2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSY
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
4MRVA 1YKSA 3BBPA 4LV6A 2OXRA 2QUZA 2ZR9A 4RKFA 3L8ZA 3KKPA 1HQYE 2CHGA 4MRSA 1E9SA 2F7SA 4Q1DA 1IBRA 1JALA 4O2RA 4P4TA 1M74A 4Q66C 3RANA 4XWKA 4QGFA 3IKJA 1FQKA 3V4FA 4TQAA 1Z29A 5B57C 2GAAA 1XMIA 3ZVRA 3Q8XB 1JQLB 4TMWA 3R8CA 4WVFA 2ZE8A 4PQRA 3CPEA 3EIHA 4E5UA 2V1UA 4CEHA 1BOFA 5FUWA 2J45A 1NN5A 2JLUA 1T4GA 4NYMQ 3AVOA 2IYVA 4YXWA 5B2ZA 4PZZA 5B58C 2P5SA 3LLMA 2QBYB 4Q7JB 1VDZA 3VU9A 4NU0A 1XU4A 2C98A 1G4AE 4BEJA 2Z83A 3R8FA 3KXLA 3GMTA 4NONA 4BFZA 3AF4A 1GSIA 3LXRA 4TL7A 2ZRLA 2IS4A 3EXAA 2F55A 4A9AA 1E69A 2OESA 3CUEF 5JCZA 1SKQA 2QPAA 1FMJA 5DLQC 5AJZA 2DB3A 5DHAA 4KLZA 4NYIR 3TAHA 4TT3A 1KI6B 1G5TA 3GLFB 4IOLA 1D9ZA 3GLIB 3OEHA 4Q7MB 2F3TA 2YC4C 4DHEA 1PZNA 3F5FA 2QZ4A 4GMDA 4GRAA 3VKHA 4CF7A 3HP1A 2VHQA 5CDFE 4LBYA 4OJQA 2D62A 3OIWA 1P6XA 1Z2AA 4WAUA 3AVVA 1P2VA 3GLHE 3K1JA 4TTPA 1NVWQ 2VP5A 4RD4A 5B30A 3CM0A 2GEDA 3GLGB 1KDRA 2YVUA 3GJ4A 3IO5A 3L0OA 4Q7KA 2WWFA 3LBNA 4MRNA 4XSGA 5C18A 1HH4A 2BM1A 2IUTA 3K0CA 4G5GA 5G3ZA 4BFUA 4RZXA 3R20A 1IQPA 3FDIA 1E4VA 1UEJA 2ZS9A 3GLFE 4Z1MA 1UPTA 3D6TB 2O8CB 2D3WA 4HATA 3B1WA 4LBVA 4QL3A 2QN6A 2P0EA 1B23P 2VP0A 4DLYA 3N5CA 1G291 4HAUA 3CRRA 2I1VB 3NTUA 3AEZA 4B3XA 2SHKA 4B6EA 3MAAC 3QF4A 5KOYA 1IN6A 3U7GA 1QG2A 1SZPA 2IBMA 3QEOA 1UAAA 2ZSFA 1E9AA 4TMKA 4EJSA 5BN4A 2V6IA 3K0AB 5GJWC 3NDBB 1QBKC 2J41A 3W90A 2IYWA 4JBXA 4L4UA 2D7DA 1BKDR 1P73A 3UANA 4BZPA 4LYAA 4DLZA 2W6JA 3I72A 4OHZA 3LX5A 2D74A 1E9CA 1G8FA 3SHFA 4URUR 3SNHA 1UADA 5FBLB 5KUTA 4PC2A 1W4CA 4DCUA 1N0WA 2C2HA 3Q7PA 3GJ0A 1W2HA 1S8FA 3SYKA 1E1QD 4JLJA 1TU4A 1NBMA 2XNDD 3WRYC 1RE0A 5F9HA 4AKGA 4D4MA 4OQXA 2ZRKA 1COWD 5KSPA 1C9KA 3IQWA 3KZ1E 1CU1A 4MH0R 2FSFA 2J9RA 2FG5A 4LY6A 2ZITA 2ZANA 1D6JA 4EAQA 3M0EA 4N0DA 4UNQA 1OH8A 1WQ1R 4BGDA 4NYMR 1ZNZA 4JL8A 4ZKEA 4XVUA 1E2IA 2REXB 1NBME 3B7GA 2ATVA 4IVPA 2DWOA 1GNRA 2P6UA 2HXSA 1LF5A 1NMXA 1OHHA 3EZ7A 3HPQA 4NH0A 4Q1AA 3QQ5A 3B2EA 4GL2A 4U5XA 2FSGA 2PMKA 1Z0IA 2XX3A 1MOZA 1XD2A 4OHXA 3I5YA 1ANKA 2JLSA 4C0QC 4C0JA 1A1VA 4E22A 1ZM4A 3FGNA 1M6NA 1K8RA 4NCIA 4AURA 3BJIC 2XB2A 2V8OA 4KBGA 3ASZA 1S4QA 3HJNA 1MR3F 2PEZA 3UG7A 3JZMA 4Q47A 2ZQ5A 1E96A 3LH5A 1Q22A 1FUUA 2QGNA 4RZ2A 4TQUS 2RHDA 4XWAA 3AUXA 4GNKA 5HE9A 4MKFA 2REBA 3FTQA 5E7MA 6Q21A 5FBQB 1Z2CA 3CZQA 2HXYA 1LVGA 1EFRA 1SHZA 2QQ0A 4CT4B 5HE8A 4JVNA 4ON9A 3Q85A 2RGAA 5JECA 2RGBA 3TQFA 2OBLA 2GK7A 1XEXA 5LD2B 2WM9B 3GJXC 1DAFA 2FX3A 3ZD6A 3N2EA 3TW4A 2CVHA 4PAOA 2QROA 3L82B 3G0HA 2F43B 2P67A 1G7TA 1GUAA 4CGZA 4QRHA 4F4CA 1E2GA 2KI5A 2DFKB 4G5SA 2HYIC 3Q5EA 3A8TA 1IY1A 4M9ZA 3C5CA 3FWYA 2D4HA 3AQ4A 2I1QA 4RCZA 4N0EA 2F9MA 3EC2A 4HYYA 4R7ZA 2ZU6A 1E2PA 5JCPA 4Q7LA 4UNPA 2Z0MA 1CJVC 3PENA 3I61A 4TMZA 1SGWA 2BCJQ 1S0UA 3BS4A 4G3XA 2BHRA 2EFDB 3L8YA 4C0AC 4DC9A 2AD1A 1NLYA 2ZJYA 4UJ3A 2QE7A 1WB9A 1BO6A 4P3YA 4I81A 3ETLA 3AVQA 4QJ4A 1IN5A 2ZI3A 4HDCA 3THWB 3OEHD 3AM1A 4BRUA 4CT5A 2PZGA 5JEDA 1NN1A 1X8KA 4CRWB 4KI0A 2ORVA 3AF2A 3CWZA 4DWJA 2F1RA 1AN0A 1DG3A 2RGNA 3I73A 4W5JA 2QG6A 5AWFC 5GADl 2GXSA 2W0SA 3U3OA 3AKCA 4RFSB 3C41J 3DOEA 2LKDA 1GKIA 1TPZA 5FPYA 2R44A 1ZU5A 1DTSA 3T1QA 1NMZA 5FTLA 2CEAA 5FUXA 1FUKA 1JJVA 1W7AA 2GTPA 1FNMA 3K0CC 4JLDA 3AKEA 4C7OB 2WJIA 2QTFA 1CRQA 1WGWA 1MO5A 1W44A 4GOJA 3ASYA 1BMFA 1G3QA 5FOTA 3TR0A 5LD2C 2ZPTX 2WWYA 2H7VA 3CF6R 2IL1A 1OJLA 5FPHA 3FMFA 5E95A 4UXHA 1D2NA 1E2HA 1GRRA 2A30A 1W36D 3QKTA 2PX0A 5DI9A 2YJTD 4C0LA 2CNWA 3NBXX 4Q19A 2ZVPX 4ESVA 4JLAA 4URWR 3QG5A 3AGPA 3HR8A 1DAIA 2NIPA 2QMOA 1D8TA 3H1TA 3EW9A 4UNSA 1VCMA 1Z3IX 1A2KC 2QAGC 3WRXC 1Q12A 4PQFA 4F93B 2C5LA 5DN6A 4X8HA 1FPMA 1W36B 4A0RA 2O0HA 1W4RA 1N5JA 5M04A 2MSCB 4H1VA 2RCNA 1XFAA 3KFVA 4M21A 3RC3A 2O8EA 4OKSA 3PEVA 4EFMA 3KFXA 2G88A 4IKEA 2YOGA 2BVNA 3P4XA 2OLKA 2IYQA 4RJLA 5EE3A 2EVWX 4B48A 4ZIRA 1WP9A 2HLDA 1HQCA 2ZI7A 1UBGA 3VX3A 2GDJA 3A1UA 2WTUA 621PA 2F6RA 2OHFA 2JDIA 4AYWA 1OXTA 4DT1B 3TIFA 2RB4A 3FHCB 4CEIB 4QHSA 5FOWA 5FTMA 2WZQA 3RS5A 5J40A 3KJGA 1KOFA 4M1MA 4JBYA 4EPWA 1E99A 1ZC3A 3SE0A 1R10A 4TLEA 4D82A 1SVSA 1CJUC 1YR7A 2ZE5A 3WMFA 2DHRA 4BFWA 1IN4A 1G3MA 3DMDA 2JATA 4BFTA 5FH9A 3ND8A 5D3MA 1VPLA 3KUDA 3NEYA 2QORA 1UF9A 2V6JA 2ZJ5A 3FMPB 1QHGA 3EZFA 4NDZA 2Z5FA 4RY2A 5IRCD 1RRPA 1Z07A 3W9YA 4NL4H 4OK6A 5CLQA 5BQ5A 3CB4A 3VR6A 3D31A 5EP3A 1T91A 1JR3A 4TL6A 2JGNA 4UJ5A 4FCVA 3SR0A 1U0HC 5BN5A 2WJVA 2DCUA 1OYYA 2GXQA 2XZLA 4BPBA 5KU1A 2MMGA 2WJYA 2NTYC 2ZRPA 1WE2A 3C16C 1R8QA 2VH5R 2G9NA 2VF8A 4MKGA 3KKQA 4Q1EA 5LBIA 3PUYA 3THOA 4ESHA 3UMFA 4PFSA 2XGJA 5L3SB 2BV3A 5L3VA 2GKSA 3ADCA 3QVUA 2CVFA 4TT3D 3BH0A 4EDHA 1Z6GA 5L3QB 2JLRA 2FH5B 1OKKA 3FFBA 3PITA 4BZQA 1KK3A 5C1BA 4WA7A 1KMHB 2XEXA 1F6BA 3L0PA 1R4AA 3T1VA 4YDHB 5BYKA 2H16A 1VCNA 3UATA 1R5OA 3LW8A 2F43A 2BJVA 2R6AA 3ECCA 4KU4A 4AKEA 1VKJA 2GJ8A 1XP8A 1YRAA 3CH5A 4HZUA 4P4SA 4B2LA 3O8RA 2V54A 3MJRA 2RGXA 2XOKD 1FX0A 2OE2A 1W0KA 2WJGA 4D0NA 5HZHA 2IYXA 2PJRA 4WBSA 2OLJA 3H86A 4U7DA 2ZUCA 5DI3B 4Q01A 1WBBA 4W5HA 1CIPA 3B1VA 4PZYA 3QF4B 3KB2A 5FI1B 2P3SA 4AG6A 1XB2A 3EC1A 3H4MA 2ERYA 4BZXA 4A8JB 2C8VA 4MYCA 1NSTA 5CLLA 2WPDA 2QMHA 3BORA 3FKSD 2W83A 3T1OA 1VG1A 2FE4A 1Q3TA 3KXIA 3DOFA 2NO7A 3A36A 4UXIA 5KNBA 3WMEA 1F2TB 1Z6AA 2CLCX 2DFTA 1TQDA 2QY9A 1VTKA 4JL5A 4URYR 1Z83A 3FKSA 1NVXQ 2GJSA 3K70D 2H5EA 3N2IA 2O8DB 1W0JA 1LY1A 3LQQA 5AJWA 4BE7B 2CK3A 3RSLA 2VP6A 4TSFD 2WJHA 2GXUA 3T15A 4GT1A 2XB4A 4B44A 4GFDA 1YE8A 4MKIA 4Q1FA 1JXOA 1H8ED 2JJ1D 3L0IB 121PA 1JXMA 3W3AA 3Q9LA 1CR2A 4NYIQ 4O3MA 2X1VA 3H0KA 2KJQA 3GEHA 5HCNA 1JAHA 2BWJA 3WBKA 1T8UA 2DR3A 2LCFA 1G18A 1TUEA 4Q1CA 4DDUA 2AKAB 1GKYA 4MYTA 3SQXA 2C9OA 4P33A 1RW4A 5BYJA 1NG1A 3I3SR 1KO5A 1KI7A 4K81B 1M7BA 3CONA 1G6OA 3OFNA 2GA8A 2JEOA 2J1LA 4B3GA 1GWNA 4JLMA 2AR7A 3AF3A 3LBHA 5D3QA 5DI3A 5IT5A 4PANA 2W6JD 1CEEA 5D3MB 1PUJA 1QVAA 1IXZA 5SZIA 4DLUA 3REFA 4TTQA 5KSOA 4LDJA 5HPYB 1W1WA 4I1UA 3B8HA 4JSYA 3WNDA 1YZKA 2IK8A 1PLJA 1G9XA 3P20A 3RYTC 3ZJYA 4ITRC 4BUJA 4HUQA 3QKSA 5EXPA 2OSBA 2FEOA 4LRWA 3BFXA 2XJ9A 3TVDA 1P60A 5H70A 2Z4RA 4O0MA 2QAJA 2C04A 4YONB 5CYPA 1XPUA 4CIDA 4KLNA 3IHLA 4M9XA 2FN4A 3OE7D 4ZDIA 3PUVA 1RRGA 2JDID 1W5TA 3QG1A 5EE0A 1ZJ6A 3K09A 4IDQA 3TUZC 2KBEA 3K9LA 1J90A 2ZJBA 3CKLA 3TGPA 1ZM3A 1EFHA 3MJHA 1I4DD 5G41A 1Q57A 3RRNA 2BEJA 1ESMA 1N6RA 1NJFA 2P65A 3J81k 2OZEA 4PC6A 2O8DA 1AS2A 1E4YA 4EIWA 4C4PA 1NN0A 1AS3A 2EYQA 3ZVNA 1KKLA 1KSHA 2H92A 5B64A 1ZUNB 4TTRA 4LC0A 4P4UA 5AJYA 4CDGA 1GZSA 2JJ1A 3LW7A 2PJZA 1H8EA 4EPTA 3OEEA 4OI0A 1KDOA 5BXQC 3LO5A 4NCHA 1DARA 2O0KA 1U81A 2OUKA 4NYJQ 3GLHA 4BLPA 3DPUA 1MKYA 5FL7D 1EX6A 2VRWA 5CDFA 1K5DA 1G21E 3SBDA 4DCSA 3VQTA 1G64A 4A6PA 4URXR 3U3RA 4TMVA 2BM0A 4V02A 4LJAA 3SN6A 3ICEA 1KAOA 1AIPA 3D7MA 3MWYW 3SJZA 1RJ9B 1CKEA 3RABA 2ZS7A 5JHHB 4MDFA 1DAEA 1QHYA 4QM7A 4JLBA 1ZBDA 5AUQA 2RMKA 2HF9A 4IDPA 5CB8A 1M2OB 4C2TA 3GQBA 1U0JA 2ZR7A 2CL6X 3AF1A 3M6AA 4DSNA 5J4KA 3K8YA 1CF4A 1CR4A 1TF5A 5FBRB 1QHNA 3K70B 4HI0E 1XTJA 3MWKA 2C9YA 4NTZA 2FV8A 1EFTA 4RCYA 3UXMA 3NHAA 4C2UA 4XVRA 4Q4JA 4X8OA 1Q1BA 4Q4JB 3CX7A 2NZ8A 4NE2A 3T12A 4Q4LA 1OXVA 1BH2A 4R9UC 4HB3A 3GP8A 1VYTA 5FR2A 1XMVA 1ZD8A 5AUPB 4TZ6A 3SEAA 2Q3FA 4FN5A 4MKHA 5GVSA 1E79A 3EASA 5DYGA 2H18A 4G5OA 1ZD9A 1P5ZB 2Z6VA 3IUYA 3U44B 1A7JA 1EESA 4F4IA 1Z0KA 3EZ9A 4C0SA 4S35A 1CULC 1KO8A 2KB0A 3X1YA 2GRJA 4HZUB 4Q9HA 1U99A 3ZZTA 1E98A 1G3IA 3THXB 3DM5A 3K9GA 4LX0A 5AUOB 2WBLC 4DDVA 2AHOA 2OAP1 3NBFA 4B76A 2V9PA 5L3QA 4F7WA 3A4NA 1EWRA 2G0NA 3QXCA 4EPRA 4LPSA 2VIIA 4G0NA 1OXSC 1RRFA 3EA0A 3ZQ6A 2EYUA 4DRZA 1CTQA 2R2AA 3MG9A 3ZDQA 4DUGA 4D4KA 5J4HA 3WP1B 1I4TD 3DVLA 4QBFA 5DISB 4CEJB 3G82C 4JS0A 4LZZA 5JWRA 4Z1MD 1Q1QA 1U98A 3MSXA 1Q0UA 1W36C 1CJKC 1P9WA 2X77A 5JMTA 1SKYB 1X1RA 5SZJA 2A5DA 1P2UA 1OFUX 1XNJA 2EFCB 4DUGD 2Q6TA 4JL6A 5UKDA 1DPFA 2O8BB 2Q9AA 2IYTA 4PQYA 1E6CA 1O3YA 2QM7A 4DIEA 4R98A 1X86B 5FOSA 2RHMA 2BDTA 2RGGA 4A8JA 1RPZA 1OIWA 2ZI4A 1KKMA 3CW2A 4WXPA 2ZI6A 4M9SA 3AKDA 3EPJA 4EFNA 2BMJA 3CLVA 2OBNA 4HAYA 3PIRA 4G5QA 3SQWA 5DGXA 2ZROA 4NBSA 4C7OA 4KJZA 3ZS8A 1D2EA 2ZE7A 3U4QA 1IY0A 2EFEB 1HE8B 2IXFA 2EFHB 2ZJAA 4P32A 3LVQE 2YC2C 3SDZA 1E32A 1G7CA 2N42A 2R6FA 1Q3HA 1E1RA 2BIFA 1YR6A 3CRW1 1GM5A 1V43A 4I1SA 4PHGA 1KO4A 3UK6A 3LXXA 3PJRA 2RGEA 2J7PA 1S1MA 1ZC4A 821PA 1GL9B 1G17A 4YMVA 2J5XA 4MDEA 2IYLD 1H8HD 3K9NA 4XD7A 3WYGA 1XRJA 4RKEA 4I1VA 4W9MC 3T35A 2GF9A 2NQ2C 3NH9A 3NVAA 4YMUA 2NOAA 2B21A 3THXA 2WSMA 4YMTA 3VNUA 1YVDA 2BKEA 2PLFA 2ZETA 5J4LA 4ZIRB 3NBYC 1AJEA 4DSUA 1NL3A 5JZVA 4AC9A 4OQMA 3UWOA 1MO6A 4YC7A 5KSZA 2QP4A 3GEEA 3OHMA 4OQFA 4A4DA 1N0UA 2CCKA 4TLAA 1Z06A 2G1JA 2R6CA 5CYOA 5FFMA 3TUIC 4RD3A 3I8SA 3VX4A 2GAOA 3VNVA 2IF0A 2PH1A 4XTRA 3KB1A 2P6NA 1EFUA 1TUIA 2WWGA 1F3OA 1GAJA 4QBHA 2TMKA 1PJRA 2WKQA 1TU3A 1DAGA 2BOVA 2XTZA 1WXQA 5GJBA 2CJWA 2ZRDA 3CWQA 2AFHE 1E2LA 4LYFA 3UMRA 4DCVA 4A92A 1D9XA 1SVKA 2V1XA 1ZW6A 2AL7A 1UKVY 4RVCA 1NJGA 1RFLA 3PG5A 2IYZA 3A1TA 2KE5A 5EP4A 4C3ZA 2AD5A 2ZRFA 1NVVQ 1ZMXA 4NCJA 4BRWA 1RJ9A 3ZGXA 1T6NA 1NBMD 1X8JA 4QM6A 5HKKA 4PAMA 3V00A 4M8NE 2YOFA 2D7CA 4DLWA 3IPYA 1KZGB 1DAHA 2ZRAA 1DELA 4KBFA 2Q21A 2ZEJA 4OQLA 5JSZB 2FNAA 3SS8A 2JLQA 2QE7D 2W58A 1XTQA 4B2IA 4TN1A 5FR1A 1JR3D 5K8TA 1LS6A 2J87A 3U5ZB 1W46A 2IT1A 1C1YA 1KNQA 2D06A 2QRNA 5DHFA 4BLSA 1E2FA 4ZO4A 2OCAA 5FTNA 3PEWA 2ZIAA 3GLIA 4EUNA 4XSHA 4FMCF 3NC0C 1TF7A 2ZRIA 4X8MA 3QF7A 4WZBE 4FMDB 1JJ7A 3B5JA 4JT4A 3NC1C 1U9IA 3B1ZA 1E2QA 1NMYA 1PLKA 3LY5A 2QSZA 4IEIA 4PC3A 4NCKA 1VHTA 1G7SA 5HCIA 3VHLB 3I92A 5KYKA 1NNEA 2RGCA 1IJFA 3K70C 2IWHA 3WP0A 3U7FB 3LD9A 3EA5A 4Z8YA 5JHGB 5C2JB 3F8TA 1T0HB 2NO6A 4JLVA 5KDLA 3U7HB 3MWLA 4AD8A 3FE2A 2AX4A 3I8XA 2BCGY 4OYHA 1BYIA 4ARZB 1QVRA 2GJAA 5KO2A 3ZIAA 1UM8A 2ANCA 1GDDA 1OE0A 2CJWB 1E0KA 1T3LA 2ZRMA 1NG9A 5JI3E 1KI3A 2G3YA 3T34A 3WHKA 1UEIA 2VTKA 3CX8A 3W5JA 3KL4A 2QTVB 1G8YA 3EARA 1N6LA 1ZIOA 1FNNA 4DEXA 4V0OA 1GP2A 1HUQA 1KHTA 1RZ3A 2PZFA 4RD6A 3GFOA 3IIKA 3X1DA 1G20E 4KFRA 3KJHA 2GETA 1VYUA 2YKGA 1Z8FA 4E09A 5CJ2A 3U4QB 5GVRA 3WBJA 3A6PC 3M1IA 3OFND 2REOA 1IN8A 4AWXA 5JLJA 2QM8A 2ZRCA 2C95A 4Q9KA 2YWEA 2Q3MA 1HT2E 4L9WA 3TNFA 4AI6A 1N5LA 1U8AA 1ZCAA 3GFTA 2ODNA 3BOSA 2CHQA 4B6FA 1Z0AA 4D26A 1A5TA 221PA 5E4FA 4WXRA 1ZP6A 4LJ7A 4OJKA 1AKEA 1H65A 3CNOA 1KSGA 3EZ6A 1MRSA 1VHLA 2XZOA 1GVNB 5JFGA 2HJGA 5EP2A 4A2QA 4GSYA 4QFMA 2FMXA 2WMOB 3GJ3A 1ZNWA 5DN6D 1OB5A 3UG6A 4B3DA 4TYQA 1JEDA 1Z6XA 2QT0A 1SVLA 1VG0B 2QAGA 2X2EA 1W48A 4PX9A 1Z63A 1W2GA 4HAXA 4HB0A 4BFSA 4DLXA 3U7EB 4TYYA 3LAWA 1Z08A 2PCLA 1MO4A 1WRBA 2R65A 1DE0A 4ZDWA 5A0FA 1DAMA 2ZVQX 3AUYA 3CRMA 3LFUA 1VCOA 3TE6A 1T5LA 2HDNB 1VG9B 3TVTA 3RAPR 1BS1A 1GRQA 3R7WB 2JLVA 2XZPA 4LJ5A 2NZJA 3W3ZB 5C4GB 1E1RD 1JPJA 1JQJC 2E87A 5FUVA 5JBQA 1W0KD 4FCTA 1CLUA 3RS3A 1W47A 3Q3JB 4H9GA 3OZXA 4IXMA 5KNDA 1FX0B 2FGKA 4EKDA 3AH8A 5FOUA 3GLFA 1W5SA 4POAA 1GTVA 1OV4A 4DLVA 1MH1A 4JMPA 4ZV4A 2JAQA 1FP7A 4IEEA 4CYMA 2FSHA 1RKBA 3C5HA 3EPHA 421PA 4HB4A 2ZI9A 1HYQA 5DO9A 1JEEA 4Q9JA 1ONBA 3V9PA 3BERA 3WY9A 4P31A 4EFLA 4WZAE 3VKWA 4IRUB 3ZH9B 2ZAOA 3RLFA 4TYNA 4GI7A 3HDTA 4Q00A 2QNRA 1KI1A 2G0TA 3KDSE 1QHSA 3PUXA 4RD2A 5CK4A 4B43A 2C03A 5L3SA 3DEFA 3QUSA 3I62A 2AN9A 2QQEA 3DZDA 4H1UA 4IVRA 1TMKA 4RZUA 4ZI2A 2F1HA 1IJEA 2O8CA 4HUTA 3U61B 1EX7A 4ABYA 2GBLA 1RVDA 5G53C 3RS7A 1PUIA 2I3BA 5DNYB 2OBMA 4HLUC 2IWRA 4L9SA 2W2XA 2WOJA 1JECA 2EW1A 5TXGA 4U02A 1GILA 4EJSB 3TRFA 4A6XA 2OFXA 3K09C 1KDPA 4TZ0A 1J2JA 5KNCA 4V0NA 2HJVA 4ZCMA 2C9CA 4D2IA 4Q21A 4OHYA 1TQ2A 1N6OA 2ZRBA 4IFEA 2XTNA 4PO1A 3IGFA 2C77A 3R7WA 2ERXA 2AXPA 2JA1A 3CRQA 5JWHA 2KBFA 1KSJA 3PQCA 2ZYUX 3QXXA 3R9IA 2W2TA 5CIWA 4PO8A 4GPTA 5AJXA 3TUJC 3B1YA 1A2BA 1T9HA 2XXAA 2FJUA 4TL8A 4LGMA 4D80A 2ORIA 4NPHA 4OHWA 1JNYA 2OFOA 1IN7A 2GZHA 1QHIA 1Y63A 4AYTA 4AG5A 2Q9CA 1ZRHA 3VTKA 3MCAA 4C0HA 2V4ZA 4R2IA 5AR1A 1N6PA 4JLPA 1JAIA 1HEIA 1XZQA 2PMDA 3DHWC 3KQKA 1UDWA 4AYXA 1EXMA 5FOXA 2VHUA 3SJCA 4EQ6B 3AVYA 1MT0A 2QL6A 4LBWA 1F2UB 1I2DA 2W6IA 2HT6A 3PXGA 3I32A 1N5IA 1II9A 4JJZA 3JVUA 3U3MA 2A5GA 1MV5A 1GFIA 1KI8A 1I2MA 2QA5A 3EIEA 2XITA 1W0JD 4QHYA 5P21A 3TR5A 3VR5A 1U0LA 4JT2A 3A58B 4QGGA 5CM9C 3SBEA 4HSEA 5F98A 3ADDA 2P5TB 3U60B 4M1SA 1KJWA 2YOHA 2L0XA 4K46A 3KKOA 1R0YA 2JIZD 3C14C 3GEIA 2H8KA 2X8AA 4XTCS 3LQRA 5TVKA 5JJLA 3RS2A 1JBKA 4BASA 3IIJA 4LI0A 1T5IA 4ZCLA 2YHSA 3KKNA 4AIIA 2GZAA 5KTYA 1FW6A 4MQBA 2YWHA 2G1KA 4DLRA 4JLNA 2J3EA 2FDCA 3OEED 4P4SB 2ZRNA 4M0LA 4O2LA 4KSCA 5ANRB 4S2EA 3FFAA 3X2SA 3BB4A 4PAQA 3OIUA 2VSOA 1OIVA 3TSOA 1KAGA 5CM8B 2XAUA 1BIFA 3TQCA 4TMXA 3ZIAD 3NXSA 2P6RA 2NG1A 5FTKA 5EJEA 3TSZA 1LS1A 2FZ4A 3X1WA 3FOZA 2LKCA 2VLIA 3BD9A 4DDWA 1Z0JA 4WW0A 2J59A 4DB4A 1OW3B 4MYUA 1L4YA 2VEDA 5SZKB 2BBWA 1E2DA 3BB3A 1LFDB 2CBZA 1OLOA 3QKUA 4I4LA 5EQTA 1T3SA 3SU8A 3CO5A 1AGPA 4Z8XA 1DO2A 1YR8A 2IW3A 1GOTA 4BQSA 4N3NA 3W8RA 1SVWA 3SYNA 3I5XA 3BH6A 3EPLA 1E2EA 4QKQA 1GL7A 3RS0A 1K5GA 4LJ6A 1F60A 2IYRA 2VHCA 1AK2A 2YNMA 1WDTA 1KI6A 3RRMA 2HV8A 2IEYA 2GNOA 2DWPA 4GZMA 1YU9A 1LV7A 1KY2A 1A4RA 5H8WA 1G8GA 2CHVA 1JI0A 3P27A 1G41A 2AK2A 1CJTC 5JRJA 4QBIA 1AKYA 1B0UA 3QI2A 3SJBA 5C46F 2A2ZA 5F3WB 3GLGE 2EWWA 3PVSA 2B7CA 4KITB 3IDQA 3GLHB 3BWDD 4DSTA 4BLOA 3K53A 4LJ8A 3WYFA 1G7RA 2O0JA 2WWXA 2OV2A 5IK2A 4ZKDA 2PBRA 1E2MA 5JWOA 3OIVA 4R2HA 3KJIA 4JVSB 4ILEA 5DH9A 4OHVA 2YWGA 3WHLA 1XEWY 3QBVA 4TL9A 2YZ2A 4HLQB 3X1XA 4FW9A 3AVUA 4D4LA 3X1ZA 1SXJC 4BECA 2FFQA 3O8BA 4K8OA 4ERNA 1YZTA 4AK9A 4TQ9A 2FSIA 4LPKA 2QBYA 2OCPA 1NIJA 3QPVA 4X8LA 3UKDA 1ZUHA 5FTJA 4NCNA 3DKPA 1S9HA 2WWHA 3MMPA 1DOAA 1KTVA 4JLKA 4CEHB 4LHYA 1ZD1A 1NVUQ 1Q44A 1T0JB 1TADA 5CITA 8OHMA 1NSFA 5HKKD 1N5KA 3IILA 1J8MF 3OF5A 1KY3A 1RYFA 1OT3A 2V7QA 3AVXA 1Q1EA 3BC1A 4L8GA 3HR7A 4FD2A 2WWIA 1F2UA 4NYJR 4Q1BA 3BH7A 1E0SA 1P4SA 4B3BA 1RIFA 3ADBA 1UDXA 3W34A 3HU2A 2VHTA 3Q72A 5KHOC 3W8NA 2UVQA 2F3RA 3SJAA 3MLEA 2K5UA 1F2TA 5DYIA 4II7A 3U3JA 3LVRE 1PV4A 2ZTSA 4FMCB 1XZPA 3E2IA 1JB1A 2JLWA 2CXXA 2QMUA 1G19A 2QU8A 3BAFA 1IONA 1NVVR 2CE7A 4D81A 2H1LA 3I4LA 3N70A 4FXPA 1MO3A 3CNNA 2IUUA 1WCV1 2FF7A 3MD0A 2JASA 4B3FX 1IM2A 3OAAD 1QF9A 1U8ZA 2A9KA 3LV8A 1PLLA 4G01B 4DT1A 2ZI5A 1YZNA 3FKQA 5HZKA 1C4OA 1P62B 4HB2A 2QT1A 3PEYA 2IXEA 2H57A 1KO7A 5EE5B 4DDTA 3IEVA 1EFCA 4PHTA 4QNMA 3VAAA 3ZLJA 2O8BA 4D0LB 2W6ID 3P4YA 1KMQA 1E1QA 3DZ8A 3EAQA 4JVMA 5EP1A 5FI0B 5AUNB 2O8FA 2GF0A 1ODFA 5EUQB 1DG1G 1FTNA 3FPAA 1S9DA 3HYRA 2QP3A 5HTKA 2VSXA 2WAYA 2MMCA 1GNQA 1L4UA 3AGQA 4US1R 3VHXA 2J0SA 3GJ7A 4M4SA 5LB4A 3UIEA 1CP2A 2HF8A 4TLBA 1SVOA 1YQTA 4HLDA 4FWTA 4ARZA 4FMBB 4LBZA 1II8A 4UXJA 1W4AA 1Q21A 1YZQA 3P32A 3BB1A 4JZKA 1N25A 1QRAA 4Y0AA 4LHVA 4IOJA 4FI3C 1AGRA 2V3CC 2C99A 2HCJB 2WIAA 3MUFA 2A5YB 3QKSB 1ZYUA 3EWAA 3RC8A 4MGIR 4L16A 3UWKA 1NLZA 1XX6A 3RRZA 4LJYA 4BFVA 5LDDC 1CRPA 1N0VC 1XEXB 3IPXA 4MRPA 3QE0A 3TSWA 5KDOA 3AVPA 5F2EA 3KQUA 2JLYA 2D2EA 3BIFA 4HEJA 2ZREA 4M1WA 4N1AA 4A15A 4HAZA 4KODA 1X3SA 1N6NA 1IAQA 4XH9B 4UNNA 3QVVA 1HURA 3ZZUA 3Q7QA 1XD8A 2YYZA 2OCBA 3BFVA 3BRWD 4QNRA 1R7RA 1GITA 4EPVA 2VYFA 2VP2A 3PCRB 2UKDA 3P1JA 3QXJA 2WWWA 2B8TA 2WMNB 2ZR0A 3THWA 3FYHA 4V0MA 2Z43A 4IJMA 2QTHA 3JZAA 3PV0A 3SI7A 1XCGB 2A7QA 2CLSA 2J7KA 3CIOA 1XMJA 1LNZA 1LTQA 1Z22A 1KI2A 4CEJA 1J8YF 1AQYA 2BBSA 4JJKA 1KI9A 5LB2A 3VU9B 2EQBA 2GCNA 5GJCA 1Z0FA 3F0TA 3GJ5A 1MRNA 3K0AA 4D4JA 2ANBA 3QEJA 4PSVA 3T1TA 1ZM2A 3W6PA 2OEPA 4LUCA 2WAXA 1S3GA 1QDEA 2ZSBA 5BWMA 4DB2A 1GKUB 2CK3D 2IUSA 1N2CE 5K8IA 1QG4A 3C4JA 3R9WA 3CZPA 2CNWD 2GILA 4RFSA 3TK1A 1U8YA 1XJQA 3K0SA 5FBWB 3DM9B 2VA8A 1RYHA 1KZ7B 1M7HA 1CR0A 4IVQA 1I4LD 1KO1A 4OQNA 2OT3B 4Y0VA 1R6BX 1L2TA 3OIYA 1OFIA 1P2SA 4F91B 2XJ4A 2ZRHA 3GJ8A 1BMFD 1FMLA 2WIBA 4KHZA 4KVGA 3WNBA 2OXCA 5JJIA 1S2MA 1TQ4A 4W5WA 1YJ5A 2ODWA 5G3YA 1E94E 2GEVA 2WV9A 2FPMA 2ONJA 1N6HA 3W6OA 1S96A 1Z47A 4FINA 2C78A 2GCOA 3T5GA 4XIGS 2W0MA 4US2R 4NZYA 4PPNA 4JIMA 2BKUA 4KXFB 4Q4AB 3GCGA 2FPKA 1G6HA 4HLCA 4E03A 2FZLA 2GK6A 3CR7A 4A0FA 3KQLA 4PPGA 1US8A 5TMPA 2DFNA 1OIXA 4KFUA 3FVQA 3SC3A 2B6HA 3MFYA 1R5BA 4DLSA 2JCSA 4QJ5A 1K6MA 1KMHA 3KKMA 3U44A 2PZEA 1HA3A 4CZ2A 1ETUA 3QENA 3QPUA 2C96A 4WOPA 2A3RA 4QXAA 2PL3A 3VMFA 2ODEA 5LPNA 2O52A 2GVZC 4A82A 2Y8EA 3TBKA 1DAKA 2OG2A 1HE1C 3KXKA 5E7IA 4A0GA 2BEKA 2HEIA 3ZD7A 1OF1A 2DFLA 2ZYWX 2FWRA 4PPFA 1CXZA 1WBDA 1U9IC 3E1SA 3LX8A 1E9DA 1TX4B 2OAQ1 4C30A 2IYYA 3K0EA 3VR3A 4YDSA 1E2KA 3AVWA 5FOVA 4Q9IA 1W49A 4F92B 1KJYA 2IHBA 4KV9A 1Q1ZA 3B82A 2IC5A 1UJ2A 5IK2D 1SXJE 2F1JA 3EZ2A 3GFPA 4DCTA 4MGYR 3TLXA 3GLIE 1TL7C 2ZJZA 2W2VA 4D25A 3BFKA 2EWVA 2ZJ2A 2NO0A 3O8DA 3KUCA 3HPRA 3GPLA 2OCYC 3RSOA 2IX3A 2MSDB 2QRZA 4DXAA 1KI4A 3F3YA 4OI2A 1NY5A 4DJTA 2FEMA 2EU8A 2GZDA 5JEEA 4HZIA 4QC2A 1YR9A 4FCWA 3E70C 2OFWA 4IDOA 1FZQA 1YZUA 4LV5B 4TYPA 4MUAA 3U3KA 3SYLA 4UNRA 1GRNA 3EPKA 4AY2A 2FPLA 3VKGA 1HV8A 1J7KA 4PHFA 2I4IA 4PSAA 1ZIPA 5FL3A 3R9XA 2VHJA 1SVMA 4KYIB 3DL0A 4I99A 3BK7A 2CLDX 3QBTA 1SXJD 1FFHA 2QPTA 5FBVB 1UBEA 1CS4C 4M1KA 4GDFA 5SZHB 1KK1A 4LHXA 2JJ2D 3GLGA 2G77B 2NO9A 2IS6A 2O8EB 1ZVQA 4M2LA 4ACBA 3AP3A 4QGHA 1OXXK 2BMDA 2ZUDA 3LWNA 1KIMA 5DE3A 4HDQB 2XSZD 4KYUA 2BBOA 4WIAA 2ZUBA 5CJPA 2HT1A 2AWNA 1XXHA 1YZLA 1P75A 1ESNA 1G5RA 2KSQA 2WVJA 3MWJA 4PZLA 3ND9A 3B85A 2N1BA 4DEYA 5A4JA 1AZSC 1U2RA 3A37A 3U6BA 1M34E 1OHHD 2NPFA 2J0VA 1XJCA 3ADKA 1QHHB 2UZIR 4B74A 1XXHE 5K8LA 1SVIA 2ZSDA 4EQ6A 2R9VA 3CF2A 1E9BA 1ZAKA 4V0LA 4LV8B 1XPOA 1ZNYA 2AFIE 1OH6A 4TSFA 5EXSA 1AM4D 2XNDA 1OH5A 1HY3A 3ZQJA 1ZU4A 1ZNXA 4XWOA 2BBTA 4B34A 3S1AA 1LW7A 4Q03A 1CR1A 4B75A 1XBTA 1COWA 3REGA 2PEYA 4LHWA 5J5CA 2V7QD 3TJZA 1XPRA 1SULA 4V0KA 4PSKA 2WJJA 4GOXA 4JKYA 2DPXA 4EPXA 5KSYA 2GCOB 4QJ3A 3A1WA 1SQ5A 1KSFX 2QI9C 3KTAA 4UKDA 3RWMB 2IF2A 1JR3E 3CRVA 2FGJA 3HU3A 4Q4HB 2JJ2A 2RAPA 1IOZA 4TLDA 4YMSA 1E9RA 4BFYA 3U6KA 2J0QA 1L7VC 2MSEB 4PXAA 2XSZA 4NKRA 1KGDA 2FA9A 5EZ5A 4DVGA 3VR2A 2GJKA 2NO1A 4GOKA 1OYWA 4M53A 4QG7A 1YZGA 2IYSA 1G16A 4DKXA 1D5CA 4I1OA 4L5BA 3WNCA 4JYBA 3ONWA 2CMKA 4NMMA 3PFIA 4G5RA 3DMNA 4FWIB 3QY0A 2P2LA 4C9BA 3AVTA 3LDAA 1XD2B 1R0ZA 3O8CA 2ZXUA 4KAXA 2V55B 1KNXA 2G83A 1TTTA 1CJMA 2GBLC 3IO3A 4JKIA 1G4UR 2GXAA 1E2NA 5L3RA 4QGAA 2QPOA 4URZR 5TB5A 1Z28A 4IOMA 1G3RA 5FUYA 3PUWA 1U94A 1ZM9A 2JLXA 1E9EA 3B6EA 3ZYCA 4BWYA 3CNLA 3DO6A 2ZJOA 4GZLA 1F5NA 2J46A 3D8BA 4KCGA 5A5GA 4OBEA 4IDHA 2F9LA 3B9PA 2XNSA 3PUZA 4PPQA 1P61B 4MUBA 4GMXA 2O8FB 2ZRGA 1V5WA 5JI2E 4Z51A 4QHTA 2X19A 4PHHA 1G8PA 1EGAA 2ZE6A 5FPSA 4ZCIA 4BLQA 5EXXA 1T3HA 2B92A 4KFTA 4BFXA 2J0UA 3BGWA 1IXRC 2RGNC 521PA 1G5PA 4KFSA 3CBQA 4Q4HA 1EFRD 2CDNA 1UBFA 1UKZA 3BE4A 4C0KA 2CE2X 2DWQA 4ZDJA 1II0A 1KJZA 4US0R 2GVDC 4OL0A 3SFVA 1Z0DA 5JSZA 3LBIA 3IHWA 4B3CA 5AJVB 3AB3A 2OILA 3NHBA 2HUPA 1DEKA 2NGRA 2VQSA 2PT5A 4LC1A 4LK2A 3IQXA 1WMSA 3NBZC 1TF2A 1VIAA 4ZDKA 3QIAA 3A4MA 2NPIA 5JS8A 1E79D 3KQHA 2B8WA 4IXNA 2OO7A 5KPJA 2KWIA 3QXSA 1ZCBA 5BN3A 3T61A 3V4RA 3LA6A 5F9FA 1P3JA 2HLDD 1X8LA 1DVRA 4F4JA 1G8HA 3NDPA 4CEIA 3QKRA 3D3QA 3JVVA 4RZ3A 1ELOA 1NLFA 1P72A 3DKVA 3SOPA 2BC9A 3CPHA 3LRPA 1XDBA 2BMFA 3ZVLA 5KDDA 3BXZA 5TARA 3OAAA 1OXUA 2CL7X 1CBUA 5CIQA 4M1YA 3NKVA 2QEQA 3E5HA 1DO0A 4C0BA 1QHHA 1OSNA 3VFDA 1J99A 1YRBA 3L43A 3W5IA 2XXAB 1OFTA 3GJ6A 3EX7C 1IY2A 2BMEA 1EG7A 2FFAA 4Q48A 1VMAA 2J0UB 5H1YA 2R6DA 1FOEB 1DS6A 4CVNA 2RKOA 5JS7A 1MABB 1H8HA 4M22A 4XD7D 1GNPA 1W4BA 4L15A 5G40A 1WF3A 5FL7A 3FHOA 4IDNA 4JBWA 2J7PD 3A4LA 4LHZA 1VG8A 2FFBA 3H84A 4Q18A 1GG2A 4A1FA 1R5NA 2XTMA 4AKIA 2FU5C 2WKRA 2XOKA 5EE9A 5DIFA 4B35A 1R0WA 4D0GA 3I1FA 3WXMA 2PT7A 2RH5A 1G3UA 1J70A 3FMIA 4IW3B 4J0QA 2Q0HA 4OK5A 1PVOA 2NMVA 1KK2A 5IDVA 1GL6A 4Q9LA 1X6VA 4Z54A 4R71A 3NG1A 3EIQA 4IFBA 2QENA 1E9FA 721PA 1SXJA 1OPXA 4KVAA 2CCGA 3GD7A 1VECA 3C15C 3SFZA 1OKKD 5L8VA 4OI1A 4JLOA 2LWIA 4PTLA 3A1VA 4G1UC 1P2TA 1R2QA 2R62A 4B33A 5J47A 3ZVMA 2YINC 4Q5IA 4B73A 4RD1A 3K0FB 1XD9A 2WSSA 4PC7A 4YMWA 1XTSA 1AS0A 2A5JA 4GBMA 2DY1A 2DBYA 2N46A 4GP6A 3PEUA 4HAWA 2PLRA 4NP6A 2ATXA 4LCBA 1XTRA 1NKTA 3H2YA 2QMEA 3FHTA 1AA9A 3CF0A 3LNCA 4JVLA 4KO8A 3ZZ0A 1XJ0A 3ICQB 1R0XA 2WKPA 4M1TA 1T8TA 1XTIA 1TAGA 1ZINA 2QAGB 3MGCA 3IBGA 2AXNA 3RNLA 3NIBA 1JR6A 2QGZA 3QKRB 4E07A 2GCPA 5TDHA 4FIDA 1FTSA 3VR1A 1L8QA 3K9HA 5H68A 5FPKA 5TY0A 4EPYA 3AKYA 2WSSD 1TEXA 2F1IA 2IS1A 1VYVA 1FL9A 3OESA 2JJ8A 1UKEA 2Z4SA 4CW7A 2IYUA 3TAUA 2H17A 2RGDA 4KSBA 1M8PA 4LYJA 3AP1A 5JJKA 1VIYA 1XF9A 1E0JA 3AF0A 3IBYA 1Y3AA 3CPJB 1NP6A 2HCBA 2YV5A 4A36A 1KK0A 2ZM5A 1NKSA 4Q02A 2G6BA 4IOKA 4MYHA 1E2JA 3NH6A 5EXTA 5J4VA 5EZ6B 3TKLA 1XCMA 1KYIA 2CCJA 2GJ9A 4DLTA 4DSOA 4XJXA 3B78A 3KQNA 3HYTA 4HDOB 4B32A 4O25A 1E3MA 3NWJA 2VBCA 2PCJA 3IEUA 1HTWA 4TLCA 2QSYA 1SKYE 3WYAA 4LOAA 1TQ6A 3NEJA 3Q5DA 4MITA 2OM2A 4XOIA 1M7GA 1KDTA 4IHQA 4OI4A 3PR1A 3RS4A 1AQUA 1UKYA 1AZTA 1XXHB 3FMOB 4TYWA 4AKHA 5KPDA 1NIPA 1XCPA 4GP7A 4MGKR 4ZI3A 1VCIA 4JSTA 4WZ6A 4BLTA 5IHPA 1NF3A 2ZYVX 4YLGA 2BJWA 3IIMA 1QZXA 1M1YE 3W6NA 4B2PA 2DYKA 4LJ4A 1S3SA 2JLZA 4B47A 1Q20A 4V0ME 1FQJA 4EJSC 1F48A 2Q9BA 4MA4A 3VR4A 2WPDD 2ZSAA 4HUQB 1EK0A 2W00A 5HR5A 5TV2A 5FPTA 1S1CA 1MABA 5IF9A 1II8B 2E1RA 2VPPA 1XEWX 3RVBA 2FOLA 2IHYA 5DSZA 3S1AB 3TH5A 1WA5A 3WMGA 3KX2A 1N6KA 1OFHA 2IS2A 3THYA 1FP6A 2GESA 3T5DA 5AK0A 1N3BA 2ZYTX 2WICA 1QHXA 2ZSEA 2VSFA 4V03A 4ACAA 3B1XA 1RC8A 5GJVC 2AWOA 1NY6A 3FB4A 3LLUA 2AK3A 4UQOA 4YQFA 1OH7A 4HAVA 1LF0A 3C7KA 4PC1A 1DADA 1NRJB 1Z6YA 2A5FA 4OK3A 3EWSA 4BEBA 1ZM7A 2A78A 2VP4A 4QOSA 1TEVA 1UFQA 3RWOA 4MGZR 3A1SA 5E3HA 1Z5ZA 3B9QA 3AV0B 3CX6A 4ASUA 2WHXA 2GWHA 2R6GA 4HLUA 1NN3A 5C4MA 1R8SA 4FMDF 5EE1A 3K0FA 2B7BA 1XTKA 5EUMA 3T06B 4ZPXA 4A2PA 3M4YA 5K8UA 2EFGA 4M1OA 2E9SA 1SXJB 4RFVA 3OE7A 1P9NA 2WOOA 5CK5A 4DZZA 3UPUA 4A8JC 3L2OB 1BYUA 1U90A 1ZUIA 4LJ9A 2ORWA 2O5VA 1O87A 3CH4B 3QSYA 4M9QA 2IA5A 2IEZA 1RRCA 3HU1A 4PR0A 4U00A 2ZU0C 1EWQA 4F38A 3SHWA 3RDPA 3TMKA 4DIDA 3RHFA 4RSGA 1YHNA 3RRYA 2ZAMA 5BW8A 3TW8B 4W7SA 5E7JA 2GEUA 1UBCA 2ECKA 1US8B 3ZS9A 2YWFA 3CR8A 3QJYA 1Z6TA 4QBGB 3O47A 4XVQA 1JPNA 2FFHA 1A82A 5JRZA 1OB2A 1NI3A 2QP9X 3SZRA 4ASUD 2IXGA 2X2FA 3QOFA 4PO9A 4LYHA 4DBLC 1SHKA 2ZJ8A 3UMSA 3QNUA 4A2WA 1XEFA 4B71A 1E0AA 2ODBA 3G5UA 3DDCA 4TWZA 3QXHA 5ELXA 3B60A 2R8RA 1D2MA 2PX3A 4LWZA 2ZS8A 3KJEA 1P7CA 2ZRJA 4MRRA 3EG5A 2Q3HA 4YXWD 4NHOA 4BLRA 1IHUA 1DBSA 4JYCA 3U2QA 3L0SA 2VL7A 4A0HA 2VP9A 1TNDA 2VF7A 2UZ3A 2AKYA 1X1SA 1IXSB 1G1MA 1LB1B 2D2FA 2GHIA 2HYDA 3QPWA 3AP2A 4URVR 3THYB 3C8UA 5J4YA 3B13B 4RD0A 4DCNA 1P9RA 4LSGA 3MRSA 1XMSA 2JIZA 1XWIA 3KTAB 5CB6A 2CL0X 2VO1A 4D6PA 3P26A 4Q4AA 1HT1E 1N6IA 2ASEA 2ONKA 1GIAA 4TMTA 4P0TA 3HWSA
chains in the Genus database with same CATH superfamily
2YV3A 4GKVA 4B46A 4MRVA 1PQPA 3BBPA 3O92A 3MCZA 1VLTA 5I7VA 1E3WA 1TB4A 1VKOA 4LV6A 4J91A 3LK6A 2GPNA 3U3DA 5CDYA 2GDZA 3L8ZA 3W79A 4U8GA 3SDBA 2CHGA 2J30A 1WABA 3L40A 4MRSA 4ZODA 5D51S 5LZ7A 3TULA 1U3WA 4GKKB 1IBRA 2O7SA 1M74A 1Z7BA 5CYFA 3DE7X 1EUCA 1R0KA 2CZGA 3MD9A 4QOJA 4U7JA 2WJPA 1HEUA 4P6VF 4B8WA 1OW6A 1Z29A 2VJPA 5I48A 1UBNA 3NCTA 2JGRA 4OREX 2YRWA 1YXMA 2Q0SA 1CX9B 3DC7A 1S5PA 3I28A 3Q8XB 1B6RA 3DWWA 1N2BA 1F06A 1K75A 2E6KA 3EMVA 1L7BA 2XVAA 3CEHA 3OSZA 4PQRA 2VTBB 4CEHA 5CCDA 1BOFA 5FUWA 3IJPA 1NN5A 2CXQA 4M55A 4NNOA 4E12A 1E1MA 4O8CA 2K2QB 5JS6A 4JASB 1CS0B 2FKNA 1LKXA 5B2ZA 2C97A 4C7KA 4CQMD 3E3LA 2P5SA 4KV7A 4QEZA 5A02A 2ZSUA 2NU8B 2OEVA 1MJFA 4DOMA 4LC9A 4C3OB 3WIEA 5HP4A 5CXSA 5DTIA 1XU4A 2X41A 3GLUA 4YCBA 2XM4A 1FVXA 5FLXA 2AR9A 3GMTA 4DCCA 4AJ4A 1L3IA 4BFZA 1T1GA 1SCUB 4WXEA 4PX3A 3OZEA 2F55A 5B4TA 1E69A 1G2PA 3AHCA 2NN3C 3FLMA 3HYSA 1ZVVA 3IHKA 4GEHA 1FMJA 1QQ5A 4YV0A 4OIMA 3S1SA 3U4MA 5DS4A 2WUEA 3F5DA 1EZ1A 4GYJA 5TPZD 3TAHA 1QX3A 4RVSA 3EUAA 1J0XO 4OPMA 1W0CA 2FPPB 4UVDA 5EWMA 3W5CA 3L7IA 5CR9A 1PS9A 1SC9A 3ZKAA 1QU2A 4IOLA 2PUGA 4BQIA 2YC4C 5ICCA 4CNQA 4DHEA 2VPYA 4HYQA 4TSRA 2NV6A 3F5FA 1RTTA 2QZ4A 3AUJB 3VKHA 3KR9A 4QDOA 4CF7A 1PIWA 4ZARA 5F21A 3ZQYA 5CDFE 2Y9PB 3JV7A 3N7UA 4MYSA 1Z2AA 4B85A 3K1JA 3ROTA 1NVWQ 3ZTTA 4I9UA 3CM0A 3ELWA 1BWPA 3GEGA 4JIOA 3GJ4A 4WGYA 4XSGA 3HXTA 4BO7A 4EL5A 3ZIBA 2VZLA 3ANTA 4G5GA 5G3ZA 4BFUA 1FB5A 2YVAA 3R20A 1FP1D 5AKEA 1UEJA 2JAOA 1D8AA 3B2QA 1JEYA 1RC0A 1QYCA 2D3WA 2I5PO 2B2XA 3GCXA 3O10A 4HATA 4HGRA 2PGNA 4II2A 1M10A 1B23P 4V39A 1P80A 3N5CA 2JK0A 3PPYA 2SHKA 4NMWA 2H0AA 2P3OA 1HE4A 2P7IA 2OPHA 3ZGOA 4F45A 2A1TS 1AO0A 2AZTA 4TMKA 2FQWA 3HTXA 1P1HA 2IU3A 3SS7X 2LUOA 3HKBB 5BN4A 2O2DA 3AW9A 4KLRA 4KQ6A 1BA2A 1X1DA 4BVJA 4WSOA 5JFOA 1QBKC 5AOBA 3WLEA 1KZYC 1NAIA 3NO4A 3X2FA 2ZATA 4JBXA 2B4TO 3D0RA 1BKDR 4Y1GA 5EHZA 2FMKA 2LIPA 1W581 2KLHA 1J09A 4OTZA 1JSXA 5EJIA 4LOHA 4QUAA 2ZXFA 4IDCA 1E1LA 4E51A 2HRBA 2VH1A 1CZRA 2QZ9A 2YYSA 4O6VA 2BHLA 3ZDEA 4W8KA 1OQAA 1LBQA 4L85A 3SHFA 4ECAA 1NR7A 1L4FA 1UADA 5FBLB 2Q8PA 4HRVA 1XHLA 1IM5A 2GN0A 2N0SA 3CLSC 1W4CA 3ROGA 2NQ8A 4BATA 3GJ0A 4F4BA 2NUBA 3OLVA 4WFQA 1K8QA 1N5RA 3HJGA 1JQDA 2HS5A 1JEQA 5JNRA 1RE0A 1YVRA 4FYHA 1Z2NX 1K9VF 2CL5A 1FY2A 1VHDA 2Q46A 2WIGA 3WIDA 4F3YA 5JH7F 4AMVA 5LQJA 1PSZA 1QQ3A 4CKWA 2R8BA 3QUQA 4X63A 5LZ8A 2J9RA 4MKZA 2ZITA 3ZCRA 3EZYA 2B99A 5JXWA 2XB2A 2G7MC 3DTVB 1D6JA 4EAQA 3M0EA 3SEOA 4QXRA 4BGDA 4Z4FA 1PT7A 1B3RA 2ACKA 1IXYA 2I6GA 4M0PA 1NBME 2DMRA 3KYIB 3B7GA 2OBXA 1GARA 1HW1A 4YT4A 4UE3S 4CKYA 4JGGA 2C5EA 2D1RA 3STUA 1LZLA 1QQ6A 2UUPA 4LTNA 3PFNA 4U5XA 5PGMA 1EBBA 1WV0A 1UK8A 1SN7A 1AQIA 4EHPA 1BW9A 2X9GA 2XX3A 5EJFA 2JGDA 4WJLA 2I9KA 4R31A 3CVWA 1U1EA 2E4VA 1ZM4A 3FGNA 2H7OA 1HDOA 2DWUA 3AY3A 2R8OA 1S3IA 3KKZA 3OMLA 4KK4A 2RCYA 3H8JA 1FRZA 2QJRA 3S99A 4DJ9A 1ZOLA 4RTSA 4GXQA 5E1OA 1IK4A 1S4QA 3HJNA 3RT1A 1OB5A 5JNVA 1RHJA 5KYUB 2PEZA 3ABSB 3BREA 3FZQA 5B3KA 1TJNA 3EFEA 1I5OA 4E22A 2ZQ5A 4L27A 1E96A 4E0BA 2HRZA 3DHEA 3LVBA 3RC1A 4XWAA 5KC9A 2DFPA 3EEFA 1ZL2A 4PEVA 5EIFA 4XOUA 4WCFC 4D8TA 1N77A 3OLXA 3M79A 4D9NA 4QVKA 1FF9A 2X15A 1B2RA 5K0SA 1OY1A 1QBGA 2MOKA 1T36B 3TX2A 5MN4A 1PDVA 1SHZA 4BPMA 1FUEA 2QQ0A 4P3KA 4D1YA 3SDSA 2QJFA 4CT4B 4E5DA 5HJ5A 2RE8A 3K15A 5F12A 1EGVB 4DCPA 3CJTA 3JARB 2RGAA 3CNBA 5JECA 1E1CA 3TQFA 2OBLA 1QTRA 4ZLDA 4MUEA 4G0ZA 5KSWB 1PTKA 2A92A 2DH5A 1I80A 1EA5A 3EA4A 1VE7A 2WM9B 3H5TA 3GJXC 3FZEA 4GIBA 3TZBA 1SCJA 3JQBA 5KWIA 2J6IA 2OHVA 1IHDA 3QA3E 3BK2A 5KVQA 3PHF2 2G1UA 2G17A 5LQCA 1CP3A 2VT2A 4PTZA 4IIEA 4L8LA 2QROA 4PX2A 4R1NA 3G0HA 4YK5A 2O4UX 5A3VA 4G65A 3AR8A 1I4ZA 1GUAA 4CGZA 2ASRA 4QRHA 2YMMA 2DFKB 4JUBA 4REQA 4G5SA 4OA8A 3Q5EA 4OM8A 2YHAA 5MFZA 3V5YA 4Y7DA 4PYMA 2ZQZA 3PYLA 1XNQB 2FMUA 5EG5A 1X0VA 2A9RA 4KC9A 4JUDX 2X86A 4P8RA 4Q6BA 2NNWB 5DHUA 4MWSA 4CMHA 1F51E 5BPHA 1E2BA 4UCFA 3OY2A 2PJDA 3KHKA 2ZU6A 2OV1A 1E2PA 3KQPA 5JCPA 1YF3A 2Z0MA 1CJVC 2JNWA 4C4OA 4N7JA 5C7OO 4O1IA 1BAPA 3KJNA 2FWMX 3I61A 3CB2A 1AVOB 5K4GA 1TO2E 3KPYA 2EFDB 2O23A 1YAUO 1LPBB 3WZLA 3KAKA 5FQOA 1IM8A 2AD1A 2ZJYA 3PUHA 4UJ3A 5ALDA 2PDAA 1LSOA 3IVRA 1J39A 5B1SA 5F7XA 1WB9A 1TTPB 2C2BA 1WPQA 1R4NA 3KXPA 2BFOA 3NCHA 4AF6A 1FFBA 2QRMA 3OEHD 3OPXA 5ALGA 5AKGA 1GCIA 5IN5A 3VPGA 2PZGA 3ANSA 3BICA 2W22A 1NN1A 2Q1YA 3FYTA 4M7PA 1FS4A 1M2EA 2P79A 3BULA 1M2OA 2ORVA 3AF2A 4KI0A 4A3SA 2CHUA 1PKEA 1CERA 3WLMA 5ISMA 5AWFC 5GPBA 5GADl 3U3OA 3AKCA 3D0KA 3DOEA 2LKDA 1TPZA 5HKOA 5TE9A 5FPYA 4W5OA 4M0DA 3PWSA 1L4NA 1P1JA 1E18A 2QLLA 2WSLA 2XYGA 4LCEA 3T1QA 4E5VA 5FTLA 3EFOA 1N0IA 4BJ1A 3BRSA 5I7OA 2PFDA 4Z4GA 1FUKA 2HF2A 2JHGA 1W7AA 4MS4A 5JUWA 1PSDA 1GTMA 3TL3A 1CFZA 1RLOA 1T6BY 2B5VA 1FNMA 2OFFA 5B7GA 5KYGA 5EMHA 3SHVA 3AKEA 3P2IA 3T3PB 1WMAA 1MFPA 1S05A 1WGWA 3C2QA 3CHYA 4JDUA 4QASA 2AJLI 1D7OA 4DXWA 4NMXB 1AD2A 4CV3A 5I47A 3V5NA 5HZHA 2ZPTX 2WWYA 4XX0B 2H7VA 3VPAA 5F78A 1OJLA 1YH3A 5FPHA 4OJYA 3V5XA 4EB0A 3R75A 1EJBA 1GRRA 1E2HA 2XS1A 4JTDB 2HTFA 4UXHA 5EINA 4JP5A 1Y7HA 5DI9A 1GPWB 2YJTD 7MHTA 2Q29A 3WG9A 2I3GA 4URWR 3QG5A 4WBNF 5E3CA 2HQSA 1DAIA 4NFYA 1RWKA 2YIDA 3EC7A 3F7TA 2NIPA 3C6XA 4GX5A 1PD0A 4NTBA 1D8TA 3H1TA 2JFQA 3EW9A 4FYYA 1ZN7A 4KQFA 4RH0A 1VCMA 3SS9X 1L7NA 4X1YA 3OIDA 3SOZA 4PQFA 1DC5A 2C5LA 2LRHA 1IVYA 3BQNB 1W36B 3LHFA 1FXWF 1T8RA 1TAHA 2AJCA 2ON6A 4L0MA 3A26A 3E9CA 1N5JA 3PQ7A 4NBRA 4UVHA 1BOOA 4WOJA 1Y5NA 3KFVA 4M21A 3RC3A 4QDKA 4BYGA 2L17A 4C5AA 2O8EA 3SF8A 5CB4A 3EB9A 2G88A 1Y1QA 3R0QA 1MAWA 1WXFA 2YOGA 4IKEA 4B48A 1SAYA 3TW6A 3CSUA 4RX1A 3G5AA 3ZCSA 1HQCA 1O0BA 1UBGA 3VX3A 4DTCA 4V2IA 1NRXA 5F5NA 621PA 2OHFA 2W2KB 3IXQA 2WVAA 2BL4A 5YASA 1T9BA 5THKA 4LMPA 5KCMA 3TIFA 2WL8A 2C1XA 3JRXA 3L4KA 4XUDA 1U2DC 3QOYA 3FETA 4RDIA 2WEKA 5J40A 1LI5A 1DHRA 3LPDA 1F0YA 5E6UB 1O7JA 4EPWA 3MJFA 4FFWA 4TLEA 3AB7A 1B2LA 3LCJA 1YR7A 4YRGA 3ZGYA 2QV7A 2DHRA 5ITVA 4Q34A 4IWXA 3AF5A 4KRGA 3RJ9A 1IN4A 2XLMA 4F71A 4XQCA 2EZ4A 3DMDA 4F4UA 4BFTA 3ND8A 3T3DA 1ECBA 2H85A 1PR4A 1H6GA 2QORA 1E3QA 2QVLA 3IJRA 2ZJ5A 5DLPA 4BO5A 2JZCA 3FMPB 1QHGA 4PXYA 4D9CA 1S2OA 2V0GA 1TT5B 4RY2A 2OQIA 2RJ3A 2WABA 1SOVA 2OHXA 2JFZA 3B3FA 5B4UA 2WT8A 3NRJA 4ZYUA 1U2QA 2YH2A 4DMLA 4L75A 3VR6A 3RQSA 3D31A 3VH3A 3WX0A 1YYJA 5AW9A 3C43A 2WAAA 4N3GA 1JR3A 2HXGA 3ENNA 2I6QA 3WYDA 3T5TA 2RH4A 3U31A 2XZLA 1YZVA 5KU1A 2MMGA 2WJYA 3AI2A 3CC8A 5JO9A 2KNHA 1UMDA 1O96B 1NLXA 3PGJA 5IXYA 2XR1A 1Y42X 4G56A 2G9NA 2VF8A 3JD3A 3LZ6A 5CPBA 1KVSA 4ESHA 3DBHA 3DOIA 5L3SB 4JV5B 4MTFA 2BV3A 2IOYA 2XD9A 3S7ZA 2IPAB 2GKSA 4DQUA 4ZP1A 4RIGA 3REOA 3QVUA 5K3BA 5A9SB 3OQ1A 2EIHA 3BH0A 4IQGA 4B6QA 1AKNA 2FH5B 3O7WA 1OKKA 1YRQA 2IP1A 3T41A 1W87A 1KK3A 5C1BA 3VNRA 2E18A 2Q8QA 3K66A 3H05A 4D6YA 4B6GA 1F6BA 3L34A 2LP4Y 3N2GA 1VCNA 4TKUA 1H9TA 5IJXA 2P8SA 3LMKA 1IXKA 5ALJA 1VKJA 4LXQA 2J3IA 1TVCA 3CH5A 4P4SA 3NANA 2HJRA 1E7YA 1TZKA 1FX0A 1T6YA 2IYXA 1DRWA 4RGVA 2DFVA 5JSQA 2OORC 3AFNA 3H86A 1UANA 1XNGA 2DBRA 5F1YA 4IH9A 4U7DA 2PRKA 1YDMA 3INGA 1IMOA 4FX2A 5DI3B 3TLJA 1TAUA 4DG5A 1QQTA 5E4YA 5EFOA 1GNVA 1HQDA 1PT5A 5FI1B 2P3SA 4EYQA 1RHQA 4O4IA 4PVCA 4A8JB 2P2ZA 2HPVA 4Y30A 5H59A 5KINB 2C61A 5CLLA 1WHTA 3QLUA 3ZCPA 1GQQA 3C7CB 5KYWA 1ECJA 3IDZA 2ODQA 2NUAA 3JQ7B 3K4HA 3LOQA 3PCTA 1G66A 4M9UA 2YS7A 3DOFA 3L8FA 1OI7A 5TQVA 3RUFA 1CUJA 4AQ7A 4UXIA 2DOKA 3A6FA 4EKYA 5KNBA 1F2TB 5ALWA 1VC2A 2O2YA 2HMZA 3QV1A 4BAUA 2GLUA 4WECA 2DFTA 1D1BA 1T3ZA 1D09A 3CUTA 4NZOA 1Z83A 2QRQA 3WE7A 4E30A 4IG9A 2H5EA 3UOGA 4EA6A 3K70D 1LY1A 1JIKA 3LQQA 4A6DA 4MPJA 2PX5A 5AJWA 3TSYA 1SBQA 4G9EA 1F8UA 4HG2A 4Y6SA 5JZMA 3RSQA 2AN5A 2PLAA 5KNCH 1RKXA 4QULA 2VP6A 4KIFA 3DUWA 4D96A 4H7KA 4I4TA 4FGWA 1SUAA 2QR3A 4JKVA 2XB4A 4D9HA 2FY8A 2PGOA 4I4TB 5SV2A 4BKMA 1T2NA 3WYNA 1ST6A 4GFDA 2IODA 4Q1FA 2VOEA 5LSAA 5FT9A 1YI1A 1AOXA 4JI4B 4DBLE 2XODA 3H9CA 4MB2A 2JJ1D 121PA 1JXMA 1L4KA 1CR2A 1SUBA 2AZXA 3PS9A 3HNRA 4G7OF 4GBGA 3H0KA 1M0SA 2R7LA 1JAHA 1NASA 2DR3A 3EMDA 2DBVO 4MPPA 4WK6A 3WKAA 4HX5A 4WACA 4Y67A 4YP9A 5JE8A 3E3AA 4TXNA 2FRXA 2WNSA 4HNAB 1MQ9A 1UBUS 5BYJA 1GA4A 1DXYA 1KO5A 2XBLA 2D1YA 2PKQP 5BP7A 3CONA 4G5FA 2X2PA 3O0TA 1KEPA 2C5FA 2GA8A 3G23A 3P5BA 3WOHA 1SC6A 5TQJA 1MPTA 2AR7A 5IT5A 5JJIA 1R6DA 3YASA 3CRNA 3I5PA 1FFXA 1MMNA 2DAPA 2WU8A 3D02A 4PANA 1CEEA 2Y39A 3L1HA 5B6IA 3PNKA 5AVOA 1A0BA 4LDJA 3WMWA 1WZUA 4MVSA 1YA9A 2HU8A 4ZCSA 5JMPA 2GM4A 1Q7EA 2CEKA 1T9KA 2BH9A 1E7SA 2IK8A 1PLJA 3GVIA 3JD0A 4ZTZB 2WB7A 1OJ7A 4G85A 1KP9A 3ZJYA 4ALMA 4DC1A 4PBTA 1QWOA 1PV3A 4X0RA 1N2OA 1SA0A 2FLKA 2RK3A 4Q93A 3RU2A 2YL1A 2ETSA 5EXPA 2JIQA 3L8GA 4F86A 1SCIA 2OSBA 2I4LA 2FEOA 1CUGA 3KSMA 2IYOA 4XM0A 2GAQA 3GZNB 5H70A 1K8ZB 1CQJA 2XGOA 2MWQA 3H8SA 3IOMA 3M4BA 3VR3D 1I01A 1SBHA 4FFSA 4Y2TA 4RJTA 3D8TA 3EZIA 5BQIA 2OC9A 5LA6B 4CM8A 2RGRA 2H6EA 5AI6A 1H6BA 1KJQA 4M9XA 1XPUA 3GNLA 1FDVA 3EXFA 4GPD1 4HP8A 5HFNA 1PDOA 2NTNA 3QG1A 5EJ4A 1PBNA 4XGIA 2CF6A 1Q0FA 1Z7GA 3DBRB 3EQZA 3NKFA 4ITVA 1WSWA 2ZJBA 2L6FA 3EG9B 1NWHA 3CKLA 3IURA 3GHHA 1EFHA 1NFNA 2PQMA 3MJHA 1I4DD 1NQWA 1T5DX 3OKCA 4C5CA 1ACLA 3GPIA 1LKZA 2Z1MA 3RRNA 3IUSA 1CPYA 2BEJA 2BMWA 2YQ5A 3I76A 2ZIGA 2P65A 1A0OA 3JS5A 1PJ3A 2H5LA 2OZEA 1YIDA 3O3MB 4EIWA 4I3HA 4DJAA 1B00A 3IQCA 1ONSA 2EYQA 2VJKA 2H92A 5B64A 3QUTA 2QM0A 1GN8A 2V45A 1LK7A 2XZTA 2G4LA 5AJYA 1QK5A 3GR6A 3HA7A 4WESA 4ZO9A 4CDGA 4G0VA 4I3MA 2VUHB 3MJVA 2RIPA 2OQ2A 2PJZA 3T5BA 1JZTA 1TZCA 3I09A 4LQLA 1T01A 3RFVA 1Y33E 2F8MA 5A5EA 2CVQA 2WB4A 5A4FS 1DARA 3BT7A 1SURA 1O6CA 1U81A 1L7XA 4NYJQ 4AWBA 3ZX4A 1ZW1A 4RYDA 3IFSA 5CVEA 1ND5A 1GUFA 2WIKA 3AI3A 2ZXOA 1M6YA 2JFGA 2GYVA 3IKMB 5CDFA 1VL6A 3T0IA 3T7EA 3NMKA 2G06A 3JTEA 3VQTA 4A6PA 2YY7A 4N47A 1CY8A 4NJMB 4DA8A 3U3RA 2WFMA 4EVRA 4DR7B 3QEAZ 4YY3B 3M3PA 4YAJA 1AIPA 4CG1A 3SJZA 3GA0A 4EO9A 2CFOA 2E21A 3AHDA 1CKEA 4FI3F 5A9TA 3O5AA 4FFLA 5JHHB 4MDFA 2R1VA 1X7YA 3ZWAA 4IICA 1SU7A 2NSDA 1C3OA 2Q2OA 2L82A 4YRCA 3U1TA 3UMVA 2RMKA 4IDPA 4EHBA 2VNHA 4TMWA 1M2OB 1RJDA 4XR4A 2RFLA 4KQGA 3UA3A 1OILA 1Y9ZA 3AF1A 2ILVA 3RYFB 3ZXSA 3ZZNA 2HADA 4ZZ3A 2A58A 1QHNA 4HI0E 3GVCA 5G4LA 2VQ3A 2WD7B 2HSWA 4HK4A 4M6WA 4R0MA 4P80A 4J4TA 4WY5A 4JMLA 3UV3A 5B3LA 2B98A 3LYLA 5BNWA 2WTNA 3OBIA 1H9AA 3ZW7A 1Q1BA 4QOGA 2Q4OA 5JSUA 3BHMA 4X1IA 4Q4JB 5JJCA 3ZC4A 1OXBB 4Q4LA 3OMXA 1BH2A 1VYTA 2VK1A 5AM3A 1XMVA 1W29A 5DYTA 4TZ6A 2RKBA 2H63A 5B2EA 1ZOOA 4CSAA 4MKHA 3TZ6A 1QH9A 3N0RA 2RHBA 2WU1A 3EASA 1X7ZB 1X38A 1ZD9A 2QUAA 4YRMA 4I50B 1A7JA 3WS7A 2C3UA 3MIZA 3KSRA 4MRMA 1K5HA 3OJEA 3KB6A 2GRJA 3BWVA 1C17M 3T5MA 1E98A 1G3IA 3I37X 5DXFA 3ZXYA 1CUDA 4XDGA 1WD7A 3DAPA 4YN3A 2OAP1 1A76A 2CN1A 2P68A 1TWGA 3NBFA 4B76A 1AB5A 5EWLB 4DJ5X 1PKXA 1F1MA 4YN0B 5JLIA 3G6WA 2EEPA 2G0NA 3QXCA 4RANA 1XZNA 4G09A 5BSFA 2Z2YA 3NORA 3RSZA 1I10A 2HSQA 1UUFA 2HRQA 3MUOA 4CLHA 3VTFA 5DNCA 3ON5A 5LNK6 3LUKA 1PGJA 5JDIC 4AX4A 5J4HA 4BNDB 1T5TA 3WP1B 3H65A 3DVLA 3EEQA 4ONEA 4ZOBA 4YP1A 4G0UA 1UFVA 4QPZA 4CEJB 2OBBA 4GWGA 1KU2A 2UUHA 3U0CA 1GZHB 1Q1QA 4J03A 4TN5A 1DIHA 4OFBA 4EHFA 1YK0A 4TKZA 1YMUA 5KC8A 5F7ZA 4BB0A 1Q0DA 2A5DA 6REQB 1XRSB 3BCUA 3GPBA 2EBHX 2IU6A 5ECDA 4JJ6A 5A6SA 4JL6A 2FJ0A 2WR8A 5UKDA 2IYTA 2J07A 2WHRA 1XYVA 5A6AA 4WGFA 4F6CA 2WINI 3PNYA 4R8MA 3SSAA 4BQQA 3K2BA 2BRUC 3HNOA 1U04A 1JZSA 2QVZX 1OFVA 2D0IA 1Y9DA 2YLDA 1KHHA 1MV8A 2ZI4A 4G1BA 1KQ3A 3DB1A 2GPTA 4NNPA 3MQ4A 2XMPA 4K1LA 4O4JF 3WVNA 3ZE0B 4E21A 1YNOA 2ADOA 3PQ3A 4QBTA 5ILOA 2E4UA 2OBNA 4NOJA 1MC4A 1WCIA 1Y4SA 2FEPA 1N2HA 1T9CA 2PX4A 4C7OA 5C8DA 3AR7A 1PF7E 2W48A 4C0SA 2J9UA 1G42A 1D2EA 4RTRA 1LDEA 4GL2A 3GEPA 3TQQA 2IXFA 2EFHB 5EWLA 1H2YA 4P32A 4ZV9A 5TSDA 3TTSA 1VL2A 3MHTA 4J0JA 1UZMA 5J63A 1I7SB 1KRXA 1FSGA 1J0AA 4ZGBA 3OA1A 2V7EA 3CRW1 3GOQA 4XWJA 2ZBQA 1V43A 2Y1CA 1OC2A 3FUCA 1YD7A 3AIOA 4EF5A 5D7NA 5GIOE 2GERA 3B38A 1W9MA 1S1MA 4LA4A 4S0ZA 4X60A 2EJBA 1STOA 1OTXA 1F2VA 2IHNA 3HJFA 1PSWA 1WMEA 4CLOA 4QTYA 1BN6A 2IYLD 1H8HD 4MTGA 2HUNA 3WYGA 2F48A 5D2CA 1PVVA 3AJAA 2N47A 3CQZA 3GBVA 4TWJA 5ALZA 3Q7IA 4COOA 5BQ3A 5H3CA 4X5OA 5BQXA 3NVAA 4K6CA 1CY1A 2PSHA 1GPDG 3M6VA 4N7RA 1V7ZA 4K28A 1U8CB 1MUUA 3EGVA 2G08A 1B8UA 3ISVA 3THXA 5LQKA 3A9TA 4HVTA 4JITA 4KUEA 1HYHA 2BKEA 4J6EA 2HMWA 1E6WA 2Y1EA 3NBYC 4FOSA 4QPPA 4EY8A 4ZIRB 1AJEA 3Q6MA 5JG7A 2HK9A 1D1QA 3L92A 4PZUA 4U9UA 5AXDA 2OZPA 5AOAA 1L9KA 4JJ8A 3RSGA 5JZVA 4RK4A 4DDMA 3NUQA 3GRRA 4PWYA 4TS3A 1AK9A 4YC7A 2M32A 4GWKA 4OQFA 1U2GC 1N0UA 5DNDA 2IELA 2CCKA 5LR6A 2EFJA 1Z06A 2G1JA 2V7WA 3RVPA 3K6BA 2G0AA 1NMSA 4DNFA 4EZEA 3O93A 3ZV3A 1Z9BA 4UVGA 1RP7A 2DQSA 3N7TA 1FFCA 2N1MA 3QFCA 2P9BA 3PF9A 2WWGA 5ESDA 2FN7A 3W4JA 4CLRA 1NT4A 2WKQA 1DAGA 3F4LA 4DSAA 3DBRA 1VE9A 2ZRDA 4JHXA 1EFAA 1E2LA 3UMRA 2ADMA 3S5UA 2CT8A 2OGSA 1BA3A 3IAM6 4PICA 1FU8A 2Z1NA 1RFLA 3VBEA 2IYZA 3A1TA 3BMOA 3L93A 5EP4A 2AD5A 3GXBA 3WIBA 1NU6A 1VXRA 3IAFA 4NCJA 2FUEA 4I9HA 2LCIA 3ZU2A 4CM8B 4TRJA 2QX7A 4RHXA 3IEXA 1JKIA 4IIJA 4QM6A 1SIOA 3DDSA 5ESRA 1T8WA 3PLRA 2A14A 2I99A 4CU5A 5HKKA 2OHHA 1HZZA 1FEZA 4FE7A 2YOFA 4L76A 1D1AA 4LNAA 3IPYA 3GJSA 1YDEA 1KIFA 1A9SA 3VOTA 1DELA 2PKCA 3IOBA 2XECA 4KBFA 1E6MA 2X1MA 5BNIA 5JSZB 4D4XA 1TA4A 3HYCA 3B0UX 1FS6A 3NAMA 1KC3A 3STVA 1XCOA 5AVWA 3ZE1B 1P5RA 3E5RA 2XGGA 5AFSA 5HHTA 1PFGA 2JGMA 4K88A 1A5SB 2VYVA 4KE7A 3PEWA 4KKVA 5KJCA 2WKWA 3LXUX 1LBSA 1QO0D 2AI3A 2LBPA 1T3TA 2ZRQA 3H9BA 3NC0C 1HSOA 1NUQA 2VF4X 4RHCA 3ZHCA 3ZQ4A 4LF9B 4GX0A 1ORJA 1SUCA 1RYZA 2OBFA 4ZLCA 3G8CA 3JQGB 1U9IA 1OCRC 2J9YB 1NMYA 1V4NA 1PLKA 1D2GA 4H31A 1HE3A 3WJAA 3C3DA 4JBHA 4NCKA 1VHTA 5DU2A 1NNEA 4HL6A 3I92A 4O8ZA 3RBAA 4O02B 1OGIA 1E4OA 4LXYA 4IDDA 2GBPA 2Y2VA 5HKAA 1CZNA 3RAGA 2QNIA 3UB2A 1ZHZA 1W1IA 5HQ3B 4MQ9F 5F5HA 1NXXA 1TTHA 1BYIA 1CYDA 1FU4A 1ZN2A 2BCGY 3KOUA 4OYHA 1VBMA 4ARZB 4YIHA 3ZIAA 1CD5A 3HUFA 4AN1A 3BDVA 1OE0A 2CJWB 1E0KA 1HGXA 5CLJA 2B8NA 3GWNA 2R9RB 4YNBA 2A0UA 1RCUA 3HJTA 2VOJA 5BQPA 2R3SA 3EVGA 2G3YA 4EQZA 4Q24A 2R8EA 1UEIA 3CX8A 4FONA 4WVFA 4ZOLB 1B0PA 4KO1S 2C7PA 1NSYA 2WJ3A 1BXZA 3E9ZA 1ZIOA 5IDWA 5DT9A 4ND1A 4DV6B 3G2LA 2R751 4TLLB 3OCJA 4W8OA 3KSBC 4KPFC 2PZFA 5AKKA 2P30A 2PZMA 1RMVA 3OVMA 1RWWA 3MLAA 2OPBA 1T4CB 4CL8A 3FSGD 3D7LA 2REQA 4OEHA 3T7IA 1N33B 4E09A 2YJNA 5AP9A 3EMBA 3M1IA 3NWPA 2ZBVA 4Q3NA 4A0SA 2REOA 2RONA 3A2MA 2JGJA 4KUGA 1IN8A 1JLKA 1BR1A 3OD5A 4CV2A 2FP4A 5JLJA 4JXXA 3U56A 1Q7CA 2C95A 1CDDA 3SKYA 1VLJA 2EEZA 2ZIEA 4GQBA 4XAQA 4YL1A 3LT0A 1MXHA 3R3HA 5CTJA 1U8AA 3HKDA 4UMFA 2WJ4A 3BOSA 1VKRA 2AN1A 4DDHA 2Q1XA 1QZ3A 4DARA 1ULUA 2I7VA 3RI3A 3CNOA 4NE9A 5FV7A 3MHPA 1IG0A 4CKEA 1FA9A 5IANA 1VFPA 3KSAC 4MUGA 2DLCX 1VHLA 2XZOA 4BMYA 1GVNB 5JFGA 4HMOA 2QLAA 2HJGA 4Z7QB 4GSYA 2ZVJA 1A71A 5CLHA 1ZI8A 3RVKA 3GJ3A 2EZ8A 2PMCA 3H5LA 3M5WA 3QVGB 4FC7A 4RHYA 3RVDA 1A96A 4KUHA 3SKXA 1MC1A 1UXIA 1A1SA 4MQFB 4RU1A 3RTBA 1I4OA 3UG6A 3VJRA 4B3DA 2JLWA 1JEDA 3OJFA 1F12A 4EVIA 4ZAZA 4PX9A 1Q0TA 2AFRA 1LSUA 1GS9A 3ZHSA 2Y9MB 4PNHA 3URKA 2X40A 2EJWA 3UMYA 3G0OA 5T3YA 5E6RA 2F90A 4I5IA 1P44A 4CMKA 1MO4A 3ZU5A 2R65A 1DE0A 1EM6A 3TE6A 1JQBA 3AUYA 2A3NA 3CRMA 3G9XA 3IYLW 2HDNB 3LFUA 4CIXA 1R4NB 1TRKA 3C3XA 1BS1A 3JQ8B 4UBJA 2JI8A 2R7WA 4LJ5A 2NZJA 1JMWA 3SC2A 3O1LA 1DX4A 3JAWB 3NHSA 1NYQA 4GEKA 5FUVA 2BH2A 1P5JA 2QX9A 4FCTA 4X64B 3EDOA 1RKEB 4IXMA 1FX0B 5IULC 2C7QA 1MEEA 1BSVA 4YRSA 2C8KA 1ZI9A 5KOJB 3O9ZA 1P77A 3QELB 4JMPA 3EPHA 1EUZA 1NTOA 4HAIA 3F5MA 4KRXA 3V42A 1LE4A 3KYJA 1Q0LA 2NVBA 4YPOA 1G4WR 2ZYGA 3P9CA 4WN3A 5DO9A 4R2KA 2CDRA 5AKLA 3CZRA 4BNJA 1OXBA 2RJNA 5C7IO 1ONBA 1YULA 8ABPA 5MFPA 4NBTA 3KZOA 2DXIA 5DNWA 4XCXA 2V7BA 1RKCA 4I55F 3VKWA 3E48A 3EISA 4XQGA 4N3CA 5DHSA 4TYNA 1XK7A 5A0VA 5C1OA 1Y9JA 3WGUA 1KI1A 2ZXPA 3I6QA 4K9OA 3PQ2A 2YRXA 3NIWA 3A4TA 4YMSA 5F52A 5GIPE 4F12A 1N32B 1P4RA 3MTEA 5EKUA 5BSWA 4K3UA 3JQ9A 1ORHA 2C03A 1LE2A 3QUSA 4X66B 2QQEA 2X8BA 4H1UA 1TMKA 4RZUA 2O8CA 1D07A 2XSEA 2XQKA 4TWRA 2AJTA 3B71A 3QI7A 3MBGA 5AVQA 4I5DA 3QJ5A 4D0SA 1RVDA 2QLNA 1UP7A 2UZ1B 4LLCA 3HKEB 3O6VA 4PGMA 5DTQA 1FSFA 2XT9A 3RS7A 3H2KA 4F96A 5DNYB 3HY6A 4FLFA 4L9SA 3GODA 2W2KA 1L5ZA 4CCAA 3TRFA 3KELA 2WQ6A 2Q2QA 1RXEA 2Q4EA 1QP0A 4TZ0A 1NC3A 1P9OA 1RS0A 2OWDA 2QD2A 2P3QA 4HQ0A 4V0NA 5KNCA 2C9CA 1K4MA 3PFGA 4OHYA 2G9VA 3DUFA 1N6OA 4PO1A 3K1IA 2BLNA 3EYAA 4M36A 4MMYB 3WK6A 1MMFB 1UMCB 3AK4A 3KYDA 3AKZA 3W04A 3KAPA 3LCMA 1SY7A 3PQCA 3OHSX 1KYWA 4LZNA 5BNTA 3GUCA 5AJXA 1WKCA 1ZA2A 1ADGA 1NBBA 3B1YA 4Z3OA 5FI5A 3M82A 3V55A 2AN3A 1QP8A 2FJUA 4PAGA 1AK1A 4PSCA 3DF7A 1HRDA 5TLSA 3LEOA 5AVJA 1LK5A 2XUZA 3DE3X 1IQUA 3BD6A 4QQKA 4QQNA 5A71A 5B2FA 3KQOA 2OHGA 5DGHA 1D4OA 1IN7A 3LS2A 3MJEA 1QO7A 3A10A 1OX5A 3MJSA 5IMBA 4AG5A 2Q9CA 1Y8RA 1ZRHA 2XM0A 2XRYA 4C0HA 3A3PA 4R2IA 5DBFA 3X2QC 1N6PA 5AR1A 1XCLA 1JAIA 4E7OA 5C4IA 4NZZA 5IHXA 1Z73A 4G4GA 3KQKA 1L7QA 2C7VA 3H7AA 2PXHA 2X7JA 2YFKA 4CF5A 3S0XA 1T13A 4ALLA 1EXMA 1SD2A 2B1JA 2Q50A 4I6EA 2VHUA 3IR6A 5FOXA 2DBQA 3NP7A 4EQ6B 2NACA 1Y1PA 2QL6A 3HWX1 1QYVA 1F2UB 1KPGA 3JR3A 2IE8A 2GBCA 3OJ0A 4ONSA 4M86A 4OHOA 3PXGA 1KQGA 1UWKA 5DM70 3GUUA 4MHSA 1L4EA 3JVUA 4JGBA 3U3MA 4BKRA 4L78A 1TRHA 3ED5A 4DABA 5C53B 1I2MA 1WDLA 2IZ1A 2Q5HA 4JQZA 1C3JA 1EQAA 2XITA 1VPWA 1QAOA 1YDGA 2I2AA 3ELDA 3IVCA 3P52A 4R05A 3PJFA 1O95D 5FNVB 2EV9A 4Q3DA 4QHYA 1VOTA 5P21A 2OV6A 1L7RA 3TR5A 1T1SA 4PIVA 3N74A 3QITA 1RDFA 3IEIA 2IQIA 2RBGA 4ZCQA 4O4HA 3S8EA 1GO2A 3E3MA 4AP5A 4QGGA 3A58B 3NHWA 3SBEA 1QB7A 4HSEA 1KBQA 4LGYA 4DGQA 5F28E 4LS3A 1PNQA 2Z8YA 1PK8A 3WSWA 5JPCA 1N4DA 4K46A 4KGXA 3EH1A 1NX9A 2CXRA 2PRSA 2A84A 5FYQA 3A1EA 3C14C 4X9XA 1TJ5A 3W4IA 3VR5D 1CY7A 2O7VA 2WZBA 5ALTA 1P0PA 2VJMB 2AG5A 1M72A 4HMQA 4V0QA 4I08A 1HNNA 3O4RA 4ZOLF 1HPLA 2UVDA 3R3UA 4Z9FA 1ETHA 3KKNA 3L6RA 4ZCLA 1QIGA 2GZAA 3FCXA 3WKDA 2X9LA 2YW9A 4AIIA 4EYSA 5EHXA 1F2DA 2O2ZA 4HN2A 4P3PA 4QA9A 2G70A 1AQNA 2XUJA 4DLRA 4IPTA 2J3EA 1IDOA 3HN2A 2FDCA 4P4SB 1Q1GA 4E0IA 4M0LA 5IJWA 4D3ZA 4W8HA 1J2YA 1UC4B