L3Q A;  4IAR A;  1N1C A;  2A1D D;  2XL4 A;  3K33 A;  1A0B A;  2YWA A;  4MW3 A;  4BEJ A;  1V54 C;  3GEI A;  4CSA A;  3H2V A;  3ITF A;  4DBQ A;  1BR1 A;  4AE4 A;  4MTF A;  5T1D B;  4E18 A;  1FAP B;  3B0V C;  2WB7 A;  4HFK B;  3QVZ A;  3L0I A;  5B3S C;  2P0N A;  4YWQ A;  1PV3 A;  2DYS C;  3ZDL A;  1D1C A;  1Y4C A;  2P61 A;  4I1M A;  1EI7 A;  4DVZ A;  3HNJ A;  2CW0 F;  3ABM C;  3U8V A;  3OEO A;  3EGD B;  5GPG B;  3OA1 A;  1CGM E;  3IEE A;  2EPL X;  1C03 A;  3LES A;  2WL8 A;  3K1I C;  3EH2 A;  4RBN A;  2J7P A;  1O3U A;  2V26 A;  1T9K A;  3F46 A;  2VCC A;  5DS5 A;  3GM2 A;  5KYY B;  4YT5 A;  3AG3 C;  2H7O A;  2W4B A;  1TWC A;  3BRJ A;  3DWW A;  3TOL A;  1U6H A;  4JEB A;  1VK5 A;  2QLA A;  5BQG A;  2LP4 A;  3AQC A;  4JW1 A;  4CSA C;  1MMG A;  1OCR C;  1ORJ A;  3QTH A;  5KYN A;  2GAQ A;  1GS9 A;  1NSG B;  4DRJ B;  2R7X A;  4CJO A;  1AVO B;  1Y6D A;  2AU5 A;  4DBR A;  2OKU A;  4U5G A;  1OW7 A;  1JRA A;  2YL1 A;  5AC5 A;  3Q6N A;  4PAC A;  1OCO C;  3MLG A;  2HMQ A;  4IB4 A;  4MVR A;  4IRU A;  2H8A A;  2AWC A;  5L3V A;  1ZW3 A;  1R4T A;  5A6A A;  2DI3 A;  2ZD9 A;  2XLD A;  3KPH A;  1WOL A;  1LI7 A;  1O87 A;  3TD7 A;  3EG9 B;  1VOM A;  2PP4 A;  1I4Z A;  3RQF A;  1M56 C;  4Z9I A;  4NY3 A;  1YLM A;  1SZI A;  4YT4 A;  1WAS A;  3O10 A;  3DMD A;  4HFF B;  3LS1 A;  1I5N A;  3VAY A;  1NBB A;  1LS1 A;  1SF8 A;  4FX5 A;  1GGQ A;  1HMO A;  3OWT A;  3U3B A;  2Q9A A;  3VM6 A;  2CCY A;  1V74 B;  2HUJ A;  2XS1 A;  1JR8 A;  3RQG A;  3EPV A;  3ZVR A;  2XRH A;  1Q0G A;  1G4U S;  5DQZ A;  5B3I A;  3HTK C;  1YAR O;  3DXJ F;  3LEV A;  4AL1 A;  2PFD A;  5L0D A;  4OIO F;  3IHU A;  4BJ1 A;  2L6H A;  5COF A;  4EBK A;  2NSG A;  2EIN C;  3HNL A;  1VB5 A;  2XLM A;  4RDA A;  2KGO A;  2Q4F A;  5COM A;  3HKK A;  5FCL A;  1K04 A;  3L1M A;  1CPR A;  4CS7 A;  3GEE A;  3NMJ A;  2NSF A;  2TMV P;  2PNO A;  4YL3 A;  5EK0 A;  1APC A;  1E86 A;  3C8Z A;  3U9M A;  2YEV A;  3M15 A;  1J8M F;  5F5F A;  2FGY A;  1RCP A;  2DGJ A;  2GFH A;  3TJ5 A;  4OD4 A;  3WOD F;  3EHM A;  1UFB A;  2XM4 A;  3CAX A;  4IAO A;  3U9J A;  5L0J A;  3ZSU A;  4C7O B;  1RKE A;  1C17 M;  2LFF A;  3SNH A;  1F1M A;  2R05 A;  2J0W A;  2YZS A;  2EIL C;  3JZ0 A;  3WG7 C;  5DVW A;  3NMK A;  3FHD A;  5T3W A;  4YK5 A;  3Q6M A;  4WGZ A;  3LS0 A;  3DKA A;  3EZH A;  4N6H A;  3UMK A;  4EHP A;  3W2W A;  2LIG A;  2VCB A;  3C18 A;  3QMK A;  3CSK A;  4MVU A;  3I4U A;  4RD9 A;  4K0D A;  3EFO A;  3GOD A;  3DE9 A;  4MTO A;  3SXY A;  1ZHZ A;  4O7G A;  3SXZ A;  4ZLC A;  2XLE A;  3SZR A;  3SYN A;  3X2Q C;  5L0F A;  2EPM X;  2J46 A;  3H2U A;  3PDM P;  3HNI A;  4YL0 A;  1ZHT A;  3TJ6 A;  4QI2 A;  4FAP B;  1FNT c;  256B A;  3W8H A;  1E2X A;  2G3K A;  4XPY A;  4L6R A;  4XQ1 A;  4Q4Z F;  2R7W A;  2YL3 A;  3GEH A;  1IZM A;  3MFN A;  3ZC4 A;  1GM5 A;  3QZC A;  1BR4 A;  3UGP A;  4Q7C A;  2NUT B;  4K1O A;  2Q9B A;  3FMS A;  2EPO A;  1FFH A;  1G5Z A;  1LE2 A;  3DAG A;  1XZP A;  1LIH A;  1D1A A;  5D92 A;  1Z7Q c;  2HV7 A;  3S9O A;  2I8B A;  1A7V A;  2VC9 A;  3LAY A;  3LLI A;  3S27 A;  3IQT A;  1ZZP A;  3V5Y A;  4PJL A;  1U0B B;  2R03 A;  1YDI A;  4PK4 A;  1ZU5 A;  1OR2 A;  1HY5 A;  1M57 C;  1T5O A;  2J9V A;  1V4A A;  1YZA A;  4ULW A;  5F5H A;  1OCC C;  2EPN A;  1B68 A;  1ZYR F;  2IXP A;  1RKC A;  4JEA A;  3AG1 C;  3C7J A;  4OD5 A;  4XEF A;  3EGX B;  2XXA A;  1CGN A;  3IPM O;  2VCA A;  3RIP A;  4N6C A;  4EWC A;  1MMN A;  4PJJ A;  3KKB A;  1V55 C;  2BL2 A;  2MYS A;  4JZA A;  2XL8 A;  5TJ5 E;  3ZTM A;  2B0J A;  2QE9 A;  2WVN A;  2XL6 A;  3EFO B;  3JSE O;  4H4K C;  4OIN F;  3RYL A;  1FR0 A;  1YVI A;  2LK4 A;  4JJF A;  3WAQ A;  3RQE A;  2ETS A;  3B9Q A;  5A6B A;  2A69 F;  3U0C A;  3LNM B;  2KYH A;  2OU6 A;  5KYU A;  2J7P D;  1D0X A;  2YL0 A;  4R32 A;  1E85 A;  4OIP F;  4KI2 A;  4NTB A;  1J8Y F;  3DJN B;  1MMA A;  2C03 A;  3KYJ A;  5JUA A;  4BEM J;  5A69 A;  2CNW A;  2O9X A;  3EH1 A;  2BE5 F;  2YLI A;  4HE8 D;  1HE1 A;  4XLP F;  3US6 A;  4YT2 A;  4KBL A;  4IJJ A;  5DLJ A;  4KNW A;  1JPN A;  4K7B A;  5T3T A;  3CQZ A;  4FES A;  3SEO A;  1S7Z A;  1WN0 A;  2HSQ A;  1Z6A A;  2Q9C A;  4LDQ A;  3SXM A;  3W8I A;  5BUO A;  5KYX B;  3B0U X;  3LNR A;  1MQV A;  1EA8 A;  1TFK B;  2HKV A;  3W4Y A;  1Q0F A;  4CIP A;  2WZF A;  5A6J A;  4U5B E;  2J0X A;  2WZG A;  1NFO A;  1M2O A;  1AUE A;  3L34 A;  4LLE A;  5A6K A;  2DYR C;  3I5Q A;  1OW6 A;  1ORY A;  3JYH A;  2Q7R A;  3RVZ A;  3AG4 C;  3WHN A;  4BG0 A;  2P6V A;  1XZQ A;  1ST6 A;  3DI5 A;  2IXO A;  5HSW A;  3EGD A;  3C8G D;  3M1C B;  4P9F A;  4P9T A;  4UDV A;  5KYY A;  3N24 A;  4O6Y A;  4U5D E;  1LI5 A;  4JC7 A;  1VLS A;  2G3V A;  4E7Z A;  1WTY A;  3ZTZ A;  3GOR A;  4G7H F;  1TKN A;  1NU9 C;  5E3A A;  3G50 A;  4CS9 C;  1C02 A;  1Z3I X;  4Z9H A;  4OIR F;  2PF4 E;  4AK9 A;  4QI0 A;  4D4N A;  3T9O A;  4WGY A;  2R7S A;  3PHF 2;  4JJG A;  1RJ9 B;  3JTL O;  3R2P A;  1FMV A;  2W9Y A;  4D4X A;  2DB4 A;  3HLZ A;  3I5P A;  4DRH B;  3S84 A;  2J9U A;  4XPW A;  1SR2 A;  3EG9 A;  2KQ9 A;  3NKD A;  1M6T A;  4HEA J;  3DZA A;  2IYL D;  3C8G A;  3B71 A;  5CI8 A;  3KYI A;  2KNH A;  1MND A;  1UG7 A;  1BDJ B;  2Q3T A;  4I44 A;  4JTA B;  1QPU A;  4E0I A;  2HV6 A;  2MHR A;  4JE9 A;  3S28 A;  3N2Z B;  1FFT C;  1RKE B;  2HJM A;  1ZVZ A;  2EIM C;  2L6F A;  3EHN A;  4NTF A;  4AX2 A;  4CX9 A;  2YQY A;  2HSB A;  1RXQ A;  1QLE C;  1KNY A;  2A6E F;  4YL1 A;  4JIO A;  2ZXP A;  2NG1 A;  4E0H A;  2AVK A;  3QVY A;  2FAP B;  3GM3 A;  3HNK A;  2WVO A;  4Z9J A;  3JSZ A;  4DXW A;  3EZI A;  4EBB A;  2F22 A;  2L6G A;  2XLV A;  1HW2 A;  3NKE A;  1GQA A;  2Y3H A;  5L0C A;  2AWY A;  3G4Z A;  1QSP A;  1K05 A;  3LEO A;  4W8K A;  2L81 A;  2OG2 A;  3T6B A;  4DRI B;  1BBH A;  3AQB A;  3QW0 A;  4CS9 A;  3UGO A;  2CYD A;  2KW3 C;  4PJM A;  2KK1 A;  2LSE A;  3C63 A;  2NUP B;  3Q7L A;  2L9J A;  4CDV A;  4XTK A;  1PCX A;  2LD6 A;  2L7A A;  1XWJ A;  2JX0 A;  2ZPA A;  1D0Y A;  4G0H A;  4BJT A;  4CIH A;  1HE9 A;  2W45 A;  4CBE A;  1A7D A;  3JYY A;  2XS8 A;  3FAP B;  4MVO A;  1E84 A;  4ULV A;  2YLG A;  2UUI A;  1YA9 A;  3RH3 A;  2R7V A;  4ZLD A;  1OKK D;  1EKY A;  2D4U A;  2H7V C;  1TWG A;  4PFO A;  2OEX A;  3FXH A;  4NCQ A;  3C62 A;  4M63 A;  3G4X A;  2IM8 A;  1TWH A;  4NTA A;  3O55 A;  1E83 A;  1TFO B;  3ASO C;  3AGU A;  3U3F A;  1BZ4 A;  2BC5 A;  1DOV A;  1OW8 A;  4QDL A;  1ORS C;  3JT1 A;  1TQG A;  4JKV A;  3ZIB A;  2NUT A;  4YT8 A;  3DM9 B;  4C3B A;  5HV9 A;  2XLO A;  1H7I A;  5B1A C;  1W2W A;  2GA0 A;  3T6G B;  3TUL A;  1G4W R;  2H7B A;  1KTM A;  2KJG A;  3EJN A;  2R7R A;  2J45 A;  1M2V A;  3S90 A;  1RJ9 A;  4GQH A;  4LAC B;  1MNE A;  1HW1 A;  1ZHW A;  5KYW A;  2ZXO A;  2UUH A;  3JRT A;  2Z15 A;  3U8P A;  2OQM A;  5B1B C;  4OIQ F;  4U5F E;  4U9D A;  4I1O B;  3J06 A;  5DQT A;  3PCV A;  4U9E A;  1SYQ A;  2HS5 A;  2EPK X;  2IXN A;  2OCC C;  3K6B A;  3T4R A;  2NUP A;  4XLN F;  1BR2 A;  1QKR A;  2XM0 A;  3SP1 A;  1FMW A;  3K7D A;  2B0H A;  5JT4 A;  3H65 A;  3ZQY A;  3FAJ A;  1O5H A;  4G78 A;  1H9T A;  3IQ5 A;  3SXK A;  2XLW A;  3AGT A;  3M79 A;  2HFI A;  1QQ3 A;  2QY9 A;  1NZE A;  4Q5S F;  5D91 A;  2Y69 C;  3W2V A;  3U2M A;  4LDK A;  4N4W A;  3MYF A;  2C04 A;  4LLC A;  3ZWI A;  5L0G A;  2HZ8 A;  2AP3 A;  2W4M A;  2R7Q A;  3DD7 A;  1Z5Z A;  2YLD A;  3DM5 A;  3EGX A;  4NQF A;  4MVS A;  3TOM A;  1L7C A;  2XXA B;  3JCU Q;  1PD0 A;  1YZC A;  1I4Y A;  2ZXR A;  4DJ9 A;  1VYK A;  3O6X A;  2CDQ A;  3ATP A;  4XPX A;  2OOC A;  2EIJ C;  3FOO A;  3B0P A;  2R9R B;  4JCH A;  4CS8 A;  3AJM A;  1Z63 A;  2MWQ A;  1WAT A;  3MBG A;  4IWB A;  2IOQ A;  2OJE D;  4I3M A;  1LPE A;  3V5X A;  5KYX A;  2V3C C;  3MYI A;  2Y39 A;  2FFH A;  5AGF A;  4IGG A;  5EGY A;  3NYJ A;  1WGW A;  3RW0 A;  3CZ6 A;  2OEV A;  3DJU B;  4WJ0 A;  1QZX A;  3V7O A;  4IAQ A;  2VH3 A;  2XSE A;  4XWJ A;  5E3C A;  4J32 B;  1TWA A;  3S29 A;  3PMR A;  3F47 A;  2P1A A;  1D1B A;  1OXK A;  1Z23 A;  4ANJ A;  1YA7 O;  3ZQV A;  3AG2 C;  2E87 A;  3ASN C;  3IQ6 A;  3N0T A;  5DS4 A;  2WVQ A;  3RKO F;  5KYW B;  4JVS A;  2GWW A;  2WZL A;  2JD3 A;  4JCZ A;  3AOU A;  2R7O A;  2Y3G A;  2J9B A;  4J7T A;  4G7Z F;  4J7Y A;  2R7T A;  1MMD A;  2ICW G;  2LCH A;  2R25 A;  4C3D A;  1KU2 A;  4ER9 A;  4LDR A;  1L3P A;  4CS8 C;  2A0B A;  2LQG A;  3GM1 A;  1D0Z A;  2A6H F;  4EIY A;  5E33 A;  1G8X A;  2XLH A;  4MND A;  3RF3 A;  3V5Z A;  2YKZ A;  4MW8 A;  3GWN A;  3A11 A;  1T6Q A;  3HJC A;  3LJB A;  2QTV A;  5DS6 A;  3IQC A;  3M4C A;  3TK0 A;  5CIV A;  1ZHX A;  3DAF A;  2KC3 A;  2M4E A;  4O79 A;  5JS5 A;  4G7O F;  1H6G A;  1TR2 A;  3T6J A;  2CNW D;  3CEX A;  1JAF A;  1Q0K A;  1YYX A;  3RFY A;  1EQ1 A;  2J9W A;  2YRF A;  3ZG1 A;  3A9C A;  4B6I A;  1LS4 A;  4KNV A;  2P7V A;  1Q0D A;  4EBJ A;  1FTS A;  1JMW A;  1LVK A;  1WWP A;  1YJG A;  4A2N B;  4JRZ A;  4C7O A;  2LFD A;  5BQI A;  2IXM A;  3NYL A;  3GAN A;  3FVY A;  4AE4 B;  1JOG A;  2YL7 A;  4YN0 B;  4E7S A;  1K40 A;  1NG1 A;  5EHH A;  2Y3B A;  4EUK B;  2CGE A;  1SMY F;  4XEK A;  4CDA A;  3KH2 A; 
#chains in the Genus database with same CATH homology
 5BQH A;  4WAB A;  3DWW A;  2Q7R A;  2UUH A;  5BQG A;  5K0I A;  4NTF A;  4BPM A;  3PCV A;  4YK5 A;  4NTB A;  2UUI A;  4JCZ A;  4YL1 A;  4AL0 A;  3B29 A;  4J7T A;  4JC7 A;  4NTA A;  4AL1 A;  4J7Y A;  4JRZ A;  5BQI A;  4YL0 A;  2H8A A;  5HV9 A;  3HKK A;  3LEO A;  2PNO A;  4YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...