2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSY
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
3RS4A 4RD6A 3MD0A 4M9QA 4NCJA 1FOEB 2VRWA 3EASA 5DHFA 1XEWY 1CJVC 4UNQA 4IDNA 1ZD8A 2KI5A 1IOZA 2D3WA 2IS4A 1DEKA 2ZUBA 2JLRA 3RS3A 1VECA 4DCUA 2O8EB 4PHHA 3DPUA 5FBLB 1W4RA 2ZE8A 3B1VA 4IFEA 2BJVA 2HT6A 3NEJA 2P5TB 3FKSA 2N1BA 2BC9A 4RD1A 5EXSA 4M4SA 4PQYA 2AD5A 1TPZA 1A2BA 2GVDC 1MO4A 1TX4B 2YOGA 5EE3A 1FNNA 1KJYA 3AKYA 3KKQA 4WOPA 4US2R 2OZEA 1U0HC 1E2HA 1V5WA 2IX3A 3THXA 2EW1A 1VTKA 3IBYA 5J4KA 5GJWC 1SGWA 4OJQA 4A36A 4DSOA 3VNUA 3FHTA 1G8PA 3U7EB 1KY2A 3GLIE 4F4IA 1A1VA 1QHIA 5E7JA 2O8CB 3WBJA 2FFQA 4V02A 3KXIA 1NLYA 3TQCA 2ZI3A 4B34A 2BM0A 4BECA 2VBCA 3SE0A 4GOKA 2CL7X 5DNYB 2F55A 2XZLA 2FG5A 1VIAA 2QP4A 1R10A 2ZJYA 3BB1A 3PR1A 1PLJA 2O0KA 4JJKA 3MSXA 4D4KA 4EJSA 1ESNA 5FFMA 3THYB 1B23P 1E32A 1KI2A 4MUBA 4YDSA 3GLFE 1G20E 4ZI2A 2XZOA 4C0QC 4U00A 5DN6A 4A9AA 2RGEA 4H1VA 4ESHA 2C95A 3G82C 3GLGA 2JLVA 4TT3D 1W47A 4LJ9A 5BW8A 2Q0HA 3MFYA 4LJ4A 1VG1A 1M2OB 3TSOA 2F1JA 3PITA 1HEIA 4QJ3A 3KQLA 1ZMXA 3V4FA 2C2HA 2FGKA 4TYQA 4MQBA 4HLUA 3IO5A 4TMKA 4LPSA 5JJKA 2IYYA 1K8RA 2WHXA 3MWLA 1OFHA 1GL6A 2RGGA 4P3YA 2EWVA 3Q72A 4ZKEA 5HR5A 4TYWA 5P21A 3TUZC 3TVDA 3KB2A 2HF9A 3DEFA 3B85A 3BOSA 2NGRA 2WKQA 3BJIC 5BQ5A 3EX7C 1II9A 2I4IA 2Q9AA 2ZVPX 1RRFA 4ACAA 5EZ5A 1TL7C 4IOLA 5FUYA 1DPFA 3CWQA 3SNHA 4ZKDA 1GNQA 1ESMA 2JA1A 2CL6X 2F3RA 1H8ED 2EQBA 1G6HA 4FD2A 4UNSA 4D6PA 2WWHA 5DE3A 1UEJA 4M22A 1NJFA 2J0UB 2PL3A 1AQUA 3NTUA 3QUSA 4DLUA 1R0WA 4M8NE 2CJWB 4IW3B 1KDOA 4A1FA 1LNZA 1U98A 4MYTA 4DWJA 4TQUS 3ZQJA 2WAYA 4AYWA 4G5RA 5AUPB 3BH7A 4C0JA 2JEOA 4QHSA 2CLSA 4XH9B 1SVIA 1V43A 1ZW6A 3BH0A 4FMCB 1Q20A 3I8SA 3AF4A 5JS7A 3FKQA 4AI6A 1NIPA 1E2GA 2Q9BA 2ZJOA 3GFOA 1Z83A 3SBEA 2QZ4A 3LNCA 3AB3A 3I5XA 4UNRA 1JR6A 5KYKA 1XPUA 1D2NA 3QXXA 3K0FA 3WMFA 3RRYA 3W9YA 3NVAA 4B43A 5K8TA 4HAWA 2BDTA 4LBYA 5L3SA 4CEHA 1I4TD 3T1QA 4D81A 5JSZB 3U4QB 2HLDA 2Q3HA 2H1LA 2WJJA 2ZPTX 3R7WA 3T06B 3ADDA 2NG1A 1SXJB 4ILEA 3L0IB 4TZ6A 4AG5A 4RZ3A 2GHIA 2IYQA 1GKYA 2IEZA 4M9SA 1SKYB 4V0MA 2ZS8A 1Z28A 4G0NA 1GITA 5EE5B 4E5UA 1WA5A 1ZNWA 1TF5A 2GJ9A 2DR3A 3N5CA 5FTMA 5EUQB 2XOKD 1WMSA 3NBYC 3TMKA 3VU9A 3AH8A 1UKYA 5SZKB 3Q8XB 2E9SA 5J4VA 2J1LA 2QAGB 4QHYA 3MJRA 4YLGA 3SYKA 4BLPA 3WHKA 4LJ6A 1N6OA 4V0OA 4C0KA 2WM9B 3IEUA 1KI1A 4S35A 5J40A 4TL8A 2J7PD 1BYIA 4TMZA 3P26A 4KHZA 3REFA 1N5KA 2VSOA 2ORVA 2NQ2C 2CVFA 3Q5EA 1R0XA 4G01B 5HTKA 2F43B 2ZRFA 3WNBA 2J45A 4GPTA 421PA 1CF4A 1IY0A 4JLOA 1R5NA 3K0AA 1E2JA 3GJ7A 5BXQC 3BE4A 4IVQA 4AY2A 4G1UC 1N6HA 2OILA 3AM1A 1T8UA 1M1YE 3PEYA 3T12A 1E9RA 3OAAD 1XP8A 4RZXA 5FL7A 4LBZA 4QBFA 1O87A 3ADKA 2ZE7A 3P27A 3LA6A 4ZCMA 1LB1B 3TNFA 1N6NA 4DJTA 4HUQB 1LF0A 3L8YA 4F91B 4OI0A 2C9YA 3SEAA 4PQRA 1E4YA 1R5OA 1WQ1R 3FKSD 4PO9A 1ZM3A 2LKCA 1X8JA 2OCPA 1G1MA 1F2TB 2VHTA 3GLIB 2ZVQX 2O8EA 1R8QA 3PUWA 2ZS9A 1UDXA 1NIJA 1E79A 5IHPA 3D8BA 1QHNA 1ZVQA 1SHZA 3QKRB 4JS0A 2CHQA 2CHGA 3NBZC 1JXMA 1GG2A 1ZNXA 2BVNA 4LJYA 2WZQA 1OIWA 2V6JA 3NWJA 2P6RA 5JWOA 2QBYB 5FUVA 5HKKA 4XVRA 2Z5FA 3T1OA 1N25A 1Z0IA 5BN3A 3UG6A 5DI3B 3MRSA 1SKQA 3GLFB 5JRJA 4JVLA 1CULC 3ZZUA 1ZCAA 3I4LA 2OSBA 5KDDA 1E96A 2IXFA 3BORA 3K0SA 2CCJA 5E7IA 3CM0A 2RGXA 1FUKA 3CH4B 1Z6AA 3JVUA 3WY9A 3IIMA 2O8CA 1J90A 4XIGS 4F38A 5F98A 2D7DA 2P67A 2GXQA 2GTPA 1P6XA 4DRZA 1Z06A 2X1VA 1N6RA 2XJ9A 3B1WA 2J87A 1D9ZA 1ODFA 5DN6D 4FCWA 2GKSA 2QPOA 1YZQA 2ZSBA 3THYA 3ICQB 1ZNZA 4V0LA 4N1AA 4Q47A 2QAJA 4NBSA 1LS6A 5AJZA 5FBQB 2B21A 2I3BA 1VCMA 2PX3A 3QNUA 5HZHA 1KSGA 1KI8A 4R98A 3BFVA 5J47A 5E4FA 3LW8A 1L7VC 3MG9A 4PSKA 3W5IA 2JIZA 2VEDA 3B78A 2OE2A 3K8YA 3B60A 3W5JA 3NDPA 3L43A 5B58C 4N0EA 2KBFA 3U3RA 1ETUA 1F5NA 4UKDA 2EFCB 2QMOA 4GP7A 1VKJA 3SJZA 2PZFA 2CLCX 4Z54A 2X19A 1KK0A 4IDQA 1XCPA 4UJ5A 1YR7A 1T3HA 1EX7A 4ZI3A 5FUXA 3RWMB 2ZYWX 1IQPA 2HDNB 1LVGA 2P0EA 1QRAA 4BGDA 1UF9A 1XMVA 1IONA 5C46F 2REOA 1MRNA 2EFEB 1YZTA 3RRMA 5DSZA 3OIWA 4PO1A 5FBWB 1HQCA 1R2QA 2W6JA 2ZITA 3HR8A 4IVRA 2FOLA 4GOJA 1LTQA 1U2RA 3QXSA 3L2OB 4KVAA 2WSMA 3N70A 4EPYA 4U02A 1D2EA 5DHAA 5FBRB 4Q4HB 3TR0A 1DO2A 2OLKA 5EXXA 4NP6A 3RSLA 1U99A 5CB6A 3B1XA 3LBHA 3CRW1 2J0UA 2W83A 1X1RA 3RSOA 2CJWA 2Z43A 2BMJA 1VPLA 2W2TA 5HPYB 1IJEA 4ARZA 2QMHA 2AD1A 4NYMQ 4HZIA 1HE1C 4AC9A 1COWA 2FDCA 3OEHA 2AKAB 3LLMA 5G41A 2QU8A 1H8HD 1ZBDA 2X2EA 1M6NA 2J0VA 1W2GA 1YRBA 1E6CA 1QHSA 1T6NA 1E9SA 1KSJA 1ZP6A 2ORIA 3M0EA 4D26A 2EFDB 4KJZA 3T1TA 5JWRA 1JQJC 4M21A 4CIDA 1NSTA 1MO5A 4RJLA 1IBRA 1UKEA 3WNDA 1D8TA 2NIPA 3G5UA 1S8FA 2QTFA 3WP0A 1JALA 2C9OA 2YOHA 3I72A 3VNVA 3GD7A 3FMOB 4WIAA 1Q21A 4AKHA 2FA9A 4I1SA 4KSCA 5F9FA 1RW4A 5JSZA 4KYUA 2WWIA 2ONKA 2ZEJA 4TN1A 3U4QA 1JPNA 2DYKA 4CF7A 2N42A 2ZR7A 2OCAA 2BMEA 2R6DA 2ZROA 4C7OB 1CRQA 1SXJA 2LKDA 4MDFA 2VH5R 2PEZA 1L4YA 1K5GA 3LVQE 4HAXA 4LC0A 1ZM7A 4OQFA 1RYFA 4ITRC 3I62A 4OHXA 2BHRA 4NCNA 3FHOA 3FMFA 1JJVA 3VTKA 4B2IA 1OJLA 3A1TA 2IYLD 3ZVNA 4OK5A 5CDFE 2QL6A 4PAQA 4C3ZA 2IUUA 5KTYA 4TYYA 1G5RA 1KJWA 4G5SA 4A6PA 4BLSA 2QAGA 3OIUA 2D7CA 2VHJA 3U7FB 3GJXC 3W6OA 2J0QA 3GLHE 3U44B 3NC1C 2QRZA 1X86B 2PX0A 1GOTA 5KPDA 2J3EA 4RZUA 3PUVA 2W58A 2J41A 2WIBA 4Z8YA 1W36B 2BKEA 3AKEA 1KI4A 5AR1A 2W0MA 1Y3AA 2B7BA 2F43A 3GFTA 4A4DA 3V9PA 2P6NA 3TJZA 5FOVA 5FL7D 2ODEA 2GK7A 2C96A 3A4NA 5LDDC 3BB3A 3P20A 1WP9A 3AVOA 1NG1A 1UEIA 1YR8A 1NMYA 4KYIB 1ZU5A 4TLEA 3OEED 2W6IA 5KUTA 4LSGA 2OHFA 4HUQA 1N6LA 1T0JB 2CK3D 2B7CA 1F2TA 1P2SA 2G77B 3GLIA 4EPTA 3CLVA 2C03A 4BFUA 3TSWA 2RH5A 3NHBA 3BH6A 5HKKD 1OFIA 3QKRA 3UMFA 5GJCA 1G8GA 3QI2A 2IXGA 4MYUA 4BLTA 5K8IA 5F9HA 3RC8A 3CZPA 2QBYA 5A5GA 2PH1A 2QSZA 2NO0A 1OF1A 3QF7A 4FCVA 1C9KA 1TEVA 2VP4A 5FL3A 5HE8A 1IY1A 1P9WA 3A1SA 5B2ZA 1SVMA 4XOIA 4BUJA 2ANCA 1E0SA 4LHVA 1QHXA 4O2LA 3IHLA 4KFUA 5DI3A 1R0ZA 1KO1A 2VF7A 3CUEF 4HLQB 4LHYA 3GLFA 3PJRA 4KU4A 3DMDA 2EVWX 1CR2A 1WE2A 2ZREA 4FN5A 3THOA 3BIFA 3DM5A 1W48A 3PVSA 1J2JA 1XPRA 4TSFD 3DDCA 2RKOA 4MUAA 1E2FA 4M1WA 3ZGXA 3FMIA 1D5CA 3W8NA 1G3QA 3PXGA 1XTSA 4ZCIA 2DWQA 1G18A 5AJXA 3R9XA 2BCJQ 4PHGA 1BOFA 1PUIA 1Z47A 3KKMA 4MRSA 2CCKA 4PAMA 4HATA 5CITA 1TMKA 3QJYA 2AFIE 1PLLA 1OLOA 3Q5DA 4GI7A 3UIEA 4B71A 2XTMA 5AJVB 1XPOA 3ZLJA 2NO9A 2NZ8A 3TSZA 3BC1A 1SULA 4MGKR 4HDCA 4FIDA 1XD2B 3NEYA 4CEJB 2Q21A 3T5GA 1GIAA 3ASYA 5TY0A 2F6RA 4G3XA 3K9LA 4KLZA 1Q1EA 2YV5A 4PHTA 5CYPA 4K46A 3AF1A 1HH4A 5KSPA 5UKDA 1O3YA 1U94A 1SZPA 5KDLA 4C0HA 1W36C 1XTIA 3BD9A 1TF2A 3QG1A 1N6KA 3TR5A 4BRWA 4JT2A 5CYOA 3SZRA 1FZQA 2F1IA 2IHYA 5B64A 2PZEA 2SHKA 3O47A 4BE7B 3K0CC 1L2TA 2RGAA 2WKRA 2FFHA 3IKJA 1CRPA 2W6JD 1RPZA 1N5JA 2FWRA 3R9IA 1TADA 1IN7A 3CNNA 2A7QA 2ZI4A 1OIVA 3KX2A 1JAHA 3RS0A 2QUZA 1AS2A 2YWFA 4XJXA 2RB4A 1XWIA 3CX6A 5TARA 1W0JA 3WNCA 3F5FA 5E95A 1SVOA 3FGNA 1S96A 4ARZB 4P0TA 5C18A 5IK2A 3CIOA 4Q4HA 2A2ZA 3A1WA 3DZDA 3NC0C 1NN5A 2ZJ2A 2GK6A 4BWYA 4R2IA 1A7JA 3OEHD 5JJIA 1ZJ6A 1DAHA 2B92A 3O8DA 3ND8A 4DCTA 4GT1A 1K6MA 3VFDA 4B2PA 4EAQA 3U2QA 1KGDA 4JKIA 2VIIA 3AP2A 1NVWQ 4W7SA 2JDIA 3CRQA 2IYWA 2GILA 1AGRA 1YQTA 3CRRA 3KJHA 4B32A 3AF2A 3SYNA 5H1YA 2RCNA 2JLYA 2G88A 4AYXA 1AS3A 3BK7A 3CPHA 4A2QA 4KSBA 3E1SA 4JSTA 2WBLC 5DI9A 5ELXA 4OJKA 2QORA 4FCTA 1JXOA 4ERNA 3QG5A 2KE5A 1ZUIA 4DLTA 1M8PA 2OV2A 4Z1MD 4P33A 1MH1A 5B30A 2VSFA 5G40A 5GADl 3AVUA 4N0DA 1G16A 1OSNA 4YMSA 3HJNA 1XF9A 2ZRGA 4IDOA 1SXJD 3L8ZA 4BQSA 1ZIOA 3T5DA 3GLHB 1ZM2A 3L0PA 3RLFA 1OHHA 3FB4A 4L5BA 3SJBA 4BFSA 1AZSC 3SYLA 1NMZA 2PMKA 1U9IC 2GA8A 4LOAA 2GESA 4JT4A 1EFHA 4C7OA 4TLCA 2NPIA 1CR4A 2ZJAA 3E2IA 4Q4AB 4GMDA 2XJ4A 1S1CA 1TQDA 3X2SA 3VKGA 1F6BA 1TQ6A 2IYUA 3EAQA 4AKEA 3OAAA 4LC1A 1KJZA 3D7MA 1NRJB 1ZM9A 2BCGY 4GOXA 3FMPB 2Y8EA 3LXRA 4I81A 2ZI7A 1E9DA 4NCKA 3DVLA 2A5JA 3PCRB 3K1JA 3U44A 4Q03A 3HU2A 3IIKA 3WMGA 3FPAA 1T4GA 4ZCLA 4DSNA 3DOFA 3MLEA 4JL5A 1KHTA 3X1WA 2XGJA 3F3YA 1KZGB 3JZAA 4JMPA 1F48A 4KXFB 2BV3A 4W9MC 2RGDA 3D3QA 2ATVA 4QM6A 3O8RA 4PZLA 1NJGA 2D2EA 2HV8A 3I5YA 1OH6A 2VPPA 4PPFA 3FE2A 3K0CA 4DSTA 5KOYA 2ZRLA 4CT5A 1RRCA 2GZAA 1NN1A 1UBEA 2GF9A 3OIVA 3TIFA 4G5QA 2W6ID 1KI9A 2DPXA 1G7CA 1W44A 4DCNA 3PFIA 2WJVA 1NVVQ 4PC3A 4RSGA 1JAIA 5FOWA 4B35A 3CR8A 1KO5A 4S2EA 2RHMA 4PPNA 1J8YF 1CJTC 1Z63A 2ZYVX 3QE0A 3QPVA 1BMFD 1W5SA 1XEXB 4D25A 2VA8A 1HA3A 4DLXA 5FR2A 3Q3JB 1RE0A 2GDJA 4URWR 4ZPXA 2C5LA 3W3AA 3EG5A 2L0XA 3H0KA 3WRYC 1OH8A 3HDTA 4GMXA 3U3KA 1G64A 1NVUQ 2XZPA 4HI0E 4BZPA 4GZLA 4PC2A 2CMKA 4C0SA 2GBLA 1E9BA 4E03A 3RNLA 2QG6A 1U0JA 1Q1BA 3KFVA 4KCGA 3LD9A 4PHFA 1CTQA 1PJRA 5CB8A 4JVNA 1GVNB 2ONJA 4C2UA 1NY5A 4BZQA 1VG9B 5C4GB 4DUGA 3QVVA 4HB3A 4M1KA 4ASUA 5FTKA 2WIAA 2ZU6A 4KODA 2ZJ8A 2XTZA 2EFHB 3MGCA 5JHGB 1EK0A 2Z6VA 5TVKA 4UQOA 2MMCA 3AUYA 4M1OA 4YMVA 2GVZC 2IL1A 3SN6A 1U8YA 2EU8A 1FMLA 2A9KA 1U9IA 3EC2A 1OH5A 1W4BA 3EIHA 1GM5A 3QENA 4OHZA 2ZE6A 1GNPA 1RZ3A 5EUMA 4DDVA 1OFTA 3QF4B 1GL9B 3S1AB 5FPTA 4MRRA 5KSOA 4AIIA 1G7SA 2DY1A 4CEIB 4B75A 4AG6A 2IWHA 4A15A 3ZQ6A 1P2VA 3SQXA 3IO3A 1MOZA 1N6IA 1XD2A 4RZ2A 1IXSB 4CEJA 1CJMA 4JLPA 5CIWA 2AHOA 3W6PA 3KDSE 1OXUA 2IYXA 3LWNA 3KUCA 3CF6R 2CE7A 1C1YA 4KV9A 3MUFA 3B82A 3ICEA 1XXHE 4GDFA 2WICA 4MKIA 2QGZA 3PENA 2OBLA 2QM8A 3EPHA 1G3RA 721PA 2A5YB 2IUSA 4HDOB 1Z22A 1UKZA 4Q1FA 1A4RA 4HEJA 3K70B 1JR3E 1H65A 3QPWA 2MSCB 1XX6A 1IXRC 1Z8FA 2CBZA 2JLZA 4TTPA 4IOKA 3TUJC 3WYFA 5E3HA 2AWOA 1JR3D 1DAFA 1N5IA 1KSHA 1W0JD 2YZ2A 4Q1CA 1H8HA 3IPXA 2ZRDA 4CGZA 5CK5A 1KDRA 3ZH9B 1E3MA 3EZ6A 5IK2D 1M7GA 3FOZA 4YXWA 3V4RA 4OK3A 4QGHA 4OQXA 1GILA 5FOXA 1HUQA 3H4MA 1UM8A 1OPXA 2JJ8A 2LCFA 1ZU4A 1IY2A 1VYTA 2QROA 1P73A 2QMUA 2XNSA 4IDPA 1P72A 2ASEA 4X8MA 1LF5A 1E2LA 1XD8A 2JDID 1UBCA 3AVYA 2JLQA 1ZIPA 2CNWA 3N2EA 1T91A 1RIFA 2OUKA 2YYZA 1Q12A 1U90A 1Z0AA 5B57C 3GJ5A 3LAWA 1IN5A 1HTWA 3CONA 2KBEA 2QT0A 2IF2A 5D3QA 1NKTA 4AKGA 3ZVRA 4URYR 1CXZA 1UBGA 3OE7D 1KNQA 4TLDA 1II0A 4B33A 2JJ2D 3SHWA 4MGIR 4D2IA 3C41J 3TAHA 2OAQ1 1OHHD 1R7RA 5CDFA 3TLXA 1VHLA 3C7KA 3TKLA 1Z6GA 3KB1A 2XAUA 2BIFA 3QEJA 4DB2A 2DB3A 1RC8A 4JBYA 1JQLB 2FNAA 3FDIA 3ETLA 3GLHA 4JVSB 1WCV1 2ZR9A 1E9AA 3KQUA 3KKOA 1EFUA 4TYPA 4DB4A 5FTLA 1KAOA 1KO8A 3WHLA 1ZD9A 1EWRA 4URZR 5L3RA 1NP6A 1VCIA 1S4QA 2FU5C 4Q9IA 4Q4AA 1YZNA 3P4XA 4LRWA 1G6OA 2ZRCA 4HAUA 4RFVA 1E9FA 1I4DD 1E2PA 1Z0DA 5EP3A 1FPMA 3T35A 3ECCA 1OXVA 2YWGA 4RCYA 1FL9A 3LDAA 1TUIA 1EFTA 1T3LA 4PC6A 4EDHA 1MT0A 2JCSA 2WSSA 4HB2A 3LXXA 1KKLA 5EP4A 2FJUA 4JSYA 3E5HA 3TAUA 2WWYA 3A8TA 1W36D 3OEEA 2QEQA 4PPGA 3X1XA 1JEDA 1QVAA 2R8RA 1TAGA 4DHEA 5IT5A 1TEXA 2VF8A 3BERA 1I2DA 2CK3A 1US8B 1JBKA 2QPAA 5C2JB 3MWYW 3UWOA 4DCVA 3DKVA 2QENA 1AZTA 4DLRA 3H2YA 2GEVA 3NH6A 2VSXA 3ZS8A 3K70C 2ZRIA 2F1RA 2IUTA 3HYTA 4OI2A 3CB4A 1IXZA 4II7A 2X2FA 3MCAA 4P4SB 2HXYA 1PVOA 3B7GA 4CT4B 2QTVB 4OHVA 5CM8B 4B3BA 3GPLA 2WPDA 2XITA 2ZSDA 3RS7A 2ZRBA 3KJIA 1QG2A 3EWAA 4C0BA 4FMBB 3ZZTA 2E87A 4B3CA 3KXLA 3LQRA 4US1R 2GXAA 2CHVA 1TQ2A 2VYFA 1BKDR 2V55B 1NN0A 1RVDA 1LS1A 4F92B 1HY3A 2B8TA 5TMPA 4QC2A 2FMXA 4HUTA 2DWOA 2AN9A 3C15C 1GAJA 4E22A 2A5FA 5JLJA 2AL7A 1XEXA 4M1TA 4Q18A 1P62B 4L8GA 5FR1A 1SXJC 3EZ2A 4L9WA 1OXTA 4TSFA 4XSGA 1XTJA 4JYBA 2NTYC 4JL8A 4QBHA 4A0HA 4BEJA 4DZZA 1TF7A 5EP2A 3CWZA 3H86A 1UDWA 3ZVMA 2ZRAA 1DE0A 3PUXA 1ZD1A 4QL3A 4NYIR 3T15A 2RGNC 5LBIA 3A36A 4DUGD 1XBTA 4ASUD 1IAQA 1P3JA 1X3SA 5HCNA 4DXAA 3R9WA 5JCPA 4JLDA 2QAGC 4NTZA 2DHRA 2D74A 1OYWA 4NYJR 1YKSA 1KK3A 2QP3A 3SJCA 1I4LD 4L16A 1VYUA 3WBKA 4WVFA 5JBQA 1E99A 1EXMA 3CX8A 4JLKA 3IHWA 4NKRA 3HWSA 2QRNA 1DBSA 1UADA 1KI6B 3WRXC 4YMUA 1G8YA 2WWXA 2QNRA 4GZMA 5FI0B 2ANBA 4MITA 1XXHB 1G8FA 4OQLA 3U7HB 1AN0A 3G0HA 3QSYA 1GP2A 4DC9A 3BGWA 3M4YA 3MAAC 4MGYR 4RFSB 4LGMA 3AV0B 4JLMA 1P2TA 2OT3B 3K09C 1SVKA 3QF4A 3F0TA 1VG0B 3S1AA 1GTVA 2UKDA 4JJZA 3Q7QA 5DGXA 5G3ZA 4V03A 4CEIA 4GP6A 2GJKA 2P2LA 3AGPA 3DL0A 4OK6A 3SOPA 4C9BA 3X1ZA 4Q1AA 2XSZD 3VR6A 1U8AA 1XJ0A 1RKBA 2GWHA 4LV6A 2VP2A 2CVHA 4XTRA 3BRWD 4KBFA 5LB4A 1XTKA 2IA5A 4Q4JB 2O8BB 3E70C 4TLAA 4ZDIA 1HYQA 3AF3A 4A0GA 4RD4A 1F2UB 1S3GA 2FEOA 5FOSA 2V3CC 2XB4A 1E69A 2HYIC 1YZLA 4PFSA 2YWEA 3GJ3A 4X8HA 1XNJA 3A58B 3TE6A 1CLUA 5L3VA 2D06A 2ERXA 4OHYA 3F8TA 3SFZA 2FV8A 4D4JA 2VO1A 1DOAA 4QGAA 2A78A 4QOSA 4DLWA 4EIWA 1KZ7B 3AP3A 2FSFA 2HXSA 5FUWA 1P9NA 3SU8A 4CW7A 3SS8A 1FX0B 4YXWD 5CLQA 4MKFA 2FPLA 5EE0A 4OHWA 3VKWA 1G3UA 4AD8A 4JLJA 1SVLA 1XEFA 1VDZA 4H1UA 4Q4LA 2O8FB 3P4YA 1EFCA 1G5PA 5HCIA 4Z1MA 3VR2A 5DYIA 1FNMA 3PUZA 4Q9LA 5FTJA 4F4JA 2CNWD 1M7BA 2GCPA 1E2IA 2IYVA 2KB0A 2Z4SA 4HSEA 221PA 5F3WB 4P4TA 4TL6A 1ZAKA 4MRPA 3UK6A 2CL0X 2WKPA 4DDTA 1N5LA 521PA 1DAMA 1W0KA 3TW4A 3RANA 3IPYA 2OM2A 3LO5A 3QBTA 3SJAA 5JFGA 1N0UA 1IM2A 4BFTA 4TMTA 3CZQA 1GKUB 4HZUB 4UNNA 1Z2AA 3AVTA 3ONWA 4W5HA 3AP1A 5AUQA 2RGNA 4Q1EA 4Q9KA 4BASA 2VP6A 5E7MA 1YVDA 2PLRA 1XTQA 2X8AA 4DVGA 3O8CA 4ZIRB 2PT5A 1VG8A 2IBMA 2DFNA 3AVWA 5J4HA 3DO6A 2IHBA 3QIAA 1XCMA 3AVPA 4TLBA 5JEDA 2UVQA 2YOFA 2CLDX 2W00A 2CCGA 5FPKA 2GZHA 4ACBA 2ZUCA 4JYCA 4B2LA 1KIMA 8OHMA 1QHGA 3QVUA 5KPJA 2BEKA 4BRUA 4Q1DA 3ZYCA 1WBDA 2O0HA 2G9NA 1DVRA 1MO6A 1FTNA 2GCOB 4M1YA 4B76A 1G9XA 1KY3A 2QM7A 2ZS7A 3K09A 2VP5A 3C14C 4Q01A 4BLQA 4NDZA 2WTUA 2Q3FA 4D0NA 2WSSD 2IK8A 2V4ZA 2OEPA 1W1WA 1E2EA 1JPJA 3W8RA 4DIEA 4DLVA 3EPJA 1FUUA 5K8UA 1OYYA 5A4JA 2BBSA 2OAP1 4FXPA 1SVWA 4G5GA 3QKSB 3I92A 2GEUA 1E0AA 1CS4C 5BN4A 2I1QA 2JLSA 4EPVA 2ZM5A 3H1TA 3I61A 3BB4A 2RGCA 2NO7A 1BIFA 1BMFA 2VL7A 1N3BA 1X6VA 2WWFA 2XTNA 3SR0A 1US8A 5CLLA 4LPKA 2V8OA 3A37A 2FFBA 1FMJA 1U8ZA 1EFRA 3C5HA 1ZNYA 2WJGA 2YC4C 3WYGA 2WPDD 3IQXA 3QKUA 4TMWA 1Z0JA 3FYHA 4P4SA 3CX7A 1R8SA 1G3IA 3CO5A 4A2PA 4FMDF 2R65A 4MH0R 5GVRA 3A4MA 4EJSB 5M04A 3RDPA 2P65A 3V00A 4NPHA 2ZXUA 2OFWA 2JGNA 2P5SA 3LBIA 4JLBA 4XD7A 1P9RA 1CBUA 2QSYA 2ZI5A 2Z0MA 1DS6A 3PEWA 1YJ5A 1JJ7A 3BS4A 4GSYA 1EWQA 3GQBA 3D31A 2EWWA 3GFPA 4HYYA 3LLUA 3LBNA 1P61B 3TW8B 3B1ZA 2XNDA 4JLVA 2F9MA 1JNYA 1HV8A 1XMIA 1ZC4A 4JIMA 4Z8XA 5HZKA 1R5BA 4YONB 1VIYA 5KU1A 1QF9A 2FFAA 2G0NA 3P1JA 1RFLA 3RHFA 2JAQA 3R8CA 4BFYA 3EA0A 3FTQA 4LHZA 1JB1A 4N3NA 3OZXA 1JECA 1Z29A 3TGPA 3ADBA 1NSFA 1GRQA 4IXNA 4LHWA 5L3QB 1KO4A 2H16A 1KI3A 1AA9A 3U3MA 1VYVA 4TWZA 2H7VA 2ZAMA 2V54A 2FEMA 1MABB 4I1VA 4MRVA 4L15A 3VR5A 2EYQA 2J9RA 4P4UA 4EUNA 2R6AA 2ZSEA 4PAOA 1KI6A 2Q6TA 4Y0VA 1DG1G 1TU3A 1KK2A 3BXZA 3CR7A 2FZLA 4YQFA 1XXHA 2HCBA 1NBME 4NE2A 4TZ0A 3KKNA 1NVXQ 3X1DA 4WZ6A 4RFSA 5BYJA 3ND9A 5C4MA 3UWKA 3HU3A 4Q7MB 2GJAA 4XWAA 1UFQA 3B5JA 4H9GA 3RVBA 1JR3A 3C8UA 4QNMA 4F4CA 1CP2A 2G3YA 2REXB 1Q3TA 3EPKA 3A6PC 3GJ8A 2ZU0C 1DAGA 4LV5B 2BEJA 4EPWA 2O8BA 1IN8A 2IYZA 4Q4JA 4CVNA 4RVCA 1Q0UA 4URVR 4IDHA 4C4PA 1E9EA 1Z07A 1P4SA 2GJSA 2BOVA 2OBNA 4LJ5A 3K70D 1KMQA 2AKYA 2ATXA 3NBXX 5LPNA 5KO2A 4TL7A 3QPUA 3OHMA 4NHOA 2GBLC 1G17A 3TUIC 3VHLB 3K9GA 4ZDKA 2VHUA 1HT1E 4I1UA 1IJFA 4LZZA 1FTSA 1X8KA 1CJKC 4TTRA 1AJEA 5JI2E 1FW6A 2TMKA 1SHKA 4KLNA 3CNOA 4DT1B 1AK2A 2PCLA 1HQYE 3B13B 3RABA 4BFVA 1G291 3W3ZB 4Y0AA 1FX0A 1E2NA 3RAPR 1T8TA 4Q7KA 1K5DA 3Q9LA 4Q21A 2K5UA 1F3OA 1XJQA 2WOOA 3UMRA 4ZV4A 4B3DA 3OE7A 121PA 2JJ1D 3A4LA 3ZJYA 2O8FA 2BMFA 2JJ2A 3ZVLA 2WWWA 5DO9A 2IW3A 1N0WA 1W0KD 1Q1ZA 5J4YA 4IRUB 3J81k 4ESVA 4US0R 2YC2C 1F60A 1LY1A 1IHUA 5H8WA 3B9PA 2HYDA 3PIRA 1DG3A 4LJ8A 4EFNA 4DDWA 4WZAE 2FPKA 3ZDQA 4BLRA 4TQ9A 1G4UR 1GUAA 3SI7A 2CE2X 1Z5ZA 4HB4A 4HZUA 4A0FA 1U0LA 2OO7A 1JEEA 4IHQA 4KO8A 3GEHA 2O5VA 3IGFA 2N46A 2R6GA 4TYNA 4F7WA 1KTVA 1Z6YA 1Q57A 4PC1A 2AXNA 3FHCB 4ZIRA 2GXSA 2EYUA 4MYCA 1Z6TA 3BFKA 1G7RA 4AWXA 4E09A 1ONBA 1UBFA 3NBFA 2BBOA 4LHXA 5TB5A 4Q5IA 4P32A 3W6NA 1OB5A 3RWOA 3OFNA 3PV0A 3K9HA 1I2MA 3CF2A 1ZYUA 4V0KA 4AK9A 3KXKA 2QI9C 2IF0A 2A5GA 3CRVA 5FTNA 2NZJA 3IILA 2OCBA 4QJ4A 3QOFA 2GCOA 2Q3MA 2VQSA 3UMSA 3KQNA 2XXAB 1HT2E 4M2LA 2QMEA 4Q7JB 4B48A 4PR0A 5KSZA 3EWSA 3VX3A 1NY6A 4D82A 2C9CA 1JI0A 4M53A 4EFLA 3VAAA 1GFIA 1OXSC 1XZQA 3FVQA 3B1YA 3NG1A 1P5ZB 1Z6XA 3D6TB 1Q3HA 3Q85A 3QKSA 4Q00A 5AK0A 3WP1B 4A6XA 3U5ZB 4B44A 4EPXA 4LUCA 2NO6A 4A8JB 1VHTA 3SDZA 1EFRD 1TTTA 3DOEA 3FFBA 3AUXA 1WBBA 2GXUA 1XRJA 5FI1B 5LD2B 4XVUA 1AKYA 2ZRJA 4U7DA 1YE8A 2ZRMA 4ABYA 4W5JA 2ZJZA 4TL9A 1ZRHA 2YHSA 1DADA 5L8VA 4PQFA 3OESA 1E1QA 5GJBA 4LWZA 2VHCA 2O8DB 1OIXA 4BLOA 2YJTD 2ZJ5A 2CXXA 4XD7D 1S1MA 4AURA 3CKLA 4LBVA 2BWJA 1B0UA 3THWB 1EX6A 2AWNA 2IYTA 2OFOA 2BBTA 2HJGA 4JLAA 4QGGA 3REGA 4BEBA 2XNDD 1MV5A 5BWMA 3GJ0A 1XD9A 4NL4H 3L82B 1KSFX 4LJAA 2V6IA 1KAGA 4TQAA 2WV9A 1G3MA 3QEOA 1CEEA 2Z83A 1YZUA 1MR3F 2WJIA 2W0SA 1E2KA 1OH7A 1WF3A 3QXCA 1KMHB 5CM9C 3VMFA 2H8KA 1Z08A 4C30A 4LBWA 2PZGA 2R6CA 4A82A 1CU1A 4BFZA 4IEIA 2QY9A 2ZJBA 1NI3A 3JVVA 4F93B 1PZNA 4O2RA 5IF9A 4NH0A 1G19A 3I3SR 1FFHA 3IUYA 4JVMA 2YNMA 4CZ2A 2NO1A 5L3QA 4C2TA 1R0YA 4KFTA 2ZSAA 1TUEA 2JLXA 2BMDA 2AK2A 3L0SA 1T5IA 1G4AE 2XSZA 4OBEA 2AFHE 2P3SA 5FOTA 1WDTA 1AKEA 1MABA 1OKKD 4MYHA 1FP6A 5IDVA 1WB9A 1UAAA 2IYRA 1LW7A 1ZUNB 2ODNA 4BPBA 2FPMA 2HCJB 4XWOA 1NMXA 4Q66C 3B9QA 4OYHA 3OF5A 2B8WA 1KKMA 3A1UA 4O25A 1S2MA 2V9PA 1OFUX 2WMNB 2QA5A 2QE7A 4U5XA 4M9XA 1FQJA 2R2AA 4E07A 1D2MA 4R71A 4I99A 3EIQA 5EZ6B 3O8BA 4XSHA 4PX9A 1EGAA 1GZSA 5SZIA 1GL7A 4ON9A 2RMKA 3C16C 4DDUA 2GRJA 3QXHA 4FMCF 4RCZA 3K9NA 4IXMA 2E1RA 3RRNA 5DLQC 5EXTA 4R2HA 1QG4A 5DISB 4GFDA 3C4JA 2FX3A 2H57A 4A8JC 3GMTA 2VTKA 1OT3A 1Q44A 5LD2C 2H5EA 2Z4RA 1J8MF 4A0RA 3HPQA 1W46A 4W5WA 2JLWA 3QQ5A 4NCHA 3SQWA 3N2IA 2YKGA 1KDTA 2V7QA 2IWRA 3MJHA 4UXHA 4JZKA 4IEEA 1LFDB 4RKEA 3NHAA 4DT1A 2FZ4A 3TRFA 3TK1A 3EZ9A 1NL3A 5AUOB 4LJ7A 4CRWB 1NN3A 3HPRA 4CDGA 2ZYTX 4QBGB 4UXJA 2WJYA 3GEEA 4WBSA 1P75A 1ZC3A 2VP0A 4M9ZA 2GETA 4EQ6B 3T34A 2KJQA 1DO0A 1XDBA 1IN6A 3B6EA 3RRZA 3NKVA 5JCZA 2IEYA 3PUYA 3KZ1E 2DFTA 5EXPA 1DELA 2R9VA 4DLSA 1OB2A 3KFXA 3NH9A 2W2VA 1P60A 1OE0A 4XVQA 4PANA 1XZPA 2GCNA 2ZRNA 5EP1A 4OQNA 1OV4A 4QXAA 5SZJA 3LW7A 1OXXK 1II8B 2WMOB 3AF0A 1N6PA 3OFND 2DCUA 1DTSA 1J99A 1KI7A 2ZSFA 1XFAA 1QDEA 1R4AA 2B6HA 2IYSA 5G3YA 1CR0A 2WOJA 4A92A 4D0GA 2OXRA 1S3SA 1KNXA 3KJEA 1Z3IX 2WJHA 3VKHA 2NMVA 1E2MA 3C5CA 2AK3A 1EG7A 4L9SA 4CYMA 1G5TA 3CPJB 4DCSA 3U3JA 1DAEA 3I73A 4DIDA 5H70A 3U60B 2PLFA 4QRHA 4D80A 5FH9A 1Z0KA 2QPTA 2AX4A 3W34A 2ZRPA 4B6EA 2XXAA 2YVUA 1G21E 1MRSA 1XCGB 2J7KA 2F1HA 3DZ8A 3UXMA 3GJ4A 4BZXA 4V0NA 6Q21A 5GJVC 5JJLA 5CJPA 3UATA 2H17A 3OIYA 3R8FA 2BJWA 3QKTA 2ECKA 1MKYA 4JLNA 1S9DA 1SQ5A 1W4AA 2CEAA 3AVQA 4PZZA 2G6BA 1W4CA 4QBIA 621PA 2WAXA 4X8OA 1KK1A 2J0SA 4NZYA 5EQTA 4WXPA 4A8JA 3VR4A 2ZIAA 1E1QD 1NF3A 1QHHB 4HLCA 4UNPA 2QP9X 1L4UA 4JL6A 4NYMR 1N0VC 3Q7PA 3AVVA 3AKDA 4BFWA 3U7GA 4PPQA 1IN4A 2F9LA 3QY0A 4HDQB 4D0LB 2O0JA 4FINA 1L8QA 4Q1BA 2O8DA 4GL2A 1RRGA 4Q9HA 3U6KA 3WXMA 2FSGA 2ODWA 3TVTA 2HJVA 1OW3B 3GLGE 1VCNA 2C98A 1W7AA 3KQHA 1Q1QA 2EFGA 3PEVA 4KVGA 5FBVB 2ZETA 1T9HA 2HUPA 1AGPA 1T0HB 3PG5A 1E9CA 3THWA 1PV4A 3KL4A 1NG9A 4MKHA 4K8OA 3EPLA 1T5LA 3B2EA 5C1BA 3JZMA 4UJ3A 1PUJA 3EARA 1E0KA 2C78A 1XMSA 2OXCA 3CRMA 4PTLA 4HB0A 3VHXA 1Q22A 1QZXA 5G53C 4J0QA 1UPTA 5D3MB 4B3FX 2VLIA 3HYRA 1DARA 1DAKA 4B47A 4OL0A 4HLDA 4RD3A 1ZUHA 1KMHA 1NLZA 5DYGA 3BBPA 3CF0A 2DFKB 2FSIA 3PQCA 2P6UA 4M1MA 4DLZA 3HP1A 3CW2A 3MWKA 2JLUA 4LI0A 3QBVA 4IFBA 2O52A 1NKSA 1NBMA 4QGFA 2QN6A 2ODBA 4XWKA 2CDNA 2IT1A 3DKPA 1Y63A 5KNBA 1RJ9B 1KO7A 1WXQA 4Q02A 3AKCA 3UKDA 1CR1A 5JZVA 1GDDA 1S9HA 5KHOC 2ORWA 4B6FA 2QGNA 5JMTA 3IEVA 2X77A 4WW0A 1A5TA 1FP7A 4M0LA 3RC3A 3U6BA 3ZIAA 3EIEA 2H18A 1X1SA 4LYAA 3GEIA 2FGJA 2QE7D 3CH5A 1TQ4A 4TMVA 5J5CA 4BFXA 5JI3E 4YMWA 4QNRA 3UANA 2GAAA 2RGBA 2UZIR 2OESA 2ZUDA 3M1IA 4UXIA 3IIJA 2RAPA 4LYHA 5EE9A 4NMMA 2DWPA 1SVSA 3AGQA 3BWDD 5TDHA 1KDPA 2J59A 1P2UA 4A2WA 1D6JA 5JHHB 1GWNA 1YHNA 4URUR 4WAUA 4POAA 2DBYA 1TNDA 2IC5A 3FFAA 4NYIQ 1P7CA 2IS2A 4URXR 2DFLA 1XB2A 3R20A 2FF7A 2JJ1A 2OBMA 4LY6A 4DEYA 3GJ6A 3EC1A 5LB2A 2PJZA 1E2QA 1GRNA 3M6AA 1XMJA 2ZI6A 4QG7A 2QQEA 4NYJQ 4YMTA 2VHQA 3GCGA 2V7QD 3X1YA 4OI1A 3W90A 4IJMA 4IOJA 4K81B 2HLDD 3EW9A 4QKQA 3BFXA 4KBGA 2AXPA 5H68A 1NLFA 2IS1A 3KTAB 4RY2A 4V0ME 5F2EA 2HF8A 3WMEA 1UJ2A 1EESA 4B74A 2C77A 4R9UC 2A5DA 3DHWC 3L0OA 4OQMA 4GNKA 1AIPA 2F7SA 1GSIA 3I8XA 2G83A 1M74A 3ADCA 2VP9A 3UPUA 4EQ6A 1UKVY 4OI4A 2PJRA 2R6FA 4KI0A 2XEXA 4L4UA 1E1RA 2V1UA 3EA5A 4RD2A 2YWHA 2OCYC 2PMDA 5AWFC 4WZBE 2C99A 3CPEA 3H84A 4DKXA 2G1KA 1YR6A 1D9XA 1Z2CA 3T1VA 2HEIA 4PSAA 3I1FA 5J4LA 1XTRA 1YRAA 3B8HA 3FWYA 3VR1A 4NU0A 1PLKA 2MSEB 3RS5A 1M7HA 2ZR0A 2PBRA 2KSQA 1YZGA 4G5OA 3IQWA 4NCIA 2ZE5A 3SFVA 3IBGA 1HE8B 4JBWA 2QQ0A 4LCBA 1G8HA 3THXB 1II8A 4KFRA 2GAOA 4JKYA 4ZO4A 1BH2A 3VQTA 4MKGA 5KDOA 2AR7A 4AYTA 5AJWA 1J70A 3TBKA 1S0UA 1W49A 2W2XA 5AUNB 4PC7A 4O3MA 4FI3C 3ASZA 2C04A 1E94E 5A0FA 4NONA 2KWIA 3MMPA 4RKFA 4GBMA 5ANRB 1Z0FA 2J5XA 3KKPA 3DM9B 4LK2A 3U3OA 1E79D 2FE4A 5K8LA 3IDQA 4Z51A 1U81A 1C4OA 1XU4A 2BBWA 2D62A 3KUDA 5EJEA 3EZ7A 1KYIA 2MSDB 4WXRA 3SBDA 4XTCS 1T3SA 4FMDB 2A3RA 2C8VA 3EXAA 4PSVA 3K53A 4IKEA 5FPYA 3TQFA 3KQKA 5DIFA 1W5TA 3LX8A 1QVRA 3QXJA 4KITB 5JEEA 5FPSA 3GLGB 2REBA 4OKSA 3LY5A 3A1VA 5IRCD 3NXSA 5DH9A 1A82A 1FQKA 1M34E 2RHDA 2R62A 2ZRKA 4HAYA 4D4LA 4R7ZA 4Q9JA 2Q9CA 2GNOA 1QHHA 2YINC 3ZD7A 2QT1A 4TT3A 3MWJA 5CK4A 2GZDA 4DEXA 4P31A 2XB2A 4FWTA 2GEDA 4I4LA 3HR7A 3VR3A 4MDEA 3UG7A 2UZ3A 3LFUA 3LRPA 3ZD6A 2BKUA 1KOFA 3ZS9A 1R6BX 4KFSA 4HAVA 5TXGA 4FW9A 1CKEA 1ELOA 1XJCA 1WGWA 4O0MA 4B3GA 3K0EA 4TMXA 2FH5B 2ZAOA 1TU4A 1BS1A 3HU1A 2WVJA 2JIZD 3TH5A 4MA4A 1XEWX 4WA7A 5HE9A 4LX0A 3RS2A 5KNCA 1OKKA 2D2FA 5D3MA 1GKIA 2H92A 1AM4D 2G1JA 2PT7A 2QTHA 1MO3A 1NBMD 821PA 2HT1A 2ZANA 3AQ4A 1H8EA 4LDJA 3CNLA 4LYFA 4PZYA 4GRAA 4Q19A 4LYJA 1QBKC 1WRBA 4YDHB 2V1XA 3LH5A 3AVXA 5CIQA 1G41A 5TV2A 5BYKA 4EKDA 4EPRA 2NPFA 1RJ9A 2G0TA 1DAIA 3GP8A 4QM7A 2GF0A 3ZIAD 3ZZ0A 2BM1A 1E98A 4M1SA 4QJ5A 3WYAA 3T61A 1F2UA 2PCJA 1YZKA 3AEZA 1X8LA 2FSHA 3K0FB 1A2KC 2J46A 5FPHA 1GNRA 5FOUA 4AKIA 2OFXA 2OG2A 1E2DA 4I1OA 5AJYA 1LV7A 5JECA 5L3SB 4CEHB 4PO8A 2WWGA 5GVSA 4QHTA 4JBXA 3RYTC 3BAFA 3R7WB 4TTQA 4YC7A 4FWIB 4EFMA 4ZDWA 1HURA 4Q7LA 2OLJA 4EJSC 4HAZA 1COWD 1QHYA 3LV8A 1VMAA 1VCOA 1AS0A 3CBQA 3SHFA 1RYHA 2D4HA 2ZYUX 3NDBB 1E4VA 1N2CE 3LX5A 4DBLC 1NVVR 2XX3A 5KSYA 5KNDA 1CIPA 4MGZR 1G7TA 4DLYA 3VU9B 2F3TA 3LQQA 4DSUA 1CJUC 1ZM4A 2ZTSA 3EZFA 2LWIA 3PEUA 1RRPA 1YR9A 3LVRE 1BO6A 1E0JA 4PXAA 4IVPA 4C0AC 1W2HA 3SC3A 4LV8B 1ZINA 5BN5A 2XOKA 3VX4A 1NNEA 4B3XA 1BYUA 2ZQ5A 4B73A 4IOMA 2IS6A 2FN4A 4QFMA 3NIBA 4D4MA 1SXJE 3U61B 1AQYA 2A30A 1YU9A 3DMNA 3I32A 4HLUC 4ZDJA 2R44A 2IXEA 1SKYE 3KTAA 2MMGA 3KJGA 4KAXA 2GJ8A 4MRNA 3K0AB 4RD0A 5SZHB 2J7PA 1J7KA 2JATA 2NOAA 5JWHA 5JS8A 4C0LA 5JRZA 5EE1A 2PEYA 4Q48A 4X8LA 2ZRHA 3P32A 2ERYA 1ZCBA 1GRRA 2JASA 5CJ2A 1ANKA 2I1VB 2ZI9A 1E1RD
chains in the Genus database with same CATH superfamily
2GDCA 3NHPA 4GYYA 3WKCA 1K7YA 1BDBA 1CJVC 5BUZA 2G76A 1VECA 1Z37A 1XA4A 4JT8A 3LZCA 2HT6A 3AG2C 3FKSA 4HO1X 4HOYA 3T9BA 5HQJA 4L22A 1A2BA 1ECLA 1QKJA 2NW6A 4DCOA 2YXBA 2EW1A 4TV8A 1SB9A 3PNPA 2ETSA 3WL8A 4B34A 2X8WA 3L9WA 3AU9A 4EX7A 3M4NA 2DMRA 3ICPA 4MUBA 2AN3A 3IKVA 4TMFA 3HUFA 3B70A 3GLGA 5SV2A 3L7DA 2YLGA 4NC3A 2ZDHA 6CHYA 1HEIA 2XDWA 2W6MA 1VIDA 2QVXX 1ZMXA 2BGJA 3V4FA 5JJKA 3ESZA 2GD6A 4AJEA 3UT0A 3BGSA 2A0KA 2KLBA 3AHHA 5TPWA 3OZSA 5DLDA 3DZIA 1DX9A 1X9IA 2VR1A 4CQNA 5CXQA 2JEOA 1GGNA 2KSFA 1SVIA 3JASA 2FRVA 3SOZA 3G2IA 3AF4A 4W8HA 1Z83A 2DRIA 1JR6A 1UMBB 3A1EA 2DYRC 4U8GA 4HL6A 2CKDA 4BRZA 1Q1AA 2WJJA 3UB4A 3VOBA 5DX0A 4M9SA 1SKYB 3EHDA 2DLDA 1ENPA 3GORA 2I4MA 4YCMA 1JA9A 3W8IA 4MVUA 4KQ1A 5J58A 5KINB 3W2EA 3KLOA 1I4WA 4JGGA 4TMZA 4WZBA 2NYAA 2FPGB 4PK4A 3D0RA 1TUBA 2XRYA 4HEA6 1Z4MA 3RYFA 3LOQA 4UNIA 1B00A 4RZXA 3WLQA 3SZMA 2C3UA 2J3MA 2C9MA 3I9FA 3B20A 3CVXA 4HDSA 2C9YA 3F3SA 2ZUWA 2BFFB 2ZS9A 3DVAB 4NQRA 3KD3A 1GG2A 1Q0MA 2BVNA 4CFZA 4BNNA 5D92A 1OCZC 4D1YA 3T1OA 1GZUA 1GPUA 3UG6A 3V1KA 5HMLA 3JQ8A 5F3DA 2CW0F 1Z7Qc 3JVUA 3ME5A 4Y30A 2VXCA 3GJZA 2PRIA 2GTPA 4MJ3A 2JI8A 2XJ9A 4JP8A 1XMOB 2FX5A 1N9ZA 5E3IA 2QAJA 4MS1B 1BSVA 4ES6A 4QOFA 2XL6A 4EGQA 2FVYA 3HA5A 1T1GA 1F5NA 4O2BF 5I48A 4F2DA 1ID1A 3PEFA 2A0WA 4U5EE 4Z54A 2H07A 4BJ6A 4X0RA 3UXYA 2GRUA 5GZ3A 1REQA 3ZBTA 3K15A 1H4TA 4D3ZA 1DIHA 2E6KA 3LQ1A 3ILVA 4EW3A 3DB2A 3TRIA 3JQ9A 1ZMRA 5AIAA 1K04A 1XZAA 3TQRA 2OLKA 2BT4A 4CF3A 2EXXA 2ZXFA 3KZOA 4TZTA 1YQWA 1OQCA 4H3HB 2PNOA 3E9NA 1W2GA 1WHTB 3N6VA 4FGJA 5AM4A 1SIUA 1J4AA 3LIIA 3QFSA 2OCAA 4E5DA 3P9CA 1RJWA 3A4VA 3GJYA 1IHYA 2G71A 3VTKA 4D3YA 4BLWA 5AVKA 2IYLD 3HVKA 4C3ZA 5KTYA 2N75A 3RH3A 3ASOC 1AZWA 3AQIA 2GR9A 2VTBB 4J49A 4IAQA 5FEUA 1GN8A 4RZUA 4Z8YA 3G7SA 4F5YA 1CUSA 2W0MA 4GKKB 2F43A 2X8LA 3LZ6A 4FMPA 2WB4A 2Z2ZA 3TZKA 2BDUA 3P20A 4N01A 3RYIB 2YJNA 1MIHA 1MB9A 2BW0A 3ISVA 1XRSB 4HGNA 4AZTA 5JROA 4XE5A 4FOSA 1H6GA 2Q27A 3CLVA 5ABPA 3NHBA 3H75A 4KIWA 4PX2A 4WGGA 2PH1A 3IMEA 3SBXA 2ANCA 3ZOZA 2PX5A 3PJRA 2CZQA 4ZMSA 2HWWA 3VF0A 1Z2PX 3PA8A 1XPRA 4GYTA 3WLOA 4M0PA 2PA3A 5BSKA 3BMNA 1YU6A 1JHVA 5SY4A 3ZHRA 4U8HA 1FDRA 4D3DA 4F5EA 5L95A 2D00A 3HGQA 1GPLA 3NEYA 2PBFA 1H93A 3DGEC 4KLZA 4DMKA 1RQLA 4FBLA 4M0DA 1VMKA 1GN9A 1CUYA 1O3YA 1U94A 2XIQA 3ZCPA 4GBJA 5PNTA 1FZQA 3H18A 2OGZA 5A7FA 4MS4A 2FFHA 3WB2A 2GM4A 3UY4A 2E82A 1S2GA 5A9TA 1YIAA 2QRQA 4OFBA 2I22A 1ISSA 1N2SA 3L05A 4B2PA 3U2QA 3CRQA 2GILA 5ALZA 3ZCQA 3AY0A 4ZZ3A 1YL5A 3LQ2A 4G63A 1ZUIA 4WKNA 4COKA 1LI7A 4BQSA 5K0SA 4L5BA 3FCEA 1L7AA 4E17A 1WZIA 2P0AA 3MEQA 2XJ4A 2F8TA 3FDQA 1AMUA 1M2VA 2IYUA 4FOLA 4C06A 1HMPA 2A57A 1YVIA 1L5SA 1DAPA 3GF4A 1SXGA 1ZZGA 3E9EA 4KXVA 5B7GA 3O8RA 4HLNA 3IKMB 4IPTA 1U4OA 1E1MA 4ZT6A 2UU9B 2YHBA 3E7XA 1XNQB 4Z9XA 1EVQA 2HA0A 1AD2A 2WK1A 1NVUQ 3ZHCA 4ZYTA 3ZCRA 3FCCA 4KCGA 4C4TA 1LH0A 4UEOA 4QODA 2YH2A 5D5QA 2H9IA 2YQ5A 4E2ZA 4K2AA 4AUMA 2ZJ8A 1BH6A 3AUUA 2Q2NA 1GNPA 4CKEB 5CXUA 4MRRA 5CLHA 5G0TA 3LNMB 3KTFA 4LSMA 3W1WA 1DKUA 4KJXA 3UPTA 4ZEXA 2OBLA 721PA 4Q1FA 1VBNA 3E35A 1JR3E 1A9QA 3NHYA 2O3TA 2IHVA 4N4AA 3UWDA 5IK2D 2Z8YA 2BP7B 4QDKA 1IY2A 3FNIA 5JNSA 3DOUA 1GGQA 2YYZA 3C2QA 2MJLA 4NEQA 1K4YA 3G0IA 1KYYA 1AKMA 1FU8A 3H13A 3RVSA 2RSEB 1LSUA 4LWPA 3C41J 3RYCA 2WHQA 3M7IA 3PICA 4X00A 3ANTA 1D6MA 4A8HA 2JI6A 4KDEA 4HADA 4JVSB 4BO7A 2V5VA 2C7OA 3JQCA 4L0MA 3WHLA 1NU6A 1VCIA 1MFZA 5JXJA 4HAUA 1FPMA 3NALA 1YBVA 3L1MA 4YMIA 1U5CA 2UZAA 4QYWA 5EZYF 4LXYA 2A1DD 4GE3A 4EDHA 1W36D 1V16B 4XX0A 5IM5A 1VLSA 3RUFA 4WEOA 3MWYW 4KO1S 1TRKA 4YMGA 4JNKA 2ZRIA 2X2FA 3MCAA 4UU0A 5FHRA 3GPLA 5A62A 4C0BA 4XCQA 2GXAA 2II6A 2Y2VA 1VJ5A 3EXG1 3TLMA 1E7SA 4U5HA 1XEXA 3QW4B 4RCVA 2KK1A 1F8YA 4LXIA 2H0QA 3M1YA 4YGYA 3C3EA 5CHEA 4L16A 1P7VA 1M2GA 1E99A 4JLKA 1DQZA 2X15A 3SXYA 4YS6A 3V8RA 1IXKA 3K8OE 2QL7A 4FYYA 5YASA 2HV9A 3DYIA 1ZL0A 2WFLB 4GP6A 1R9MA 2VC9A 2CNDA 4ZVQA 3COWA 2CBXA 1T9ZA 5CX1B 2P4UA 5F4BA 3T9EA 1Q0GA 4X7MA 1K66A 1BXZA 1TFOB 2ILVA 1DOAA 1E6WA 4QGAA 1S7CA 2A78A 4DLWA 3EH1A 3W9UA 5A5VA 1TWHA 4ZQHA 2VUHB 2O0MA 1EP3B 1HNWB 3NGLA 3E05A 2IDJA 3P4YA 1EFCA 1G5PA 3DE2X 3HKCB 2OM2A 2WB7A 3WNQA 3QMPA 3BL6A 4RJTA 1PJSA 1IEVA 4Q1EA 4NENB 1I0IA 1L3BA 1F0YA 2IBMA 1G5IA 5HJ2A 1LVHA 3ESQA 1Z8HA 2PGOA 4ALNA 8OHMA 1JKMA 4BRUA 1CUXA 4RHCA 5K51A 1FQOA 1D07A 4L9AA 4EI9A 4Q7QA 1FUUA 4G9BA 4FXPA 2GEUA 4V3BA 3VPSA 3EZYA 2XTNA 3SHQA 2V8OA 1TYAE 1FMJA 1EFRA 5A05A 3HFSA 3PQFA 4ED9A 5ALVA 1PT5A 3QEKA 3CZAA 1PL7A 4B4DA 4NPHA 1J6UA 1SFRA 4LTNA 4N6OA 1CBUA 2VHYA 3BS4A 1H94A 2EWWA 2XMZA 4HYYA 3ZTYA 3LBNA 1HMYA 4CMEA 4MHSA 3RHFA 4R01A 1ABFA 4NEGA 4GGOA 4G09A 5CW1A 4ZYXA 1TCAA 4HQNA 2DBQA 5HTOA 4IV5A 2BN4A 1CUAA 2XUGA 4AFNA 1VYVA 3FA2A 3JSAA 2XR1A 1N32B 4HP8A 5J43A 4JBLA 3AI1A 3AB8A 1IBLB 1KK2A 4YRFA 3V4LA 4JCHA 1RYZA 1NVXQ 3X1DA 3U5SA 4RFSA 4FHDA 4QIHA 3OX3A 2FMIA 3COSA 2ZWMA 3B5JA 3NORA 5K0ZA 1Z7GA 5JDCC 4HEQA 4ESEA 3ZU6A 3MJ4A 4R1PA 3OHMA 2FDXA 1FBTA 3C3KA 3FYCA 3EQ7A 1FTSA 3DBLA 1KJJA 5BVGB 3KT3A 5DFAA 4BFVA 3ZHOA 1WY5A 3N9IA 1E3WA 1K5DA 1UFBA 1ONSA 3N8DA 2WMDA 3OE7A 1HG0A 1TQGA 1M1XB 4ENRA 4W6QA 3P52A 4PZUA 2HPAA 2FWMX 4CSAC 1JG4A 1HDZA 1NTRA 5AM3A 3FTEA 5DHTA 3IA2A 1G4UR 4D4XA 4BVHA 2KGOA 5ENZA 2ZIXA 2NSJA 3FIJA 4S12A 2EYUA 1Y1SA 1Z6TA 4C14A 3RBXA 4Q5IA 1S89A 3OFNA 1TIPA 4QWMA 4OHFA 1KVQA 2G1UA 2IF0A 3B0PA 5K6AA 1VXRA 4PLZA 3NYWA 2DFPA 1G9TA 1NUQA 3ET4A 4HDKA 1Q91A 2QMEA 4XWGA 2W90A 1CVIA 2ZBQA 4CIVA 4P2GA 3O9MA 3AOEC 3K6BA 3D6TB 1Z6XA 2QNIA 3F7OA 4LUCA 2Z57A 4A8JB 4X3PA 4WE3A 1ACMA 1Y33E 2JJMA 4U7DA 4ABYA 2ZYRA 4M0CA 5GJBA 5EMMA 3IEEA 2BWJA 1QQ6A 1MV5A 1P77A 4FSDA 3HHPA 2Q07A 5DDIP 4J16A 4LFCB 5DCYA 4QDXA 4RNDB 2E1PA 4A5OA 3IE0A 4F93B 5KOIA 2PUDA 4HSGA 3TLJA 3V7WA 1JXAA 3PEEA 2BC5A 3FB1A 2RAVA 1TUEA 2WYWA 2AK2A 3E9RA 4EBJA 4QBKA 3FUTA 5HJEA 3CT4A 4OSPA 1H5QA 4Y2QA 3N0WA 3KSAC 1XLTC 3D64A 3EH2A 1J8QA 3K9NA 1VC2A 4EVRA 1QG4A 2GJ4A 5KYVA 2R8ZA 3HPQA 3AR4A 3TJ5A 4IB4A 1T9GR 4YWHA 1KDTA 2V7QA 3MJHA 3PTAA 4OQQA 3C4QA 1KJNA 1WZNA 1OI7A 2HU8A 3L7OA 3ZOKA 1TWCA 2Z6AA 3EXHA 1IN6A 1J5PA 1ISMA 2K2WA 3T3MB 2R9VA 4CCYA 4RQUA 2FQWA 3K2QA 2IUFA 3AXTA 3HADA 3V1MA 2BF7A 5F23A 1RHMA 2XVYA 1SM4A 2CZCA 3TLEA 1IUKA 2IGTA 2B2NA 2HOQA 2C2WA 2JAOA 3W3AH 1G5TA 1Z4JA 4DCSA 4IUCS 3QFCA 4D9JA 3H16A 5H70A 1PG0A 4X65B 3W34A 2YVUA 5GJVC 4D45A 2QDKA 1P0MA 2OKUA 3QKTA 4O1HA 1XRRA 3WHPA 1KK1A 5K0EA 4REOA 3DNFA 5E2AA 4IH9A 1U80A 1MNDA 3DBVO 1SUEA 4OMFG 4FJ2A 1H9CA 1DJQA 2PWZA 4Y2XA 3O31A 1AGPA 1X15A 3OJEA 2AMFA 4B84A 2C78A 2PKRA 2I9KA 3SKXA 1DARA 3FWNA 2OCXA 1TQ8A 3RW9A 3ZC3A 2A6PA 1V1RB 3BBPA 4ZJYA 1L3PA 1M1UA 1Q1GA 2JLUA 4QGFA 4V0RA 4D9IA 2VDMB 1A9RA 3FRJA 4DRYA 3QHAA 2SNIE 3O5AA 4O33A 4EIYA 2HCTA 2XMBA 1O95A 1GYPA 3NYMA 4R69A 4JN6B 2Y05A 1YFKA 2HMSA 4ANFA 1TK2A 2HA3A 1T6IA 2LIGA 3FUUA 2JJ1A 3Q0EA 4GLFA 1XMJA 2XCUA 4ZCRA 1KQNA 1VL8A 1U0SY 2AXPA 5F2EA 4RKQA 4G8CA 5EYPB 3P2KA 2B2XA 3W77A 3UJBA 1I2BA 2HIHA 4BNZA 2F7SA 2VJDA 3R23A 3UPUA 2G0AA 2OO5A 2PMDA 4ER5A 2G1KA 3O8OA 3ZXXA 1KETA 1A8PA 2HEIA 1NATA 2BGGA 5KX5F 1QMPA 3VR1A 4UMVA 1QHEA 3AUTA 1A4UA 3GZ4A 3DMFA 4EMUA 3GN2A 3KLPX 2VH2A 5AUNB 4A0SA 2VH3A 4O3MA 2C04A 5K2OA 4FFPA 4MVSA 4XQ1A 5TEWA 2C8VA 4H0FA 1E8NA 1VRCA 3KQKA 1WHSB 5IUKC 1P1CA 3N5KA 2XT9A 2P5YA 2BAGA 3GEPA 2NZYA 4L8YA 2R62A 4Q9JA 2JD0A 4EI8A 2YINC 3VAYA 5CW2A 4P31A 2GN8A 1DT5A 4RZIA 3FPKA 1X80B 2IH4A 3LRPA 1KL7A 1Z34A 3KQOA 1UODA 1ZZPA 1NF9A 1H2XA 3GH1A 3M6UA 3SKVA 3HBJA 2MSNA 1UKAA 3F97A 1X42A 1FP4A 3FNEA 1CUEA 4KIFA 4LX0A 3L7IA 4CKCA 2PT7A 3PWKA 1NBMD 2ZANA 3HI4A 4E1VA 3CNLA 1QBKC 1WRBA 4IDAA 2ORYA 2Y2UA 1U04A 4PXYA 3MHPA 3N8GA 1Y1LA 4P7FA 2GF0A 1R5ID 3N53A 5FOUA 4E33A 3MK31 3EGOA 3R76A 4H1TA 2FWBA 1L5WA 5CD9A 3OEOA 3BIWA 4IFTA 3CBQA 2OXTA 1ZHTA 4EMTA 4CN9A 1DOHA 1I7NA 1QO0A 3PHCA 4C0AC 4DRJB 3QE9Y 4CLDA 1C1XB 2PAFA 1XZGA 4XRGA 5IBCA 4PS1A 2R44A 1JGTA 4CMCA 3IQFA 4MRNA 1RKXA 1UBLS 3T6JA 5T4EA 1CFJA 4IJWA 1E18A 3DEIA 2ZI9A 5DM1A 5EE0A 3KL2A 3MM4A 4TVOA 1BWPA 1M33A 5DHFA 4WLFA 3VKVA 5EUBA 3WKDA 2XOXA 3U3ZA 3PXXA 2HMVA 2P6MA 4O4HB 4RD1A 4YL1A 1BAPA 3ESXA 5EE3A 3LPDA 1FNNA 3KVVA 1G21A 2NXWA 4WGFA 3THXA 2PXCA 5GJWC 3P2MA 3SHOA 3NYQA 1BOOA 2POQX 5E7JA 3C1TA 4V02A 4DQ0A 3R4CA 5CT9A 1YB5A 3MWEA 5AI9A 1X7HA 3IXMA 2D5AA 2H4JA 4YDSA 4OXNA 1UZUA 1VOMA 4RF4A 1IBSA 2R97A 5K03A 5F33A 3Q3HA 2IYOA 3TEJA 2IV7A 3KYJB 1GL6A 2RGGA 1VYHA 4AZVA 3O4FA 4G67A 3W1VA 2YZSA 2ZP1A 4UZSA 1QGUA 3IAFA 5FUYA 5D51S 4LF9B 4YT4A 1H8ED 2EQBA 1IZMA 4TMYA 2PL3A 4DWJA 4L8VA 1DQNA 4LVNA 2YYAA 2Z2KA 4LXQA 1U28A 3JY6A 1N2CB 1HFJA 3GFOA 1KYQA 3OZ7A 5CA1B 3NVAA 2FGYA 1KZ6A 2BDTA 4A3SA 3T1QA 2FN8A 4MP6A 4K9RA 2NG1A 2FKAA 3JCZA 5KNDD 3OPQA 1V41E 3N3BC 4LRUA 4V0MA 3ZCSA 4CV1A 1SQ6A 2FMFA 1N36B 1RWNA 3A6KA 3ACCA 2VP3A 2RBKA 5SZKB 3Q8XB 4IJQA 1A7UA 1RZVA 3AJEA 4ZCPA 3WHKA 4LJ6A 2DGJA 2JIPA 4V0OA 3I53A 4JA0A 2EF1A 2YZMA 4X1KA 2ST1A 421PA 3RV3A 3I0ZA 1EUZA 2OILA 5T5QA 1RMYA 4OUDB 2R751 2FWNA 4FJ0A 4ZCMA 1SKBA 4EL5A 4YRBA 2WU4A 5J1TB 3RU9A 4XLNF 5ALDA 4IDEA 3WBFA 2PLWA 4WNAA 4JS0A 3NBZC 2QN2A 2QBYB 3HY3A 4XVRA 2C84A 2JFUA 2WSYB 3PE3A 4TVKA 3PGMA 1EB9A 1QIMA 1M2EA 3CO0S 3SC2B 5KDDA 3GANA 4XIGS 4F38A 3F5SA 3LX6A 1MW9X 3GRRA 4L6AA 4DUZB 4L4RA 7REQA 3L40A 3OJXA 2XD4A 3SGLA 3WYEA 1XZFA 3W2WA 4ZVSA 4TKMA 3BXHA 1K3FA 2FOXA 1XGKA 1DWPA 4UKDA 1U1EA 4NV0A 1CUDA 1VKJA 3SJZA 2CLCX 3VZPA 7AT1A 3NRJA 3RSQA 1YR7A 2OGTA 4PYOA 5EIEA 2IXTA 1NU8A 2ZYWX 4DMRA 4BGDA 2IPMA 5D7NA 1VSTA 2ZITA 2Y0BA 4J1SA 3KJZA 2YVAA 1FLVA 4Q4HB 3TR0A 1JDUA 2Z3WA 3CEMA 1OILA 2VRBA 3WLMA 2W2TA 3GGSA 4FFBA 1YS4A 2REQA 4QLBA 3ROXA 4ARUA 3EF3A 1JDSA 1YRBA 2YLDA 3E23A 1NSTA 1NGSA 4KMMA 3GD7A 3MUOA 1FCJA 4HVLA 5F9FA 3VPBA 3U4QA 4TN1A 1C3EA 1P8AA 5F1OA 5K05A 4OQFA 3PLAE 3IMGA 4B2IA 5BNZA 2GT1A 4YJ3B 2PVSA 2ATCA 4PAQA 3PFCA 1ZHZA 4NFHA 4QOGA 2OBYA 2BFAA 4FLEA 2YRFA 4R1SA 3D1VA 1G8MA 3LDHA 2I33A 2ODEA 3BWVA 2P1ZA 2GLUA 5AKLA 2OENG 1NG1A 4GL4A 1UZMA 5EPUA 2GEKA 3CQZA 1H9BA 1NYRA 1UFRA 2NO4A 3RSSA 4J4TA 2O8NA 1T4MA 1KMMA 1NBHA 2PF4E 5EC8A 5HKKD 3L6RA 4PW0A 3K71B 3RC8A 5KOHA 1VZ3A 3WWDA 1TEVA 1WASA 5HE8A 5K3SA 1G20A 4LHYA 2I6TA 3ETGA 1WN0A 3DMDA 3BIFA 3L79A 3IXLA 3PVSA 1N9GB 3EAFA 2VK1A 4XYLA 4E0IA 2DWQA 3S8YA 3JD4A 4F1WA 1PUIA 2AFIE 2CJPA 2CNKA 4FIDA 3G2NA 1QRUA 1WZCA 2H4WA 5TY0A 1RKCA 3A10A 3ZPXA 1RYNA 3G2PA 3UFXA 4M37A 2QI9F 1TF2A 2X0IA 5DXFA 3R3HA 4BRWA 1UJNA 5CYOA 3PFWO 5K20A 1IB6A 1NBWB 4GLOA 2FWRA 3ADPA 2QRLA 1AS2A 1JHQA 2GOYA 1WW8A 1T9KA 1W0JA 3FGNA 4X63A 1Q3KA 1QGED 2X51A 4XUEA 3CIOA 3ITNA 4R0NA 5TT1A 1KMNA 2Z56A 4MQMA 4RXTA 1KGDA 1NVWQ 4DY6A 5LWHA 1TAHA 1U0EA 1H2RS 3M1LA 1G6KA 4UHKA 2BLNA 4UCWA 3RKOF 3VR2D 1NT2A 1QLWA 3H3FA 3PHIA 3DT9A 3L0PA 1Q0TA 1U9IC 3TG8A 3WIOA 1V3TA 1CR4A 2ZJAA 5IC4A 4ZO6A 3FUCA 5M34A 3CC8A 1THTA 3PA6A 1ZM9A 5MHTA 3LJKA 4YJHB 1NLUA 3PCRB 3K1JA 5K5EA 4J75A 1B3BA 3VA7A 3UCEA 2VPIA 1P1FA 3KZKA 4M7OA 3N2GA 4PZLA 4LXTA 3OMLA 3DTVD 2WUVA 1OC2A 4CT5A 1M56C 4FNOA 3RGWS 1P9OA 1YH3A 1ZG3A 1JAIA 4DBQA 4EENA 1Z63A 5JBNA 4PSUA 1QVZA 2ID9A 3Q3JB 5EIWA 5CNJA 5TQJA 4GI5A 3F2VA 1JYEA 3CXRA 4PC2A 1Q1BA 2B0HA 1Z5WA 4B9EA 3PDMP 1X7XB 1GVNB 5C4GB 1TA9A 3HB0A 4HB3A 5FTKA 2H85A 2PSDA 4X20A 3NKEA 3K33A 4EBBA 2DERA 4XUCA 4YPFA 5IANA 4BYMA 3EFOB 1HGXA 4J9VA 3ZWVA 4S1VA 4CEIB 1W2WB 2IWHA 3PCVA 1QO7A 1I5NA 4WADA 1EX9A 3PGLA 4FDAA 4KR3A 5E6RA 3BL8A 2P27A 1TM2A 4X0EA 3ZV5A 3ICEA 3KETA 1ZHOA 1VLVA 2FPIB 3X1JA 1Z0UA 3TUJC 3WYFA 3HO1A 1S5PA 3LDFA 4U5DE 5LMCA 3S2FA 1JDNA 4CGZA 5IAGA 2AXEA 3KSUA 2X8JA 4XW2A 3V4RA 1DX6A 1HUQA 5C35A 1OPXA 4X66B 3EHMA 2JZNA 3UMKA 5KTTA 3MELA 3FPGA 5J5AA 4WFKA 3U9TA 4JYPA 1T1RA 4JC5A 3UH1A 4JSRA 4E5SA 1HTWA 3CVOA 1ZSNA 2QT0A 1GCOA 3QMMA 2RJ3A 4G2TA 4JXZA 2OAQ1 1BCSA 5DN9A 3GL9A 5IAEA 2JGMA 4JBYA 3GLHA 3HL0A 4IICA 1E9AA 3WNZA 3TXYA 2R7MA 4W5QA 4A03A 4URZR 4J1NA 3GT7A 5ES3A 5LU8A 4Q4AA 1VJ1A 4YWQA 2D4UA 5HKAA 4FQ8A 4S3MA 4PQGA 1OXVA 5ICEA 1FL9A 1KHHA 2M4EA 2JCSA 1PSWA 1QS0A 4PPGA 3AIKA 1NKVA 2FJPA 1HE9A 3HYTA 3JARB 4CT4B 2PGDA 1FTWA 2ZRBA 4M76B 4LJRA 1YR3A 4MV7A 2V55B 5TGZA 2A9PA 1GAJA 1QR6A 1P62B 4L8GA 1OCOC 4QBHA 3A9CA 3O3OB 2CFOA 5DASA 1QGAA 1FX1A 4FOOA 3K4QA 1AV7A 5HFJA 1HEUA 4IIUA 1YDMA 5C34B 2XGSA 1HXHA 3WRXC 1EMDA 5CCBA 3ZWIA 3G88A 1DJPA 1F0PA 3MYIA 2UKDA 4V03A 3ABIA 3DZJA 2AZMA 3TS1A 2YY5A 3NRCA 4ZVKA 3ZDXB 4G85A 4ZYLA 3TOZA 1YZLA 4J3JA 3IBCA 3DXFA 1OREA 1J5EB 3HUDA 4R1NA 4J7YA 2BM9A 3RIGA 2JAPA 3GG9A 4HDMB 1V9CA 1G3UA 3P8ZA 2O8FB 5E6SA 2KYRA 1LKZA 4QOJA 2I7XA 1XDSA 4C6TA 3EHEA 2OCCC 2M6SA 3SJAA 4JUDX 2RHTA 1SOMA 2RGNA 4Q9KA 4CTJA 2VP6A 3GHYA 3PXCX 4JGIA 1O3UA 3H6GA 1YDGA 4OG2A 3G4ZA 4P82A 2CCGA 3B0VC 3QVUA 3UGTA 1M6TA 4RE6A 3QVKA 4C5BA 4CQMB 4KAFA 4M1YA 4ZRMA 3PPWA 2CYBA 1O97C 1S2NA 2HJ3A 2Y0EA 2V4ZA 2K2QB 3C24A 4ENSA 2XMQA 4K05A 5CLLA 3A37A 5EESA 3R74A 3NBKA 1T2VA 4BV8A 4NNPA 5A6SB 5F7JA 1POWA 5CTJA 4R68A 3AGTA 5DTIA 4YAGA 4ZOCA 4JLBA 5B2FA 3P2YA 2AZTA 3GQBA 2GZ1A 4H7DA 4Z8XA 5GGYA 4X60A 3MCZA 3R8CA 1KPIA 4UTNA 2YZGA 2RSLA 3I01A 4CG1A 2GRAA 3AU8A 3RNOA 5LOVB 1XDDA 4INZA 3RVLA 2H7VA 2FEMA 3EOZA 4LE2A 2JH9A 5FDFA 1LQTA 3JQAA 4TZ0A 3KQQA 4YCLA 5C4MA 1KEUA 3UWKA 1DC3A 4PO3X 5FV4A 5GZ6A 2W45A 1NBAA 1Q3TA 4NJMA 1E5QA 1Q0UA 4URVR 1U8TA 2DPYA 5KO2A 3E27A 4CPDA 3QZUA 2C7RA 3S2YA 2WUGA 1X8KA 1FC0A 4TTRA 5INTA 5KAMA 1FW6A 5IU6A 2PCLA 3GLRA 3OC0A 4NRDA 3FDZA 4ZHSA 4I3FA 2OV1A 1AKQA 2CD7A 4XGRA 4CM7A 1SVUA 3ZDAA 4RF5A 3H7IA 4JGBA 3MTGA 3KEGA 1DG3A 5ERGB 2JLAA 3ZDQA 4ODIA 4PLHA 1Z5ZA 2P9JA 1JEEA 2R00A 1LRKA 5ALEA 2O3UA 3QU7A 2QTWB 4JXJA 4LHXA 5IKPA 2VH1A 2WVHA 3CF2A 2MYUA 2X2OA 3OKAA 1WCIA 1P0IA 4OA5A 4JUAA 3D59A 1CT9A 2WTXA 3EWSA 5L7YA 5EGSA 2H11A 3FVQA 1F4PA 2YXDA 3EGXA 3S4YA 1G6Q1 4LY9A 2Y27A 1XNHA 4XVUA 3IQGX 1YE8A 3B8EA 2ZJZA 3SX4A 5L8VA 3D2BA 2WZCA 2FFJA 2C4UA 5ALQA 3SC6A 4Q6WA 1AQIA 3I45A 5J23A 2ZJ1A 3Q9SA 3CRNA 4LJAA 2FSVA 3ED1A 2PUTA 2IY7A 1YZUA 1QC5A 1CU1A 2QY9A 5LQUA 4QXMA 3GVCA 4JVMA 4CJOA 5H59A 4QTZA 2L81A 5FOTA 1C17M 4G1BA 1WBJB 2JFFA 3EEOA 3PBKA 4REQB 3CR3C 1DXYA 2V9PA 1GTG1 1Z88A 5E1OA 2JH8A 2WYIA 4GPIB 3R1IA 4W7HA 3G1WA 4JNCA 4LCEA 4DDUA 2PL9A 3B71A 3S2ZA 1WY7A 2HSWA 4GFDA 1TIBA 5L4SA 5ESWA 2JHGA 1CDEA 4BJ5C 1YB1A 3ESRA 1CUJA 1ZUD1 4HJRA 4ZQEA 3TRFA 5FKJA 1LGYA 3ISJA 1SA0A 1ZGBA 5DGDA 3LTEA 4WBSA 1Y5MA 2FX2A 1XHEA 3F5QA 3C45A 1ONNA 3B6EA 3QYPA 5LZ5A 2NUAA 1OB2A 2OXEA 1NJ8A 3LW7A 1OXXK 4MYRA 4A92A 2XOEA 2HA2A 5GMOA 2NMVA 2YMMA 1EG7A 3ZKAA 4I50A 5AXCA 5IJ9B 4L74A 1L9XA 3N24A 3P9IA 1Z0KA 2AN4A 3RBZA 4LDAA 4YRKA 2I0FA 1I7SB 5C5CA 5EJ5A 4P9NA 2EBUA 1GPDG 621PA 3EBPA 3GGDA 3OFSA 1QHHB 5LQKA 2G28A 3MBKA 5AHWA 4F3KA 1I4EB 1L7PA 2Y1LA 2Y3DA 2PH3A 3AINA 1DTWA 3D6MA 3TVTA 1AMNA 1KAHA 2EFGA 4RHEA 5COBA 3W06A 2ATEA 4MKHA 1RHJA 2KW3C 4BFCA 3WDSA 4K7BA 10MHA 3G13A 5DYGA 3VJMA 2G9RA 1YUMA 1DPGA 2HK6A 3QBVA 4DTIA 1UWLA 2QT9A 5FFNA 3H5RA 2VZ0A 1IOVA 1UC8A 1NURA 4YH1A 4M46A 3IEVA 3HBMA 1O0BA 3DT6A 4LN1A 3HACA 1EAYA 2QE7D 1ZUNA 5LLSA 3ZQKA 3LL7A 3UANA 2C4VA 2RAPA 5EE9A 4E11A 3IPCA 3TLZA 1WG8A 2PKYX 2L19A 2IC5A 1B0AA 1GUDA 3MQFA 2FF7A 2OBMA 2YYSA 4NYJQ 2B37A 4GX2A 4PYLA 1MJHA 3QLVC 4CKBA 1CHNA 2UYGA 5HFNA 4QO7A 1QGYA 3LZDA 5BNFA 1T1IA 4C3OB 3JALA 3ELBA 1B3RA 3C3AA 1G2IA 3L41A 1R64A 2VTVA 1TM3E 2Y1XA 1SU6A 3RS5A 4G5OA 3D5QA 1HE8B 1G8HA 4TV8B 1XVUA 4G7OF 3ZD8A 1HQKA 3UMHA 2Z2XA 3V55A 3P96A 4A2NB 4FI3C 3BEDA 4RKFA 4LK2A 1RBQA 3EGCA 4RACA 1O5OA 5HRCA 3NETA 2C7PA 5DVZA 3TQFA 1B8UA 3CTMA 3H5LA 5AOCA 3GLGB 3LY5A 5I5EA 3LA8A 3QFTA 3OE4A 3FJYA 3ZHYA 4MWZA 2I65A 3TFOA 5H16A 1V25A 1YONA 3PFGA 2BELA 1BEEA 3PS9A 2KQ9A 3WIDA 2W2QA 1DCMA 3OLZA 3H4VA 1YRLA 3FVWA 4LC9A 2JAWA 5TPWB 2P9HA 3KOOA 3PCXA 3GEMA 4AS3A 4RK0A 3FTDA 4KQKA 3GV0A 1CUCA 1RAHA 1AKNA 3GPDG 1R88A 3HSSA 2DPHA 4WK4B 1Z12A 3W7AA 1DAIA 3HYSA 3JASB 1PS8A 1DQSA 3HFJA 1T29A 1E98A 1PVDA 4RIFA 4ZQFA 4ID9A 2P4HX 3NJ8A 5JECA 5FPPA 4ENWA 2QTNA 3VM6A 1UJBA 5U9CA 1YKFA 2CF5A 1S8NA 3LX5A 1ORSC 3KVRA 4QYIA 2GAQA 4ND5A 1ZM4A 2A88A 1YR9A 3LVRE 2WT9A 2V5AA 1W2HA 5KKNB 4BTVA 1DC7A 4B3XA 4DYVA 4WZBB 5KTMA 4X45A 4LRTB 1M1NA 1N3IA 1TUBB 3RYFB 5TPZA 3PB3A 3P32A 1E1RD 5LC1A 2D5BA 4C0XA 5JVEA 1EX1A 4HDSB 3LUPA 3JPYA 1W4RA 2BJVA 3D4PA 4EB3A 2AD5A 5LM3A 2YOGA 4ZVPA 4AQDA 4BE4A 4R9SA 4PFOA 4GVXA 3JQ8B 4I6JA 1KY2A 3GLIE 3EBOA 2FFQA 4E88A 1UFVA 3IMCA 4GECA 3W5SA 4UVIA 3LKBA 5BWNA 3JVIA 4BVGA 4QASA 4RVFA 5KWIA 2BLLA 2BHNA 2IBFA 1SIBE 2V3WA 3O38A 4MQBA 2XKKA 2OR3A 4LPSA 1V5EA 3MWLA 4PLTA 2PYZA 2X1LA 1TC2A 2VUSA 5H5JA 1REQB 4RKYA 1MTZA 2HF9A 5DYNA 4DXDA 2G4VA 2I4IA 5AM2A 4ZKDA 2J30A 1MEOA 4FD2A 2GX6A 1KDOA 2J3HA 4Y7DA 5A4MS 2IY8A 1Q20A 5TF0A 3V4ZA 1ZK4A 2XHZA 1GUYA 2D59A 3WSWA 2IYPA 2ODAA 2WRZA 4PX3A 4JQCA 5H9WA 5D3KA 1YFLA 3OFVA 4KLCA 4B80A 2ZBFA 5T7BA 2LCIA 5JV5A 1ZNWA 1Y1QA 3VU9A 2VXYA 3SYKA 1PX0A 3N75A 1C3XA 2Z5VA 2B9EA 2J7PD 3PRHA 4G01B 3WNBA 2F43B 3C7AA 5KTSA 1H6CA 3H2UA 3C5WP 3M1CB 3BE4A 2JLBA 4AY2A 4MARA 3BXEA 2FZEA 1EVLA 3OAAD 5JSYA 5HJ7A 1SVNA 3DEAA 3TNFA 4GE0A 3GR6A 4FDTA 4PQRA 1T1JA 1G8KA 2BKLA 3UB2A 2O8EA 3FYTA 4RDCA 1SHZA 3UGKA 3EY4A 5DLEA 4YP5A 1RZUA 2C2KA 1ZITA 1Z0IA 5EIHA 4IF6A 5L7WA 2FPOA 2QSUA 1ZCAA 2A7XA 4PYIA 1WXXA 2VK2A 2PGXA 1Z6AA 3BXOA 3M5PA 4N7RA 2Y67A 3AI7A 4LQDA 4YX9A 3BMNB 4JMLA 2J87A 3JQ6A 4ZVUA 2CB0A 1WNFA 4Q47A 3UOGA 1XP5A 4DVZA 4B8YA 3B78A 3K8YA 4PFJA 2R7RA 2FOIA 3IDSA 3OFJA 3OVMA 4ZCSA 4ARAA 3L4JA 2X19A 2ZUVA 5BURA 1EX7A 4MS4B 3RVOA 4ZI3A 1UF9A 2IBSA 1IONA 1E59A 2OA0A 3ZDRA 5JATA 2W6JA 1U2RA 1N0IA 4D9NA 4U02A 5LYYA 5T67A 5E4TA 2VPWA 2SKCA 4TKLA 3KVOA 5AJTA 5E9QA 1KIAA 2JGDA 2J3KA 2XUFA 1T6NA 3NQ41 3JQ7A 2IBTA 3TIIA 4I5GA 2F48A 4A91A 1D1CA 2Z8YM 4R8RA 4WRRA 3PDCA 5KCMA 1BD3A 2VH5R 1M2VB 3LKDA 4OINF 3V4VB 4YAEA 2PU7A 1FFAA 2QAGA 2JZOA 3SLKA 1AUOA 1DC4A 4TN5A 1MLDA 2E37A 4YCAA 3FLEA 4CX9A 4BVBA 1P2GA 2P6NA 2COKA 3BGOS 4ZOQI 4HWSA 1PTKA 5LDDC 4D98A 4PG8A 2XLBA 4Q15A 4F2GA 2H1FA 4WD3A 2YL7A 4P5DA 2PBZA