4J7YA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 58
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7yA00
4YL1A 4J7YA 2UUIA 2PNOA 4AL0A 4JCZA 4AL1A 3B29A 3HKKA 4BPMA 2H8AA 5BQGA 4JC7A 5HV9A 5K0IA 2UUHA 3DWWA 4NTAA 4J7TA 3LEOA 5BQIA 4WABA 5BQHA 4YK5A 3PCVA 4YL3A 4YL0A 4NTFA 4NTBA 2Q7RA 4JRZA
chains in the Genus database with same CATH superfamily
2YLDA 4UDVA 4DRHB 3IQ5A 3LJBA 3T9OA 3EGDA 3AG2C 4AE4B 4AL1A 1ZHXA 3FAJA 1WATA 2P6VA 2GAQA 2IOQA 1TWHA 2CNWA 4WGZA 1OW8A 4P9TA 2XLWA 4O79A 2YZSA 1O87A 4W8KA 5COFA 1OR2A 3EH2A 3KPHA 2J46A 4BEMJ 4Q4ZF 4MVMA 4J7TA 3H65A 5DQZA 2J9BA 4W8PA 5A6JA 4U5EE 5BQHA 3DJNB 3S0XA 4EKWA 4QI0A 2HKVA 1S7ZA 2C03A 4ONSA 1EQ1A 2MHRA 2Q9CA 4LLEA 3MBGA 4U5GA 3MLGA 1NG1A 3K1IA 2XLEA 2L6FA 2NPUA 3US6A 3BRJA 1D0YA 2CYDA 3B0PA 4JRZA 1T6QA 4K1OA 5CI8A 2YEVA 4YJWA 1KNYA 1OCRC 3JSZA 4IB4A 4MW3A 3RFYA 1BR4A 1FFTC 3U2LA 2HMZA 2Y3HA 4CDVA 4LERA 3B29A 1OQCA 3B71A 3SXZA 3U9JA 1VYIA 4JKVA 2Y39A 3C62A 3UMIA 3JSEO 5AC4A 4YT5A 4CJOA 1MMNA 2L9JA 3TJ5A 3A9CA 2WVNA 3J06A 3AGUA 2XRHA 3ZTZA 1CGOA 4MQ9F 2XLMA 3Q6MA 4NC3A 5IY5C 2P1AA 4HFKB 5L0HA 2HV7A 3HNIA 3MX3A 1M2VA 1C03A 5B3SC 1YYXA 3EG9B 3S28A 2DYSC 2Q9BA 3LLKA 3POVA 1JAFA 1I4YA 2LQGA 2G62A 2WZLA 2IXPA 2L7AA 3Q6NA 4KC9A 2VCBA 2I15A 1QSPA 2RSEB 3DKAA 5F5HA 4NTBA 5KYXA 2ZPAA 5L0DA 2H7OA 1Q0DA 4YN0B 4I44A 5L0JA 2BE5F 2DB4A 1APCA 4G0HA 5E2QA 3SXYA 2Q4FA 4KNWA 1YDIA 3QZCA 4PACA 3U3BA 1NBBA 1LVKA 2WZFA 4OIQF 2J0XA 2C04A 1ZHTA 1ZU4A 3FVYA 4ER9A 1G8XA 1T6IA 3NKDA 3X2QC 4LDQA 5KYYB 4K0DA 1CGME 4PJLA 4WABA 3ASOC 1OXBA 4P6IC 4CS8A 5DS6A 2XL4A 3WHNA 4DOZA 2V3CC 4XEFA 1OW7A 1MQVA 1PD0A 1TR2A 2P7VA 3T6JA 2YL1A 1ST6A 3C8GB 3LNMB 4MTFA 1Z23A 3SZRA 3DE8A 1LS1A 1U6HA 3JT1A 4BJ5A 4G7HF 2PBEA 5A6BA 4C7OB 2R7QA 4YL1A 2VC9A 1A7VA 1KTMA 2AWYA 2PNOA 4AL0A 2KSFA 2M4EA 2J0WA 1LPEA 4U5CE 2KYHA 3U2MA 1JOGA 3MYFA 1OCZC 1TWGA 2L81A 3GM2A 1K04A 1OCCC 4IAQA 3FXHA 4JC7A 4X0RA 3V5XA 3GM1A 3EFOB 3GWNA 3I4UA 4HE8D 3OEOA 4JZAA 4JEAA 1NLXA 1HE9A 1LI7A 5L0IA 1G4US 4CS9A 5JT4A 3DM5A 2R25A 2ZXPA 3DJUB 4DJ9A 3CEXA 2B0HA 4F4BA 3AG1C 4Q5SF 4I1MA 1C17M 4BJ6A 1YA7O 3SNHA 2DI3A 4MVOA 4EBJA 1FR0A 1Q0FA 1Z3IX 4ULVA 3JZ0A 1RKEB 2I8BA 2H7VC 4Z9IA 1XWJA 3ZQVA 3TD7A 4KBLA 4DRIB 1M57C 1R4TA 2ASRA 1OR3A 3W2VA 2GWWA 4MVRA 5BQGA 5AC5A 3EHMA 3AOUA 2PX0A 1XZPA 2Q3TA 2YQYA 1YLMA 2YLIA 3C7JA 5B1AC 4A2NB 1RCPA 2LFFA 1NFOA 4FESA 4IWBA 2XM4A 4ANJA 5E3AA 2XL8A 4E0IA 1D1CA 3AJMA 1KU2A 1GM5A 1RJ9B 4D4XA 2J8WA 1BZ4A 2J7PA 3G50A 4NTFA 1PD1A 3S9OA 3N24A 2A1DD 2A6EF 3IQTA 2NUTB 2GA0A 1MNEA 4IGGA 1OKKA 2LIGA 1E85A 2WL8A 2CDQA 2Z15A 1G4WR 3L0IA 4EBBA 3JRMO 1WN0A 5E33A 4DVYP 3SXKA 3ECSA 4I1OB 2KC3A 1PCXA 4IARA 3H2VA 1AUEA 1JPJA 1YYJA 3OA1A 5A6BD 4G7ZF 3VYWA 2W4BA 3DM9B 4U5BE 1MMDA 4U9EA 3TULA 2OOCA 2XSEA 4CIHA 1T6UA 3HNKA 1NU9C 2KW3C 4MNDA 1WTYA 3GODA 3MFNA 1LE2A 1FMVA 4OINF 3RQEA 2LCHA 2V26A 3RW0A 5JS5A 3HTKC 2HJMA 3UGPA 2IXNA 1V55C 4XEKA 4O6NA 4YK5A 4KNVA 2X0CA 2BC5A 5JRAA 1EA8A 2XM0A 1OCOC 1E2XA 1QLEC 1LKXA 2R7WA 3C8GA 3LUTB 4M63A 1A0BA 3RQGA 1D1BA 1IZMA 3ATPA 3GEHA 4C7OA 4CSAA 4YWQA 3NDBB 2OQMA 1GGQA 3TQOA 3ITFA 2R7VA 3I5PA 2R05A 4GYTA 1V54C 5A6AA 3EZIA 3K66A 1EI7A 2IBFA 3HNLA 4LLCA 4PR9A 3B0UX 4J30B 1H6GA 5L0CA 3LLIA 4N6CA 1K40A 4XEVA 1T01A 2AWCA 3WAQA 5TJ5E 5KYUB 1GS9A 2CGEA 3G4ZA 2QNLA 2WZGA 2G3KA 4IAOA 3PHF2 1UG7A 3EFOA 2Q00A 1S05A 4AK9A 4XTKA 1LS4A 2CW0F 4JJFA 4MVSA 4R32A 3S27A 3G4XA 2R7TA 2HZ8A 3VAYA 3C18A 1QKRA 1Z7Qc 3PDMP 3L8IA 3UGOA 2HSBA 4CIPA 1DOWA 2JD3A 4N4WA 4YT4A 1G5ZA 3PMRA 2W4MA 1Q0MA 2Q7RA 3HNJA 4JVSA 3SP1A 3S90A 1I5NA 5L0GA 3NYMA 2EPLX 2J7PD 2QY9A 2EINC 2OKUA 1OXKA 3QVZA 2H8AA 4NCQA 3M1CB 3VRCA 3ZIBA 4BJ1A 1IW7F 1OKKD 1RKCA 1C02A 3M4CA 4U5FE 5HV9A 3UNGC 5D92A 4JJGA 3K6BA 5CIVA 2ZXWC 2AVKA 2EIJC 1TWAA 2EIKC 5BQIA 4CDYA 1N1CA 5D91A 3Q7LA 5GPGB 1RJ9A 3TOLA 3LS1A 3NYLA 1A41A 4XPXA 3ZC4A 4D4NA 5DS5A 3OWTA 4C3BA 2PF4E 1OW6A 1B68A 2VCCA 4DXWA 2NUTA 3DE9A 2ZXRA 5JLIA 2J9VA 2XLOA 2DGJA 3DI5A 3DMDA 5EK0A 3RYLA 2R9RB 4QDLA 4Z9HA 4Z9JA 1WOLA 2VASA 3C8GD 3TOMA 5DLJA 4AE4A 2IXMA 4XQ1A 3T6GB 3EGXB 4H4KC 3RQFA 2H7BA 4MVUA 3AG3C 4PJJA 1Z63A 3KL4A 4OD4A 1R5ID 1UFBA 2OEXA 3V7OA 4IJJA 1QPUA 2YL3A 1HMOA 5FCLA 3B9QA 1ZVZA 3GORA 1V74B 1YJGA 2EILC 4JCHA 3W8HA 2A0UA 3LEOA 3R7CA 4CS7A 4O6MA 3T6BA 3E9VA 2Y69C 2A69F 2HMQA 4MTOA 5E3CA 2EPKX 4BG0A 3N0TA 1E86A 2HUJA 1VLTA 1HW1A 3TK0A 4CBEA 2LK4A 4JTDB 2XLVA 1HY5A 2YVKA 3Q7GA 4CX9A 2QLAA 1J8YF 3NMJA 3RH3A 3V5YA 3DD7A 1D1AA 4L6RA 3A11A 1FTSA 4DRJB 3IQ6A 3HJCA 4JTCB 1ORJA 4Q7CA 2NSFA 2VCAA 2NG1A 1TWCA 1XZQA 3DAFA 5L3VA 2XS1A 3FMSA 3IHUA 4E7SA 3JCUQ 1VB5A 3UMHA 1Z6AA 3VM6A 1NZEA 1CGNA 1E84A 4EUKB 1YVIA 4E0HA 1FAPB 4NTAA 1ZYRF 2HJ3A 5T1DB 3U9MA 1T5OA 1DOVA 3ZVRA 2LD6A 1D0ZA 1NU7D 2XLHA 4HEAJ 1TFOB 3S84A 3FOPA 2A6HF 4YL3A 3EG9A 4C3DA 4YT8A 3QTHA 2J45A 4XPWA 4XPYA 2PP4A 1SMYF 3ABMC 5KYWB 2ICWG 5DVWA 2LFDA 3QW0A 4LACB 5AGFA 1VYKA 3IPMO 3LNRA 2XL6A 2Y3GA 3K1IC 3M15A 3K7DA 4PFOA 2WVQA 4OD5A 1J8MF 1I4ZA 2W9YA 5HSWA 2WB7A 3ZSUA 4BJTA 2OJED 2JX0A 3AGTA 3GWLA 4BPMA 4U5DE 4YT2A 1SR2A 4NY3A 3WG7C 2XXAB 3KMIA 3S29A 3U5SA 3K1HA 3FDQA 1LM3B 3AQBA 3ABKC 1H9TA 2QE9A 2P61A 4PK4A 2YLGA 2Y3BA 3UR3C 3AG4C 3B0VC 2DYRC 2A68F 3EQLF 1M6TA 5KYYA 2L6GA 1RMVA 3FOOA 1MMGA 2IM8A 1BDJB 3LESA 3PCVA 4EHPA 5COGA 1ZW2A 2XS8A 5B3IA 5KYNA 2F22A 2R7OA 3NG1A 1BR2A 2EIMC 3UMKA 1EKYA 3NKEA 3RF3A 1A7DA 2O9XA 1YZAA 1ORYA 1VMAA 2MWQA 4K7BA 4MVQA 4JW1A 4XWJA 4EIYA 3T4RA 2FGYA 2AP3A 1U0BB 1LIHA 4E18A 1H9GA 3I5QA 2Y3DA 5EGYA 1LE4A 3EGXA 1L7CA 2KQ9A 1TQGA 1HMDA 4FX5A 2KGOA 1YZCA 2YL7A 4C3EA 2R7RA 4OIPF 1F1MA 2RD9A 3NMIA 4EBKA 2UUHA 3KKBA 4DBRA 2J9UA 4MW8A 3H2UA 3EPVA 2OCCC 1SYQA 1ZHZA 1HE1A 3RIPA 5CI9A 2LSEA 3FAPB 2WVOA 1LI5A 3AQCA 2KK1A 3QW1A 4YL0A 3W8IA 4CDAA 3U8PA 1MMAA 4KI2A 2EPNA 4FAPB 2YL0A 2NSGA 2YRFA 4CS8C 2R7XA 2XLDA 2OG2A 3GANA 3JYHA 3DZAA 2GFHA 3O10A 2L6HA 3GEIA 4HFFB 5JUAA 1PV3A 1RKEA 2UUIA 3ZQYA 4BJ5C 2TMVP 4IRUA 4JCZA 1VK5A 3ABLC 1AVOB 4H54A 3NRHA 3NYJA 4ULWA 2ETSA 1M2OA 2NUPB 3U3FA 5DQTA 3LS0A 3SEOA 1FFHA 3F47A 1Y6DA 4WJ0A 3L1MA 2EPOA 2B0JA 1QQ3A 1VLSA 4PJMA 1NFNA 2CCYA 1JR8A 2J9WA 3N2ZB 1W2WA 2LP4A 5FZTA 3F46A 3DXJF 2G3VA 2HV6A 4O7GA 4RD9A 5L0FA 4RDAA 5JVEA 5F28E 3RKOF 5B1BC 1CPRA 3W2WA 4CS9C 5KYWA 1HW2A 3QMKA 2YKZA 4GEHA 4B6IA 5EHHA 4U5HA 4JURI 5BUOA 1M56C 2HSQA 5JP7A 4BJ6C 2E87A 1SF8A 3M4BA 1BBHA 2VH3A 2YWAA 3EGDB 1D0XA 3HKKA 4AX2A 2KNHA 2XXAA 4WGYA 4G7OF 1Y4CA 1CPQA 2OU6A 3CQZA 1Q0KA 1WGWA 2FFHA 4J32B 4GQHA 1TFKB 3CSKA 2VB6A 2BL2A 4RBNA 1NSGB 2X51A 4E7ZA 3VF0A 1H7IA 1MNDA 4CJGA 5K0IA 4MS2A 1O5HA 1ORSC 1QZXA 2CNWD 3CAXA 3KYIA 2HFIA 4DBQA 2EPMX 3JTLO 3U8VA 5A69A 3ZWIA 3HLZA 1VTMP 2OEVA 2FAPB 4MTGA 3O39A 3U0CA 4BEJA 4PJNA 3MYIA 3GM3A 4E17A 3KH2A 4JIOA 1YAUO 2AU5A 5L3QA 4OIOF 2MYSA 4N06A 3LEVA 3L8JA 1WASA 4MVZA 4O6YA 2R02A 1GQAA 1T9KA 2D4UA 3RVZA 4I3MA 3EHNA 3EZHA 1SZIA 5COMA 1ZHWA 3ZTMA 5KYUA 1QVXA 3O55A 3E70C 1YA9A 1Q0GA 4G78A 4U9DA 2QTVA 4A4AA 3SXMA 4PFPA 2GDCA 4JE9A 3KYJA 3V5ZA 4QI2A 5F5FA 3C63A 2M64A 3BEHA 1K05A 2KJGA 1M2VB 1ZZPA 1BR1A 2P0NA 4N6HA 3NMKA 2R7SA 4JTAB 1JRAA 4ZLDA 5T3WA 3RVYA 5A6KA 4FWVA 5KYXB 1ZU5A 2ZXOA 3K33A 3ZG1A 2YHSA 2OJQA 4EWCA 2W45A 4JEBA 4NQFA 5JSLA 4OIRF 4XLPF 1JPNA 4J7YA 2Q9AA 3FHDA 3ZDLA 2QUPA 3R2PA 4CSAC 3JRTA 3W4YA 2A0BA 2NUPA 3IEEA 3O6XA 2R03A 3QVYA 2HS5A 3LAYA 2JPUA 3WODF 1A7EA 4P9FA 3TJ6A 4DVZA 2ZD9A 4ZLCA 3JYYA 3ASNC 1E83A 1AEPA 3DWWA 2PFDA 3EH1A 3IQCA 1RXQA 3EJNA 3L34A 1U89A 4LDRA 3C8ZA 3M79A 1WWPA 1Z5ZA 3GEEA 256BA 2D5RB 1VOMA 1O3UA 2PX3A 3CZ6A 1TKNA 1FMWA 5T3TA 3X1OA 2IYLD 5DS4A 1YARO 2R7UA 4LDKA 1ZHYA 1ZW3A 1FNTc 2IXOA 3SYNA 4XLNF 1V4AA 1L3PA 3DAGA 1JMWA
chains in the Genus database with same CATH topology
4YL1A 4J7YA 2UUIA 2PNOA 4AL0A 4JCZA 4AL1A 3B29A 3HKKA 4BPMA 2H8AA 5BQGA 4JC7A 5HV9A 5K0IA 2UUHA 3DWWA 4NTAA 4J7TA 3LEOA 5BQIA 4WABA 5BQHA 4YK5A 3PCVA 4YL3A 4YL0A 4NTFA 4NTBA 2Q7RA 4JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL1 A;  4J7Y A;  2UUI A;  2PNO A;  4AL0 A;  4JCZ A;  4AL1 A;  3B29 A;  3HKK A;  4BPM A;  2H8A A;  5BQG A;  4JC7 A;  5HV9 A;  5K0I A;  2UUH A;  3DWW A;  4NTA A;  4J7T A;  3LEO A;  5BQI A;  4WAB A;  5BQH A;  4YK5 A;  3PCV A;  4YL3 A;  4YL0 A;  4NTF A;  4NTB A;  2Q7R A;  4JRZ A; 
#chains in the Genus database with same CATH topology
 2YLD A;  4UDV A;  4DRH B;  3IQ5 A;  3LJB A;  3T9O A;  3EGD A;  3AG2 C;  4AE4 B;  4AL1 A;  1ZHX A;  3FAJ A;  1WAT A;  2P6V A;  2GAQ A;  2IOQ A;  1TWH A;  2CNW A;  4WGZ A;  1OW8 A;  4P9T A;  2XLW A;  4O79 A;  2YZS A;  1O87 A;  4W8K A;  5COF A;  1OR2 A;  3EH2 A;  3KPH A;  2J46 A;  4BEM J;  4Q4Z F;  4MVM A;  4J7T A;  3H65 A;  5DQZ A;  2J9B A;  4W8P A;  5A6J A;  4U5E E;  5BQH A;  3DJN B;  3S0X A;  4EKW A;  4QI0 A;  2HKV A;  1S7Z A;  2C03 A;  4ONS A;  1EQ1 A;  2MHR A;  2Q9C A;  4LLE A;  3MBG A;  4U5G A;  3MLG A;  1NG1 A;  3K1I A;  2XLE A;  2L6F A;  2NPU A;  3US6 A;  3BRJ A;  1D0Y A;  2CYD A;  3B0P A;  4JRZ A;  1T6Q A;  4K1O A;  5CI8 A;  2YEV A;  4YJW A;  1KNY A;  1OCR C;  3JSZ A;  4IB4 A;  4MW3 A;  3RFY A;  1BR4 A;  1FFT C;  3U2L A;  2HMZ A;  2Y3H A;  4CDV A;  4LER A;  3B29 A;  1OQC A;  3B71 A;  3SXZ A;  3U9J A;  1VYI A;  4JKV A;  2Y39 A;  3C62 A;  3UMI A;  3JSE O;  5AC4 A;  4YT5 A;  4CJO A;  1MMN A;  2L9J A;  3TJ5 A;  3A9C A;  2WVN A;  3J06 A;  3AGU A;  2XRH A;  3ZTZ A;  1CGO A;  4MQ9 F;  2XLM A;  3Q6M A;  4NC3 A;  5IY5 C;  2P1A A;  4HFK B;  5L0H A;  2HV7 A;  3HNI A;  3MX3 A;  1M2V A;  1C03 A;  5B3S C;  1YYX A;  3EG9 B;  3S28 A;  2DYS C;  2Q9B A;  3LLK A;  3POV A;  1JAF A;  1I4Y A;  2LQG A;  2G62 A;  2WZL A;  2IXP A;  2L7A A;  3Q6N A;  4KC9 A;  2VCB A;  2I15 A;  1QSP A;  2RSE B;  3DKA A;  5F5H A;  4NTB A;  5KYX A;  2ZPA A;  5L0D A;  2H7O A;  1Q0D A;  4YN0 B;  4I44 A;  5L0J A;  2BE5 F;  2DB4 A;  1APC A;  4G0H A;  5E2Q A;  3SXY A;  2Q4F A;  4KNW A;  1YDI A;  3QZC A;  4PAC A;  3U3B A;  1NBB A;  1LVK A;  2WZF A;  4OIQ F;  2J0X A;  2C04 A;  1ZHT A;  1ZU4 A;  3FVY A;  4ER9 A;  1G8X A;  1T6I A;  3NKD A;  3X2Q C;  4LDQ A;  5KYY B;  4K0D A;  1CGM E;  4PJL A;  4WAB A;  3ASO C;  1OXB A;  4P6I C;  4CS8 A;  5DS6 A;  2XL4 A;  3WHN A;  4DOZ A;  2V3C C;  4XEF A;  1OW7 A;  1MQV A;  1PD0 A;  1TR2 A;  2P7V A;  3T6J A;  2YL1 A;  1ST6 A;  3C8G B;  3LNM B;  4MTF A;  1Z23 A;  3SZR A;  3DE8 A;  1LS1 A;  1U6H A;  3JT1 A;  4BJ5 A;  4G7H F;  2PBE A;  5A6B A;  4C7O B;  2R7Q A;  4YL1 A;  2VC9 A;  1A7V A;  1KTM A;  2AWY A;  2PNO A;  4AL0 A;  2KSF A;  2M4E A;  2J0W A;  1LPE A;  4U5C E;  2KYH A;  3U2M A;  1JOG A;  3MYF A;  1OCZ C;  1TWG A;  2L81 A;  3GM2 A;  1K04 A;  1OCC C;  4IAQ A;  3FXH A;  4JC7 A;  4X0R A;  3V5X A;  3GM1 A;  3EFO B;  3GWN A;  3I4U A;  4HE8 D;  3OEO A;  4JZA A;  4JEA A;  1NLX A;  1HE9 A;  1LI7 A;  5L0I A;  1G4U S;  4CS9 A;  5JT4 A;  3DM5 A;  2R25 A;  2ZXP A;  3DJU B;  4DJ9 A;  3CEX A;  2B0H A;  4F4B A;  3AG1 C;  4Q5S F;  4I1M A;  1C17 M;  4BJ6 A;  1YA7 O;  3SNH A;  2DI3 A;  4MVO A;  4EBJ A;  1FR0 A;  1Q0F A;  1Z3I X;  4ULV A;  3JZ0 A;  1RKE B;  2I8B A;  2H7V C;  4Z9I A;  1XWJ A;  3ZQV A;  3TD7 A;  4KBL A;  4DRI B;  1M57 C;  1R4T A;  2ASR A;  1OR3 A;  3W2V A;  2GWW A;  4MVR A;  5BQG A;  5AC5 A;  3EHM A;  3AOU A;  2PX0 A;  1XZP A;  2Q3T A;  2YQY A;  1YLM A;  2YLI A;  3C7J A;  5B1A C;  4A2N B;  1RCP A;  2LFF A;  1NFO A;  4FES A;  4IWB A;  2XM4 A;  4ANJ A;  5E3A A;  2XL8 A;  4E0I A;  1D1C A;  3AJM A;  1KU2 A;  1GM5 A;  1RJ9 B;  4D4X A;  2J8W A;  1BZ4 A;  2J7P A;  3G50 A;  4NTF A;  1PD1 A;  3S9O A;  3N24 A;  2A1D D;  2A6E F;  3IQT A;  2NUT B;  2GA0 A;  1MNE A;  4IGG A;  1OKK A;  2LIG A;  1E85 A;  2WL8 A;  2CDQ A;  2Z15 A;  1G4W R;  3L0I A;  4EBB A;  3JRM O;  1WN0 A;  5E33 A;  4DVY P;  3SXK A;  3ECS A;  4I1O B;  2KC3 A;  1PCX A;  4IAR A;  3H2V A;  1AUE A;  1JPJ A;  1YYJ A;  3OA1 A;  5A6B D;  4G7Z F;  3VYW A;  2W4B A;  3DM9 B;  4U5B E;  1MMD A;  4U9E A;  3TUL A;  2OOC A;  2XSE A;  4CIH A;  1T6U A;  3HNK A;  1NU9 C;  2KW3 C;  4MND A;  1WTY A;  3GOD A;  3MFN A;  1LE2 A;  1FMV A;  4OIN F;  3RQE A;  2LCH A;  2V26 A;  3RW0 A;  5JS5 A;  3HTK C;  2HJM A;  3UGP A;  2IXN A;  1V55 C;  4XEK A;  4O6N A;  4YK5 A;  4KNV A;  2X0C A;  2BC5 A;  5JRA A;  1EA8 A;  2XM0 A;  1OCO C;  1E2X A;  1QLE C;  1LKX A;  2R7W A;  3C8G A;  3LUT B;  4M63 A;  1A0B A;  3RQG A;  1D1B A;  1IZM A;  3ATP A;  3GEH A;  4C7O A;  4CSA A;  4YWQ A;  3NDB B;  2OQM A;  1GGQ A;  3TQO A;  3ITF A;  2R7V A;  3I5P A;  2R05 A;  4GYT A;  1V54 C;  5A6A A;  3EZI A;  3K66 A;  1EI7 A;  2IBF A;  3HNL A;  4LLC A;  4PR9 A;  3B0U X;  4J30 B;  1H6G A;  5L0C A;  3LLI A;  4N6C A;  1K40 A;  4XEV A;  1T01 A;  2AWC A;  3WAQ A;  5TJ5 E;  5KYU B;  1GS9 A;  2CGE A;  3G4Z A;  2QNL A;  2WZG A;  2G3K A;  4IAO A;  3PHF 2;  1UG7 A;  3EFO A;  2Q00 A;  1S05 A;  4AK9 A;  4XTK A;  1LS4 A;  2CW0 F;  4JJF A;  4MVS A;  4R32 A;  3S27 A;  3G4X A;  2R7T A;  2HZ8 A;  3VAY A;  3C18 A;  1QKR A;  1Z7Q c;  3PDM P;  3L8I A;  3UGO A;  2HSB A;  4CIP A;  1DOW A;  2JD3 A;  4N4W A;  4YT4 A;  1G5Z A;  3PMR A;  2W4M A;  1Q0M A;  2Q7R A;  3HNJ A;  4JVS A;  3SP1 A;  3S90 A;  1I5N A;  5L0G A;  3NYM A;  2EPL X;  2J7P D;  2QY9 A;  2EIN C;  2OKU A;  1OXK A;  3QVZ A;  2H8A A;  4NCQ A;  3M1C B;  3VRC A;  3ZIB A;  4BJ1 A;  1IW7 F;  1OKK D;  1RKC A;  1C02 A;  3M4C A;  4U5F E;  5HV9 A;  3UNG C;  5D92 A;  4JJG A;  3K6B A;  5CIV A;  2ZXW C;  2AVK A;  2EIJ C;  1TWA A;  2EIK C;  5BQI A;  4CDY A;  1N1C A;  5D91 A;  3Q7L A;  5GPG B;  1RJ9 A;  3TOL A;  3LS1 A;  3NYL A;  1A41 A;  4XPX A;  3ZC4 A;  4D4N A;  5DS5 A;  3OWT A;  4C3B A;  2PF4 E;  1OW6 A;  1B68 A;  2VCC A;  4DXW A;  2NUT A;  3DE9 A;  2ZXR A;  5JLI A;  2J9V A;  2XLO A;  2DGJ A;  3DI5 A;  3DMD A;  5EK0 A;  3RYL A;  2R9R B;  4QDL A;  4Z9H A;  4Z9J A;  1WOL A;  2VAS A;  3C8G D;  3TOM A;  5DLJ A;  4AE4 A;  2IXM A;  4XQ1 A;  3T6G B;  3EGX B;  4H4K C;  3RQF A;  2H7B A;  4MVU A;  3AG3 C;  4PJJ A;  1Z63 A;  3KL4 A;  4OD4 A;  1R5I D;  1UFB A;  2OEX A;  3V7O A;  4IJJ A;  1QPU A;  2YL3 A;  1HMO A;  5FCL A;  3B9Q A;  1ZVZ A;  3GOR A;  1V74 B;  1YJG A;  2EIL C;  4JCH A;  3W8H A;  2A0U A;  3LEO A;  3R7C A;  4CS7 A;  4O6M A;  3T6B A;  3E9V A;  2Y69 C;  2A69 F;  2HMQ A;  4MTO A;  5E3C A;  2EPK X;  4BG0 A;  3N0T A;  1E86 A;  2HUJ A;  1VLT A;  1HW1 A;  3TK0 A;  4CBE A;  2LK4 A;  4JTD B;  2XLV A;  1HY5 A;  2YVK A;  3Q7G A;  4CX9 A;  2QLA A;  1J8Y F;  3NMJ A;  3RH3 A;  3V5Y A;  3DD7 A;  1D1A A;  4L6R A;  3A11 A;  1FTS A;  4DRJ B;  3IQ6 A;  3HJC A;  4JTC B;  1ORJ A;  4Q7C A;  2NSF A;  2VCA A;  2NG1 A;  1TWC A;  1XZQ A;  3DAF A;  5L3V A;  2XS1 A;  3FMS A;  3IHU A;  4E7S A;  3JCU Q;  1VB5 A;  3UMH A;  1Z6A A;  3VM6 A;  1NZE A;  1CGN A;  1E84 A;  4EUK B;  1YVI A;  4E0H A;  1FAP B;  4NTA A;  1ZYR F;  2HJ3 A;  5T1D B;  3U9M A;  1T5O A;  1DOV A;  3ZVR A;  2LD6 A;  1D0Z A;  1NU7 D;  2XLH A;  4HEA J;  1TFO B;  3S84 A;  3FOP A;  2A6H F;  4YL3 A;  3EG9 A;  4C3D A;  4YT8 A;  3QTH A;  2J45 A;  4XPW A;  4XPY A;  2PP4 A;  1SMY F;  3ABM C;  5KYW B;  2ICW G;  5DVW A;  2LFD A;  3QW0 A;  4LAC B;  5AGF A;  1VYK A;  3IPM O;  3LNR A;  2XL6 A;  2Y3G A;  3K1I C;  3M15 A;  3K7D A;  4PFO A;  2WVQ A;  4OD5 A;  1J8M F;  1I4Z A;  2W9Y A;  5HSW A;  2WB7 A;  3ZSU A;  4BJT A;  2OJE D;  2JX0 A;  3AGT A;  3GWL A;  4BPM A;  4U5D E;  4YT2 A;  1SR2 A;  4NY3 A;  3WG7 C;  2XXA B;  3KMI A;  3S29 A;  3U5S A;  3K1H A;  3FDQ A;  1LM3 B;  3AQB A;  3ABK C;  1H9T A;  2QE9 A;  2P61 A;  4PK4 A;  2YLG A;  2Y3B A;  3UR3 C;  3AG4 C;  3B0V C;  2DYR C;  2A68 F;  3EQL F;  1M6T A;  5KYY A;  2L6G A;  1RMV A;  3FOO A;  1MMG A;  2IM8 A;  1BDJ B;  3LES A;  3PCV A;  4EHP A;  5COG A;  1ZW2 A;  2XS8 A;  5B3I A;  5KYN A;  2F22 A;  2R7O A;  3NG1 A;  1BR2 A;  2EIM C;  3UMK A;  1EKY A;  3NKE A;  3RF3 A;  1A7D A;  2O9X A;  1YZA A;  1ORY A;  1VMA A;  2MWQ A;  4K7B A;  4MVQ A;  4JW1 A;  4XWJ A;  4EIY A;  3T4R A;  2FGY A;  2AP3 A;  1U0B B;  1LIH A;  4E18 A;  1H9G A;  3I5Q A;  2Y3D A;  5EGY A;  1LE4 A;  3EGX A;  1L7C A;  2KQ9 A;  1TQG A;  1HMD A;  4FX5 A;  2KGO A;  1YZC A;  2YL7 A;  4C3E A;  2R7R A;  4OIP F;  1F1M A;  2RD9 A;  3NMI A;  4EBK A;  2UUH A;  3KKB A;  4DBR A;  2J9U A;  4MW8 A;  3H2U A;  3EPV A;  2OCC C;  1SYQ A;  1ZHZ A;  1HE1 A;  3RIP A;  5CI9 A;  2LSE A;  3FAP B;  2WVO A;  1LI5 A;  3AQC A;  2KK1 A;  3QW1 A;  4YL0 A;  3W8I A;  4CDA A;  3U8P A;  1MMA A;  4KI2 A;  2EPN A;  4FAP B;  2YL0 A;  2NSG A;  2YRF A;  4CS8 C;  2R7X A;  2XLD A;  2OG2 A;  3GAN A;  3JYH A;  3DZA A;  2GFH A;  3O10 A;  2L6H A;  3GEI A;  4HFF B;  5JUA A;  1PV3 A;  1RKE A;  2UUI A;  3ZQY A;  4BJ5 C;  2TMV P;  4IRU A;  4JCZ A;  1VK5 A;  3ABL C;  1AVO B;  4H54 A;  3NRH A;  3NYJ A;  4ULW A;  2ETS A;  1M2O A;  2NUP B;  3U3F A;  5DQT A;  3LS0 A;  3SEO A;  1FFH A;  3F47 A;  1Y6D A;  4WJ0 A;  3L1M A;  2EPO A;  2B0J A;  1QQ3 A;  1VLS A;  4PJM A;  1NFN A;  2CCY A;  1JR8 A;  2J9W A;  3N2Z B;  1W2W A;  2LP4 A;  5FZT A;  3F46 A;  3DXJ F;  2G3V A;  2HV6 A;  4O7G A;  4RD9 A;  5L0F A;  4RDA A;  5JVE A;  5F28 E;  3RKO F;  5B1B C;  1CPR A;  3W2W A;  4CS9 C;  5KYW A;  1HW2 A;  3QMK A;  2YKZ A;  4GEH A;  4B6I A;  5EHH A;  4U5H A;  4JUR I;  5BUO A;  1M56 C;  2HSQ A;  5JP7 A;  4BJ6 C;  2E87 A;  1SF8 A;  3M4B A;  1BBH A;  2VH3 A;  2YWA A;  3EGD B;  1D0X A;  3HKK A;  4AX2 A;  2KNH A;  2XXA A;  4WGY A;  4G7O F;  1Y4C A;  1CPQ A;  2OU6 A;  3CQZ A;  1Q0K A;  1WGW A;  2FFH A;  4J32 B;  4GQH A;  1TFK B;  3CSK A;  2VB6 A;  2BL2 A;  4RBN A;  1NSG B;  2X51 A;  4E7Z A;  3VF0 A;  1H7I A;  1MND A;  4CJG A;  5K0I A;  4MS2 A;  1O5H A;  1ORS C;  1QZX A;  2CNW D;  3CAX A;  3KYI A;  2HFI A;  4DBQ A;  2EPM X;  3JTL O;  3U8V A;  5A69 A;  3ZWI A;  3HLZ A;  1VTM P;  2OEV A;  2FAP B;  4MTG A;  3O39 A;  3U0C A;  4BEJ A;  4PJN A;  3MYI A;  3GM3 A;  4E17 A;  3KH2 A;  4JIO A;  1YAU O;  2AU5 A;  5L3Q A;  4OIO F;  2MYS A;  4N06 A;  3LEV A;  3L8J A;  1WAS A;  4MVZ A;  4O6Y A;  2R02 A;  1GQA A;  1T9K A;  2D4U A;  3RVZ A;  4I3M A;  3EHN A;  3EZH A;  1SZI A;  5COM A;  1ZHW A;  3ZTM A;  5KYU A;  1QVX A;  3O55 A;  3E70 C;  1YA9 A;  1Q0G A;  4G78 A;  4U9D A;  2QTV A;  4A4A A;  3SXM A;  4PFP A;  2GDC A;  4JE9 A;  3KYJ A;  3V5Z A;  4QI2 A;  5F5F A;  3C63 A;  2M64 A;  3BEH A;  1K05 A;  2KJG A;  1M2V B;  1ZZP A;  1BR1 A;  2P0N A;  4N6H A;  3NMK A;  2R7S A;  4JTA B;  1JRA A;  4ZLD A;  5T3W A;  3RVY A;  5A6K A;  4FWV A;  5KYX B;  1ZU5 A;  2ZXO A;  3K33 A;  3ZG1 A;  2YHS A;  2OJQ A;  4EWC A;  2W45 A;  4JEB A;  4NQF A;  5JSL A;  4OIR F;  4XLP F;  1JPN A;  4J7Y A;  2Q9A A;  3FHD A;  3ZDL A;  2QUP A;  3R2P A;  4CSA C;  3JRT A;  3W4Y A;  2A0B A;  2NUP A;  3IEE A;  3O6X A;  2R03 A;  3QVY A;  2HS5 A;  3LAY A;  2JPU A;  3WOD F;  1A7E A;  4P9F A;  3TJ6 A;  4DVZ A;  2ZD9 A;  4ZLC A;  3JYY A;  3ASN C;  1E83 A;  1AEP A;  3DWW A;  2PFD A;  3EH1 A;  3IQC A;  1RXQ A;  3EJN A;  3L34 A;  1U89 A;  4LDR A;  3C8Z A;  3M79 A;  1WWP A;  1Z5Z A;  3GEE A;  256B A;  2D5R B;  1VOM A;  1O3U A;  2PX3 A;  3CZ6 A;  1TKN A;  1FMW A;  5T3T A;  3X1O A;  2IYL D;  5DS4 A;  1YAR O;  2R7U A;  4LDK A;  1ZHY A;  1ZW3 A;  1FNT c;  2IXO A;  3SYN A;  4XLN F;  1V4A A;  1L3P A;  3DAG A;  1JMW A; 
#chains in the Genus database with same CATH homology
 4YL1 A;  4J7Y A;  2UUI A;  2PNO A;  4AL0 A;  4JCZ A;  4AL1 A;  3B29 A;  3HKK A;  4BPM A;  2H8A A;  5BQG A;  4JC7 A;  5HV9 A;  5K0I A;  2UUH A;  3DWW A;  4NTA A;  4J7T A;  3LEO A;  5BQI A;  4WAB A;  5BQH A;  4YK5 A;  3PCV A;  4YL3 A;  4YL0 A;  4NTF A;  4NTB A;  2Q7R A;  4JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...