4J7YA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 58
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7yA00
4AL1A 4WABA 5HV9A 3PCVA 4JRZA 3B29A 4JCZA 4JC7A 2H8AA 4BPMA 2PNOA 5K0IA 4J7TA 4NTBA 2UUIA 5BQGA 4AL0A 2UUHA 5BQIA 3HKKA 4NTFA 5BQHA 4YL1A 3LEOA 3DWWA 2Q7RA 4YL0A 4YK5A 4NTAA 4YL3A 4J7YA
chains in the Genus database with same CATH superfamily
1A41A 3KYJA 3QZCA 4NCQA 3C63A 1BR4A 3JSZA 4KNWA 4WABA 5L3QA 5COGA 2LSEA 3Q7LA 5BUOA 1YA9A 2JPUA 2Q9BA 1H6GA 2CW0F 4I1OB 4EKWA 5L0CA 2ZXWC 1UFBA 4JE9A 5T1DB 1V74B 2QY9A 3I5QA 1OXBA 3EPVA 1B68A 1CGNA 1XZQA 3AGTA 4KC9A 1JR8A 1R4TA 2J8WA 1O87A 3LNRA 3HJCA 2ASRA 2A68F 1APCA 1K05A 1K40A 4AE4B 1GS9A 3Q6MA 2XLWA 1M57C 3HNIA 2A0BA 3QW0A 3DWWA 1BZ4A 3FHDA 3VYWA 4XEVA 3C62A 4C7OA 2LFDA 4XPXA 2OJQA 1OKKD 4CS8C 1Z63A 2Q9CA 3C8GB 1QKRA 3CSKA 4MVUA 256BA 2KYHA 3DAGA 2A6EF 4W8PA 5JUAA 4DRIB 2RD9A 1Q0FA 1Z23A 2P0NA 4OIRF 3GM1A 4BJ6C 4GQHA 1E84A 1TFKB 2YEVA 3KYIA 1NFOA 3AG1C 2J45A 2OEXA 4JCHA 3K7DA 1MNDA 5D91A 3ABLC 3UR3C 4BPMA 4U5EE 1SR2A 2PX3A 2XRHA 2W4MA 3A11A 3GEIA 4U5BE 3RVZA 3SXZA 1OCOC 1YVIA 2ZD9A 3T9OA 3WHNA 4YT8A 1NU7D 5T3TA 4PR9A 4AK9A 2L6GA 4IRUA 4JKVA 5FZTA 3HNKA 1TR2A 4BJ6A 3LAYA 4BJ1A 3I4UA 2EPLX 2W4BA 3LLIA 2Q7RA 2R7SA 4Z9IA 3M15A 1VB5A 1OKKA 2IXPA 1D1CA 1QQ3A 4A2NB 2A1DD 3TULA 3I5PA 1D0YA 5KYUA 3V5XA 2R7VA 2DYRC 4LDQA 3W8HA 3UGPA 4OIPF 1KTMA 1M2OA 1CPQA 3QVYA 3RQEA 3ZQVA 1Z7Qc 4E0HA 4JTAB 2HUJA 1XWJA 1EKYA 5JRAA 3TQOA 5JVEA 4G7HF 2YLDA 3ABMC 1Y4CA 2GA0A 4PK4A 2HMZA 3C8ZA 1FMVA 5BQIA 4CIPA 1JPNA 4P9TA 2IXMA 4XPYA 2OQMA 3U8PA 3JT1A 5EGYA 2EPOA 4EBKA 3EGXB 4E18A 3CAXA 3DM5A 3ZTMA 2WB7A 3U9MA 2E87A 1Z3IX 4CS9A 4I3MA 3JYHA 3ZVRA 3W4YA 1EQ1A 4MVRA 1GM5A 1MMAA 2WL8A 3SEOA 3PMRA 4FESA 4I1MA 4NQFA 1HMOA 2BL2A 4OIQF 1LS4A 4ZLCA 5F28E 1Q0GA 2VB6A 3MFNA 1F1MA 4DRJB 4Z9JA 5AC5A 4XLPF 1OCZC 3S27A 1YJGA 5A6BA 3ASOC 4XEFA 1AEPA 1ZU4A 2JD3A 4MVSA 2R25A 3JRTA 4O6MA 5F5HA 2R03A 3LNMB 4DJ9A 4RDAA 3GORA 2R7TA 3JTLO 4ULVA 5KYWB 1I4YA 1N1CA 1IZMA 2J46A 2L9JA 1HMDA 4G0HA 1JPJA 4HE8D 1CGOA 1LI7A 1PD1A 1RJ9B 4I44A 4NTAA 3F47A 4XEKA 5IY5C 3CZ6A 1A7DA 2I15A 3EFOA 4LLCA 4C3DA 2YHSA 1FFTC 3JCUQ 2C03A 5B1BC 3EGDA 5HV9A 1HE9A 5KYNA 1VOMA 3FAPB 2Z15A 1M2VA 2B0HA 3AQCA 3RQGA 4C3EA 5L0JA 5B1AC 1HE1A 1KNYA 2CYDA 2NUPA 4IAOA 1MNEA 3MX3A 3AG2C 2F22A 2GFHA 2R7WA 4IWBA 1QVXA 2YWAA 3EH1A 3TK0A 1BBHA 2R05A 3EJNA 4LLEA 2XSEA 4Q4ZF 2UUHA 1RXQA 2NUTA 2QNLA 4X0RA 1H7IA 5DQTA 2OG2A 3LEOA 2LQGA 4RD9A 4CSAA 3DZAA 5CI8A 1OQCA 4JTDB 1QZXA 2J9VA 2Y3DA 3H65A 2IXOA 4GEHA 1E2XA 3GANA 3TOLA 2XM0A 2XLMA 2YLGA 4B6IA 1KU2A 3KMIA 3MYFA 3SZRA 2AWCA 1A7EA 4U9EA 4O79A 2W45A 2OCCC 1U0BB 1BDJB 2EINC 4ANJA 5DLJA 3L0IA 1L7CA 1T6UA 2B0JA 2XL4A 4JVSA 1E85A 4E7SA 3NYJA 2VH3A 4PJNA 4IJJA 3DD7A 1Q0MA 2WZFA 1RKEA 4YN0B 2I8BA 3JYYA 4HEAJ 4WGYA 5A6KA 4PJLA 3GM3A 2W9YA 2FAPB 2R7OA 2YRFA 5BQGA 1JOGA 3SP1A 3DJNB 3HLZA 1VLTA 3RQFA 3RH3A 3SYNA 1A0BA 4A4AA 2ZXOA 2VCBA 3T6BA 1G5ZA 4FX5A 1OCRC 3KL4A 3E9VA 1RJ9A 2CDQA 2HV7A 1C02A 5JT4A 1Q0KA 3LS1A 4C7OB 4LDKA 1PD0A 3K1HA 1LE2A 2XLHA 4DOZA 4JIOA 3IQCA 1UG7A 3MYIA 3QVZA 3RIPA 2YL0A 3DMDA 3ZDLA 2HFIA 1YYXA 3LJBA 3NG1A 1TWGA 3A9CA 1EI7A 4JJFA 4U5HA 3U9JA 2AU5A 4LACB 2NUPB 4F4BA 2ICWG 1WOLA 2Y39A 3AOUA 3KH2A 2WVQA 1SF8A 2Y3BA 4MQ9F 3U3FA 2NUTB 2HJMA 1FFHA 1LVKA 2CNWD 4NY3A 4RBNA 3T6GB 3O39A 1NLXA 1V55C 2M64A 2V3CC 3SXYA 3ASNC 4K7BA 4YT5A 2KQ9A 1I5NA 2IM8A 5L0HA 3DJUB 2J9WA 3N0TA 2YZSA 2VASA 4MW8A 4U5CE 4AE4A 5DS4A 3ITFA 4MVQA 4N4WA 2R9RB 2XS8A 5T3WA 1DOVA 1ORSC 4KI2A 1TFOB 2YVKA 5A6AA 1RMVA 4YK5A 3KKBA 4E17A 2VC9A 3U8VA 4L6RA 3TD7A 3RKOF 3S0XA 2DB4A 2TMVP 3R2PA 4R32A 1YZAA 4K1OA 2EILC 3POVA 3AQBA 3MBGA 3V5ZA 4XWJA 5CI9A 2AVKA 3FDQA 1D1BA 1T01A 2HJ3A 4E7ZA 2AP3A 1O3UA 1FMWA 4XPWA 3ZWIA 3BRJA 1G8XA 2LFFA 3HNJA 5GPGB 4YT2A 3GWNA 1YAUO 3NRHA 3B9QA 4JTCB 2OEVA 5TJ5E 4JJGA 1Y6DA 1VTMP 3EGDB 2KC3A 2WZGA 3CQZA 4HFFB 3O55A 4YL0A 3C8GD 3ECSA 1SYQA 1YDIA 5D92A 4MTGA 2A6HF 4EBJA 1AUEA 3RYLA 4MVMA 1SZIA 3O6XA 5B3IA 3RF3A 4PJJA 4HFKB 2DGJA 3NKEA 3T4RA 4AL1A 4DRHB 4YT4A 3NMIA 4W8KA 3JSEO 4Z9HA 3TOMA 3IQ5A 4QI2A 2CGEA 1ORJA 3EHNA 3FOOA 3OEOA 1VMAA 5COFA 1S05A 3KPHA 4KBLA 3AG4C 3DE8A 3ZIBA 4BEJA 2V26A 5KYXA 4P9FA 3IHUA 5DVWA 4BEMJ 3EHMA 3HTKC 3K66A 3S28A 3ATPA 3B71A 2ZXRA 3EQLF 4IARA 4ULWA 2PP4A 3FAJA 5KYXB 2Q4FA 1G4US 1LIHA 4EWCA 3V7OA 4JZAA 4BJ5A 1YA7O 3DKAA 4G7OF 3G4ZA 3U5SA 1CPRA 3BEHA 2G62A 2LIGA 2G3VA 1PV3A 1T6IA 2H7OA 4N6CA 4DBRA 2YL1A 1EA8A 2KSFA 3IQ6A 3US6A 3GM2A 2OU6A 1E86A 1O5HA 3VM6A 3U0CA 1H9GA 3JRMO 1ZW2A 2XS1A 3K6BA 3M1CB 3NYLA 1K04A 2EIKC 4G78A 2AWYA 4JRZA 4JURI 2XM4A 4JEBA 3NMKA 4CDVA 1C03A 2J9BA 3GEHA 3K1IA 3EFOB 5L0IA 4M63A 4CJGA 4D4XA 3DI5A 3UGOA 2A0UA 3RW0A 1TWAA 2GWWA 4G7ZF 4CS7A 2OJED 4K0DA 2L81A 2IXNA 3AG3C 2QE9A 3HKKA 3EH2A 2OOCA 3FMSA 5KYWA 3C7JA 4E0IA 5JSLA 2HS5A 1ZVZA 1W2WA 2A69F 2NPUA 2EPNA 4CBEA 2IBFA 1TWCA 2C04A 2EIMC 1BR1A 2IOQA 3LS0A 2M4EA 2CNWA 2XLOA 2X0CA 4ER9A 4QDLA 4PFPA 5E33A 2GAQA 2PBEA 5FCLA 4XTKA 2BE5F 1GQAA 4PFOA 4U9DA 2LP4A 2HSQA 3C18A 2L7AA 4NC3A 2EPKX 4QI0A 3J06A 3OWTA 1OW8A 4OIOF 1ZHWA 2XXAB 3NYMA 1RKEB 1R5ID 1FAPB 2Q00A 1YARO 4YWQA 3F46A 1DOWA 4U5FE 3GWLA 3GODA 2Q3TA 4MTFA 2HMQA 4BG0A 1TWHA 5KYYB 4Q5SF 1HW1A 2EPMX 3H2VA 3SXMA 3JZ0A 2NSGA 3C8GA 1V4AA 3E70C 5E3AA 4JEAA 1G4WR 1HW2A 2X51A 4LERA 1Q0DA 3QMKA 1WASA 3W8IA 3AGUA 1D0ZA 2KK1A 1NZEA 1ZHYA 2Y3HA 1M6TA 3LESA 3L8IA 1OCCC 1JMWA 1WATA 2D4UA 3UMIA 4O7GA 1I4ZA 5KYYA 2P7VA 3VRCA 1E83A 2IYLD 1LI5A 3AJMA 1J8MF 3NKDA 2H7VC 3R7CA 1VYIA 3NDBB 1D1AA 3FOPA 1FR0A 4IAQA 2R7RA 4MTOA 4FWVA 1FNTc 1D0XA 4CDAA 2P61A 4MS2A 4AL0A 5DS5A 2YL7A 2P6VA 2XLEA 3S9OA 1AVOB 3UMHA 3MLGA 2YQYA 4MW3A 5AGFA 3LLKA 2MYSA 4BJTA 2YL3A 2XXAA 4WJ0A 1ZHZA 3OA1A 5JP7A 5A69A 3WODF 1YLMA 2WVNA 4IB4A 2J9UA 2KJGA 3X2QC 5F5FA 4OINF 2H7BA 2XLVA 1T5OA 2O9XA 1NBBA 2Q9AA 3M79A 1YZCA 4J7YA 5DQZA 5DS6A 2NG1A 3CEXA 3IPMO 4DVYP 2KGOA 4EUKB 2PFDA 3LEVA 3EZIA 4LDRA 3B29A 1OR3A 1LE4A 2R7QA 1S7ZA 3X1OA 2NSFA 2XL8A 3DAFA 5AC4A 1GGQA 1LS1A 1WGWA 2PNOA 3K1IC 4NTBA 1M56C 2VCAA 1OW7A 1YYJA 1Z6AA 1ZZPA 3EZHA 1WN0A 4JW1A 3H2UA 2QTVA 3NMJA 4EBBA 2R7XA 1M2VB 4H54A 4KNVA 1MMNA 1WTYA 1Z5ZA 5L0DA 4CJOA 3SNHA 3QTHA 2CCYA 3RVYA 4CS8A 2HSBA 2KNHA 4AX2A 3DXJF 3U3BA 4BJ5C 3EGXA 2VCCA 4FAPB 2ETSA 3FVYA 5A6BD 3IQTA 4Q7CA 5L0GA 4XQ1A 3M4CA 2GDCA 2QUPA 1VLSA 3M4BA 1T6QA 3PCVA 5JLIA 3S90A 1VYKA 1NG1A 4DBQA 2DYSC 2J0WA 2LK4A 4JC7A 5EHHA 3SXKA 3N24A 1NFNA 3L8JA 2Y69C 4OD4A 5E3CA 5K0IA 4J7TA 2HV6A 2P1AA 1OXKA 1VK5A 2J7PA 2YKZA 3QW1A 1NSGB 3Q6NA 3UMKA 1QLEC 4EHPA 3B0VC 2YLIA 2J0XA 1U6HA 4MVZA 5KYUB 1ZW3A 2ZXPA 3DM9B 1PCXA 3DE9A 5B3SC 2R7UA 4MVOA 4C3BA 2WVOA 4D4NA 4H4KC 3EG9B 4ONSA 1WWPA 1OR2A 3FXHA 2OKUA 1FTSA 3HNLA 1OW6A 4YL3A 5JS5A 2XLDA 2J7PD 5CIVA 2MHRA 4EIYA 1C17M 2WZLA 4GYTA 1H9TA 1LM3B 4N6HA 4CSAC 3WG7C 1TQGA 2EIJC 3EG9A 4CDYA 4WGZA 3IEEA 2H8AA 5L0FA 3S84A 1JRAA 2L6FA 4U5GA 5L3VA 1BR2A 5EK0A 4ZLDA 1ZU5A 3S29A 3N2ZB 4O6NA 3ZC4A 5A6JA 2Y3GA 2MWQA 1J8YF 2RSEB 4OD5A 4PACA 3B0UX 3PHF2 4CIHA 1LPEA 2LCHA 5HSWA 5BQHA 1MQVA 3RFYA 1MMDA 2HZ8A 3U2MA 3ZG1A 2L6HA 2D5RB 1A7VA 3B0PA 3ZSUA 1MMGA 1NU9C 1ZHTA 2PX0A 4YJWA 1U89A 3ZQYA 4J30B 4UDVA 1T9KA 2R02A 1RCPA 4XLNF 3Q7GA 4PJMA 3ZTZA 5E2QA 4MNDA 2LD6A 1TKNA 4DVZA 3TJ5A 3W2WA 3L1MA 4JCZA 3V5YA 1IW7F 3TJ6A 1QPUA 2BC5A 4P6IC 3O10A 2XL6A 4IGGA 2FFHA 4O6YA 3T6JA 1ZYRF 2PF4E 4N06A 3W2VA 4J32B 2UUIA 1SMYF 1L3PA 3UNGC 3VAYA 1HY5A 1LKXA 1QSPA 1RKCA 3G50A 5COMA 4NTFA 2KW3C 4YL1A 1CGME 3WAQA 3ABKC 3U2LA 3GEEA 1XZPA 3VF0A 3G4XA 3LUTB 2FGYA 3PDMP 4DXWA 1ORYA 1ZHXA 1V54C 4U5DE 4CS9C 2JX0A 4CX9A 1JAFA 2G3KA 2ZPAA 2QLAA 2DI3A 1ST6A 3K33A 3L34A 2HKVA
chains in the Genus database with same CATH topology
4AL1A 4WABA 5HV9A 3PCVA 4JRZA 3B29A 4JCZA 4JC7A 2H8AA 4BPMA 2PNOA 5K0IA 4J7TA 4NTBA 2UUIA 5BQGA 4AL0A 2UUHA 5BQIA 3HKKA 4NTFA 5BQHA 4YL1A 3LEOA 3DWWA 2Q7RA 4YL0A 4YK5A 4NTAA 4YL3A 4J7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL1 A;  4WAB A;  5HV9 A;  3PCV A;  4JRZ A;  3B29 A;  4JCZ A;  4JC7 A;  2H8A A;  4BPM A;  2PNO A;  5K0I A;  4J7T A;  4NTB A;  2UUI A;  5BQG A;  4AL0 A;  2UUH A;  5BQI A;  3HKK A;  4NTF A;  5BQH A;  4YL1 A;  3LEO A;  3DWW A;  2Q7R A;  4YL0 A;  4YK5 A;  4NTA A;  4YL3 A;  4J7Y A; 
#chains in the Genus database with same CATH topology
 1A41 A;  3KYJ A;  3QZC A;  4NCQ A;  3C63 A;  1BR4 A;  3JSZ A;  4KNW A;  4WAB A;  5L3Q A;  5COG A;  2LSE A;  3Q7L A;  5BUO A;  1YA9 A;  2JPU A;  2Q9B A;  1H6G A;  2CW0 F;  4I1O B;  4EKW A;  5L0C A;  2ZXW C;  1UFB A;  4JE9 A;  5T1D B;  1V74 B;  2QY9 A;  3I5Q A;  1OXB A;  3EPV A;  1B68 A;  1CGN A;  1XZQ A;  3AGT A;  4KC9 A;  1JR8 A;  1R4T A;  2J8W A;  1O87 A;  3LNR A;  3HJC A;  2ASR A;  2A68 F;  1APC A;  1K05 A;  1K40 A;  4AE4 B;  1GS9 A;  3Q6M A;  2XLW A;  1M57 C;  3HNI A;  2A0B A;  3QW0 A;  3DWW A;  1BZ4 A;  3FHD A;  3VYW A;  4XEV A;  3C62 A;  4C7O A;  2LFD A;  4XPX A;  2OJQ A;  1OKK D;  4CS8 C;  1Z63 A;  2Q9C A;  3C8G B;  1QKR A;  3CSK A;  4MVU A;  256B A;  2KYH A;  3DAG A;  2A6E F;  4W8P A;  5JUA A;  4DRI B;  2RD9 A;  1Q0F A;  1Z23 A;  2P0N A;  4OIR F;  3GM1 A;  4BJ6 C;  4GQH A;  1E84 A;  1TFK B;  2YEV A;  3KYI A;  1NFO A;  3AG1 C;  2J45 A;  2OEX A;  4JCH A;  3K7D A;  1MND A;  5D91 A;  3ABL C;  3UR3 C;  4BPM A;  4U5E E;  1SR2 A;  2PX3 A;  2XRH A;  2W4M A;  3A11 A;  3GEI A;  4U5B E;  3RVZ A;  3SXZ A;  1OCO C;  1YVI A;  2ZD9 A;  3T9O A;  3WHN A;  4YT8 A;  1NU7 D;  5T3T A;  4PR9 A;  4AK9 A;  2L6G A;  4IRU A;  4JKV A;  5FZT A;  3HNK A;  1TR2 A;  4BJ6 A;  3LAY A;  4BJ1 A;  3I4U A;  2EPL X;  2W4B A;  3LLI A;  2Q7R A;  2R7S A;  4Z9I A;  3M15 A;  1VB5 A;  1OKK A;  2IXP A;  1D1C A;  1QQ3 A;  4A2N B;  2A1D D;  3TUL A;  3I5P A;  1D0Y A;  5KYU A;  3V5X A;  2R7V A;  2DYR C;  4LDQ A;  3W8H A;  3UGP A;  4OIP F;  1KTM A;  1M2O A;  1CPQ A;  3QVY A;  3RQE A;  3ZQV A;  1Z7Q c;  4E0H A;  4JTA B;  2HUJ A;  1XWJ A;  1EKY A;  5JRA A;  3TQO A;  5JVE A;  4G7H F;  2YLD A;  3ABM C;  1Y4C A;  2GA0 A;  4PK4 A;  2HMZ A;  3C8Z A;  1FMV A;  5BQI A;  4CIP A;  1JPN A;  4P9T A;  2IXM A;  4XPY A;  2OQM A;  3U8P A;  3JT1 A;  5EGY A;  2EPO A;  4EBK A;  3EGX B;  4E18 A;  3CAX A;  3DM5 A;  3ZTM A;  2WB7 A;  3U9M A;  2E87 A;  1Z3I X;  4CS9 A;  4I3M A;  3JYH A;  3ZVR A;  3W4Y A;  1EQ1 A;  4MVR A;  1GM5 A;  1MMA A;  2WL8 A;  3SEO A;  3PMR A;  4FES A;  4I1M A;  4NQF A;  1HMO A;  2BL2 A;  4OIQ F;  1LS4 A;  4ZLC A;  5F28 E;  1Q0G A;  2VB6 A;  3MFN A;  1F1M A;  4DRJ B;  4Z9J A;  5AC5 A;  4XLP F;  1OCZ C;  3S27 A;  1YJG A;  5A6B A;  3ASO C;  4XEF A;  1AEP A;  1ZU4 A;  2JD3 A;  4MVS A;  2R25 A;  3JRT A;  4O6M A;  5F5H A;  2R03 A;  3LNM B;  4DJ9 A;  4RDA A;  3GOR A;  2R7T A;  3JTL O;  4ULV A;  5KYW B;  1I4Y A;  1N1C A;  1IZM A;  2J46 A;  2L9J A;  1HMD A;  4G0H A;  1JPJ A;  4HE8 D;  1CGO A;  1LI7 A;  1PD1 A;  1RJ9 B;  4I44 A;  4NTA A;  3F47 A;  4XEK A;  5IY5 C;  3CZ6 A;  1A7D A;  2I15 A;  3EFO A;  4LLC A;  4C3D A;  2YHS A;  1FFT C;  3JCU Q;  2C03 A;  5B1B C;  3EGD A;  5HV9 A;  1HE9 A;  5KYN A;  1VOM A;  3FAP B;  2Z15 A;  1M2V A;  2B0H A;  3AQC A;  3RQG A;  4C3E A;  5L0J A;  5B1A C;  1HE1 A;  1KNY A;  2CYD A;  2NUP A;  4IAO A;  1MNE A;  3MX3 A;  3AG2 C;  2F22 A;  2GFH A;  2R7W A;  4IWB A;  1QVX A;  2YWA A;  3EH1 A;  3TK0 A;  1BBH A;  2R05 A;  3EJN A;  4LLE A;  2XSE A;  4Q4Z F;  2UUH A;  1RXQ A;  2NUT A;  2QNL A;  4X0R A;  1H7I A;  5DQT A;  2OG2 A;  3LEO A;  2LQG A;  4RD9 A;  4CSA A;  3DZA A;  5CI8 A;  1OQC A;  4JTD B;  1QZX A;  2J9V A;  2Y3D A;  3H65 A;  2IXO A;  4GEH A;  1E2X A;  3GAN A;  3TOL A;  2XM0 A;  2XLM A;  2YLG A;  4B6I A;  1KU2 A;  3KMI A;  3MYF A;  3SZR A;  2AWC A;  1A7E A;  4U9E A;  4O79 A;  2W45 A;  2OCC C;  1U0B B;  1BDJ B;  2EIN C;  4ANJ A;  5DLJ A;  3L0I A;  1L7C A;  1T6U A;  2B0J A;  2XL4 A;  4JVS A;  1E85 A;  4E7S A;  3NYJ A;  2VH3 A;  4PJN A;  4IJJ A;  3DD7 A;  1Q0M A;  2WZF A;  1RKE A;  4YN0 B;  2I8B A;  3JYY A;  4HEA J;  4WGY A;  5A6K A;  4PJL A;  3GM3 A;  2W9Y A;  2FAP B;  2R7O A;  2YRF A;  5BQG A;  1JOG A;  3SP1 A;  3DJN B;  3HLZ A;  1VLT A;  3RQF A;  3RH3 A;  3SYN A;  1A0B A;  4A4A A;  2ZXO A;  2VCB A;  3T6B A;  1G5Z A;  4FX5 A;  1OCR C;  3KL4 A;  3E9V A;  1RJ9 A;  2CDQ A;  2HV7 A;  1C02 A;  5JT4 A;  1Q0K A;  3LS1 A;  4C7O B;  4LDK A;  1PD0 A;  3K1H A;  1LE2 A;  2XLH A;  4DOZ A;  4JIO A;  3IQC A;  1UG7 A;  3MYI A;  3QVZ A;  3RIP A;  2YL0 A;  3DMD A;  3ZDL A;  2HFI A;  1YYX A;  3LJB A;  3NG1 A;  1TWG A;  3A9C A;  1EI7 A;  4JJF A;  4U5H A;  3U9J A;  2AU5 A;  4LAC B;  2NUP B;  4F4B A;  2ICW G;  1WOL A;  2Y39 A;  3AOU A;  3KH2 A;  2WVQ A;  1SF8 A;  2Y3B A;  4MQ9 F;  3U3F A;  2NUT B;  2HJM A;  1FFH A;  1LVK A;  2CNW D;  4NY3 A;  4RBN A;  3T6G B;  3O39 A;  1NLX A;  1V55 C;  2M64 A;  2V3C C;  3SXY A;  3ASN C;  4K7B A;  4YT5 A;  2KQ9 A;  1I5N A;  2IM8 A;  5L0H A;  3DJU B;  2J9W A;  3N0T A;  2YZS A;  2VAS A;  4MW8 A;  4U5C E;  4AE4 A;  5DS4 A;  3ITF A;  4MVQ A;  4N4W A;  2R9R B;  2XS8 A;  5T3W A;  1DOV A;  1ORS C;  4KI2 A;  1TFO B;  2YVK A;  5A6A A;  1RMV A;  4YK5 A;  3KKB A;  4E17 A;  2VC9 A;  3U8V A;  4L6R A;  3TD7 A;  3RKO F;  3S0X A;  2DB4 A;  2TMV P;  3R2P A;  4R32 A;  1YZA A;  4K1O A;  2EIL C;  3POV A;  3AQB A;  3MBG A;  3V5Z A;  4XWJ A;  5CI9 A;  2AVK A;  3FDQ A;  1D1B A;  1T01 A;  2HJ3 A;  4E7Z A;  2AP3 A;  1O3U A;  1FMW A;  4XPW A;  3ZWI A;  3BRJ A;  1G8X A;  2LFF A;  3HNJ A;  5GPG B;  4YT2 A;  3GWN A;  1YAU O;  3NRH A;  3B9Q A;  4JTC B;  2OEV A;  5TJ5 E;  4JJG A;  1Y6D A;  1VTM P;  3EGD B;  2KC3 A;  2WZG A;  3CQZ A;  4HFF B;  3O55 A;  4YL0 A;  3C8G D;  3ECS A;  1SYQ A;  1YDI A;  5D92 A;  4MTG A;  2A6H F;  4EBJ A;  1AUE A;  3RYL A;  4MVM A;  1SZI A;  3O6X A;  5B3I A;  3RF3 A;  4PJJ A;  4HFK B;  2DGJ A;  3NKE A;  3T4R A;  4AL1 A;  4DRH B;  4YT4 A;  3NMI A;  4W8K A;  3JSE O;  4Z9H A;  3TOM A;  3IQ5 A;  4QI2 A;  2CGE A;  1ORJ A;  3EHN A;  3FOO A;  3OEO A;  1VMA A;  5COF A;  1S05 A;  3KPH A;  4KBL A;  3AG4 C;  3DE8 A;  3ZIB A;  4BEJ A;  2V26 A;  5KYX A;  4P9F A;  3IHU A;  5DVW A;  4BEM J;  3EHM A;  3HTK C;  3K66 A;  3S28 A;  3ATP A;  3B71 A;  2ZXR A;  3EQL F;  4IAR A;  4ULW A;  2PP4 A;  3FAJ A;  5KYX B;  2Q4F A;  1G4U S;  1LIH A;  4EWC A;  3V7O A;  4JZA A;  4BJ5 A;  1YA7 O;  3DKA A;  4G7O F;  3G4Z A;  3U5S A;  1CPR A;  3BEH A;  2G62 A;  2LIG A;  2G3V A;  1PV3 A;  1T6I A;  2H7O A;  4N6C A;  4DBR A;  2YL1 A;  1EA8 A;  2KSF A;  3IQ6 A;  3US6 A;  3GM2 A;  2OU6 A;  1E86 A;  1O5H A;  3VM6 A;  3U0C A;  1H9G A;  3JRM O;  1ZW2 A;  2XS1 A;  3K6B A;  3M1C B;  3NYL A;  1K04 A;  2EIK C;  4G78 A;  2AWY A;  4JRZ A;  4JUR I;  2XM4 A;  4JEB A;  3NMK A;  4CDV A;  1C03 A;  2J9B A;  3GEH A;  3K1I A;  3EFO B;  5L0I A;  4M63 A;  4CJG A;  4D4X A;  3DI5 A;  3UGO A;  2A0U A;  3RW0 A;  1TWA A;  2GWW A;  4G7Z F;  4CS7 A;  2OJE D;  4K0D A;  2L81 A;  2IXN A;  3AG3 C;  2QE9 A;  3HKK A;  3EH2 A;  2OOC A;  3FMS A;  5KYW A;  3C7J A;  4E0I A;  5JSL A;  2HS5 A;  1ZVZ A;  1W2W A;  2A69 F;  2NPU A;  2EPN A;  4CBE A;  2IBF A;  1TWC A;  2C04 A;  2EIM C;  1BR1 A;  2IOQ A;  3LS0 A;  2M4E A;  2CNW A;  2XLO A;  2X0C A;  4ER9 A;  4QDL A;  4PFP A;  5E33 A;  2GAQ A;  2PBE A;  5FCL A;  4XTK A;  2BE5 F;  1GQA A;  4PFO A;  4U9D A;  2LP4 A;  2HSQ A;  3C18 A;  2L7A A;  4NC3 A;  2EPK X;  4QI0 A;  3J06 A;  3OWT A;  1OW8 A;  4OIO F;  1ZHW A;  2XXA B;  3NYM A;  1RKE B;  1R5I D;  1FAP B;  2Q00 A;  1YAR O;  4YWQ A;  3F46 A;  1DOW A;  4U5F E;  3GWL A;  3GOD A;  2Q3T A;  4MTF A;  2HMQ A;  4BG0 A;  1TWH A;  5KYY B;  4Q5S F;  1HW1 A;  2EPM X;  3H2V A;  3SXM A;  3JZ0 A;  2NSG A;  3C8G A;  1V4A A;  3E70 C;  5E3A A;  4JEA A;  1G4W R;  1HW2 A;  2X51 A;  4LER A;  1Q0D A;  3QMK A;  1WAS A;  3W8I A;  3AGU A;  1D0Z A;  2KK1 A;  1NZE A;  1ZHY A;  2Y3H A;  1M6T A;  3LES A;  3L8I A;  1OCC C;  1JMW A;  1WAT A;  2D4U A;  3UMI A;  4O7G A;  1I4Z A;  5KYY A;  2P7V A;  3VRC A;  1E83 A;  2IYL D;  1LI5 A;  3AJM A;  1J8M F;  3NKD A;  2H7V C;  3R7C A;  1VYI A;  3NDB B;  1D1A A;  3FOP A;  1FR0 A;  4IAQ A;  2R7R A;  4MTO A;  4FWV A;  1FNT c;  1D0X A;  4CDA A;  2P61 A;  4MS2 A;  4AL0 A;  5DS5 A;  2YL7 A;  2P6V A;  2XLE A;  3S9O A;  1AVO B;  3UMH A;  3MLG A;  2YQY A;  4MW3 A;  5AGF A;  3LLK A;  2MYS A;  4BJT A;  2YL3 A;  2XXA A;  4WJ0 A;  1ZHZ A;  3OA1 A;  5JP7 A;  5A69 A;  3WOD F;  1YLM A;  2WVN A;  4IB4 A;  2J9U A;  2KJG A;  3X2Q C;  5F5F A;  4OIN F;  2H7B A;  2XLV A;  1T5O A;  2O9X A;  1NBB A;  2Q9A A;  3M79 A;  1YZC A;  4J7Y A;  5DQZ A;  5DS6 A;  2NG1 A;  3CEX A;  3IPM O;  4DVY P;  2KGO A;  4EUK B;  2PFD A;  3LEV A;  3EZI A;  4LDR A;  3B29 A;  1OR3 A;  1LE4 A;  2R7Q A;  1S7Z A;  3X1O A;  2NSF A;  2XL8 A;  3DAF A;  5AC4 A;  1GGQ A;  1LS1 A;  1WGW A;  2PNO A;  3K1I C;  4NTB A;  1M56 C;  2VCA A;  1OW7 A;  1YYJ A;  1Z6A A;  1ZZP A;  3EZH A;  1WN0 A;  4JW1 A;  3H2U A;  2QTV A;  3NMJ A;  4EBB A;  2R7X A;  1M2V B;  4H54 A;  4KNV A;  1MMN A;  1WTY A;  1Z5Z A;  5L0D A;  4CJO A;  3SNH A;  3QTH A;  2CCY A;  3RVY A;  4CS8 A;  2HSB A;  2KNH A;  4AX2 A;  3DXJ F;  3U3B A;  4BJ5 C;  3EGX A;  2VCC A;  4FAP B;  2ETS A;  3FVY A;  5A6B D;  3IQT A;  4Q7C A;  5L0G A;  4XQ1 A;  3M4C A;  2GDC A;  2QUP A;  1VLS A;  3M4B A;  1T6Q A;  3PCV A;  5JLI A;  3S90 A;  1VYK A;  1NG1 A;  4DBQ A;  2DYS C;  2J0W A;  2LK4 A;  4JC7 A;  5EHH A;  3SXK A;  3N24 A;  1NFN A;  3L8J A;  2Y69 C;  4OD4 A;  5E3C A;  5K0I A;  4J7T A;  2HV6 A;  2P1A A;  1OXK A;  1VK5 A;  2J7P A;  2YKZ A;  3QW1 A;  1NSG B;  3Q6N A;  3UMK A;  1QLE C;  4EHP A;  3B0V C;  2YLI A;  2J0X A;  1U6H A;  4MVZ A;  5KYU B;  1ZW3 A;  2ZXP A;  3DM9 B;  1PCX A;  3DE9 A;  5B3S C;  2R7U A;  4MVO A;  4C3B A;  2WVO A;  4D4N A;  4H4K C;  3EG9 B;  4ONS A;  1WWP A;  1OR2 A;  3FXH A;  2OKU A;  1FTS A;  3HNL A;  1OW6 A;  4YL3 A;  5JS5 A;  2XLD A;  2J7P D;  5CIV A;  2MHR A;  4EIY A;  1C17 M;  2WZL A;  4GYT A;  1H9T A;  1LM3 B;  4N6H A;  4CSA C;  3WG7 C;  1TQG A;  2EIJ C;  3EG9 A;  4CDY A;  4WGZ A;  3IEE A;  2H8A A;  5L0F A;  3S84 A;  1JRA A;  2L6F A;  4U5G A;  5L3V A;  1BR2 A;  5EK0 A;  4ZLD A;  1ZU5 A;  3S29 A;  3N2Z B;  4O6N A;  3ZC4 A;  5A6J A;  2Y3G A;  2MWQ A;  1J8Y F;  2RSE B;  4OD5 A;  4PAC A;  3B0U X;  3PHF 2;  4CIH A;  1LPE A;  2LCH A;  5HSW A;  5BQH A;  1MQV A;  3RFY A;  1MMD A;  2HZ8 A;  3U2M A;  3ZG1 A;  2L6H A;  2D5R B;  1A7V A;  3B0P A;  3ZSU A;  1MMG A;  1NU9 C;  1ZHT A;  2PX0 A;  4YJW A;  1U89 A;  3ZQY A;  4J30 B;  4UDV A;  1T9K A;  2R02 A;  1RCP A;  4XLN F;  3Q7G A;  4PJM A;  3ZTZ A;  5E2Q A;  4MND A;  2LD6 A;  1TKN A;  4DVZ A;  3TJ5 A;  3W2W A;  3L1M A;  4JCZ A;  3V5Y A;  1IW7 F;  3TJ6 A;  1QPU A;  2BC5 A;  4P6I C;  3O10 A;  2XL6 A;  4IGG A;  2FFH A;  4O6Y A;  3T6J A;  1ZYR F;  2PF4 E;  4N06 A;  3W2V A;  4J32 B;  2UUI A;  1SMY F;  1L3P A;  3UNG C;  3VAY A;  1HY5 A;  1LKX A;  1QSP A;  1RKC A;  3G50 A;  5COM A;  4NTF A;  2KW3 C;  4YL1 A;  1CGM E;  3WAQ A;  3ABK C;  3U2L A;  3GEE A;  1XZP A;  3VF0 A;  3G4X A;  3LUT B;  2FGY A;  3PDM P;  4DXW A;  1ORY A;  1ZHX A;  1V54 C;  4U5D E;  4CS9 C;  2JX0 A;  4CX9 A;  1JAF A;  2G3K A;  2ZPA A;  2QLA A;  2DI3 A;  1ST6 A;  3K33 A;  3L34 A;  2HKV A; 
#chains in the Genus database with same CATH homology
 4AL1 A;  4WAB A;  5HV9 A;  3PCV A;  4JRZ A;  3B29 A;  4JCZ A;  4JC7 A;  2H8A A;  4BPM A;  2PNO A;  5K0I A;  4J7T A;  4NTB A;  2UUI A;  5BQG A;  4AL0 A;  2UUH A;  5BQI A;  3HKK A;  4NTF A;  5BQH A;  4YL1 A;  3LEO A;  3DWW A;  2Q7R A;  4YL0 A;  4YK5 A;  4NTA A;  4YL3 A;  4J7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...