4J7YA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
b'HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Homo sapiens
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
total genus 58
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7yA00
4YL3A 3HKKA 3PCVA 2PNOA 5BQHA 4YL1A 3B29A 4JCZA 4JC7A 5K0IA 4NTAA 4AL1A 4WABA 5BQIA 4JRZA 4AL0A 3DWWA 3LEOA 5HV9A 4YK5A 2UUIA 2H8AA 2UUHA 2Q7RA 4J7TA 4J7YA 4NTFA 4YL0A 4NTBA 4BPMA 5BQGA
chains in the Genus database with same CATH superfamily
4MQ9F 3HKKA 3UMHA 2XS1A 4JE9A 5HSWA 1J8YF 4QI2A 1RJ9A 4CX9A 3I5PA 1OR2A 3LLIA 1OR3A 5DS5A 1M57C 4L6RA 4NY3A 3S27A 4O6NA 5DQTA 1A7VA 1IW7F 1S05A 1ZHYA 3A9CA 2D5RB 2XL8A 2ICWG 4QDLA 4LDKA 2QY9A 1Z3IX 1AVOB 4C3DA 4H54A 2LSEA 2DB4A 4G7HF 1V4AA 3FAJA 2B0JA 2OOCA 5KYNA 3AG4C 1T6UA 3MX3A 4KNWA 4ZLDA 4IRUA 4LDQA 3U8PA 4BEMJ 2VASA 1O5HA 4IGGA 3Q6NA 3QVZA 4P9TA 5COGA 2EINC 2ETSA 5DLJA 2WZFA 3NMJA 3SYNA 4OINF 2XLEA 3SZRA 4C3BA 5EHHA 3NMKA 3DKAA 4Z9JA 1NFOA 3QW0A 3L8IA 1D0XA 3C63A 4E7SA 4NTAA 1LI7A 3WAQA 2EPKX 3U8VA 5COMA 3DJUB 1D1BA 2YVKA 1PD0A 3LJBA 4A2NB 1V55C 5JT4A 4HE8D 2QLAA 1H9TA 1WOLA 1JRAA 2L6FA 2V26A 3OEOA 2LFDA 4W8KA 2VCBA 1TWAA 1QPUA 4JTCB 4PK4A 4YK5A 5GPGB 2HKVA 3HNKA 3S84A 4MVZA 1G4WR 2ASRA 1U89A 1YZCA 2XXAA 4FX5A 2LCHA 5JLIA 2FFHA 3K1HA 4J7YA 2XM4A 5CI9A 1F1MA 1O87A 5AGFA 3C8GA 4E18A 3F47A 4YT4A 3EG9A 2OEXA 2PBEA 3N24A 4O6MA 4MTFA 3T9OA 3CAXA 2XM0A 3SXKA 1LE2A 3LUTB 3NRHA 3W8HA 3RVYA 4ZLCA 4BJTA 3LNMB 5KYWA 3K33A 4Z9IA 1E2XA 1YDIA 4D4XA 1G8XA 3C8GD 3LS1A 1MQVA 1LS1A 3ASOC 4LACB 4NC3A 2E87A 2P0NA 1EA8A 2VH3A 4RBNA 3RKOF 4BJ1A 5F5HA 5A6KA 4YWQA 3K1IC 3M15A 2G3KA 3I4UA 4I1MA 2R7XA 1TQGA 2H8AA 5L0HA 3C18A 3M4BA 2IYLD 3RQFA 2TMVP 2NSFA 2PP4A 3SEOA 5IY5C 2I8BA 3KL4A 2IBFA 2YLGA 4BJ6A 2P7VA 4JVSA 4U5FE 3HTKC 3QVYA 2MWQA 4JEAA 1SYQA 2H7VC 4HFKB 3X1OA 2WZLA 3M79A 1RMVA 2HJ3A 3PDMP 1YJGA 4D4NA 1ZHWA 5KYXB 3UMKA 3C8GB 1QZXA 4CS7A 2DI3A 2WB7A 1K40A 1HMDA 1SZIA 2YL3A 1NFNA 4MTGA 4U9DA 2R7RA 4CS8C 1QSPA 2WVQA 3EFOA 2PF4E 3NYMA 5KYYB 4OIOF 1G4US 2ZXRA 1VLSA 2CGEA 2Y3BA 4AK9A 4K0DA 2YHSA 4OD4A 5D92A 4MVSA 3NYJA 3NKDA 1ZHXA 2IXOA 256BA 2EPLX 4AE4B 5AC5A 1MNEA 4CJGA 1A0BA 1LPEA 2KW3C 1TWCA 3QW1A 4YL0A 5HV9A 3ABMC 2A69F 5B1AC 5BQGA 1HE1A 2CDQA 4JIOA 4ULWA 2RD9A 5EK0A 3U3FA 1M56C 2A1DD 1QLEC 5L0CA 3DMDA 3PMRA 3RQGA 1CGOA 3WHNA 4EIYA 3EPVA 2JD3A 5L3QA 1BR4A 4M63A 4Q5SF 3AJMA 2J45A 4JC7A 1WGWA 2J0WA 4JZAA 4MTOA 3SXZA 3G50A 4J32B 1Z63A 3S9OA 1QVXA 2OKUA 5T3TA 3PHF2 3DM9B 2QE9A 1LKXA 4E0HA 2R7UA 5B3SC 3EHNA 3GODA 3IHUA 3U9JA 3ZSUA 3JSZA 1WATA 2NUTA 2R7WA 2EPMX 1M6TA 1T6IA 4GEHA 1YZAA 2GDCA 3LS0A 3NYLA 1C02A 2XRHA 4MW3A 4PJNA 3SNHA 3POVA 2KGOA 4H4KC 4XLPF 2KSFA 2L81A 4WGYA 1ZHTA 2R03A 2WZGA 1CPRA 3CEXA 2M64A 3NKEA 3K7DA 2EPOA 4JTAB 1MMGA 1XZPA 2A6HF 3NG1A 4XEVA 1QKRA 3TJ5A 2J9VA 4JJFA 1OKKA 1AUEA 2GFHA 3FAPB 4DBRA 3FXHA 1ZW3A 3KH2A 1KNYA 5DS6A 1FNTc 1Q0DA 2I15A 1LM3B 3ATPA 1TFKB 4O7GA 1MMAA 4AE4A 3EGXB 2J0XA 3Q6MA 1GGQA 4IWBA 5AC4A 2Q9BA 1R5ID 2YRFA 4MS2A 5DVWA 3KKBA 2DYSC 3U9MA 1NSGB 3C8ZA 3MLGA 4KNVA 3DE8A 3CQZA 4OIQF 5E3CA 5F5FA 3O6XA 3K6BA 4LLCA 2XL4A 4Q4ZF 4K1OA 2J7PA 1TWGA 2L9JA 4NTFA 2CYDA 4BPMA 3G4XA 1YA7O 1HE9A 3N0TA 2BL2A 2R02A 3JTLO 5TJ5E 3VYWA 5BQHA 2NUPA 4CBEA 2LK4A 3T6JA 3A11A 1RKEA 2A0BA 3DZAA 3EZHA 3H65A 2QNLA 5JP7A 2HV7A 4N6HA 2R7QA 4O6YA 2KNHA 4PJMA 3R2PA 4AL0A 3V5XA 5L0FA 3EG9B 1NZEA 2P61A 3UGPA 2XSEA 2LFFA 1NG1A 3R7CA 3V7OA 4U5HA 1D0ZA 1A7EA 5E33A 2J8WA 2CCYA 3ZIBA 1HW2A 3I5QA 3U3BA 5A6BD 3QMKA 1Q0FA 1HW1A 2H7BA 2C03A 3V5YA 1NU7D 2HSQA 1OW8A 1PV3A 3AG2C 1V54C 3C7JA 3AQBA 1H7IA 1M2OA 3AOUA 3GM2A 3JYYA 2GAQA 1SF8A 4IAQA 4PR9A 4NTBA 3VF0A 4U9EA 2DYRC 2L7AA 3AGUA 3EGDB 3AQCA 4DRIB 5JSLA 4EBJA 2HZ8A 3MBGA 2PX3A 2XLVA 3ITFA 2R25A 1L7CA 4YT2A 1GS9A 3RIPA 4UDVA 1JMWA 1R4TA 1JR8A 3E70C 1UG7A 4JEBA 4MVMA 3M4CA 3G4ZA 3JZ0A 3ZTMA 2KC3A 4HFFB 2GWWA 5L0DA 2RSEB 1AEPA 5KYUA 4E7ZA 1M2VB 3JCUQ 4XPYA 2O9XA 5FZTA 1GM5A 2NPUA 2VCCA 1OCOC 3VM6A 1Z6AA 1GQAA 3F46A 3V5ZA 3KYJA 4DRHB 2MYSA 2OU6A 4XWJA 3B0PA 2Q7RA 3SXYA 1VLTA 2EILC 4AX2A 4MW8A 4CDYA 1OQCA 4DXWA 5KYXA 1YVIA 3BEHA 3ECSA 3ZG1A 3UMIA 1TKNA 2J7PD 1D1AA 1LI5A 4JURI 1JPJA 2EPNA 4MVQA 4XEFA 1BZ4A 2YL0A 3EZIA 4BEJA 1KTMA 1APCA 3AGTA 3EFOB 4PJLA 4KBLA 1FFTC 2Y39A 2LQGA 2CNWD 3HJCA 2YZSA 4YT8A 1YYXA 4WABA 3OA1A 2LD6A 3K66A 4PFPA 2ZD9A 3S29A 5A6JA 3IEEA 2A68F 3JRTA 4OIRF 3WODF 3FDQA 1N1CA 2VB6A 3Q7LA 1CGME 3O39A 1K05A 1OCRC 2B0HA 2EIJC 2Q4FA 2XLDA 3FMSA 3IPMO 3S90A 3J06A 1LVKA 1NLXA 1JOGA 1V74B 2A0UA 2OJQA 3ABKC 3FOPA 3DAGA 4PACA 4DRJB 2NSGA 4NQFA 1ZZPA 2XLOA 2WL8A 4RDAA 1MMNA 3AG1C 4J30B 4KC9A 1YAUO 2AP3A 2YWAA 3U0CA 1LE4A 1WTYA 2HUJA 1LIHA 3DD7A 4JCHA 1UFBA 2BC5A 1FR0A 1M2VA 4ER9A 1E84A 4QI0A 3HNJA 3ABLC 4G0HA 3TOLA 4C7OA 2C04A 3MYIA 3FHDA 3ZDLA 1YLMA 1EQ1A 3M1CB 5JVEA 3HNIA 3S0XA 2L6HA 2LIGA 2P1AA 1K04A 1ZYRF 3ASNC 3LESA 1VTMP 4JJGA 4I3MA 4IAOA 2R05A 3DJNB 4I44A 4U5CE 4JRZA 2DGJA 2YLIA 1MMDA 3EJNA 4JTDB 3DWWA 3TD7A 4E17A 2AVKA 4GYTA 3O10A 1FFHA 3GWLA 1S7ZA 5A6BA 4XTKA 4XLNF 2G62A 4ONSA 1FAPB 4C3EA 3LLKA 4K7BA 4BJ5A 2V3CC 1VK5A 4CS9A 2IOQA 5L0JA 4XQ1A 4ULVA 3CZ6A 3LEVA 1ORSC 4HEAJ 1TR2A 3PCVA 1VOMA 3C62A 3GEHA 3TOMA 3BRJA 3ZWIA 2XXAB 1A7DA 3VRCA 2J9WA 3W4YA 2A6EF 4WGZA 4CIPA 3KYIA 3KMIA 2OQMA 3T6GB 3EH1A 1Y4CA 3JSEO 4XPWA 1SR2A 2XLHA 2HFIA 3UGOA 4X0RA 3RW0A 3LAYA 2J9UA 2YL7A 3GWNA 2KK1A 2OG2A 3GANA 2D4UA 2M4EA 2NG1A 2XLMA 3RFYA 2Q9CA 3FOOA 1W2WA 2OCCC 3DAFA 3IQ5A 4OD5A 2Q3TA 5CI8A 2F22A 2IM8A 3ZQVA 2AWYA 1WASA 3RVZA 2QTVA 2XL6A 2IXPA 4E0IA 2PNOA 5KYYA 1L3PA 3B29A 4OIPF 4JCZA 1BDJB 4EBBA 1O3UA 1JAFA 1YYJA 2Y3DA 4MNDA 2CW0F 3QZCA 2PFDA 4RD9A 4U5BE 4AL1A 4DVZA 5D91A 2W4BA 2X0CA 4EUKB 2YL1A 1SMYF 2IXMA 1G5ZA 3L34A 3LEOA 4LERA 4U5DE 1Q0GA 2HJMA 4YT5A 3T6BA 3EGDA 3L1MA 1H6GA 3NMIA 4G7OF 5A6AA 1OCCC 2ZXOA 3S28A 1YA9A 4GQHA 2HSBA 1RKEB 4BG0A 1D1CA 1Z5ZA 4G78A 4CDVA 2UUHA 2HS5A 1ZVZA 1E83A 3VAYA 3GM1A 5JS5A 3W8IA 4U5EE 3ZQYA 4N4WA 3EHMA 3N2ZB 4P6IC 2HMZA 2H7OA 4IB4A 2AU5A 3U2LA 4DOZA 3SXMA 3IQTA 2P6VA 4CJOA 3LNRA 1A41A 4F4BA 4MVRA 5B3IA 4YL1A 3ZC4A 1FMVA 3HLZA 4FESA 4FWVA 5JUAA 5K0IA 1FTSA 3L8JA 3ZTZA 1Q0MA 4N06A 1RCPA 1VB5A 4B6IA 4R32A 1T9KA 5DQZA 1PCXA 4MVOA 1VYIA 1PD1A 3B71A 3H2VA 1Z7Qc 3DXJF 4CSAA 1ZW2A 5E2QA 5CIVA 2YQYA 5T1DB 1I4ZA 1C03A 1ORYA 2UUIA 3DI5A 3X2QC 1ZU5A 1FMWA 5JRAA 2Y69C 2FAPB 2R9RB 3MYFA 2BE5F 2IXNA 4LLEA 5A69A 2W9YA 3RF3A 3US6A 3IQCA 1I5NA 5KYUB 4W8PA 4JW1A 4BJ6C 3JRMO 4CDAA 2KYHA 3DE9A 3EQLF 1Q0KA 5B1BC 4YL3A 2KJGA 2NUTB 1OXKA 3GORA 5T3WA 1HMOA 3TULA 2R7SA 4EKWA 1VYKA 2R7TA 2YEVA 3H2UA 1MNDA 4IJJA 3K1IA 2YLDA 5L0IA 5BQIA 1ZU4A 1TWHA 4WJ0A 3NDBB 4FAPB 3E9VA 3U2MA 4IARA 3HNLA 3CSKA 4NCQA 2Q9AA 2WVNA 3TQOA 2W4MA 4DVYP 4C7OB 2CNWA 2NUPB 3OWTA 3RYLA 5E3AA 3JYHA 2EIMC 2PX0A 2VCAA 2JX0A 3B9QA 3WG7C 1OW6A 5KYWB 1B68A 1U0BB 1BBHA 3EGXA 4P9FA 2EIKC 1BR1A 2HMQA 1U6HA 3U5SA 4CSAC 1XZQA 1NBBA 1Y6DA 3GEEA 3AG3C 3QTHA 4I1OB 3W2VA 3ZVRA 5BUOA 1T01A 4Q7CA 4Z9HA 3RQEA 5L3VA 1OCZC 1EKYA 1H9GA 2G3VA 2J46A 5DS4A 3TK0A 3UNGC 4PJJA 4G7ZF 2VC9A 2ZXPA 4XPXA 2R7OA 3UR3C 2Y3HA 2L6GA 1TFOB 4YN0B 3GEIA 5EGYA 3IQ6A 1VMAA 5COFA 2W45A 5F28E 1RXQA 3O55A 3RH3A 1BR2A 2KQ9A 2XS8A 3JT1A 3B0VC 4KI2A 1RJ9B 1T5OA 3TJ6A 2R7VA 2QUPA 1LS4A 1DOWA 1ORJA 1T6QA 1XWJA 1YARO 2X51A 4U5GA 1RKCA 4PFOA 4LDRA 1C17M 3B0UX 4O79A 2XLWA 4JKVA 3SP1A 1EI7A 4BJ5C 1JPNA 1I4YA 2ZXWC 1D0YA 2AWCA 3L0IA 4EHPA 4MVUA 3EH2A 4XEKA 1E86A 1CPQA 1OXBA 3Q7GA 2GA0A 1E85A 3FVYA 1ST6A 4CS8A 4A4AA 1OKKD 1CGNA 3MFNA 4CS9C 4EWCA 1HY5A 1OW7A 3W2WA 5L0GA 2HV6A 2WVOA 2Y3GA 3KPHA 4YJWA 3T4RA 1KU2A 2ZPAA 4CIHA 4DBQA 1Z23A 3DM5A 2JPUA 2Z15A 4ANJA 2FGYA 2LP4A 2MHRA 2Q00A 1DOVA 3GM3A 2OEVA 1WWPA 4DJ9A 4EBKA 1WN0A 2J9BA 2OJED 4N6CA 4J7TA 1NU9C 1ZHZA 1IZMA 2YKZA 1J8MF 1QQ3A 5FCLA
chains in the Genus database with same CATH topology
4YL3A 3HKKA 3PCVA 2PNOA 5BQHA 4YL1A 3B29A 4JCZA 4JC7A 5K0IA 4NTAA 4AL1A 4WABA 5BQIA 4JRZA 4AL0A 3DWWA 3LEOA 5HV9A 4YK5A 2UUIA 2H8AA 2UUHA 2Q7RA 4J7TA 4J7YA 4NTFA 4YL0A 4NTBA 4BPMA 5BQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  3HKK A;  3PCV A;  2PNO A;  5BQH A;  4YL1 A;  3B29 A;  4JCZ A;  4JC7 A;  5K0I A;  4NTA A;  4AL1 A;  4WAB A;  5BQI A;  4JRZ A;  4AL0 A;  3DWW A;  3LEO A;  5HV9 A;  4YK5 A;  2UUI A;  2H8A A;  2UUH A;  2Q7R A;  4J7T A;  4J7Y A;  4NTF A;  4YL0 A;  4NTB A;  4BPM A;  5BQG A; 
#chains in the Genus database with same CATH topology
 4MQ9 F;  3HKK A;  3UMH A;  2XS1 A;  4JE9 A;  5HSW A;  1J8Y F;  4QI2 A;  1RJ9 A;  4CX9 A;  3I5P A;  1OR2 A;  3LLI A;  1OR3 A;  5DS5 A;  1M57 C;  4L6R A;  4NY3 A;  3S27 A;  4O6N A;  5DQT A;  1A7V A;  1IW7 F;  1S05 A;  1ZHY A;  3A9C A;  2D5R B;  2XL8 A;  2ICW G;  4QDL A;  4LDK A;  2QY9 A;  1Z3I X;  1AVO B;  4C3D A;  4H54 A;  2LSE A;  2DB4 A;  4G7H F;  1V4A A;  3FAJ A;  2B0J A;  2OOC A;  5KYN A;  3AG4 C;  1T6U A;  3MX3 A;  4KNW A;  4ZLD A;  4IRU A;  4LDQ A;  3U8P A;  4BEM J;  2VAS A;  1O5H A;  4IGG A;  3Q6N A;  3QVZ A;  4P9T A;  5COG A;  2EIN C;  2ETS A;  5DLJ A;  2WZF A;  3NMJ A;  3SYN A;  4OIN F;  2XLE A;  3SZR A;  4C3B A;  5EHH A;  3NMK A;  3DKA A;  4Z9J A;  1NFO A;  3QW0 A;  3L8I A;  1D0X A;  3C63 A;  4E7S A;  4NTA A;  1LI7 A;  3WAQ A;  2EPK X;  3U8V A;  5COM A;  3DJU B;  1D1B A;  2YVK A;  1PD0 A;  3LJB A;  4A2N B;  1V55 C;  5JT4 A;  4HE8 D;  2QLA A;  1H9T A;  1WOL A;  1JRA A;  2L6F A;  2V26 A;  3OEO A;  2LFD A;  4W8K A;  2VCB A;  1TWA A;  1QPU A;  4JTC B;  4PK4 A;  4YK5 A;  5GPG B;  2HKV A;  3HNK A;  3S84 A;  4MVZ A;  1G4W R;  2ASR A;  1U89 A;  1YZC A;  2XXA A;  4FX5 A;  2LCH A;  5JLI A;  2FFH A;  3K1H A;  4J7Y A;  2XM4 A;  5CI9 A;  1F1M A;  1O87 A;  5AGF A;  3C8G A;  4E18 A;  3F47 A;  4YT4 A;  3EG9 A;  2OEX A;  2PBE A;  3N24 A;  4O6M A;  4MTF A;  3T9O A;  3CAX A;  2XM0 A;  3SXK A;  1LE2 A;  3LUT B;  3NRH A;  3W8H A;  3RVY A;  4ZLC A;  4BJT A;  3LNM B;  5KYW A;  3K33 A;  4Z9I A;  1E2X A;  1YDI A;  4D4X A;  1G8X A;  3C8G D;  3LS1 A;  1MQV A;  1LS1 A;  3ASO C;  4LAC B;  4NC3 A;  2E87 A;  2P0N A;  1EA8 A;  2VH3 A;  4RBN A;  3RKO F;  4BJ1 A;  5F5H A;  5A6K A;  4YWQ A;  3K1I C;  3M15 A;  2G3K A;  3I4U A;  4I1M A;  2R7X A;  1TQG A;  2H8A A;  5L0H A;  3C18 A;  3M4B A;  2IYL D;  3RQF A;  2TMV P;  2NSF A;  2PP4 A;  3SEO A;  5IY5 C;  2I8B A;  3KL4 A;  2IBF A;  2YLG A;  4BJ6 A;  2P7V A;  4JVS A;  4U5F E;  3HTK C;  3QVY A;  2MWQ A;  4JEA A;  1SYQ A;  2H7V C;  4HFK B;  3X1O A;  2WZL A;  3M79 A;  1RMV A;  2HJ3 A;  3PDM P;  1YJG A;  4D4N A;  1ZHW A;  5KYX B;  3UMK A;  3C8G B;  1QZX A;  4CS7 A;  2DI3 A;  2WB7 A;  1K40 A;  1HMD A;  1SZI A;  2YL3 A;  1NFN A;  4MTG A;  4U9D A;  2R7R A;  4CS8 C;  1QSP A;  2WVQ A;  3EFO A;  2PF4 E;  3NYM A;  5KYY B;  4OIO F;  1G4U S;  2ZXR A;  1VLS A;  2CGE A;  2Y3B A;  4AK9 A;  4K0D A;  2YHS A;  4OD4 A;  5D92 A;  4MVS A;  3NYJ A;  3NKD A;  1ZHX A;  2IXO A;  256B A;  2EPL X;  4AE4 B;  5AC5 A;  1MNE A;  4CJG A;  1A0B A;  1LPE A;  2KW3 C;  1TWC A;  3QW1 A;  4YL0 A;  5HV9 A;  3ABM C;  2A69 F;  5B1A C;  5BQG A;  1HE1 A;  2CDQ A;  4JIO A;  4ULW A;  2RD9 A;  5EK0 A;  3U3F A;  1M56 C;  2A1D D;  1QLE C;  5L0C A;  3DMD A;  3PMR A;  3RQG A;  1CGO A;  3WHN A;  4EIY A;  3EPV A;  2JD3 A;  5L3Q A;  1BR4 A;  4M63 A;  4Q5S F;  3AJM A;  2J45 A;  4JC7 A;  1WGW A;  2J0W A;  4JZA A;  4MTO A;  3SXZ A;  3G50 A;  4J32 B;  1Z63 A;  3S9O A;  1QVX A;  2OKU A;  5T3T A;  3PHF 2;  3DM9 B;  2QE9 A;  1LKX A;  4E0H A;  2R7U A;  5B3S C;  3EHN A;  3GOD A;  3IHU A;  3U9J A;  3ZSU A;  3JSZ A;  1WAT A;  2NUT A;  2R7W A;  2EPM X;  1M6T A;  1T6I A;  4GEH A;  1YZA A;  2GDC A;  3LS0 A;  3NYL A;  1C02 A;  2XRH A;  4MW3 A;  4PJN A;  3SNH A;  3POV A;  2KGO A;  4H4K C;  4XLP F;  2KSF A;  2L81 A;  4WGY A;  1ZHT A;  2R03 A;  2WZG A;  1CPR A;  3CEX A;  2M64 A;  3NKE A;  3K7D A;  2EPO A;  4JTA B;  1MMG A;  1XZP A;  2A6H F;  3NG1 A;  4XEV A;  1QKR A;  3TJ5 A;  2J9V A;  4JJF A;  1OKK A;  1AUE A;  2GFH A;  3FAP B;  4DBR A;  3FXH A;  1ZW3 A;  3KH2 A;  1KNY A;  5DS6 A;  1FNT c;  1Q0D A;  2I15 A;  1LM3 B;  3ATP A;  1TFK B;  4O7G A;  1MMA A;  4AE4 A;  3EGX B;  2J0X A;  3Q6M A;  1GGQ A;  4IWB A;  5AC4 A;  2Q9B A;  1R5I D;  2YRF A;  4MS2 A;  5DVW A;  3KKB A;  2DYS C;  3U9M A;  1NSG B;  3C8Z A;  3MLG A;  4KNV A;  3DE8 A;  3CQZ A;  4OIQ F;  5E3C A;  5F5F A;  3O6X A;  3K6B A;  4LLC A;  2XL4 A;  4Q4Z F;  4K1O A;  2J7P A;  1TWG A;  2L9J A;  4NTF A;  2CYD A;  4BPM A;  3G4X A;  1YA7 O;  1HE9 A;  3N0T A;  2BL2 A;  2R02 A;  3JTL O;  5TJ5 E;  3VYW A;  5BQH A;  2NUP A;  4CBE A;  2LK4 A;  3T6J A;  3A11 A;  1RKE A;  2A0B A;  3DZA A;  3EZH A;  3H65 A;  2QNL A;  5JP7 A;  2HV7 A;  4N6H A;  2R7Q A;  4O6Y A;  2KNH A;  4PJM A;  3R2P A;  4AL0 A;  3V5X A;  5L0F A;  3EG9 B;  1NZE A;  2P61 A;  3UGP A;  2XSE A;  2LFF A;  1NG1 A;  3R7C A;  3V7O A;  4U5H A;  1D0Z A;  1A7E A;  5E33 A;  2J8W A;  2CCY A;  3ZIB A;  1HW2 A;  3I5Q A;  3U3B A;  5A6B D;  3QMK A;  1Q0F A;  1HW1 A;  2H7B A;  2C03 A;  3V5Y A;  1NU7 D;  2HSQ A;  1OW8 A;  1PV3 A;  3AG2 C;  1V54 C;  3C7J A;  3AQB A;  1H7I A;  1M2O A;  3AOU A;  3GM2 A;  3JYY A;  2GAQ A;  1SF8 A;  4IAQ A;  4PR9 A;  4NTB A;  3VF0 A;  4U9E A;  2DYR C;  2L7A A;  3AGU A;  3EGD B;  3AQC A;  4DRI B;  5JSL A;  4EBJ A;  2HZ8 A;  3MBG A;  2PX3 A;  2XLV A;  3ITF A;  2R25 A;  1L7C A;  4YT2 A;  1GS9 A;  3RIP A;  4UDV A;  1JMW A;  1R4T A;  1JR8 A;  3E70 C;  1UG7 A;  4JEB A;  4MVM A;  3M4C A;  3G4Z A;  3JZ0 A;  3ZTM A;  2KC3 A;  4HFF B;  2GWW A;  5L0D A;  2RSE B;  1AEP A;  5KYU A;  4E7Z A;  1M2V B;  3JCU Q;  4XPY A;  2O9X A;  5FZT A;  1GM5 A;  2NPU A;  2VCC A;  1OCO C;  3VM6 A;  1Z6A A;  1GQA A;  3F46 A;  3V5Z A;  3KYJ A;  4DRH B;  2MYS A;  2OU6 A;  4XWJ A;  3B0P A;  2Q7R A;  3SXY A;  1VLT A;  2EIL C;  4AX2 A;  4MW8 A;  4CDY A;  1OQC A;  4DXW A;  5KYX A;  1YVI A;  3BEH A;  3ECS A;  3ZG1 A;  3UMI A;  1TKN A;  2J7P D;  1D1A A;  1LI5 A;  4JUR I;  1JPJ A;  2EPN A;  4MVQ A;  4XEF A;  1BZ4 A;  2YL0 A;  3EZI A;  4BEJ A;  1KTM A;  1APC A;  3AGT A;  3EFO B;  4PJL A;  4KBL A;  1FFT C;  2Y39 A;  2LQG A;  2CNW D;  3HJC A;  2YZS A;  4YT8 A;  1YYX A;  4WAB A;  3OA1 A;  2LD6 A;  3K66 A;  4PFP A;  2ZD9 A;  3S29 A;  5A6J A;  3IEE A;  2A68 F;  3JRT A;  4OIR F;  3WOD F;  3FDQ A;  1N1C A;  2VB6 A;  3Q7L A;  1CGM E;  3O39 A;  1K05 A;  1OCR C;  2B0H A;  2EIJ C;  2Q4F A;  2XLD A;  3FMS A;  3IPM O;  3S90 A;  3J06 A;  1LVK A;  1NLX A;  1JOG A;  1V74 B;  2A0U A;  2OJQ A;  3ABK C;  3FOP A;  3DAG A;  4PAC A;  4DRJ B;  2NSG A;  4NQF A;  1ZZP A;  2XLO A;  2WL8 A;  4RDA A;  1MMN A;  3AG1 C;  4J30 B;  4KC9 A;  1YAU O;  2AP3 A;  2YWA A;  3U0C A;  1LE4 A;  1WTY A;  2HUJ A;  1LIH A;  3DD7 A;  4JCH A;  1UFB A;  2BC5 A;  1FR0 A;  1M2V A;  4ER9 A;  1E84 A;  4QI0 A;  3HNJ A;  3ABL C;  4G0H A;  3TOL A;  4C7O A;  2C04 A;  3MYI A;  3FHD A;  3ZDL A;  1YLM A;  1EQ1 A;  3M1C B;  5JVE A;  3HNI A;  3S0X A;  2L6H A;  2LIG A;  2P1A A;  1K04 A;  1ZYR F;  3ASN C;  3LES A;  1VTM P;  4JJG A;  4I3M A;  4IAO A;  2R05 A;  3DJN B;  4I44 A;  4U5C E;  4JRZ A;  2DGJ A;  2YLI A;  1MMD A;  3EJN A;  4JTD B;  3DWW A;  3TD7 A;  4E17 A;  2AVK A;  4GYT A;  3O10 A;  1FFH A;  3GWL A;  1S7Z A;  5A6B A;  4XTK A;  4XLN F;  2G62 A;  4ONS A;  1FAP B;  4C3E A;  3LLK A;  4K7B A;  4BJ5 A;  2V3C C;  1VK5 A;  4CS9 A;  2IOQ A;  5L0J A;  4XQ1 A;  4ULV A;  3CZ6 A;  3LEV A;  1ORS C;  4HEA J;  1TR2 A;  3PCV A;  1VOM A;  3C62 A;  3GEH A;  3TOM A;  3BRJ A;  3ZWI A;  2XXA B;  1A7D A;  3VRC A;  2J9W A;  3W4Y A;  2A6E F;  4WGZ A;  4CIP A;  3KYI A;  3KMI A;  2OQM A;  3T6G B;  3EH1 A;  1Y4C A;  3JSE O;  4XPW A;  1SR2 A;  2XLH A;  2HFI A;  3UGO A;  4X0R A;  3RW0 A;  3LAY A;  2J9U A;  2YL7 A;  3GWN A;  2KK1 A;  2OG2 A;  3GAN A;  2D4U A;  2M4E A;  2NG1 A;  2XLM A;  3RFY A;  2Q9C A;  3FOO A;  1W2W A;  2OCC C;  3DAF A;  3IQ5 A;  4OD5 A;  2Q3T A;  5CI8 A;  2F22 A;  2IM8 A;  3ZQV A;  2AWY A;  1WAS A;  3RVZ A;  2QTV A;  2XL6 A;  2IXP A;  4E0I A;  2PNO A;  5KYY A;  1L3P A;  3B29 A;  4OIP F;  4JCZ A;  1BDJ B;  4EBB A;  1O3U A;  1JAF A;  1YYJ A;  2Y3D A;  4MND A;  2CW0 F;  3QZC A;  2PFD A;  4RD9 A;  4U5B E;  4AL1 A;  4DVZ A;  5D91 A;  2W4B A;  2X0C A;  4EUK B;  2YL1 A;  1SMY F;  2IXM A;  1G5Z A;  3L34 A;  3LEO A;  4LER A;  4U5D E;  1Q0G A;  2HJM A;  4YT5 A;  3T6B A;  3EGD A;  3L1M A;  1H6G A;  3NMI A;  4G7O F;  5A6A A;  1OCC C;  2ZXO A;  3S28 A;  1YA9 A;  4GQH A;  2HSB A;  1RKE B;  4BG0 A;  1D1C A;  1Z5Z A;  4G78 A;  4CDV A;  2UUH A;  2HS5 A;  1ZVZ A;  1E83 A;  3VAY A;  3GM1 A;  5JS5 A;  3W8I A;  4U5E E;  3ZQY A;  4N4W A;  3EHM A;  3N2Z B;  4P6I C;  2HMZ A;  2H7O A;  4IB4 A;  2AU5 A;  3U2L A;  4DOZ A;  3SXM A;  3IQT A;  2P6V A;  4CJO A;  3LNR A;  1A41 A;  4F4B A;  4MVR A;  5B3I A;  4YL1 A;  3ZC4 A;  1FMV A;  3HLZ A;  4FES A;  4FWV A;  5JUA A;  5K0I A;  1FTS A;  3L8J A;  3ZTZ A;  1Q0M A;  4N06 A;  1RCP A;  1VB5 A;  4B6I A;  4R32 A;  1T9K A;  5DQZ A;  1PCX A;  4MVO A;  1VYI A;  1PD1 A;  3B71 A;  3H2V A;  1Z7Q c;  3DXJ F;  4CSA A;  1ZW2 A;  5E2Q A;  5CIV A;  2YQY A;  5T1D B;  1I4Z A;  1C03 A;  1ORY A;  2UUI A;  3DI5 A;  3X2Q C;  1ZU5 A;  1FMW A;  5JRA A;  2Y69 C;  2FAP B;  2R9R B;  3MYF A;  2BE5 F;  2IXN A;  4LLE A;  5A69 A;  2W9Y A;  3RF3 A;  3US6 A;  3IQC A;  1I5N A;  5KYU B;  4W8P A;  4JW1 A;  4BJ6 C;  3JRM O;  4CDA A;  2KYH A;  3DE9 A;  3EQL F;  1Q0K A;  5B1B C;  4YL3 A;  2KJG A;  2NUT B;  1OXK A;  3GOR A;  5T3W A;  1HMO A;  3TUL A;  2R7S A;  4EKW A;  1VYK A;  2R7T A;  2YEV A;  3H2U A;  1MND A;  4IJJ A;  3K1I A;  2YLD A;  5L0I A;  5BQI A;  1ZU4 A;  1TWH A;  4WJ0 A;  3NDB B;  4FAP B;  3E9V A;  3U2M A;  4IAR A;  3HNL A;  3CSK A;  4NCQ A;  2Q9A A;  2WVN A;  3TQO A;  2W4M A;  4DVY P;  4C7O B;  2CNW A;  2NUP B;  3OWT A;  3RYL A;  5E3A A;  3JYH A;  2EIM C;  2PX0 A;  2VCA A;  2JX0 A;  3B9Q A;  3WG7 C;  1OW6 A;  5KYW B;  1B68 A;  1U0B B;  1BBH A;  3EGX A;  4P9F A;  2EIK C;  1BR1 A;  2HMQ A;  1U6H A;  3U5S A;  4CSA C;  1XZQ A;  1NBB A;  1Y6D A;  3GEE A;  3AG3 C;  3QTH A;  4I1O B;  3W2V A;  3ZVR A;  5BUO A;  1T01 A;  4Q7C A;  4Z9H A;  3RQE A;  5L3V A;  1OCZ C;  1EKY A;  1H9G A;  2G3V A;  2J46 A;  5DS4 A;  3TK0 A;  3UNG C;  4PJJ A;  4G7Z F;  2VC9 A;  2ZXP A;  4XPX A;  2R7O A;  3UR3 C;  2Y3H A;  2L6G A;  1TFO B;  4YN0 B;  3GEI A;  5EGY A;  3IQ6 A;  1VMA A;  5COF A;  2W45 A;  5F28 E;  1RXQ A;  3O55 A;  3RH3 A;  1BR2 A;  2KQ9 A;  2XS8 A;  3JT1 A;  3B0V C;  4KI2 A;  1RJ9 B;  1T5O A;  3TJ6 A;  2R7V A;  2QUP A;  1LS4 A;  1DOW A;  1ORJ A;  1T6Q A;  1XWJ A;  1YAR O;  2X51 A;  4U5G A;  1RKC A;  4PFO A;  4LDR A;  1C17 M;  3B0U X;  4O79 A;  2XLW A;  4JKV A;  3SP1 A;  1EI7 A;  4BJ5 C;  1JPN A;  1I4Y A;  2ZXW C;  1D0Y A;  2AWC A;  3L0I A;  4EHP A;  4MVU A;  3EH2 A;  4XEK A;  1E86 A;  1CPQ A;  1OXB A;  3Q7G A;  2GA0 A;  1E85 A;  3FVY A;  1ST6 A;  4CS8 A;  4A4A A;  1OKK D;  1CGN A;  3MFN A;  4CS9 C;  4EWC A;  1HY5 A;  1OW7 A;  3W2W A;  5L0G A;  2HV6 A;  2WVO A;  2Y3G A;  3KPH A;  4YJW A;  3T4R A;  1KU2 A;  2ZPA A;  4CIH A;  4DBQ A;  1Z23 A;  3DM5 A;  2JPU A;  2Z15 A;  4ANJ A;  2FGY A;  2LP4 A;  2MHR A;  2Q00 A;  1DOV A;  3GM3 A;  2OEV A;  1WWP A;  4DJ9 A;  4EBK A;  1WN0 A;  2J9B A;  2OJE D;  4N6C A;  4J7T A;  1NU9 C;  1ZHZ A;  1IZM A;  2YKZ A;  1J8M F;  1QQ3 A;  5FCL A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  3HKK A;  3PCV A;  2PNO A;  5BQH A;  4YL1 A;  3B29 A;  4JCZ A;  4JC7 A;  5K0I A;  4NTA A;  4AL1 A;  4WAB A;  5BQI A;  4JRZ A;  4AL0 A;  3DWW A;  3LEO A;  5HV9 A;  4YK5 A;  2UUI A;  2H8A A;  2UUH A;  2Q7R A;  4J7T A;  4J7Y A;  4NTF A;  4YL0 A;  4NTB A;  4BPM A;  5BQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...