2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
b'AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
1SKQA 2JCSA 1E0AA 3AVQA 1MABA 5DGXA 1KO7A 4QL3A 5H70A 2P65A 1OE0A 4NYJR 3K70B 3W34A 1CKEA 1KI8A 5JWOA 4QGAA 4KXFB 4L16A 4XD7D 2F1IA 2A30A 2H7VA 4WAUA 3QG1A 3K8YA 3PUZA 1NN1A 4JL5A 1WBDA 3PXGA 4PQFA 4EPTA 1UJ2A 4P32A 2WAXA 3T1QA 3GLIE 2O8BB 2ZIAA 2GJSA 3Q7PA 3GLGA 1A7JA 3NWJA 1XJQA 3AVOA 2JJ1D 1E9FA 3UWKA 3SU8A 1X8KA 1OIWA 3A1VA 4AYTA 1RKBA 2BEJA 1V5WA 2RKOA 4ZDIA 1KMHB 4ZCLA 3U7GA 2NPFA 3O8BA 1FFHA 1R8QA 2FNAA 2FDCA 2HEIA 2JDID 2QRZA 2J45A 2ZRGA 4CDGA 3IBGA 4B3DA 2MSDB 3WHKA 2BHRA 4UNQA 2QROA 4CEIA 4Q48A 721PA 5L3SA 2GXUA 4L4UA 4A8JB 1II8B 1W7AA 2HCBA 2W0MA 2QAGA 1A2BA 4DEYA 2CCGA 2XJ9A 4AKGA 3TAUA 2PJRA 3JVVA 2YOGA 3TMKA 1W5SA 4MUAA 2IYYA 3OAAD 5FL7A 3WNBA 4AIIA 1Q1BA 4MUBA 2ZM5A 4UJ5A 3BH6A 1CLUA 3R8CA 3ICEA 5JSZA 1N6KA 4IFEA 1QF9A 5EXTA 3WXMA 1L4YA 3A36A 3QF4B 2FGJA 4IXMA 3AUXA 4NH0A 2HDNB 5LD2C 1P75A 1HY3A 1KI2A 5C4GB 3D7MA 4F92B 1YE8A 2DFTA 2UKDA 1GSIA 3AP1A 1VG1A 1CJKC 1SXJD 3EASA 1OXXK 1EFRA 1UDWA 5AUQA 1BMFD 3TBKA 1NIPA 1NJFA 1Z3IX 3CF2A 4JBWA 4ASUA 4QJ3A 5EUQB 1FQKA 1RVDA 4LPSA 2C77A 3NVAA 2RH5A 3GFOA 2GK6A 3U61B 1KI6B 1ZD1A 4EJSC 5C1BA 3P26A 4LHWA 5EUMA 1MRSA 1N6OA 4DJTA 2P6UA 3VR4A 1NIJA 2QPOA 3SR0A 3O8RA 2QU8A 1MV5A 4C0KA 4BFYA 4PHHA 5KTYA 4Q4JA 1QHHA 2WKQA 3VKHA 4LJ4A 4UXIA 2K5UA 2FFHA 2CVHA 3KQNA 2IYZA 3NEJA 2WV9A 1UPTA 1ZP6A 3TK1A 2ZRDA 4EIWA 5KDDA 2PZGA 1MH1A 4JLJA 4F4JA 1I4DD 1XEFA 1J99A 2WWXA 1DADA 1JNYA 1HT1E 1OFUX 1XB2A 4LV8B 1ZVQA 4AWXA 1HE1C 5CJ2A 3RDPA 4CT5A 1W36B 1COWD 1KSFX 2PX0A 2VP6A 4LYAA 4J0QA 1U90A 3A58B 5JJLA 3I62A 1RE0A 3HR8A 4GPTA 3VR5A 4BZPA 2GVZC 2FU5C 4TL8A 3G5UA 1SVSA 4JS0A 3F3YA 1IN6A 3FTQA 3VHXA 3NBXX 2D3WA 5F98A 2OT3B 4Q7JB 3RAPR 2PT7A 4V0OA 2BJVA 3FMFA 3GD7A 1MKYA 2ZUBA 2RGDA 1G8PA 2WICA 3FGNA 3TUJC 3FFBA 1P9NA 2IS4A 4XSHA 3TGPA 4PQYA 1E98A 3OF5A 2FWRA 4V0LA 3THYA 3ICQB 3SOPA 3TUIC 1JJVA 1VCNA 1MABB 3CUEF 3VR2A 5GADl 1SGWA 1R5OA 1XBTA 3P27A 2H1LA 3EAQA 1WMSA 4XTCS 2CE7A 5CK5A 4DUGA 1VDZA 5AK0A 5L3RA 1OH5A 4QNMA 1FZQA 2F1JA 1SHKA 3GMTA 2WBLC 2PL3A 1XRJA 3F8TA 3TAHA 4KJZA 4AK9A 4LC0A 3QKRA 2FPLA 4DSOA 3C15C 4BRUA 4CRWB 1G5TA 3BFXA 4W5HA 1YU9A 4M9QA 2RMKA 3MCAA 3GFTA 1XXHA 2H57A 4LDJA 1XEXA 4D80A 1DELA 2IYXA 2X19A 2YKGA 3KTAB 3PV0A 1YHNA 4JVMA 4OHYA 4GMDA 5CDFE 1DS6A 2G88A 3MD0A 3DZ8A 2LKDA 3ZVLA 5EXXA 2OE2A 3THXA 2JATA 1XPRA 5GJVC 5TDHA 2QN6A 4A6PA 4AD8A 1OYYA 1TU3A 4S2EA 3T12A 3TW4A 1N6PA 3FMOB 4JLDA 3WYGA 1ZU5A 2ZRBA 3GEHA 3LBHA 1ETUA 3LO5A 2P2LA 2CHVA 1OHHA 1MO3A 4TMZA 4NPHA 3BFVA 4D0GA 1CS4C 1DVRA 4I1OA 5FR2A 3QSYA 1Z07A 3W3AA 1E1QD 4BFXA 121PA 3K70C 3DOEA 4V0ME 3U3JA 5AUPB 5JSZB 2HV8A 3CPJB 1RJ9A 5IRCD 1J7KA 1ZM4A 1DAKA 1YZTA 2GRJA 5SZKB 4EAQA 4G5GA 2R6FA 3R9IA 3TR5A 5F2EA 1Z83A 4RD4A 3B7GA 2EFHB 4X8OA 2PZFA 5DSZA 1GM5A 4IOMA 2EW1A 4HLDA 3VTKA 3EG5A 1T6NA 3FKSA 1CJMA 1DE0A 2ODEA 2ODWA 4QBHA 1CBUA 5P21A 2ZSDA 1XP8A 4ZIRA 3CX6A 3VU9A 4JL8A 4A2PA 1ANKA 4HUTA 1GNRA 2O8FA 2GKSA 3EZFA 1P2VA 4LRWA 1E2GA 3BRWD 4UNNA 1NG9A 4TL7A 3P1JA 1I4LD 1SVMA 3ZH9B 4MYTA 1X8LA 1ZRHA 2F3TA 2QGZA 3QXJA 1QHHB 4QGGA 4F91B 4M22A 1M7GA 2IBMA 4X8MA 2ZRPA 3MSXA 2CDNA 1NBMA 2J46A 4Q9IA 1Z28A 1CR0A 2JDIA 2QP3A 3K0SA 4JZKA 4Q5IA 2YWFA 4Q4HA 2VYFA 4LHZA 4ZDWA 3RS3A 2B7CA 1HQCA 2G3YA 4FN5A 3MAAC 1G8HA 1OT3A 2AN9A 2FE4A 1Q3HA 1R4AA 4XJXA 2O8DA 5KUTA 4G01B 5CLQA 3TUZC 3U5ZB 3AVYA 4X8LA 2ZUCA 1G1MA 4L5BA 2RGGA 4BPBA 2WJJA 5JJKA 5AJZA 3G82C 1F5NA 1W4CA 3EPLA 3CR7A 1XCPA 1KO5A 5LPNA 3RRMA 1AQYA 3A6PC 4US0R 4EFMA 2J7KA 4LBWA 4MQBA 2XZOA 1WXQA 2WJHA 1W4BA 1P5ZB 4N0DA 3U3MA 2ZEJA 3W8NA 1HYQA 1BH2A 3AGQA 3B1ZA 1HEIA 2DYKA 2GEVA 3CKLA 2TMKA 2O8EA 1R10A 4B3CA 5HZKA 3WBJA 1Q3TA 4BEJA 4I81A 4LSGA 4Z8XA 4BFZA 1G64A 1JR3D 2PCJA 2QP9X 4Q21A 5FI0B 5DI3B 1GVNB 3T5GA 4DBLC 4WZ6A 3CR8A 1SZPA 2B8WA 4GT1A 1J70A 2CL6X 2X8AA 1G17A 5J5CA 4LJ9A 5JWHA 3RC3A 3W6PA 1VCOA 1KY2A 2G0TA 4BLTA 2ODBA 4PANA 1F3OA 5KDOA 4Q66C 4CYMA 2IS2A 4US1R 2XSZD 4B3FX 4PPQA 1U0HC 1NG1A 2GJKA 1Q1EA 3CZQA 4CEJB 3DO6A 3PUXA 3DM5A 4Q19A 5EP2A 4BFTA 3AH8A 3AUYA 3P4XA 3TQFA 3ZS9A 5DE3A 5K8LA 1ZUHA 2KBFA 1BIFA 5DH9A 1XU4A 2GXQA 5L3VA 1FOEB 2GWHA 2YINC 4HB4A 2QBYA 1Q1ZA 4V02A 4A6XA 2DWQA 3TVDA 1W36C 3FKQA 1N6RA 1MO5A 2CK3A 1W2GA 1XD2A 2WPDA 5UKDA 1BKDR 4PAQA 5DISB 3Q5DA 2HF8A 3ZD7A 3IDQA 1XWIA 5FL3A 1N6HA 2J0VA 2V1UA 4PO1A 3NTUA 2J0SA 4KYIB 4TQUS 4TZ6A 3B78A 4KODA 2BCJQ 4JL6A 4IDOA 4TYNA 3C5CA 2J59A 3JZMA 1CULC 3LY5A 4JLBA 1OXVA 4C7OA 1KSGA 3UMSA 5GJWC 3LAWA 1R5BA 4DSTA 3U7EB 1E2NA 1FTNA 2A9KA 1QZXA 1KO4A 2RGNC 4I1SA 4KCGA 4JLOA 2RGCA 1E9AA 2FEOA 3I4LA 1G19A 3KKOA 4Z8YA 1F6BA 3GLHE 2C2HA 1PJRA 1RJ9B 1YZLA 3M4YA 1VIYA 4R9UC 4HUQA 4D2IA 4BFVA 2I3BA 1N0UA 5GVSA 1VPLA 1MO6A 4GMXA 2FSGA 1KAGA 4IDPA 3ZLJA 4G1UC 4DKXA 5J4VA 4M1MA 1UKVY 3O47A 1LF5A 3QQ5A 1J8MF 4POAA 3EX7C 1Q57A 3OIVA 1OJLA 1TAGA 4IVRA 2ORVA 2XGJA 4M4SA 5BN5A 1NMYA 3SC3A 3A1TA 2WOOA 4GOJA 3BD9A 5HZHA 2G9NA 5DO9A 2BWJA 3QNUA 3B60A 1T8UA 1R8SA 1D2NA 3NBFA 3HDTA 1G7SA 1GKYA 3MWKA 2BMDA 4WIAA 1Z0JA 1GIAA 2RAPA 5F9HA 3ADDA 3B6EA 1C4OA 3AF2A 2NZJA 1UM8A 3I3SR 4A0RA 4W9MC 1LY1A 1XTRA 2QAGC 1DO0A 2FFAA 5C46F 5D3MB 2VSFA 1QHXA 1DARA 1Z06A 1NRJB 2D06A 1E9RA 4OJKA 3RVBA 5C2JB 2QT1A 1RRGA 1KZGB 1NVVQ 3FYHA 5G3ZA 4P31A 3AGPA 3GJ0A 4QHSA 3A1WA 5AJVB 2HLDD 4MH0R 3A1SA 1R7RA 3BC1A 3SFVA 4XVUA 3GLIA 2QMEA 2ZJZA 4KAXA 2IF0A 3CBQA 1D8TA 3I61A 4A0HA 3AVTA 5A4JA 1P62B 3NHAA 3NH9A 2ZRFA 1M8PA 5LDDC 3ZIAA 1IOZA 1HT2E 3NIBA 4BASA 2REBA 2J0UA 2LWIA 3QXXA 2J41A 4DCUA 4HYYA 4HAZA 1KZ7B 2QQEA 2B92A 4FCVA 2O8EB 3QVUA 5H1YA 5CITA 2ZRLA 4YDHB 1Z6TA 1IJEA 1JPNA 5GJBA 1D6JA 1MOZA 2ZRCA 3BH0A 1P6XA 1KKMA 5AWFC 2ZI7A 2QORA 4BEBA 1KK1A 1UBEA 3OE7A 4YXWD 5JBQA 1S4QA 2ZJ8A 3B9PA 3LBIA 2IEYA 3U4QA 5FPTA 4FINA 4MRRA 1PLJA 2GBLA 3Q8XB 4JLMA 2ZE8A 2ZETA 4L15A 2IC5A 4CW7A 4ABYA 2QRNA 3TSWA 5GJCA 3LDAA 2CLCX 3LW7A 1X86B 2O8CA 1Q20A 4DB2A 1SXJE 4P4SA 2H5EA 1XMVA 2P5SA 1KI7A 1U0JA 1CTQA 3GLFE 3I8XA 3RSLA 2HXSA 5FOUA 1C1YA 3LD9A 4RZUA 3CLVA 2O0KA 2FZ4A 2W2TA 3LRPA 3SYKA 1CU1A 3V4FA 3ZS8A 2BBTA 2PMKA 5FUVA 2WJIA 1T5IA 2RB4A 2BJWA 2FPKA 3DMNA 3QUSA 4MRSA 1DPFA 3KX2A 4PTLA 5B30A 4TZ0A 2A2ZA 1XEWX 3B1XA 1OH7A 2C78A 3K9HA 3I5XA 2ZJAA 4QJ4A 4TLEA 4NYMQ 4WW0A 1G3IA 2H17A 2W2XA 2YHSA 4OHZA 1KO8A 1JAHA 4A92A 2VO1A 2ZI4A 1XD8A 2AX4A 1U2RA 4B2IA 4R7ZA 4EPRA 3LXRA 2NIPA 4DT1B 1JXMA 4E07A 1A4RA 3U6KA 1N5KA 2IK8A 2A3RA 4NCKA 4M1YA 1KYIA 3R7WA 3TIFA 4RSGA 5BQ5A 3CRMA 2YV5A 1RIFA 1HQYE 2DWPA 4Z54A 5FPKA 3K0AA 3AF3A 2OFXA 1JQJC 4EQ6A 4YMVA 1W5TA 1EFUA 2IT1A 4DDVA 2F9MA 1VG8A 1Z6YA 4IHQA 4N3NA 4PC6A 2ZJOA 1U9IC 3CRRA 3T1VA 2GNOA 2R6GA 4M9XA 4MGIR 1G6OA 1Q21A 4ZDKA 1S3GA 2IYSA 1JI0A 4BFUA 2D74A 3T1TA 1G7TA 5SZHB 3F5FA 4LHYA 2IUUA 1A2KC 3EA0A 3QJYA 4XSGA 4DLWA 2FSFA 2ZS9A 2CHQA 3W5JA 1TQ2A 2XSZA 4B75A 4NE2A 3L8YA 3L82B 2ZI3A 5AJWA 2VHQA 2BEKA 1P9WA 4LV5B 4EPVA 2IHYA 3W3ZB 3DHWC 3R9XA 1OXTA 4DLSA 3BH7A 1N5LA 5JRJA 4GOKA 4B32A 1Z22A 4D0NA 1AZSC 5F9FA 3L2OB 4MGZR 4C2TA 3PUYA 4Z51A 3C16C 3AVVA 1KNXA 3EARA 4MYCA 4IVQA 4HZUA 4YLGA 1ZMXA 1JR6A 2ATVA 4O2LA 4LV6A 4XH9B 4HAWA 5EP4A 1IAQA 3QBTA 2GEUA 4CF7A 2R44A 3RLFA 3ZZ0A 4TL6A 1KJZA 1LVGA 1E69A 2BMFA 5HE8A 4WZAE 4Q02A 4S35A 2YC2C 3RNLA 2W2VA 3HWSA 3FWYA 4EDHA 2A7QA 3PVSA 1OFHA 1SVKA 4B3GA 3QI2A 3S1AA 2IS6A 1GL6A 3QBVA 4AKEA 3KJEA 3AKDA 3X1ZA 5TXGA 4F4IA 1OIXA 4EFLA 2PEYA 4JJZA 1H8HD 3EIEA 2W6ID 4NYMR 4C0SA 4KO8A 3B82A 4LHVA 4ARZB 1N0WA 3KB1A 5CDFA 4CEHB 1F48A 4Q03A 1W47A 1KK2A 2CHGA 3BXZA 3L0SA 2JJ2A 3VX4A 3DPUA 5CK4A 2ZRHA 1HA3A 4NCHA 1W48A 1G18A 1N2CE 4UKDA 1Q12A 2UZIR 4GBMA 3DOFA 3MG9A 2O5VA 5H68A 2ZAOA 4HLQB 2OBLA 2C04A 5EZ6B 4GFDA 2E9SA 1NNEA 2IS1A 1ESNA 1E79D 1OFTA 1RFLA 3B1YA 3K0CA 1E9CA 3A8TA 1SHZA 3U6BA 2OO7A 1XCMA 5HR5A 2IF2A 3T5DA 1Z47A 1ZAKA 2VP2A 1E6CA 3G0HA 4V0MA 2J5XA 1X1SA 4EUNA 4YDSA 4IOJA 4IDQA 5FBLB 1PZNA 4PC2A 2XTZA 4P4SB 4QG7A 5KPJA 4OI0A 1E99A 2AK2A 4E09A 3K9NA 3GFPA 1E3MA 1B0UA 3I8SA 4KHZA 1WF3A 3QG5A 4WXPA 1T91A 2WJVA 4XWOA 1Z2CA 3E5HA 1NJGA 4AG6A 1DO2A 2LCFA 3BE4A 221PA 4Q9HA 2JGNA 4QHTA 4D4LA 3VAAA 1W0KA 3BORA 4IRUB 1H65A 1RYHA 2FGKA 4HDOB 3THWB 4JBXA 1IJFA 4JT2A 3QKTA 5SZJA 2V4ZA 2QE7D 3KUDA 4FWIB 5KNDA 2AK3A 1O3YA 1NN0A 1J8YF 2ZRNA 1XF9A 2QENA 4MKIA 3HJNA 1P2SA 1F2UA 3QXHA 3SN6A 5J4LA 1W44A 3K0FA 3WHLA 2J87A 4XTRA 3LWNA 3R7WB 5JHGB 3MUFA 4RY2A 1LV7A 2ZJBA 1VCIA 4PC3A 5JZVA 1FX0A 2OSBA 2J7PA 1G6HA 1RRPA 2EQBA 3NDBB 3BGWA 4AKIA 1XZPA 1RRCA 3HYTA 1CRQA 2ZSAA 3K0AB 4GP7A 4JBYA 1Z6XA 4PFSA 3X1DA 2BM0A 2OBMA 2HYIC 4OQXA 2OLKA 4F7WA 1EGAA 1H8ED 3P20A 3MWYW 4HSEA 2VHTA 4UNSA 2ERYA 2DPXA 4WA7A 2OFOA 5IK2A 5E4FA 3X1XA 2DY1A 2Q9AA 3UKDA 5DN6D 4IDNA 5DNYB 3PG5A 4U02A 4CT4B 5L3QB 2GAOA 3BS4A 3FHOA 1JR3E 2GETA 1US8B 2YZ2A 1NVWQ 4EPXA 2VTKA 2FF7A 1EK0A 1V43A 3ECCA 5J47A 5FTJA 2ZRMA 4FMCF 4TMVA 4U5XA 4EFNA 1UDXA 2FX3A 3UG6A 1TL7C 2IXGA 1G8FA 3KKPA 1EX6A 4DC9A 3WYFA 1W0JA 1ZD9A 2BBWA 1FNNA 4Q9LA 5DIFA 3LX8A 3V9PA 3IGFA 4KVAA 4HLUA 2BM1A 1QBKC 1XCGB 2ZE5A 3WNCA 1F2TA 2E1RA 1ZC4A 4GP6A 4HAUA 2QPTA 5DYIA 3LLUA 4N1AA 5FOSA 4TLBA 2HF9A 4FIDA 2NGRA 3GPLA 3C5HA 3HPRA 1YZGA 5EP1A 3U3RA 2WAYA 3OFNA 5FPHA 1G41A 3DKPA 3EZ2A 4Q1FA 4WBSA 1G4AE 4Q1CA 1FMLA 4M1OA 4DZZA 1E2LA 1OB2A 4B43A 1XTIA 3IEUA 4Q7MB 4DIEA 1U81A 1Q0UA 2GXAA 4I99A 2A5YB 4B76A 2ZI5A 2GHIA 2W00A 3GLGB 2XITA 3EPJA 3MJRA 4DCTA 4WXRA 4XOIA 2V8OA 3AV0B 4KSCA 1YZUA 3L43A 4URYR 5J4HA 1TPZA 2VP4A 1A5TA 2IEZA 2VBCA 3FHTA 4BZXA 2A5GA 1DEKA 1A82A 2CE2X 1JAIA 4KV9A 5FTKA 2QT0A 2F1RA 5DLQC 4XVQA 2B8TA 1QVRA 4CEIB 2KB0A 1MO4A 1OYWA 4R2HA 3TE6A 5L3SB 5KHOC 5ANRB 2XB4A 4H1UA 5D3QA 1OKKD 1Z6GA 2QAGB 3GLHA 3KJIA 1LS1A 4FCWA 3AVPA 3RS2A 4HDQB 3IHLA 3DZDA 3WP1B 5AJXA 2OXCA 4ZKEA 4TSFA 4HDCA 4A1FA 4QBIA 4DDUA 3AKYA 3RYTC 2EFDB 2H8KA 5CYOA 2GA8A 5JEDA 5FI1B 4C0LA 3OZXA 5HKKA 3N70A 3IIJA 2FV8A 1F60A 2ATXA 1ZNYA 2FH5B 2C96A 2QTHA 1G4UR 2KI5A 4FMDF 2QA5A 1LW7A 1RYFA 3K70D 1TNDA 4GNKA 1JECA 4BUJA 5E95A 3VNVA 3R8FA 5CJPA 3FE2A 1OLOA 3WRYC 5JHHB 1QDEA 4JLPA 2VSOA 1AKEA 1S1CA 2Q3FA 4V0NA 4B3XA 4DLVA 4ZCIA 1H8HA 2ZPTX 4XD7A 5F3WB 1VG0B 3PEUA 4KFTA 4MKHA 4QFMA 2GZHA 3TR0A 1M1YE 2ORWA 2FG5A 3BB4A 3WMEA 2ZYWX 1XZQA 3QOFA 3IBYA 2AWNA 3NXSA 2GESA 3R9WA 1YZKA 2I1VB 1XTJA 2Q3HA 2XNDD 2JLVA 1T3SA 1VTKA 3H84A 4NP6A 3Q3JB 2ZI9A 2JJ1A 3QPVA 3IO3A 4OK6A 3QXSA 1II0A 3LV8A 1AQUA 4Q4JB 1E0KA 2WKRA 2PLRA 4Z1MD 2IWRA 2GBLC 2G83A 1KI1A 2J0QA 4D6PA 2ZRIA 5FPSA 2AXNA 1WE2A 1K8RA 1P4SA 1SKYB 1UADA 2R6AA 4TYWA 3I72A 4RZ2A 2YJTD 4URWR 5JS7A 1EWRA 1RRFA 3H4MA 2X1VA 4I1VA 5FBQB 2MMGA 2KJQA 1KDOA 2EWWA 2WWWA 1U8YA 2NTYC 4UXJA 1Q1QA 2V6JA 5TARA 3W6OA 2N46A 3CH4B 1GNQA 1RC8A 3ADKA 4C3ZA 4PPNA 3LLMA 3BAFA 4PSAA 3OAAA 3KQKA 1DAHA 2I4IA 1KDRA 2EU8A 4DCNA 2JA1A 3PENA 1FUUA 4MA4A 4RVCA 3VR1A 3C7KA 1JALA 3LVRE 4ILEA 1QHGA 2FN4A 3PIRA 3NKVA 3L8ZA 4TTPA 2V7QD 4TMTA 1ZM2A 5EE1A 2JJ8A 5SZIA 3U3KA 3REGA 3OEED 2IYTA 2WMOB 4O0MA 5FUWA 2GAAA 2Q6TA 2XEXA 1NN5A 1E1RD 2EWVA 5DHAA 1NLFA 2R62A 2V3CC 1SXJA 1Z63A 2AL7A 3TKLA 1BMFA 1F2TB 3GLFA 3A4LA 1JEEA 1Z8FA 1AS0A 1JEDA 3ZZTA 3THYB 2QUZA 2OLJA 3IPXA 4ERNA 5IF9A 4MDEA 1IONA 5B2ZA 4LZZA 4G5RA 4NHOA 1CR2A 3MLEA 1AS3A 3WYAA 3ADCA 1Z2AA 5BW8A 2JIZD 4KLZA 3W5IA 1CIPA 1D9XA 2ZJYA 3EWSA 4E5UA 3AVUA 1ZYUA 4BE7B 4ZI3A 1EFHA 5B58C 4KBGA 5G40A 3SYLA 4B34A 3A4MA 1E0SA 3ZVNA 1XDBA 1X8JA 3WP0A 4GRAA 1R0YA 4MKGA 1MT0A 2Z6VA 3QEOA 3QKRB 3ETLA 4AY2A 4MGKR 1CP2A 2CNWD 1JQLB 2ORIA 4NCJA 4URZR 4C4PA 4JSYA 4WZBE 3EXAA 1XXHB 4FXPA 1XEXB 2XZLA 4US2R 4TLAA 2QQ0A 3KKNA 3MMPA 1KNQA 2BBSA 2P67A 2NPIA 4PX9A 5DN6A 2VP5A 2ZE7A 1OV4A 1DAMA 3THXB 2Z4RA 1W36D 3RC8A 3KFXA 1UAAA 5DI9A 2Z5FA 5JFGA 3IKJA 4PZLA 5FOTA 1EFTA 5KNBA 2W58A 4FWTA 3UG7A 1COWA 5DHFA 5B64A 3DDCA 5KPDA 5EQTA 4IEIA 1AM4D 2WIBA 3TH5A 3VQTA 4PC7A 2ZYTX 4PPGA 2SHKA 1RPZA 1N25A 1FTSA 5AJYA 2CL7X 4ZI2A 3U7HB 1KTVA 1WA5A 1E2KA 3K09A 3GJ8A 3NBYC 4JIMA 2P6NA 3FOZA 5FUXA 2IYLD 4YONB 2N1BA 2OAQ1 3R20A 1DAIA 3I32A 4Q47A 3SBEA 2AXPA 2V9PA 3BB3A 1IY2A 2HYDA 1KO1A 3REFA 2WWHA 3QE0A 3AM1A 5G53C 3ASYA 1FP6A 5CB8A 1HUQA 2R2AA 1NLZA 2F3RA 5BYKA 3BJIC 2HCJB 1K5GA 4ZV4A 5EE9A 2ZROA 4PZYA 1WDTA 4UQOA 3KL4A 4OQFA 4BLSA 1ZCBA 4BLPA 2C95A 1ZBDA 4G5QA 1GRRA 1W4RA 2C03A 3H2YA 4K46A 4KSBA 1E9EA 1XTKA 4II7A 4C2UA 3U2QA 2BOVA 1WBBA 1TUEA 1S3SA 4QBGB 1XTQA 2Q21A 4GI7A 4ACBA 3ONWA 2P0EA 1KIMA 4LGMA 3EIHA 1KDPA 4NKRA 2QZ4A 4TQ9A 3UXMA 1UBGA 4UXHA 3V00A 3VU9B 3ZVRA 4ZIRB 1TMKA 3RS5A 4MRPA 2O8FB 1AS2A 3K0CC 1N0VC 2F9LA 3LW8A 3A1UA 3MWLA 2GXSA 4E22A 4Q1EA 4Q9JA 3FMIA 2UVQA 3BBPA 4JLAA 1CR4A 1QG4A 1RZ3A 3UIEA 4OBEA 1R0WA 2QMHA 3HPQA 2JEOA 1KJYA 1S1MA 5J4YA 3X2SA 4XWAA 2RCNA 1J2JA 2BKUA 5JS8A 1I4TD 4Q4HB 3PITA 4O3MA 3RS7A 2BVNA 2F43A 3C14C 3MJHA 4CZ2A 2VLIA 1NSTA 4QBFA 2O8DB 4EPYA 2WKPA 5JI2E 4L9WA 1L4UA 4URVR 5FL7D 3AB3A 4Q1DA 5KSOA 4EKDA 3VMFA 1CEEA 3F0TA 2WJYA 1E9SA 1OPXA 5BWMA 4IFBA 3FFAA 3UATA 2QL6A 3U60B 4UNPA 4LC1A 3EZ9A 4MGYR 1E1QA 3WY9A 2DB3A 4URUR 2A5JA 1IN4A 2W6JD 4D4KA 1E2JA 3WMFA 5A0FA 3LFUA 2BBOA 2DFNA 4O25A 5LB2A 4B6FA 621PA 3CB4A 1II9A 3TRFA 2YNMA 3CO5A 1IY0A 1E9BA 3EC2A 1M7HA 1FL9A 2FPMA 4F38A 2PZEA 1IY1A 4BLRA 1EFRD 3O8CA 4ASUD 4BRWA 4ZKDA 4QGHA 2FMXA 2L0XA 3BK7A 3SDZA 3SNHA 1P61B 4D25A 3GLFB 2BKEA 4JKYA 2QP4A 1N6LA 1OIVA 1DAGA 1U98A 2H16A 1AGRA 2GDJA 2QMUA 1HE8B 2O8BA 1IN5A 1ZIPA 3M6AA 4IXNA 2NMVA 2JLSA 2ZRKA 2IYVA 2BV3A 2O0HA 1TQ4A 2XNDA 3IIMA 3NC1C 3NHBA 3PEWA 4PO9A 5EE5B 3B9QA 3B13B 3JZAA 3N2EA 3KKMA 2WOJA 3CRVA 1KMHA 2CVFA 2RGEA 1DG1G 1NSFA 2QM7A 2AR7A 2JLWA 2G6BA 1TEVA 4M53A 1AN0A 2G77B 4XVRA 3SE0A 4E03A 4URXR 2XNSA 3OEHD 4PHGA 2ZJ5A 3GJ3A 5CIQA 2QBYB 1DBSA 4A8JA 1E0JA 1II8A 5EJEA 1N6IA 4M1TA 4MYUA 2E87A 5IT5A 3I1FA 3M1IA 4GZMA 1QG2A 1VYUA 3H1TA 2F6RA 2IUTA 1XD2B 2ZR0A 4LYHA 1MR3F 3TQCA 1Z29A 2Q9BA 3EWAA 6Q21A 3B1WA 3SHFA 4W7SA 4OQLA 3E2IA 1X3SA 5CM9C 5A5GA 4OHWA 5HCNA 1R6BX 4TWZA 3THOA 2N42A 2ZTSA 1P9RA 2VP0A 1ZJ6A 2JLQA 1E4YA 1NVVR 3SI7A 3GJ7A 3NBZC 4C7OB 1T5LA 3QF4A 2DWOA 5HCIA 2D2FA 4PAMA 2D62A 3KFVA 4HLUC 4QRHA 4PPFA 2ZAMA 1Z0FA 2JASA 1T0HB 2ONJA 2X2FA 1NP6A 1KI4A 3CONA 2GEDA 1E2QA 2ONKA 4OQMA 1JR3A 1U0LA 5K8TA 1E2EA 2WIAA 2Z43A 3C4JA 4QC2A 1KAOA 3CPEA 4D0LB 2EFCB 1N6NA 4RZXA 1ZNWA 4HUQB 4B2LA 4OJQA 4TN1A 3NC0C 1Z0IA 4HZIA 4A9AA 1KI6A 2RHMA 1E32A 3E1SA 1KJWA 1ZIOA 1OXUA 5JWRA 3SJAA 2AKYA 3PQCA 4DSUA 2QM8A 2XXAA 1DOAA 1QRAA 2ASEA 4QM6A 3D31A 3W90A 2P5TB 3RWOA 1DG3A 1EX7A 2QTVB 3LNCA 3ZZUA 1M34E 521PA 2CBZA 4DWJA 4DLRA 3SHWA 4N0EA 4M9ZA 2ZVQX 2WSSD 1Q22A 1GILA 5E3HA 4FI3C 5FTLA 2ZITA 1T9HA 2AWOA 1T8TA 4NYIQ 1G3UA 4WVFA 2QMOA 2J1LA 2GJ8A 2VHCA 5TB5A 4M21A 2CCKA 4BZQA 4BECA 4NTZA 2BC9A 1YR9A 2ZUDA 1AZTA 2OCAA 1UEIA 1VYVA 1E94E 3IQXA 2GF0A 5FTMA 1AJEA 1PUJA 2XX3A 3HR7A 4TT3D 5CLLA 4DLZA 3EIQA 2PBRA 1GUAA 2CL0X 2QTFA 3GCGA 4FD2A 2GK7A 5FR1A 4BLQA 3U44A 2NZ8A 1OFIA 2AD5A 1OHHD 1TF2A 2A78A 2ZI6A 2Z0MA 3T06B 2GF9A 4TMKA 4MITA 3QIAA 2VEDA 3GLIB 4O2RA 5AUOB 1TTTA 3P32A 1BYUA 2C99A 2QNRA 3KJHA 1NVXQ 3SJBA 4C0BA 4DLTA 4P4TA 4TYPA 3IUYA 3KKQA 1R0XA 3QENA 2J0UB 3KZ1E 3X1YA 4H1VA 1XMIA 1VKJA 1PLLA 3IIKA 4QGFA 4A15A 1QHSA 4F4CA 4M9SA 2ZSEA 4JYBA 2OILA 2C5LA 4QOSA 4L8GA 1CJUC 5CIWA 5E7MA 3SJZA 4LJYA 2H92A 1NN3A 1FP7A 5L8VA 3KQLA 2KBEA 2FFQA 1GNPA 4TLCA 4GL2A 3FKSD 2CJWA 4DIDA 1LFDB 3A37A 2D4HA 4BLOA 4IVPA 3CZPA 3U4QB 3UPUA 2O52A 1W2HA 4KI0A 2V55B 1UBCA 3KTAA 4XWKA 1HURA 1TUIA 2O8CB 4B35A 3VKGA 3RRZA 4BGDA 1XJCA 5JEEA 2LKCA 4PAOA 5IDVA 2ZR9A 2PJZA 2OCBA 4QJ5A 1N5IA 1GAJA 2WVJA 3FHCB 4Q18A 1NBMD 2UZ3A 3NH6A 3U3OA 2IYWA 2GZAA 3HU3A 3ZGXA 1ZM7A 2ODNA 1ELOA 2OCYC 2XZPA 4IW3B 3ZQ6A 4RKEA 4AURA 4G5OA 4DLXA 3FB4A 3AVWA 1GP2A 1M74A 4YC7A 2VF8A 4NYIR 1VIAA 1KI9A 3KJGA 4RZ3A 5AR1A 4CIDA 4C0AC 1G5RA 3KB2A 2RHDA 1N3BA 2HLDA 3FMPB 3QXCA 1OSNA 4KFUA 5J4KA 4AYWA 2XB2A 1EWQA 2KWIA 2VSXA 4LJ8A 1NMZA 3VX3A 5FOXA 2YWGA 4R71A 3W8RA 3BERA 3C41J 4OK5A 4TMWA 1R0ZA 1IN7A 3VFDA 4IJMA 2R6CA 2OEPA 4JVLA 4L9SA 4RFVA 3WRXC 4Q7LA 1KKLA 1FPMA 4WOPA 1YRBA 4NZYA 4LY6A 5KNCA 4ZCMA 1VHTA 2W6JA 1IBRA 1GL9B 2NO1A 3SQWA 1S2MA 1SXJC 4HAXA 4G5SA 3IEVA 1WRBA 2GCOA 3HYRA 3ND8A 4TYQA 3CPHA 4OHXA 4EQ6B 4PHTA 2ERXA 1UKEA 4BFSA 4PXAA 2A5FA 4P33A 3AP2A 4Q00A 4X8HA 3SZRA 4NCNA 2ECKA 2ZQ5A 5LB4A 4B6EA 1NI3A 2ZS7A 3RANA 2OG2A 2AFHE 4YXWA 3WBKA 3LQRA 5KSZA 1XX6A 1TX4B 3W6NA 2G1JA 1S9DA 2HJGA 2XTNA 2CMKA 3BIFA 5H8WA 1Z0KA 1OW3B 1ZM3A 4PO8A 1G3QA 3AF4A 4JVNA 2XXAB 2BMEA 3L0OA 3RABA 3L0IB 4AG5A 2NO7A 4BFWA 4JYCA 2VF7A 3BOSA 3RRNA 3GJ6A 3QF7A 2ZSFA 1KOFA 1ZINA 4OQNA 1FNMA 3IPYA 1G16A 4PZZA 4MKFA 2ZR7A 2QSZA 1CR1A 4FMCB 2OBNA 3OEHA 2CK3D 4LBZA 1XPOA 1XMJA 4TYYA 2XJ4A 3L0PA 4OI1A 2WPDD 1KMQA 2FSHA 2OUKA 4LWZA 1BYIA 3LVQE 4HZUB 1U94A 4JMPA 3T61A 1CRPA 3JVUA 3D3QA 2OV2A 2YWHA 2OM2A 2R8RA 1NL3A 2GCPA 3VHLB 1AK2A 2ZE6A 3HU1A 2IXFA 2PEZA 4P4UA 3AKCA 3UK6A 1OH8A 2OHFA 3K09C 4I1UA 3U44B 4A0FA 1U99A 1VYTA 4Q01A 4PC1A 3QPUA 3J81k 3K0EA 3S1AB 3UMFA 3OHMA 1YR8A 1UKZA 2Z83A 3K9LA 4G3XA 2IYQA 1R2QA 1ONBA 1BO6A 4K8OA 2DR3A 5DI3A 4YQFA 3DL0A 1OB5A 1ZC3A 1IM2A 1Z6AA 2QSYA 1E2IA 3B1VA 4HLCA 4KFSA 5CB6A 4LX0A 1KSJA 4H9GA 4IOKA 2KSQA 1TEXA 5IHPA 2O0JA 4U7DA 1L2TA 2KE5A 4ZDJA 1LNZA 4Q4AA 3ZD6A 3EW9A 4LJAA 4LBYA 4NL4H 3U7FB 1U9IA 3B8HA 4OL0A 2YYZA 1P3JA 5LBIA 1NY5A 1IXZA 2DCUA 3RSOA 4CEJA 1J90A 2YOHA 3PFIA 4PQRA 3TSZA 4JLVA 1GRNA 1SVLA 1NVUQ 4B47A 4MDFA 5TMPA 1UKYA 2CJWB 1Z0DA 2WHXA 2HT6A 1BOFA 1TADA 2FSIA 1T3HA 2CLSA 1ZW6A 2HUPA 1E2FA 4MRNA 4DDWA 4KFRA 2VQSA 4RJLA 3SS8A 1UBFA 3N2IA 3AF1A 3LA6A 3PEVA 4DLUA 2WWFA 4B73A 2WSSA 4RCYA 1ZCAA 5G3YA 2MSEB 3GEIA 2FA9A 4Q7KA 3EPKA 4LJ5A 2IA5A 4LYJA 3LX5A 4GSYA 2IXEA 2IWHA 1UEJA 4ON9A 4LJ6A 1G20E 4ESVA 821PA 1O87A 2GJAA 2HXYA 4HAYA 3EA5A 3PUVA 1XD9A 3DVLA 3KXLA 3GLGE 3MRSA 1E2MA 3CX8A 1I2DA 4DVGA 3T34A 4CGZA 2AHOA 4TT3A 3P4YA 4Q9KA 1ZNZA 4Q4LA 5JRZA 5FOVA 2C9CA 4DHEA 4FMDB 4OKSA 4P3YA 1DAFA 3QKUA 1A1VA 4IKEA 5HTKA 1U8ZA 4U00A 1W49A 5JJIA 2WMNB 3TVTA 3SEAA 1T4GA 2OCPA 3ZIAD 4C0JA 5EE0A 5FBRB 2W6IA 3KQUA 3ZVMA 1XTSA 2V1XA 3HU2A 3DM9B 1F2UB 2VHUA 1Z08A 3Q7QA 3ZQJA 3K0FB 3OIUA 2ZYVX 3NEYA 4R2IA 2RGAA 2NOAA 4R98A 1HH4A 1YJ5A 2C9OA 1FX0B 3FPAA 2GCOB 3C8UA 1R5NA 1E2HA 1IHUA 1W1WA 5JI3E 4GDFA 1NY6A 3FVQA 3HP1A 1KSHA 3Q5EA 1E2DA 3ND9A 2A5DA 4HB2A 1K5DA 2XOKD 3AKEA 3OE7D 3CH5A 2WWYA 1P7CA 1D2EA 4RD2A 3CRQA 1E79A 1IN8A 1GITA 1N5JA 2EYUA 4FMBB 3TJZA 5JLJA 1X1RA 1G3MA 2FEMA 3D8BA 5FBWB 3DEFA 1S96A 2JLRA 1PLKA 2ZS8A 4LYFA 4RFSA 2BCGY 4B2PA 5JCZA 3GJ4A 1ZUNB 2Q0HA 5FFMA 3UWOA 3IQWA 3NDPA 1FMJA 4FCTA 2Q9CA 1SVIA 2Y8EA 3RRYA 2QI9C 2B6HA 1JBKA 4A8JC 1GL7A 5AUNB 3T35A 4DXAA 3ZDQA 1U8AA 4KVGA 5D3MA 1S8FA 2WSMA 1AIPA 2VIIA 3VKWA 2VP9A 3CF0A 4ESHA 4ITRC 2IYUA 2IW3A 2VA8A 3B2EA 1WB9A 2ANCA 4OHVA 2DFKB 1EG7A 2OZEA 4D26A 1FUKA 4QM7A 1B23P 5J40A 4LBVA 5JCPA 3CIOA 1L7VC 1YQTA 2WM9B 4UNRA 1TQ6A 4ZPXA 4LJ7A 2QE7A 1SKYE 1P73A 4B3BA 5EXPA 2NO9A 1NKTA 3I92A 1G7CA 3AEZA 1LB1B 2PT5A 4TLDA 3ASZA 2NQ2C 4A0GA 2B21A 4Y0VA 4D81A 3M0EA 3CWZA 4NU0A 3D6TB 5HPYB 4Y0AA 2OESA 2ZVPX 2VRWA 3O8DA 1W46A 3LXXA 4LPKA 2FZLA 5JMTA 4EJSA 3GEEA 5KDLA 4IDHA 4B74A 3ADBA 5DYGA 2C8VA 1E2PA 1KHTA 4W5WA 1P2TA 4A2QA 4HB0A 5EXSA 4K81B 1H8EA 1TU4A 2AD1A 2FOLA 3KXIA 4OI4A 5FPYA 3VR3A 4C9BA 2G1KA 2QEQA 4FW9A 1Z0AA 1RW4A 4NONA 5FUYA 4Q4AB 4QXAA 5KO2A 1GDDA 2R6DA 3LBNA 4DEXA 1G21E 3AVXA 1T0JB 5K8UA 4DDTA 1JPJA 3IHWA 1NMXA 3X1WA 3VNUA 1XPUA 1SQ5A 4DCVA 3T1OA 1G9XA 3CRW1 2WWIA 4JLNA 3CWQA 1DAEA 2OXRA 2JLUA 1TF5A 4DLYA 2CXXA 1UF9A 2DBYA 2QG6A 2RGXA 4OK3A 2ZXUA 3GJ5A 4LI0A 3GLHB 3KQHA 5BN4A 2JLYA 1GRQA 1VHLA 1ZUIA 1JB1A 1G8YA 3CW2A 1BS1A 3MGCA 4B44A 5C18A 3I5YA 2JAQA 3ZYCA 4GOXA 2AFIE 2DHRA 5JECA 3V4RA 1ESMA 2D2EA 3VR6A 1GOTA 1KY3A 1NKSA 4YMUA 1PVOA 1EESA 5KU1A 4HAVA 2WWGA 4AC9A 1G8GA 1P72A 1XXHE 2PCLA 5FH9A 4IEEA 1KGDA 1Y3AA 2CLDX 2VHJA 2MSCB 4B48A 4DT1A 2X2EA 2WJGA 2XTMA 2OAP1 2YOFA 3DMDA 2QPAA 2D7CA 2IUSA 4M1KA 4BQSA 2F7SA 4UJ3A 3IO5A 3WNDA 4DSNA 2Z4SA 3MFYA 4D82A 2HJVA 1M2OB 3SBDA 3BFKA 5C4MA 1GKIA 3TSOA 4QNRA 1QVAA 3PJRA 1X6VA 1CJTC 2JJ2D 3PUWA 4LUCA 2GJ9A 1XMSA 1ZNXA 2Q3MA 2FJUA 3GQBA 4NDZA 1CJVC 1KI3A 2P6RA 2QY9A 1MRNA 1W4AA 4JLKA 5B57C 1XNJA 4RD3A 3QVVA 3K9GA 4ZO4A 3WMGA 2IL1A 5KSYA 4TL9A 2GZDA 1PV4A 2ZU6A 2REOA 4LK2A 3W9YA 3CNLA 1K6MA 3QKSA 4KBFA 4PSVA 4A2WA 1QHNA 1YR6A 1IXSB 2P3SA 3SYNA 1WGWA 1AA9A 2REXB 4RD6A 3UMRA 4JVSB 5HE9A 4JJKA 4A82A 1D2MA 3PR1A 3CNOA 3QEJA 1VECA 3UANA 5BXQC 1G5PA 4RFSB 4A4DA 2ZYUX 4BWYA 1FW6A 1OKKA 5FOWA 2WTUA 3CF6R 1D5CA 3CX7A 3EPHA 2IYRA 2WZQA 3GJXC 1SVWA 2PX3A 2VL7A 1LS6A 4G0NA 1IQPA 2W83A 1WCV1 1W0KD 2CCJA 1OXSC 1OF1A 1P2UA 4F93B 1HV8A 4HATA 2R9VA 1IXRC 2PMDA 2GILA 5TVKA 3ZJYA 2ZANA 4B71A 4NCIA 4LCBA 1YZNA 2NO0A 1LF0A 5G41A 3RWMB 4QKQA 1M6NA 2IX3A 4TMXA 3PEYA 5BN3A 4RKFA 1NBME 8OHMA 4LOAA 2I1QA 2YC4C 4KLNA 2C9YA 4ARZA 4B33A 2GCNA 1YRAA 4CEHA 1SXJB 1XEWY 2DFLA 1NF3A 2NO6A 3NG1A 2ZRJA 4TQAA 1GFIA 4M2LA 4NMMA 4TTQA 5LD2B 4YMWA 2OFWA 1T3LA 1FQJA 4RD1A 1G3RA 3B85A 4Q1AA 4Q1BA 3H0KA 2J7PD 1DTSA 1YZQA 3A4NA 3SFZA 1VG9B 1SULA 3PCRB 1WQ1R 5K8IA 2ZJ2A 4RCZA 1TF7A 3B5JA 4M8NE 4EJSB 3EC1A 2FFBA 4PSKA 3DKVA 4M1WA 2C98A 3BB1A 2VH5R 4Z1MA 2XOKA 2D7DA 2HT1A 5CM8B 2BMJA 1ZM9A 5IK2D 3RS0A 1KDTA 1LTQA 1M7BA 1JXOA 3CNNA 1ZU4A 1YR7A 1XFAA 1GKUB 3FDIA 3K1JA 3QY0A 5GVRA 4DCSA 3I73A 4OI2A 1PUIA 3K53A 4JT4A 1QHIA 2EFGA 1GWNA 4RD0A 3SQXA 4M0LA 2EVWX 3Q72A 4M1SA 2JLXA 4GZLA 1S9HA 1CF4A 2IHBA 3KUCA 3KXKA 3OESA 5M04A 2ANBA 4PR0A 2JLZA 4DRZA 1VMAA 2NG1A 2F1HA 3SJCA 4KU4A 1W0JD 3THWA 2ZSBA 1I2MA 3N5CA 4A36A 2XAUA 3TW8B 3LH5A 4OYHA 4MYHA 2GTPA 4NYJQ 2V7QA 5BYJA 3AQ4A 1L8QA 1P60A 5EE3A 2W0SA 3OIYA 5EZ5A 3GP8A 2R65A 4HEJA 5KOYA 3RS4A 4AI6A 2GVDC 2QAJA 3OEEA 1EXMA 3BWDD 1YKSA 2B7BA 3H86A 1E1RA 1WP9A 4AYXA 3AF0A 1QHYA 2H18A 4QHYA 5E7JA 1E4VA 421PA 4CVNA 4KITB 2BIFA 4XIGS 1Z5ZA 4HI0E 4V0KA 3Q85A 4TTRA 1VCMA 1G291 5CYPA 3OFND 1GTVA 1GZSA 4LHXA 4DUGD 1CXZA 1E96A 4C0HA 2V6IA 3QPWA 4NBSA 3LQQA 5EP3A 1KK3A 2QGNA 3E70C 1NLYA 2J3EA 4W5JA 1C9KA 1XJ0A 2JIZA 1EFCA 1S0UA 3TLXA 4YMSA 5TV2A 2ZREA 1G7RA 5KSPA 5KYKA 1HTWA 4AKHA 2BDTA 1Q44A 2EFEB 2YVUA 1D9ZA 4EPWA 1JJ7A 4JKIA 4DB4A 3IILA 1OH6A 5FTNA 3OIWA 2CEAA 4C0QC 2CNWA 4HB3A 2MMCA 5L3QA 1YVDA 2PH1A 3CM0A 4IOLA 3RHFA 1GG2A 5FBVB 1US8A 3QKSB 5E7IA 4D4JA 1ZD8A 4JSTA 5TY0A 1UFQA 4PHFA 3AP3A 3Q9LA 3EZ6A 1AKYA 3EZ7A 4MRVA 2G0NA 2F55A 2PLFA 4V03A 4YMTA 2VPPA 1AGPA 3T15A 2YWEA 2F43B 2ZU0C 2RGBA 2X77A 4I4LA 5ELXA 2V54A 4TSFD 2EYQA 3MWJA 1E9DA 1SVOA 2ZRAA 4C30A 5HKKD 4P0TA 4D4MA 3KDSE 1KK0A 4KYUA 1Y63A 2AKAB 1TQDA 2RGNA 3TNFA 2J9RA 1ODFA 4ACAA
chains in the Genus database with same CATH superfamily
2W70A 5JWOA 4PAWA 5CVDA 1TVCA 2B9VA 4R7TA 4HAIA 4JL5A 1WBDA 5LSAA 3BYZA 3EGWA 3HGTA 4D9CA 2DHDA 1A7JA 3KEQA 2YVAA 4WEQA 4AYTA 4ZANA 3CINA 4UVHA 4NNOA 1J25A 1L6IA 1D4ZA 3PRHA 4CEIA 3HBJA 5M7EA 1GPWB 3M82A 2EARA 1WMAA 4YL3A 4ZJZA 4BNHA 3I4UA 2BHTA 3DDOA 1H6AA 4DRHB 1XROA 2WIJA 3HCOA 1A7AA 3I30X 1VC2A 1YQWA 1UQTA 2HDNB 5IX8A 1W59A 1AKMA 5BSUA 3FCUB 3GVHA 3OJFA 1S2OA 1CNFA 5EUMA 4JURI 3JTEA 3ROKA 4AL1A 4MVJH 2Q8PA 1N8KA 3I04M 4EVRA 1QYRA 2K5UA 3A2MA 1HFWA 4AP5A 4BJHB 3SGLA 3UYKA 3I9OA 1RQRA 3MMNA 3D5QA 1XB2A 2YXNA 1MEJA 2CLEB 3JQDA 4CT5A 3EXIA 3BMCA 1H9TA 2FU5C 1W25A 4JS0A 2R4QA 4LNHA 3D8RA 2WR8A 1YO6A 5CT5A 4LDQA 1MKYA 2ZUBA 3CX3A 1ZKDA 4XSHA 2ZQYA 5FIUA 4EARA 2H2DA 2WUWE 3S28A 4LZPA 1MABB 1O77A 3ZCVA 4TMYA 2MSWA 2DHEA 3LCVB 3AR3A 1J07A 5E6RA 2QM0A 2WBLC 3C15C 1V5FA 1CCWA 2UXCB 3HK2A 4WGYA 4JIOA 2IYXA 3MZ0A 2YKGA 4JVMA 4H17A 3PVCA 1ZPDA 2BDUA 4JSRA 1QV6A 2VDWA 5JLAA 3LBHA 4OIQF 4CIWA 3KG2A 1M1YB 4U8GA 2FN3A 2ODQA 3VU3A 5MGNA 1NJ5A 4CKWA 5FLEX 4F86A 3LPMA 3UW3A 4HEAJ 1ZM4A 3ESRA 3OZEA 2JFHA 2RE8A 1SIUA 4IOMA 1OI4A 4LZOA 2AOWA 3T3EA 2ODWA 4INZA 5B55A 3CX6A 4Z3DA 2Q3DA 5FCDA 4BRSA 1SUCA 4F21A 4K9LA 3WL8A 2OC9A 2ZDGA 1ZRHA 4FDVA 4M22A 4J75A 3MSXA 2JDIA 1S6YA 2QTRA 4BBPA 4ZDWA 2IJGX 3OQ1A 2FE4A 1VJGA 1C41A 4R1LA 1G1MA 2PXXA 1JUDA 3R7DA 1AQYA 4US0R 4QWMA 1WXQA 3PEFA 4UARA 4B3CA 4LSGA 2ZIFA 3OZCA 5FCLA 1D0VA 3LCCA 2G62A 4GT1A 3M6UA 2H4JA 4LJ9A 4F71A 2QN2A 5BSGA 1IBMB 3U8VA 4M8IA 3V4SA 1IUKA 5EP2A 4BX3A 5DP2A 1BIFA 4I1YA 2PL1A 4JE9A 2CV0A 2J0WA 2YINC 2GR9A 3SD7A 3NO4A 1W2GA 5UKDA 3V1KA 2J0VA 1NFQA 4DWVA 2UUAB 4EO4A 3R0JA 2ZXEA 3TXYA 2QN9A 3QWIA 4HYEA 1CUXA 1OXVA 4M8KA 1YKGA 1P18A 3TNLA 1Z82A 3CLHA 1I5OA 1Q1NA 4RGQA 3REQB 3KEMA 4Q4CA 4D2IA 3O4IA 3KHSA 5C8XA 5D3ZA 5D85A 1NHWA 4UU1A 3P9KA 5JAPA 3JQEA 4ID3A 4NQRA 1GEEA 1T2VA 4O6MA 3NTVA 1IXKA 1BS2A 3HXTA 2VAPA 4OJTA 3OA2A 1ZOIA 1GIAA 2RAPA 4R2XA 1F38A 2AJBA 4EOGA 2G36A 1E9RA 4OJKA 1DHRA 4YRBA 3BC1A 3OECA 2QU7A 4ER0A 4ER7A 3ODGA 1RI3A 2DYRC 3UJ9A 2ES4A 2B30A 3R7CA 1IUNA 5AD1A 1J9EA 1EWKA 3WLOA 2GCGA 4YDHB 1Z6TA 1IJEA 1JPNA 1YACA 2QORA 4JEUA 1QIKA 1C2YA 2SBTA 3VR5H 1AUPA 2F48A 1PLJA 3Q8XB 3ANXA 5IHXA 2ZETA 2VWQA 3H5WA 3R24A 4RANA 1L7CA 2RB4A 2MOKA 1KEPA 1ZAYA 4MRSA 2MHCA 4KXMA 2ZJAA 2XF8A 2BFWA 2R8BA 2IK8A 4RPJA 2I8LA 2YV5A 3D4PA 1FQOA 2DWPA 2GAJA 4XOUA 2FZEA 1W5TA 1EFUA 1BH6A 1WM1A 3CRRA 1P5HA 3ZWBA 1Q21A 1S3GA 1H2FA 4LHYA 4XSGA 2PMBA 5MFZA 4B75A 3N7AA 3Q7LA 4XCVA 4UU0A 2PPLA 3L8YA 4CG2A 3VSEA 2PNJA 4DA9A 4Q24A 3I9KA 2HWKA 1KWGA 1Q3KA 1KNXA 4YLGA 3GCDA 5DLJA 4G4SP 3IX7A 3WGIA 2H1RA 4PINA 4TL6A 4NAHA 3MCVA 1NUQA 4B3GA 4QEZA 3WGYA 1C50A 4C7VA 2W6ID 1R12A 3JWEA 4NYMR 4Q03A 1KK2A 3GRKA 3UV3A 1CUBA 2NU6B 2O5VA 2NSYA 4JLWA 1RP7A 1E9CA 4JENA 4FUQA 3IQCA 2J5XA 3VZSA 4IDQA 3GFQA 3K9NA 3NM4A 1RWMA 2EIMC 4BQOA 4Q9HA 2NAFA 2NLOA 3EEQA 5IN5A 5C53B 3RV4A 2AZMA 5KNDA 3TTWA 1MMAA 1J8YF 3QUAA 1UXHA 3WLAA 5JYCA 1ZX1A 5TPWA 3ZEIA 1CGME 2OSBA 4MV5A 1ENOA 3WLKX 4CTMA 4QBTA 3AR9A 1U0RA 3CRZA 3V42A 4ZAVA 4MR8B 2NSFA 3BTOA 3SEZA 1ORTA 4ARAA 2OWEA 4QGBA 4CN9A 3F5MA 1KJ9A 1B2RA 1EJ2A 3AINA 5C31A 1O6BA 2LRHA 1F4PA 2OB1A 3W4YA 2IUYA 2DQSA 2P9CA 1EH5A 1EX6A 4LYDA 2EQAA 3PHBE 2YWBA 2YWRA 3DDHA 2UYCA 4FC6A 2ZE5A 4HAUA 5K0JA 1GU1A 4UHEA 2HF9A 2PZJA 4RS4A 3RQSA 1YZGA 4L1KA 3AF5A 2PF4E 3RYLA 3UHPA 1U81A 1X1QA 4U6NA 2YJ6A 4M55A 1NZEA 1T24A 5THKA 3UOGA 4R8RA 2IZOA 4OSEA 3WK6A 4ETNA 2F1RA 3NMJA 1CY4A 1XN1A 3M2PA 4XUDA 4O4JA 4D96A 5DLQC 4UZFA 3PA8A 4R2HA 4OSPA 1OKKD 3B2QA 3BWBA 3FPGA 5LLSA 4R8SA 1BHJA 3PNVA 5HKOA 3NRJA 4QQ8A 3SX0A 3D59A 4E15A 3PHCA 2DUMA 4YUZA 4FK8A 4X3CA 1O3UA 5DXFA 4HGYA 3BWEA 1Y4SA 3QI7A 1DBQA 2PE5A 1NPYA 1XTJA 4A5SA 2XQKA 2JLVA 1GEGA 2FWJA 3H84A 1T36A 2HA0A 5JADA 5LBUA 4DJFC 2QW0X 4A0SA 1L5QA 4I1VA 3K5PA 1VB5A 3B52X 3SZ3A 3VR1A 4HFKB 4RLSA 1EUDB 3PVZA 3WBBA 3L8ZA 4ZTUB 2I4TA 1CUCA 3HLZA 5AHOA 3REGA 1RXCA 4NJMA 3VC1A 4BLVA 5ADHA 2FR8C 3A1NA 4L5CA 1L4BA 4PPYA 1GXSA 3WWOA 5IF9A 1Q16A 4EELA 4KLRA 4E5UA 1R0KA 4KBGA 4I4NA 3VXKA 4R2KA 1EJ0A 3VZBA 3KUUA 5L40A 4NCJA 1XDZA 1XXHB 3TOZA 3VAZA 2FRDA 4U4AA 1EK1A 3AB8A 2B3TA 3DDSA 1M83A 5EKUA 1A50B 3GAAA 3GW8A 4TUYB 1Y3FE 5AI6A 2LVBA 1Y8CA 3PYXA 3AXSA 4HXGA 2DX7A 2P6NA 2ZAYA 2NM0A 1QS0B 4G5HA 3RJ9A 3FTCA 4BVGA 4DARA 2QTCA 2H08A 2VDUE 1LC0A 2UXBB 3TG8A 1AMOA 2G5GX 4H7KA 4BUZA 3SC6A 3TLGA 1FNBA 1I6LA 1BBHA 5D1NA 2E55A 3NUZA 1LPOA 5THXA 1GZVA 3HDVA 3T6JA 2QZ4A 4C4RA 1CRZA 3N3AC 2YASA 3A1UA 4NBRA 5LMNB 3JAMA 5C32A 2Y0DA 2DQKA 3KQSA 1RZVA 2LTAA 1KQOA 2XD4A 5J4YA 3EXG2 4W1SA 5JZBA 2ZUSA 2F43A 3KC2A 4QBFA 5JI2E 2ZJ7A 3TSAA 4ZT7A 4UNPA 1WQ4A 5BNTA 1DX9A 4Q82A 3W04A 1F0PA 1I7PA 1E9BA 3LO8A 1U6HA 3IR7A 2X4IA 3C8HA 4LS3A 5K4GA 4P5PA 1RSZA 1C3JA 4I6GA 3CLUD 3FPJA 1JFFB 4XJSA 1D7OA 4JKYA 1DWUA 5JRDS 2M6SA 2H16A 1WUYA 1XRQA 5EJAA 1E6LA 2YH2A 2ZIXB 5BMOA 1UJCA 3ELBA 4DL9A 5DK4A 2G77B 2F3SA 3C74A 1G5HA 4OJNA 2JRCA 1E0JA 1II8A 4MYUA 1L1RA 2DM6A 3SZGA 3TGWA 1PWXA 3FIUA 4MYSA 4H7FA 3P19A 3KB8A 1RXWA 4C3EA 2QX8A 3RVQA 1T5LA 3HVHA 2B83A 4RJTA 1E59A 1NP6A 2DP4E 1VIVA 3TPZA 4IMPA 1N6NA 4RZXA 4HUQB 4HZIA 2RHMA 5FUBA 5C81A 4RHFA 3PXCX 3IJPA 4OHKA 1YA7O 1C2TA 4MWTA 1I3LA 2QD2A 2Z2ZA 1M5RA 3H1FA 2OCIA 4N0EA 1CIVA 4UBJA 4B4VA 4CIAA 2ADMA 1X7XA 2ZZKA 3TULA 1AZTA 1XNQB 2WMDA 5K0BA 1RKQA 4EFKA 3OX3A 1GUAA 5ISMA 1R1DA 5IH7A 1J4AA 1Z75A 2PHZA 1H6DA 3QWHA 5D00A 2BR4A 3O7WA 3W3AD 4DLTA 4TYPA 4ZOLB 2A6HF 1HLFA 1Y89A 3NT2A 4L08A 4F4CA 4M9SA 1O5OA 3W7VA 1DAOA 1YI0A 2H92A 4JX8A 2C3UA 3N6VA 5L8VA 4TXHA 5EJGA 4G1EB 3B6MA 1LFDB 3KZVA 3V4VB 1XZAA 3RE1A 4DC1A 4ZZ3A 2QD5A 3V6LA 3OEWA 4ZYLA 3SS9X 3VKGA 2LKCA 4HWGA 5B3AA 3LK6A 4QJ5A 1M8FA 4NFLA 4JI0B 3IQFA 1MG5A 4JH0A 2VYVD 4IZIA 3EIXA 3ZJ5A 3QOYA 4DLXA 3AVWA 4EYQA 3GHYA 3VPAA 4LJ8A 3A2KA 4Q15A 5DM2A 3MUNA 1WUTA 4IJMA 4PQGA 1FPMA 3FD8A 5EJ2A 2PU7A 3IL2A 2NO1A 1V5IA 3W5BA 1GTL1 4L7VA 4EQ6B 4PHTA 5LYJB 2PGNA 1YDHA 4QDOA 1OBHA 2GH1A 2ERCA 3CE6A 3OP4A 1S9DA 4BNIA 3DAOA 3ICCA 3RB8A 4JJ8A 1G3QA 1VE9A 4CMIA 1U3WA 1NVMB 4EW6A 5GOZA 1H3NA 3DOOA 2O3RA 5AVUA 3ENNA 2FRDC 4V3CA 3SZLA 3QBJA 4CUJA 3T5PA 5EXDA 4JC0A 5HS4A 5CDGA 4F2GA 3W77A 3GPDG 4YIKA 5JASA 4JGBA 4FU0A 2CMFA 4XIYA 3C7TA 4IO1A 1OB5A 1Y8ZA 1YNOA 1Q5PA 4I2VA 2Q2VA 4IKPA 3IXLA 2AMVA 3U7FB 2H8AA 3KK0A 3TSZA 5C1PA 3WODF 2NZYA 1XA4A 2FSIA 3O8OB 2HUPA 2XKBA 3NV9A 4YN0B 4II2A 3NHKA 4DLUA 4P4LA 5C4IA 4ESVA 2QRGA 2NADA 4QYSA 3D0QA 3WAJA 3CWCA 4DLLA 1U9YA 4AMYA 5JC1A 1ISGA 1ZK1A 4U00A 4C0JA 4DBZA 3ADPA 3KQUA 3ZVMA 4G07A 3DM9B 2EP8A 3ROPA 1JSXA 2LV8A 1CDDA 3MX3A 2JC3A 3OC0A 2QNBA 1L9XA 5FZTA 1KSHA 3Q5EA 3ZWDA 4S1OA 5KB3A 1K5DA 2O1XA 2WJAA 5JSHA 1T3GA 1LVKA 5DS4A 4P98A 2Q49A 2VTBA 1A9YA 1QVXA 1S96A 1EVJA 1RABA 4XGIA 3BD8A 4UVGA 5BSFA 4E4RA 4ZP1A 4O63O 3TTYA 3CTPA 3B8EA 4YT2A 2D3TA 3QHAA 3TL3A 1K6EA 2IXPA 1DXHA 1KFBB 1ODCA 5IY5C 1YWGO 4ZEVA 4JDUA 1RJEA 4J9UE 1G8KA 2CNNA 5HPYB 4LXYA 5HUHA 2ZVPX 5L0IA 4FKZA 2GD2A 4JUDX 1VDMA 5E9QA 3GEEA 4IDHA 2CF6A 1QTNA 4W5WA 4YV0A 3FCEA 2CXTA 4NK4A 4C9BA 2OO5A 1Y7TA 4L6CA 2XCRB 1YDFA 5KO2A 4RXMA 5TPZD 4D3YA 3I64A 4ZODA 3ZPXA 4E6EA 2JFQA 1WTYA 3ZHZA 2GERA 1L5ZA 2VRCA 5DLPA 4MP8A 5C0OE 2JLYA 1U1DA 1RT9A 3ONEA 1RRKA 4YIHA 4LZJA 3ZYCA 1J22A 3A2LA 3CISA 5ENZA 4YAWA 4JTDB 3NZEA 3K2IA 1V8ZA 2VHJA 1GQSA 4HGQA 5BSRA 2PFKA 2EHJA 1M34A 2QPAA 4HWOA 1NI4A 4KGXA 2Q27A 1NBOA 2BD0A 4IDGA 1XWJA 1WEHA 2BGLA 4FFBB 3ZBPA 4UULA 2HPAA 3ESQA 2GSWA 3G5LA 4Y18A 1ESCA 1QKJA 1MAHA 4TL9A 4RC9A 2C4HA 1O5HA 1YR6A 3ZV6A 1HE4A 3A6ZA 3O39A 1T3TA 4IIUA 1JU4A 4XLPF 1XWWA 1H22A 4YTEA 1E5LA 2WZQA 1QH8A 1SVWA 2QUIA 4F72A 4BWGA 2HMTA 4G1FA 2PMDA 1K2WA 2ZANA 5ILGA 4CODB 4GEKA 3ZXUB 3O91A 2TMYA 3JSEO 1KMIY 4E1BA 2NTEA 2XPCA 3A4NA 1KJ8A 2P35A 3ANNA 3CLRD 4BMPB 2WTEA 2IY7A 4A26A 2FFBA 4FLMA 4YL1A 4XUCA 3BB1A 2XOXA 2H51A 1GKUB 3FDIA 4U7FA 1DKPA 4ENRA 2OG1A 2JLXA 3ZJUA 1OW8A 4GZLA 3FUCA 3KXKA 1QHFA 1VMAA 4G56A 1I2MA 1RYEA 3AJMA 1TAHA 3QLEA 2C83A 1G38A 5A04A 1MIHA 3TO5A 3MT7A 2QTMA 3CURA 1BKYA 1G6KA 2R7SA 2L6GA 3UAWA 3KIPA 1E4VA 4A23A 2XDAA 4BKOA 4FFLA 1THMA 3CFYA 4NBSA 2WUDA 1SG6A 3BQMB 3DCIA 2O7VA 4IG4A 4FN4A 1Q44A 3WKCA 4EPWA 4DJAA 3Q8WA 3GL9A 4CJOA 4EF5A 1ZD8A 4TQGA 3B71A 4MLCA 3AP3A 4MRVA 1YHYA 4L78A 4YMTA 1JEAA 2W9YA 1XK7A 2XLWA 2O4CA 2EYQA 4GMGA 4HQNA 4N03A 4P0TA 5LOVF 4RORA 1NW8A 1LDMA 4DEVA 2J31A 3UUWA 1U2GA 2QY6A 4WAUA 2QVLA 1ZGGA 4MJLA 4DMHA 2ZKIA 3KZXA 1Q17A 3KSUA 4MNTA 2UYGA 1KYQA 3V8RA 1IPHA 1OIWA 4LISA 2FPSA 3WKAA 1BTOA 1FFHA 3EXHB 4B3MB 4Q48A 2HCBA 1RHUA 3NBAA 2R6R1 1XTUA 4J0JA 3IUJA 1MFPA 3OAAD 4DR2B 4AIIA 5IN4A 1U8EA 3UH0A 5I9TA 1F9EA 8MHTA 3NT5A 1SC4A 1UZUA 2F9FA 3BICA 1HY3A 1SOVA 1GL3A 3NM5A 4QOJA 4Y9DA 4X7RA 4AUMA 4NG4A 1WKVA 1TU0A 2WB4A 2VZLA 4MRMA 1N6OA 5JPIA 1BVUA 5CT9A 4MPPA 2QU8A 3FPLA 2OO5C 1QP7A 1YYXA 4RJKA 1QHHA 4LJKA 4POOA 3HC7A 1V1MB 4YPFA 5A4MS 3EVGA 1ZVQA 4BJ6C 5KNBD 5D84A 2AUNA 4L8VA 5T3UA 1PV3A 2ZSUA 4RA6B 3A11A 2FLVA 3E2PA 3V1TC 4YV7A 2OT3B 4C3OB 1T4BA 1U6KA 3TUJC 3FFBA 1E3TA 2Z09A 4RSRA 2QMYA 4HD8A 1VJ5A 1PJCA 1JJVA 2NYRA 4CE6A 1XVIA 1U7DA 4BUCA 4N4WA 1XHLA 1YS7A 5BPFA 2YMLA 1HNZB 1U4OA 3DMHA 1QYVA 2FPLA 4LDJA 2X19A 3TCXB 2WAAA 2OVBA 3QOWA 5CDFE 3MD0A 3F4KA 1EBUA 5TDHA 5L45A 3KALA 3AFNA 3VUFA 4OUDB 3R3ZA 2CVQA 1ETUA 3G8DA 2X8JB 3AYXB 4EG8A 4D41A 1V41E 4JB3A 2BJHA 4O8CA 1MF7A 2W2QA 4LKRA 4YPOA 1DMRA 4ZO8A 4F1WA 3WK5A 4QQRA 3VOSA 5FV4A 2QUKA 4UTZA 4ICIA 4RD4A 3MPOA 2PZFA 4OFBA 3DZAA 2PBEA 1PYGA 2ODEA 3DNFA 3X2QC 4OMFG 2V4MA 5H81A 3ZHTA 4XYBA 3US6A 3ASNC 3Q7GA 4DIKA 3N6RA 3E0XA 3RS3A 5AMXA 1OT3A 2FW7A 1KFCB 3ZY4A 1GCGA 5A9SA 5CLQA 1X38A 3V7NA 3NORA 5LPNA 2XZOA 1IN1A 5AK3A 3H4VA 1T9GS 2GEVA 3C2QA 1Q1AA 3U7IA 5DI3B 3PDIA 1SZPA 3N8DA 2IPAB 4PW0A 1G17A 1IZZA 1VCOA 1YA8A 4MHTA 4LF4B 3B3AA 4US1R 3MJEA 4CQLB 5CXQA 3DM5A 1Y9ZA 3AH8A 3AUYA 5SYMA 1H23A 2I6FA 3F6PA 2HV6A 2CBGA 4RMNA 4JB0A 5DHQA 3QE3A 1N6RA 1VHQA 4NDAA 1L7DA 4YAUA 1YJBA 5COQA 1O5TA 5JT4A 4JL6A 1T4CA 4Y1RA 4TRJA 3ZR4B 2H63A 4Y30A 5GJWC 1BRMA 5CRIA 1NNLA 4I1SA 3K6RA 1HRKA 3TJ5A 2DUUA 1WEKA 1LCIA 2IYFA 1A8SA 5GV8A 1N0UA 3RUEA 1KNYA 2VC2B 5HFNA 4J03A 3OTHA 4DKXA 5J4VA 2QTWB 4YO7A 3FGOA 4RKWA 4KQ9A 2OKUA 3EMDA 4F2WA 2CY0A 1DX4A 3LKVA 3B60A 4WXMA 1GKYA 5F9HA 1MP0A 2L82A 1A9PA 1LY1A 1XTRA 2Q0QA 2XUGA 4Q9DA 2VSFA 2NNLD 2UAGA 1RRGA 5ILQA 4P31A 4QHSA 1UKAA 2ZJ6A 4XVUA 4KAXA 2IF0A 1D8TA 3MHPA 3ZIAA 5F28E 2F1KA 3JSZA 3B51X 1N5MA 2XMGA 3L8GA 4KQXA 2C2XA 3RT7A 1NF2A 4QUJA 3OCXA 5CNKA 2WL8A 4MARA 1KH1A 3O2NA 5FDFA 1G2IA 3PCXA 3G4ZA 3TSWA 4P4SA 1GYRA 4NS4A 1TC2A 1T01A 4YWHA 1ZO8A 2B99A 3LRPA 4HLNA 4NQFA 2CLMB 2WJIA 1Q84A 5K0SA 3LS2A 1DPFA 2YY5A 1DIBA 4OHZA 5B58T 3SAJA 3CRMA 3JAWB 2INGX 3K0AA 3TQRA 2ZXWC 4J0GA 4YMVA 4RETA 5F33A 5C1IA 1NQWA 3HBFA 3ETCA 4DYHA 3EXEB 1U3UA 3GQBB 2EPNA 4CQMD 5SZHB 1ZHXA 4LERA 1KZ9A 4EA9A 4N8SA 4QD3A 2PDAA 1RMTA 1A9QA 3MA0A 3ZYZA 2DULA 1VRCA 1WZNA 2V5VA 4QREA 2OUIA 2JFOA 3WDLA 2JVIA 3NR2A 4JMLA 1OREA 1FVXA 1FMVA 1HDRA 3O92A 3R7LA 1PSWA 4Q02A 3B3QA 3GN1A 1KJIA 2PAFA 1EEXB 1ZW1A 4AP6A 2H59A 3OOYA 3AKDA 4WERA 4E7OA 4WD3A 4E5YA 4YL0A 5IEJA 4CEHB 3EVFA 1CEXA 5L0CA 2ICAA 3PXAA 4DOMA 2VZ9A 3BXZA 3WWDA 4P54A 2DBRA 4MINA 2VYNA 2P2ZA 3DOFA 2ZAOA 1R37A 3R4CA 1XCOA 5IJ9B 2G40A 3UM9A 3WL4A 4R31A 1J0CA 1O94A 3HXOA 1KVRA 4QNNA 5JQWA 4FGUA 2V5AA 2ZBFA 4YDSA 5KHAA 4AUEA 5FBLB 1P0FA 1T91A 2X0EA 4D9BA 4FDUA 4R16A 4A7PA 1W1UA 4OB7A 2Q3JA 1S3IA 5E4YA 2QE7D 2HU7A 4FWIB 3L5OA 4PWZA 1H1LA 5C5EA 4JC8A 5A4AA 2H4YA 2QV0A 4R84A 1W44A 3K0FA 4RWZA 3GG9A 3M70A 4QT4A 2ICWG 1ZJZA 4GP7A 4WBNA 4GLBA 2IU3A 1NLXA 4F7WA 4F7DA 3M9LA 3G6WA 3FZNA 2XUFA 4CJXA 3X1XA 4Y1FA 3H2UA 4EY5A 4EPXA 2FF7A 2JFXA 1Y9DA 3WZLA 1M10A 2IXGA 4DC9A 4L4RA 2BZSA 4KAFA 2I3GA 2EF0A 4IIFA 3ROXA 5KOJA 1OA1A 3OJWA 5EIAA 4JUCA 5DYIA 2XZDA 4NESA 4N1AA 3VC3A 3HNLA 1WSWA 3U3RA 3NJ8A 3NB0A 3ESYA 4D3SA 1JKFA 5EZYA 3ITDA 4NJEB 2W00A 3DOHA 5AOCA 2IPLA 3L7LA 3WG9A 4B17A 2JAXA 2DUNA 4WNYA 5ECWA 2O59A 5AKGA 2JZNA 5KCZA 2HNAA 1JDVA 5L3SB 1FDUA 2XB4A 3JQ9A 4G1CA 3KJIA 3SCZA 2RD2A 5CFQA 1RFGE 3KM0A 4FYXA 5HIIA 2JPUA 3L1HA 4ZKEA 2QV7A 4PNZA 1GPH1 4N01A 1M3SA 2PVPA 4M8LA 3UMHA 1N0IA 4JBHA 1F60A 2IIPA 5HA5A 1G4UR 3HJFA 4RCVA 4ZU1X 3AOEA 1WZEA 3OOSA 4GZ5A 5F9MA 1TFUA 2XQJA 1DKOA 4B3XA 4DLVA 2I0FA 4V38A 4Q3AA 3ETDA 3OOHA 4ND8A 5AW5A 4RTPA 3LE8A 5E38A 2EDCA 2R5FA 5DYNA 2R1UA 1FUUA 1GYQA 3C7KA 3NKVA 1HK7A 3R40A 3FY4A 2R25A 5F77A 3QW2A 1EDBA 1HC7A 1D0XA 3OEED 3WLFA 1VLLA 5FUWA 1WNFA 2YDXA 1Z63A 1I2AA 1PX0A 3A4LA 4AUNA 4PE5B 2VPIA 5J5AA 5CGZA 1WZIA 4RIGA 5EZYF 4ZQFA 3CV3A 2W6PA 4JOQA 1EFVA 5JROA 3QKRB 1N75A 3ETLA 3EXAA 2IE8A 1TGYA 4DMLA 1X7YB 3WYCA 2WIBA 3NS7A 5C5DA 3VQTA 2CV1A 2GFIA 1C4XA 3WDMA 4EGCB 2LD4A 1FTSA 3ZLBA 3U7HB 4WACA 4DWWA 3RTDA 3KE9A 3GC6A 1KTMA 5JH7A 5CM2Z 4D8TA 4BO7A 4TGLA 2FWPA 4Z7QB 5BOSB 3DLCA 1HUQA 1NLZA 4K1OA 3ICOA 5IMBA 2J9FA 4IJVA 4C2UA 2M6RA 1NGSA 3Q6NA 3S8MA 1KE2A 1TMKA 3LXMA 4RHUA 1O94C 7MHTA 4FC7A 3K1AB 1CZUA 1V39A 1N7HA 3X2SA 2PPVA 3BILA 5EMNA 2FKNA 4FYJA 1DUVG 3I8OA 3K6SA 5KSOA 3QE4A 3R44A 2ZIGA 1P5JA 4LC1A 3EZ9A 4ZPJA 3WY9A 3K4QA 3LQ1A 4I9GA 4JGGA 1SEPA 3A3KA 2DI3A 2ZDHA 1X7WA 4JUIA 1LBQA 4DW8A 2XKKA 3C6KA 3UWPA 1EB8A 1W94A 1V1RB 1HE8B 3MQ4A 5EJIA 5ICMA 1IB6A 5AO9A 2CDRA 1SKMA 2C54A 4PG5A 4U9UA 1MNAA 2NU9B 1YB2A 3IAFA 3OA0A 3FPSA 2IUTA 1JG2A 4YJ2A 1E62A 4TSKA 4L8WB 3WLPA 1UFKA 2AFHA 4PPFA 2XWJI 1HSZA 2GEDA 3PGKA 2NZ2A 4B2LA 4ZXFA 2ZYRA 3E1SA 3U48A 1O7JA 2H4ZA 5DWDA 1DEXA 1W2WB 1VP9A 1W75A 1MCZA 3BA6A 4H0CA 1FJGB 4AN0A 2Q7OE 4MQEB 3JCZA 3JQAB 4MS3B 4NYIQ 3SF0A 1G3UA 3GM2A 2QMOA 4OGLA 3LNMB 1PUJA 3A6HA 3OLWA 2VNIA 4IQ4A 2QTFA 3GCGA 3S55A 3GZTB 1VLVA 3NGXA 4GRIA 3CEHA 5HHTA 1DTEA 5BQFA 1ZW3A 3IUYA 2JVKA 1H6CA 3ZY6A 2GM4A 2R60A 4H1VA 1XMIA 1QF7A 3JAKA 4J0DA 4QDKA 3T7CA 4YR9A 3GCZA 3NYMA 3RSZA 1WHSB 4BAZA 4ESEA 3ZC4A 1W88B 4IGAA 4INJA 4XCXA 4KQJA 1N2EA 5CU7A 3IAS1 4GLLA 2QRPA 3IIIA 3K4PA 2YJZA 4PAOA 1GAJA 3QFFA 4OYLA 3AG3C 4NXMB 3U3OA 3SS7X 3G9UA 5D1HA 4NNPA 1PFGA 4XUEA 1F1MA 1AKRA 4YJ2F 3ZDFA 5I5EA 1IHDA 2C59A 4CM7A 4B45A 1W35A 3EGIA 5EWMA 4FBMA 5CDYA 3EQ6A 4MGHA 3U4IA 4KH0A 3BGOS 3KQYA 4DANA 1J5EB 3E1KA 2A5FA 3V4ZA 4Z6KA 1QFZA 2ZTHA 1E1CB 5LB4A 3RANA 5NLLA 4K9OA 1J1IA 3IXMA 4PO8A 2O3JA 2RG1A 2FSPA 1XAGA 4OF4A 3R77A 5DOZA 3ZQKA 5ERYA 2XW6A 1KMQA 1U94A 2OM2A 1O6CA 4EL5A 5E3JA 5L3ZA 1TXGA 3UGOA 1MHPA 1JHPA 1UBTS 1IOWA 2HSZA 2IYQA 3R0IA 4YQFA 3E0QA 2AN1A 3ZHSA 4LX0A 4PY2A 1TEXA 3L41A 3DDZX 2NSGA 3NCHA 3ZK7A 3BXHA 1IJBA 3ROFA 2JFGA 3PFIA 1BS9A 4ZQHA 4REMA 1LA2A 4MDFA 2CJWB 4IJ5A 2WG2A 5E1OA 5B4UA 1ZRNA 3N2IA 3AF1A 3LA6A 3OQJA 3DMTA 1LI4A 2MSEB 2FA9A 1ZVJA 1GNTA 1HFEL 2Z04A 5ARCA 1V4BA 3WV4A 4R54A 1EXDA 3AIKA 5KMGA 2PANA 1U8ZA 2P9TA 1T4GA 2PBFA 2W6IA 4LXUA 1U28A 2OCLA 1F2UB 1RI1A 3GRRA 2H1WA 3PGJA 1VRWA 4AJ1A 3FPAA 3HCRA 1UAGA 5B3SC 3GLKA 2AZ4A 1OWMA 2G09A 4TWBA 4WK2B 3WIOA 1PEAA 4D42A 1BDIA 4RDHA 4YRKA 4ODIA 2B35A 3GJ4A 1ZUNB 1U1GA 2R7RA 4R8MA 2X2PA 3NQ41 3OOWA 1F20A 3NDIA 4DXAA 2AHRA 3FZQA 3AOUA 3ND7A 1S8FA 3CF0A 4YCLA 1LKXA 2RHLA 1QKRA 3DYVA 4CMBA 1L7VC 4IHJF 1OQCA 4QUKA 2I4MA 4DNPA 3N2LA 1G7CA 3KPUA 3AEZA 2XBMA 1N36B 2W6QA 4WWHA 4DKJA 3GJRA 2PJUA 3K05A 4IDAA 5JMTA 3RAJA 3DF9A 3QX3A 3I2GA 3KAQA 2FOLA 2G1KA 4QXAA 1R9JA 1G21E 4FS8A 3BCSA 3TEMA 3DE4X 5A4IS 3HKBB 3EFOA 3IP9A 1ZOSA 2AOTB 3CWQA 2GLTA 1MLDA 4C3DA 2FUEA 2W2NA 1XZFA 1PEDA 1ILEA 3OZGA 3UB2A 3MJFA 4NCBA 1G8YA 4BGVA 1QFJA 3CJTA 4DR7B 5F2NA 4HVCA 3FAJA 5JSUA 4KUHA 2X2EA 2EJVA 4B79A 1QIHA 5DASA 2YOFA 3L46A 3PRKE 4IFTA 1CJBA 1LV8A 2QRJA 4OFXA 3K32A 1RQPA 3MTAA 2XT9A 3Q9NA 1D6SA 3AI3A 1FXSA 4PN3A 4NE9A 3WMGA 2XDQB 2MHRA 5BWBA 1K6MA 4CLRA 1SBQA 4BNXA 1VPVA 4O4HF 3DZGA 1L5OA 3F7MA 1A98A 3V55A 5ILOA 5CDTA 1OKKA 2HMUA 3CF6R 4HX5A 1JWAB 4L9AA 3ZOKA 4G0NA 4ZCPA 1OF1A 1EAMA 5HCUA 3FNQA 4W82A 3E4DA 4GMKA 4GKVA 4NCIA 4UHCA 4QWWA 2RKBA 5LQMA 4GW3A 4TQAA 4PYQA 3M6WA 1FQJA 2IYPA 4RD1A 2OFFA 7ADHA 2BH2A 3FF1A 4FCCA 2BH9A 4EJSB 2XOKA 3VO1A 1ZM9A 5GWXA 4LRSB 4KVZA 3W8FA 4L07A 4OI2A 1IXYA 4P58A 4YDQA 5CPBA 4OU4A 1NT4A 4BNGA 4G97A 3MB5A 2DSNA 2GTPA 1XXLA 1WMFA 1DKMA 3H19A 3PIDA 4HTFB 2A0KA 3LZDA 2VB6A 4S2UA 5HGJA 1RCFA 4TTRA 1M6HA 2FR8A 2DPMA 3CMCO 3AZQA 2QGNA 1HTWA 1R0CA 4JCOA 3C4QA 4GQIA 3A9SA 3QRWA 2CEAA 1BMDA 1EZ1A 3W2FA 2J3JA 1E6WA 4F96A 3GVCA 5HS6A 1RR6A 5JZMA 4FT4A 4B82A 4Y2HA 1QGAA 3DMTC 1PI3A 4JQSA 2Q5CA 1WVMA 1ID8A 4K9DA 4JXJA 5ELXA 5JRAA 3VYUB 4P7KA 2PYIA 1I1NA 2OBFA 2YV3A 1MZVA 1BWQA 2KK1A 1BCRA 1B93A 3KNZA 1DB3A 4KYUA 3MWEB 1ZLYA 2J9RA 3W9SA 4AZWA 2I29A 1G8JA 1U28C 3IXQA 4L16A 4JYZA 1JHYA 4O1MA 3E9DA 3DLPX 4JXKA 2I87A 4Z4FA 1QNFA 5GMOA 1JDZA 5ELLA 2BEJA 2OXTA 3JVDA 1PZEA 4DGSA 2YQZA 2XLDA 4WDRA 1EE1A 2V6BA 1XU7A 3TAUA 2PJRA 1D2CA 5G02A 5IJZA 1LPPA 1QC5B 2ZM5A 3BEDA 4YRJA 2H7CA 3H04A 1N6KA 4IFEA 2HHAA 4LWOA 4HX9A 3Q3GE 3IRVA 1ABFA 5BNIA 3Q8LA 2PUEA 5C4GB 2O06A 3AP1A 3EASA 1C3EA 3TBKA 1NJFA 4W6QA 3LHKA 1LPBB 2A1IA 1H2AS 3NVAA 1ZDMA 3R5TA 4M49A 1T8WA 1WHTA 1Y7IA 1WZCA 1DC7A 4I1IA 4BFYA 3ZDYB 2OB2A 4HS4A 2FFHA 1ZP6A 2UUCB 1JNYA 5H02A 5B1HA 3T5MA 3UICA 1PR5A 1TK2A 4QJBA 4HEA1 4Z9AA 3NBXX 1JH8A 2BJVA 3PDHA 4LY3A 3M1YA 4HFJA 5TS2A 2IS4A 3MXTA 5AI4A 1XF1A 1YJQA 1PL0A 2QJTA 4NULA 5KC9A 1QZTA 3SR3A 4NHEA 1AURA 1PL8A 4DUGA 4ZVUA 1X42A 3HJBA 2XL6A 5EHXA 4BO2A 3HZZA 3NUGA 3T0GA 4YY3B 4L3VA 5ALVA 1IMOA 2OGTA 4YYZA 5K3FA 4K0DA 2CUNA 4XJTA 1WV0A 1S02A 2ZWVA 3NWPA 4NRDA 2Q6OA 2QD4A 1CP3A 4Y2XA 1ZU5A 1OXKB 1W30A 1RYYA 1U7TA 1J09A 5EYPA 1HLDA 5JOQA 1QPZA 3W3AA 3ZXIA 1KQ3A 1NLUA 4N18A 4V0SA 1N5RA 3C1OA 4KXUA 5JSZB 1F1BA 4L0DA 1YZTA 1WTCA 4EA6A 4C3UA 2WE7A 4JJGA 3EXG1 5B1EA 1LK7A 1L5GB 4NAUA 2FW0A 3KO8A 1AKVA 4GPD1 3WGVA 3CNQS 4OGFA 2IBMA 5HUQA 2J46A 4Q9IA 5KBYA 2B7CA 2VYVA 2OOCA 1ECBA 3OTQA 2QXTA 2ZUCA 1XMXA 2WD8A 4TRRA 3CR7A 2EFYA 3C63A 4EYSA 4IMJB 1W4BA 3KYJB 2QK4A 5DT2A 3JX9A 1XN4A 4R9SA 3H2JA 4PF1A 5MN5A 1CUFA 4FBLA 5EMMA 1WIWA 1G64A 1NURA