2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
3UPUA 2OCYC 1RVDA 3BK7A 4HUQA 4WA7A 2YWEA 2WKRA 4URXR 4R9UC 1COWD 5KHOC 1PLLA 1S2MA 5FBRB 5EE1A 4PPNA 3TGPA 5CM9C 1MT0A 1E2JA 4HZIA 3S1AA 1ZM2A 1CR2A 1AK2A 3VHXA 1U98A 1U99A 2DR3A 1G8FA 1U81A 4HAXA 2GETA 1NF3A 2ZU0C 4DIEA 1NLFA 3MWKA 4RY2A 1UBEA 3IIMA 1H8HD 3H1TA 2OCBA 4C7OA 3DEFA 1NVVR 2VYFA 3NBZC 3AP3A 2ZRIA 3D7MA 4M4SA 3KQNA 1KI8A 2RGCA 2P67A 3F8TA 5FOWA 2W2TA 3K0AB 3EARA 3B1VA 5IDVA 3TMKA 4DLRA 1XF9A 2MSEB 3MWJA 4G5SA 4RD0A 2XZLA 4C0QC 4IDOA 3TE6A 3BB4A 1ZIPA 4HLQB 1E9RA 4Q9LA 3FFBA 4MYHA 4US1R 3AVVA 3AVPA 2ECKA 3O8RA 3JVUA 1KI6B 2LKDA 5EP4A 1N6LA 2HJVA 3OZXA 3QNUA 1EESA 4XD7D 3E70C 1G64A 2N42A 2R65A 4LJ5A 1OXUA 4L8GA 5CK5A 3AB3A 3EIEA 3X1YA 2AL7A 3THWA 5AK0A 3C15C 4OQMA 1EGAA 1AA9A 1D8TA 1G5PA 2I1VB 2J41A 3MJRA 4LYFA 4CEJB 2NZ8A 3EPKA 3RANA 3K0SA 3B6EA 2ZRLA 4ACBA 3CPEA 2GCPA 2W6ID 2BBWA 3CX8A 3L8YA 4C3ZA 4ERNA 4DB4A 2DB3A 1SXJA 1DVRA 2HCJB 1NBMD 1WB9A 2H18A 3BH0A 3KKOA 4DLWA 2ZJ2A 1SZPA 3THOA 3PJRA 2AFIE 2ZRMA 2ZRCA 4XSGA 3QENA 1IY2A 4DHEA 3VAAA 3OE7D 4ESHA 4PSAA 2JIZD 1XCGB 1IY0A 2QTFA 3L8ZA 2DBYA 5EE0A 2GDJA 3WMEA 2YZ2A 1OSNA 2F43A 1S9HA 1D2NA 1R5NA 4PO8A 2EYQA 2Z6VA 1ESNA 2A7QA 2FE4A 3ZIAD 5H70A 2DHRA 3AUXA 1JAHA 1S4QA 1F48A 5KSPA 2QM8A 1TMKA 1FL9A 2IYUA 2JLUA 1VMAA 5FTLA 3IQWA 4D81A 5EP1A 4BRWA 1A2BA 1Q3HA 1DO0A 2FU5C 4H1UA 1TX4B 4QJ3A 1Z0DA 1E4YA 2ORVA 3DMDA 3T5GA 4PO1A 1E1QA 1KIMA 5AJZA 4A8JB 3QG1A 4UXJA 4D80A 3ZD6A 1E99A 2ZJZA 1OKKA 1RRFA 3KQHA 4MUBA 2R44A 3LQRA 4OQFA 4O2RA 1M6NA 3W3AA 4TLCA 3W9YA 4ZDIA 3WBKA 2WWXA 3I1FA 2CEAA 2GJAA 4FW9A 1Z29A 1WQ1R 2YJTD 1E2QA 3CR7A 1DTSA 2QORA 4M1KA 2VEDA 4QGAA 4C0KA 5L3VA 2XNSA 4EPYA 2QAJA 1GG2A 1M74A 1TEVA 2F1JA 2ZRHA 2OG2A 2ZRNA 3DMNA 1JAIA 4P3YA 5DYGA 4Q7MB 1EWRA 4LJ6A 1P9RA 4HI0E 5F3WB 1XU4A 1VHTA 4ON9A 4M21A 2PZEA 1NLZA 2D06A 4MKGA 3T61A 1XTKA 2P6RA 3GFTA 3KJEA 3Q3JB 2IK8A 1LF5A 2BJWA 4Q1CA 1XRJA 5FTJA 5FR2A 2KJQA 3P32A 3NWJA 2ZJ8A 1GAJA 1GUAA 3SU8A 1ZNXA 1H8EA 1U0HC 2ZRPA 3GEEA 1KNQA 2O5VA 2QSYA 2PCJA 2Y8EA 3OEHA 2W58A 4A92A 4M53A 3SJCA 4XVQA 4GBMA 2CVHA 1W47A 1N6PA 1UDWA 1W36D 1SXJD 2MMGA 1H65A 4JLNA 1DAFA 4WAUA 2AD1A 2RGBA 4V0ME 4IOJA 1RKBA 1EK0A 4OL0A 5B2ZA 2JDIA 1OHHA 5TARA 2N1BA 1GILA 4IVQA 3SJBA 4A4DA 2AWOA 1G4UR 4KFSA 4WVFA 6Q21A 2CL7X 4J0QA 3ZLJA 1FTNA 2FG5A 3DO6A 3K70C 2V54A 4ZCLA 2OO7A 2WMNB 2O8EA 2Q9BA 2DY1A 2IHBA 1ZW6A 4OQXA 1R4AA 4WXPA 2J46A 3TAHA 3AVUA 4BECA 2IL1A 2C78A 3NEJA 1GFIA 5G3ZA 3MG9A 3OIVA 1Z06A 3K53A 3VR1A 3RS3A 5FPYA 2GXAA 2GEDA 3J81k 3LLMA 1PJRA 2WJJA 4PQFA 2Q9AA 1OH5A 2CLDX 3F0TA 3AP1A 1W2GA 1YQTA 5KUTA 1FX0A 4HLUA 3U4QB 1R5OA 4A0FA 3UG6A 1QHYA 1ZUHA 1OKKD 4G5OA 1BKDR 1NVWQ 2OESA 3EZ9A 3UWKA 1RRCA 2QT1A 3NKVA 4OK5A 3K9LA 1TAGA 2J0SA 5SZIA 1Z8FA 3UMSA 3BORA 2R2AA 4HAWA 3WNDA 4A1FA 4B3BA 2FSGA 4OI1A 2VHQA 3ZH9B 1XCMA 3PVSA 2OILA 4US0R 2JJ1A 4KXFB 4DSTA 2QROA 4ZDKA 2C03A 5FBWB 1F5NA 4K46A 5HKKA 2DWOA 4FN5A 1E98A 1KDPA 4ZI2A 4TYYA 1A82A 2VRWA 4MH0R 5GVSA 2WKQA 2OFWA 2J7KA 2RGGA 3OHMA 2ODNA 3X1ZA 3QPUA 1ZVQA 2H16A 1XJQA 2WIAA 2WJYA 4AK9A 1XMJA 2ZRKA 4TZ6A 2PLFA 2BEKA 2ZE7A 3LLUA 3B1WA 1D2MA 2GVDC 4D4LA 4ZCIA 3EWSA 1W2HA 1FP6A 2YOGA 3QVUA 1FNNA 4XTCS 4IEEA 4Q1AA 5L3RA 1IJEA 1WBDA 1H8ED 2H5EA 1RZ3A 2QG6A 3S1AB 3U3RA 5B58C 3DZ8A 3N5CA 3OEHD 3QBVA 2Z5FA 4QBHA 4BLQA 1Q3TA 1Z6GA 2WJVA 2ZPTX 3TR5A 2V6JA 2PLRA 4DCSA 3LX8A 3QF4A 3HU1A 3CZQA 4M1MA 1GNPA 1QG2A 4IOKA 3TR0A 3ZVNA 2HYDA 4PQRA 3Q9LA 3GJ3A 2KI5A 1T0HB 2JDID 4NP6A 1KDOA 5TY0A 5AJXA 1QG4A 2WAYA 4EKDA 2JEOA 2QENA 1KI7A 2IC5A 4KYUA 4X8HA 5DISB 5TDHA 3LXRA 4TL8A 4KJZA 1Q0UA 3R8CA 3W6PA 4CRWB 3QVVA 2ZR7A 1JXOA 2RGNC 3WNBA 2ZJYA 2VHTA 3AGQA 1HV8A 3AKYA 1DG3A 1SVKA 1OFTA 3QKUA 1S3SA 3FKSD 3MD0A 4EPVA 1R5BA 4NYJQ 4UJ3A 4P33A 4N0DA 2EFEB 4IXNA 3EIHA 3JVVA 2ZJAA 3HJNA 1FUKA 3GLIE 2AFHE 1GNQA 3EPHA 3I5YA 3IDQA 2ZYVX 2CL6X 2A5JA 3R7WA 1QHGA 4WXRA 1T8TA 1II8B 1ZAKA 5EZ6B 2XJ9A 4AWXA 2ZI6A 3OEEA 4GP6A 3EPJA 2X77A 2V7QA 4JL5A 5FPTA 1SXJB 3DL0A 1MO3A 4BLSA 2ZRFA 3FHCB 3NBFA 4U02A 2FNAA 4BPBA 3BJIC 1QF9A 3IILA 5SZKB 2C98A 3K0CC 1L4YA 1NIJA 5KNDA 2XNDA 4M2LA 4RZUA 1SHKA 3EC2A 4Z51A 4TL6A 2H8KA 4EPXA 3SDZA 3LDAA 4P4SA 3WYFA 2DFTA 1W44A 1NMZA 5TV2A 4NE2A 5HKKD 1QZXA 3ADBA 2QAGA 3RC8A 4E22A 4RKEA 3WRXC 3AVWA 2OV2A 1N5LA 4I1UA 2Q9CA 4PAQA 2F43B 2J0VA 2BWJA 5FI0B 2JLQA 3IKJA 3IPYA 2DWPA 2P65A 2OHFA 3T5DA 5JS7A 2AWNA 5J4HA 3SJAA 3U6BA 2IF0A 1QVAA 2FZLA 4LGMA 1LS6A 1XPRA 2V6IA 4W5WA 3ZVLA 5HZHA 1W0JA 1SKQA 2HV8A 4JS0A 2ZRGA 3W90A 2XJ4A 1WA5A 1F6BA 3T15A 4IJMA 4OHYA 4IOMA 2J45A 4OK3A 2CHQA 1E69A 2ORIA 4MGIR 3RHFA 1X8JA 4II7A 5EP2A 1OB5A 1U8AA 4R2HA 5BXQC 5AWFC 1PV4A 1E0AA 3Q7QA 2J7PA 4A2PA 2ZIAA 3DKVA 2V1XA 4LWZA 2PT7A 3E2IA 3ZQ6A 1ESMA 4TMVA 3B1YA 1J7KA 3EG5A 5FOVA 4Q21A 1GITA 2IYRA 5DIFA 3U3OA 4JT2A 1GTVA 2ZTSA 1OH7A 1G8GA 1WXQA 3IQXA 4FMCF 4CEIA 3I92A 4YDSA 4DVGA 1VYVA 3B8HA 4DT1B 3KKQA 1NMYA 4G0NA 4TMXA 2LKCA 3RS0A 1W4BA 1EWQA 3LO5A 1W0KD 4TQAA 4CDGA 2PL3A 5ANRB 1PUIA 2KBFA 4PQYA 1WRBA 1FQKA 5EE9A 4BQSA 4C2TA 2NZJA 4E03A 4MYCA 4QHTA 5TXGA 3NG1A 3UANA 1SVLA 1QVRA 1E9AA 1S9DA 3QI2A 1G5TA 1VG0B 2CLCX 1WE2A 2IYWA 4KU4A 1X3SA 2EFGA 2CE7A 3OIYA 3NDPA 3SBDA 3WXMA 4D4KA 1QHIA 1FOEB 1VKJA 3AKEA 5EUMA 5FH9A 3QIAA 2EFDB 1ZJ6A 3G82C 3CIOA 4ZI3A 1F60A 2XNDD 4AYXA 3NVAA 3QKSB 5BQ5A 4M9QA 1R0WA 2QTHA 1GOTA 3B13B 3RRMA 2F9LA 1UFQA 5KSZA 4A36A 2OBLA 2VA8A 4QOSA 4TT3D 2X2FA 1W4RA 5BWMA 4GT1A 4ZDJA 2KWIA 2CCJA 4IVRA 3AQ4A 2EWVA 3TLXA 3WP1B 4YMUA 2IYZA 2WWWA 1G9XA 4K8OA 3L0PA 2XOKD 5A0FA 1EFHA 4AI6A 4DB2A 4TYQA 2CLSA 2NO1A 3LWNA 1AGPA 1ZRHA 3TUZC 1NKTA 1LF0A 2GZDA 4NTZA 4Q01A 3R9WA 4NYIR 1WDTA 3ZS8A 4A8JA 1WF3A 1CR1A 1E32A 1NIPA 1QHXA 1N6IA 1W0JD 2ZXUA 3MCAA 3BC1A 3FE2A 1SQ5A 3FFAA 2QZ4A 3M6AA 2C04A 1W4AA 4B3CA 1KI3A 2BBOA 3LX5A 2BCGY 2JLYA 2JLSA 1N0VC 2J7PD 3GJ4A 5HE9A 2IS6A 1E2GA 4KITB 2NQ2C 2ATVA 1V43A 2ZAMA 2ZI5A 5KDDA 5HE8A 3ZQJA 3DZDA 2VHJA 3CX6A 2L0XA 3CRW1 1FNMA 1T3HA 3A1TA 1ZD9A 1XP8A 2EQBA 4R71A 1M2OB 1NVUQ 1NJFA 1WMSA 2CCKA 4QBFA 3R9IA 2J59A 2YYZA 4MQBA 4NYJR 1OIVA 4F4IA 3RS4A 2CHGA 2YWGA 3DM5A 4URWR 5EP3A 3T06B 1X8LA 2OBNA 1KKMA 4PR0A 4DKXA 1Z0AA 5JLJA 4DCTA 1E2EA 1U90A 3BFKA 4X8LA 1GSIA 3MSXA 4PC1A 2AD5A 4OK6A 3QXHA 2OT3B 3IHLA 3VR4A 3IO5A 4YMTA 4QGFA 1KZGB 1ZP6A 1KY2A 2CBZA 4NPHA 1N0UA 2QRZA 4JVMA 5E95A 4Q4AA 5J40A 3QF4B 2ODEA 1JJVA 3C8UA 4M1WA 4FCVA 4LJ8A 4XWOA 1Z0KA 5EXTA 1YZQA 3LVQE 1IN4A 5CB8A 2OLJA 4EUNA 4TYWA 4KFUA 3RS5A 2QU8A 3EPLA 1D9ZA 4QM7A 4EFMA 2BBSA 4YQFA 2QE7A 4BWYA 2ZUCA 1RPZA 4BFUA 3EX7C 4LRWA 2B8TA 3PQCA 2REXB 4BFXA 2ZJBA 1HT2E 3SE0A 4Z1MA 4QKQA 3Q7PA 3GLGE 2RCNA 3BERA 4LJ9A 1YE8A 1YZNA 2V8OA 4JKIA 1N3BA 4V0LA 1YRAA 2GCOA 4LJ4A 4F92B 8OHMA 4HEJA 4URZR 3U4QA 4BFSA 4KO8A 3T1OA 1S3GA 4URVR 4YXWD 2QRNA 4D4MA 4PC2A 1NSTA 4P32A 5CLLA 2BJVA 5EXSA 5C4MA 1T0JB 4CW7A 4HLCA 4RZXA 3P4YA 4Q1BA 2JA1A 2ZS9A 2O8DA 4TWZA 4E07A 2BKEA 3LRPA 2ODBA 3VKHA 2XTNA 4MGZR 2ZRBA 3GJXC 4UNPA 3OESA 3CF2A 4A0RA 2GNOA 4KFTA 1DAKA 5DI3A 5SZHB 3FOZA 3X1XA 4L9WA 1DARA 2XB4A 4QM6A 1XB2A 1OLOA 2ZYUX 4V0OA 4PAOA 4ZO4A 5EXPA 1T5LA 2JLWA 4HAVA 2R6FA 3LVRE 5FOUA 2DYKA 1ZMXA 3X1WA 3K9GA 3GD7A 3R20A 1Q12A 2AN9A 2IYVA 2QPOA 3NIBA 4C0JA 4PXAA 3A1UA 4MA4A 3V4FA 1KO7A 1WCV1 4OI2A 1R8QA 4LUCA 1XTQA 1GL6A 3GJ6A 4Q7JB 4DCVA 2PEZA 3BB3A 3N70A 5FOSA 5J4LA 3A36A 1XD9A 3AKDA 1E2IA 1ZUIA 1JEEA 1KSHA 1UJ2A 3FTQA 2DFKB 3EZ2A 5B64A 4L16A 1HQYE 4AURA 2X8AA 5DHAA 4BLPA 5HCIA 1OYWA 4GNKA 1TEXA 3BB1A 1KKLA 3X2SA 2HEIA 3LW8A 5F2EA 1Z6YA 2B7CA 2RKOA 1ZD1A 3RABA 4MDFA 3CBQA 2OAP1 4M1YA 2ZUBA 4NYMQ 2PMDA 3ICQB 3NEYA 3K0CA 3KL4A 2ERYA 4HAZA 1L7VC 4KVGA 3D8BA 3C5HA 4AKHA 3KQLA 2WMOB 1TF5A 5EE3A 4LK2A 4DRZA 1E2KA 3EWAA 1IAQA 3DVLA 2OCAA 4A2QA 3CH4B 3KB2A 3LBNA 3TBKA 5H8WA 2IWHA 4CEIB 4XSHA 5UKDA 3CUEF 1JQLB 2QE7D 3E5HA 2XTMA 3U61B 2W00A 2QNRA 1II0A 1NRJB 3PG5A 3U3MA 4BLRA 4Z1MD 2ZEJA 2J9RA 2QP4A 3EZFA 1SKYE 5K8TA 1NG9A 3QE0A 1FQJA 3SYNA 3WY9A 2FDCA 3GLHE 4OHZA 4M9ZA 1NN5A 4B48A 4I99A 3B9QA 1G4AE 1II8A 1KGDA 1ZC3A 1SULA 4B35A 4CT4B 3ADKA 2ASEA 3L43A 2F3RA 3MFYA 1ZYUA 5D3MA 4A15A 4XVUA 2EWWA 2QMUA 2E1RA 2IUTA 4WZAE 3ZGXA 4BLOA 1L2TA 1RYHA 5AJYA 3QUSA 1T5IA 1WBBA 1O3YA 3Q5DA 1XD2A 5CJPA 1TF7A 4OJQA 1EX7A 5AUPB 3TVTA 1VG8A 1OB2A 1IJFA 3QKRB 5JJKA 2H1LA 2UVQA 4BZXA 2CDNA 2W83A 2WKPA 3DKPA 2JJ8A 4RZ2A 1C4OA 2FFQA 2WJGA 2XAUA 3K09A 4GOKA 4QHSA 2ZSBA 2A78A 2ZVPX 1UBFA 1CULC 1YZGA 5DO9A 3LH5A 3TKLA 4ZKEA 4IOLA 3REGA 2W2XA 1AS2A 5K8LA 3A6PC 2ORWA 4KHZA 1TTTA 2GVZC 4FIDA 1KSFX 4CF7A 2VSFA 2QN6A 4LYHA 1F3OA 5EUQB 4DLSA 1R2QA 4JVNA 5CDFE 5EQTA 5EE5B 1JR3E 1NY5A 4QFMA 1XPOA 1RYFA 3TSZA 2CVFA 1G20E 2HDNB 1N0WA 2ODWA 3CWZA 1CEEA 4Q66C 5KO2A 2GXSA 4S2EA 1VYUA 2GA8A 1JBKA 4NCKA 4CGZA 1I2MA 5A4JA 1CTQA 3C4JA 4JYCA 2J5XA 3FYHA 4XJXA 1DBSA 3L82B 2NO9A 3H84A 1JB1A 3GEHA 4B6FA 4M22A 1ZIOA 4DXAA 4FINA 1NG1A 3UATA 2AK2A 3HR7A 4GFDA 4PX9A 1M34E 1ODFA 3A8TA 1Q1QA 3PR1A 1GL7A 3EZ7A 4P31A 2GF0A 2G6BA 4HAYA 1KO1A 4H9GA 2NO7A 2NO0A 2OAQ1 3IIJA 1EFTA 1XTIA 4LX0A 3WMGA 4C0HA 4DT1A 1G5RA 1AQUA 2O52A 3RS7A 5CIWA 4L15A 4XWKA 3AKCA 3L2OB 1BYIA 5IK2A 1US8B 1NKSA 1YKSA 3BH6A 3LBIA 2BOVA 3WBJA 2Z4SA 3IO3A 2IUUA 1T4GA 4NONA 2Z83A 4OI4A 1G7RA 1N2CE 4Q4HB 1LB1B 5KOYA 3I4LA 3TNFA 4EPRA 2FGKA 1N6KA 3CNLA 4W7SA 3ZYCA 2C9CA 1Z0IA 2ZSAA 1XXHE 2OBMA 4GI7A 5H1YA 3LNCA 3TH5A 1GIAA 2OUKA 2DFLA 2X19A 4IDQA 1OH6A 1Z5ZA 5F9HA 2V9PA 5TMPA 1CS4C 1D5CA 2BIFA 4I1OA 4YLGA 5LPNA 3AF2A 1XPUA 3PUZA 1IXSB 4DCUA 1G291 4EJSC 5DE3A 3LFUA 3AUYA 4B32A 4NCHA 4Q4AB 2ZS7A 4BFZA 4F91B 3QKSA 2WWGA 5FBLB 3T1TA 4B76A 4Q03A 4GPTA 5JJLA 5FL3A 5K8IA 1ZM3A 4G5RA 3GLFE 4DDTA 1N25A 4GZMA 3IBGA 4DLVA 4OQLA 4KSCA 3O8BA 1XJCA 2ZREA 1C9KA 4TMKA 4DLTA 2TMKA 2V1UA 2AHOA 2Q0HA 1Q1BA 1A5TA 1CXZA 4ASUA 3MWYW 3AF1A 2F55A 1B23P 1TPZA 1W4CA 2JGNA 1BMFA 1U0LA 2UZIR 521PA 1SVWA 1CR4A 1K5DA 5J4KA 1UPTA 2GCOB 1P2SA 3QJYA 2JATA 1KO8A 4IFEA 4FCTA 4A6XA 1E1QD 5FTKA 3AF0A 3CNNA 3RC3A 3SN6A 1TQ2A 1JALA 4L5BA 3VNVA 1UKVY 5KU1A 4B44A 2ZI3A 2B7BA 4YMVA 2O8DB 4NYMR 5JI2E 3A1SA 1RE0A 3GJ7A 4JLKA 4C30A 4L4UA 2DCUA 2VP9A 2D74A 1EXMA 3O47A 1UEJA 2O8CA 1E2LA 4JLPA 3ASZA 3I62A 1OXVA 2PCLA 1DO2A 5FOTA 1X1SA 5DI3B 4XVRA 1U0JA 3NHBA 3B78A 2MSCB 4AKEA 2BDTA 3VU9A 3B82A 1R0YA 1RRPA 4FWTA 5E7IA 1FZQA 4M1TA 1QRAA 5J4VA 3L0IB 4IXMA 4Z8YA 3ASYA 4IRUB 4QJ5A 1E96A 3BFVA 2ZI7A 1M7BA 5KDLA 5J4YA 3RRNA 2WWFA 1HE8B 2YWFA 1O87A 1Z0JA 2W6JA 1GNRA 3BGWA 4V0KA 2R9VA 2QGZA 1AGRA 4TTRA 3T1QA 3FVQA 3RNLA 3TIFA 2YV5A 4IDPA 3WYGA 2ONKA 1TQ4A 4LSGA 4MKFA 2H57A 1E2DA 3FKQA 3A1WA 4Q7LA 3W3ZB 2WWYA 5C2JB 3SHWA 3PUWA 4US2R 5BN4A 1SVIA 3TUIC 4TTQA 2O8BB 4WW0A 5IT5A 1Q57A 1II9A 3GCGA 4P0TA 2QT0A 2BCJQ 2ZE6A 3PUXA 4JT4A 1AZSC 4ARZB 2Q21A 1OHHD 1UKEA 1TU3A 2NIPA 4BGDA 2PZGA 2O0KA 4KBGA 3U6KA 1L8QA 5JEEA 4DLZA 1XEWY 3CR8A 4Q5IA 4BE7B 4QRHA 1U9IC 3UMFA 4OI0A 1VG1A 3U3KA 2DPXA 2D7DA 3QBTA 1AZTA 1WP9A 3C5CA 3Q5EA 4GRAA 4MYTA 1ZUNB 4RFSB 1Z28A 4HATA 4JVSB 2IYXA 2AXPA 3ZVMA 1EFRA 2IWRA 4AC9A 2OXRA 3FWYA 1A7JA 4ZPXA 4B75A 2J3EA 3WHKA 121PA 2IUSA 4FMCB 1BMFD 1R0XA 4BFYA 4C4PA 4ZV4A 1CR0A 3HPRA 1NBME 5L3SA 3ADCA 4B3FX 1KHTA 4PHGA 4BEJA 2BMDA 4ZKDA 4D25A 1F2TA 3UMRA 2I3BA 2PX0A 1ZNZA 2FMXA 2ZRAA 5JRJA 2FPMA 5CK4A 1M1YE 1YJ5A 2ZI4A 5IRCD 5D3MB 1CBUA 2H7VA 1P62B 2KE5A 5EJEA 1IOZA 2IYSA 3PIRA 3AGPA 4RSGA 2O0HA 1XD2B 1E9EA 1VCOA 2WPDA 2WM9B 4LOAA 4NCIA 5H68A 2IYYA 1NJGA 4FMDF 3X1DA 2RB4A 2JJ1D 4DJTA 2BM0A 4GOJA 1Z2AA 4GMXA 4HB3A 2QL6A 3TQFA 2Q3HA 2GF9A 3G0HA 4WBSA 5DYIA 2GRJA 3SR0A 1P4SA 2FPKA 1ETUA 1E9CA 1RIFA 1Y63A 2IEYA 3EZ6A 2WHXA 3C41J 3KB1A 2CNWA 1KK1A 3IBYA 4IHQA 4LYJA 4NMMA 3RSOA 2IS2A 1G3MA 3SQWA 4B33A 3REFA 1OH8A 1P2UA 1EX6A 2FX3A 1A4RA 3KKMA 2W6JD 1WGWA 2K5UA 4G5GA 5DN6A 4MDEA 2JLZA 5DNYB 2YOFA 4JBWA 3CW2A 1KZ7B 5AJVB 5C18A 3GP8A 3FMPB 2HCBA 5FUVA 4DLXA 4EQ6A 1KJZA 2OFXA 1CU1A 1G3UA 2MMCA 4JL8A 3QEJA 4QG7A 2CK3A 2Q3MA 4ILEA 2REBA 1B0UA 3BAFA 3FMIA 4UNNA 5JS8A 2QEQA 1LW7A 3TQCA 3TSOA 2D4HA 3HR8A 2GXUA 3L0SA 1VTKA 1P2VA 1XNJA 1IM2A 3R9XA 2ZSFA 5KNCA 1UKYA 4AYTA 1OF1A 5A5GA 1W36C 221PA 3I61A 4MRNA 3QOFA 2RGAA 4PPGA 1M7HA 1E1RA 4JVLA 4A82A 2J87A 2XSZA 2HJGA 4TLBA 4B71A 4TYNA 3MAAC 4GSYA 3NH6A 4LHWA 4LDJA 1VIYA 1K5GA 4DUGA 1AM4D 2Z0MA 3ZVRA 2GAOA 1J2JA 2ZROA 1XZPA 1G7SA 2JCSA 1KTVA 4IKEA 3SS8A 4B6EA 5BN5A 1G19A 4A0HA 1P3JA 1SXJE 1G7TA 3THXA 3ZZ0A 1T3LA 4Q4LA 4RCYA 4W9MC 4DDVA 3N2EA 3K9HA 1JR6A 3IGFA 1E6CA 3DDCA 3KUCA 3OEED 4KBFA 4M1OA 3U3JA 5KTYA 2V7QD 5JJIA 1W49A 3PUVA 5L3QA 4FMBB 3QKRA 2B6HA 2P6UA 1VCMA 2WOOA 1K6MA 4ABYA 3IIKA 4MRVA 3KQUA 5C46F 4DC9A 2NOAA 1KK0A 2OSBA 4MGKR 1MRSA 4A6PA 5K8UA 1BS1A 3FGNA 4WOPA 2WPDD 4DDWA 1LV7A 3CLVA 3VR2A 1CLUA 1JNYA 1T3SA 1XXHA 5HR5A 5DSZA 1N6OA 2NTYC 1JJ7A 1PVOA 3N2IA 4IDHA 3MGCA 4M8NE 1OE0A 1E2FA 1TADA 421PA 1OXXK 3HYTA 2C95A 1KMQA 5LDDC 2VQSA 1BO6A 2VSXA 2EFHB 2CNWD 1ZINA 2QMOA 3CM0A 4LJAA 3A4LA 4V0MA 2C96A 4YMWA 3SYLA 1NVVQ 2CXXA 3BWDD 2G88A 4HB2A 2XZOA 4LBYA 1V5WA 3KKPA 2P5TB 4PTLA 4LBVA 2VH5R 3FB4A 5F98A 3AVQA 5HTKA 3EC1A 3HYRA 3GJ5A 3V4RA 2ANBA 3U7FB 5FFMA 1Q1EA 3W8RA 4KI0A 4O3MA 3CX7A 1JPJA 4LCBA 5G53C 2FSHA 4AG5A 3QQ5A 3GLFA 3B60A 4FXPA 1LFDB 3LW7A 2ZR0A 4QC2A 2R6AA 2BV3A 2CK3D 3CB4A 4PANA 2VBCA 3VNUA 1R10A 5FR1A 3RLFA 3KFVA 1QHNA 2QGNA 3A4NA 3PUYA 1I4LD 1JECA 4TZ0A 1EFUA 3DHWC 2DWQA 4EJSA 3I5XA 3UXMA 4NL4H 2CE2X 3W6OA 4F93B 3HDTA 4JLAA 1XCPA 4TTPA 5JCZA 3KJIA 2O8CB 3GLGB 1G1MA 4C0SA 2HT1A 3B1XA 3D6TB 2R62A 1L4UA 3FDIA 1Z22A 3PFIA 4NH0A 1YVDA 5FUXA 2ZE5A 3KJGA 5LD2C 5ELXA 5BYKA 1US8A 4XIGS 2D2FA 4C9BA 1JPNA 3U60B 4JJZA 4P4TA 4IW3B 3VU9B 4LPSA 2FV8A 3ONWA 3FHTA 5HZKA 2WAXA 1DAGA 4Q4HA 2I1QA 4B2IA 5CB6A 2XB2A 2R6CA 1GRNA 4K81B 4U00A 4Q18A 2HYIC 1QHSA 3U5ZB 5E7MA 3EASA 1XEWX 2WJHA 3W34A 1M8PA 2F9MA 4DUGD 2NPFA 1ELOA 821PA 1MH1A 2ZSEA 3NXSA 3AV0B 3PEWA 1XTSA 3BIFA 1G18A 5GJCA 3I72A 4CVNA 4MRSA 1R7RA 1E0JA 4HSEA 1MO5A 3MRSA 2IHYA 4D0GA 4G3XA 5JWOA 4Q9HA 3WRYC 3GQBA 1ZC4A 3OFNA 4TL9A 3RWMB 2N46A 3VHLB 2EW1A 2JJ2A 3CONA 2P3SA 2VLIA 3CH5A 5LB4A 5CLQA 1P7CA 4JBXA 3LY5A 4LY6A 3WHLA 2F6RA 4JSTA 5DHFA 4HLUC 1HH4A 1C1YA 3KXLA 5E4FA 2FPLA 2CL0X 1E4VA 2WWHA 4FWIB 4MITA 3D3QA 4P4UA 2GTPA 1U94A 5L8VA 3SZRA 2LCFA 3I8XA 5KPJA 2BMFA 2GK7A 2IYLD 1KI9A 2PBRA 3W8NA 5IF9A 4ZIRB 1UADA 4Q1DA 1E94E 1KAGA 2IYQA 2WICA 2B8WA 2J1LA 2ZYWX 3P27A 4BZQA 2ZS8A 4G5QA 5JWHA 3BE4A 5AUQA 4WIAA 4NKRA 3WYAA 4D4JA 1LVGA 2FOLA 3PEUA 1S8FA 1MOZA 2IYTA 2XZPA 2PX3A 3NC1C 3P4XA 4OBEA 4QXAA 5KYKA 4D26A 3CRVA 3GFOA 4B74A 4XD7A 1F2TB 3RYTC 2ATXA 3AVOA 2EFCB 2WWIA 2G1KA 2HF8A 3MJHA 4IFBA 4LJ7A 4A0GA 4MGYR 2FF7A 2QBYA 1VCNA 2J0UA 5DH9A 4AYWA 3CWQA 3U7GA 5G40A 1TF2A 4UJ5A 2A5YB 5JECA 1XEFA 2RAPA 2ZR9A 4RD2A 4CZ2A 4Z8XA 1W5TA 2ERXA 1SKYB 3BFXA 4U5XA 1F2UA 3TJZA 3GLIA 2P6NA 1DPFA 5FUWA 5KSYA 4HDOB 1G6OA 2C5LA 2E87A 4LBWA 4HDCA 3U7HB 1RC8A 1CF4A 3PEYA 4UXIA 2WJIA 1ZM7A 3CKLA 4TMTA 3K70D 1AN0A 2GILA 1U9IA 5JEDA 3HWSA 3CZPA 1XMSA 2RGNA 3CF0A 2QMHA 2XX3A 1AKEA 2ZANA 1T91A 4PFSA 3HU3A 3W5JA 3QF7A 1P5ZB 1GL9B 3CRRA 4PZYA 1NY6A 2YHSA 4JLBA 4D0LB 5CM8B 4EDHA 1DELA 1HQCA 4U7DA 2F1RA 2B21A 2XEXA 2AKAB 2O8BA 4EQ6B 4UXHA 4WZ6A 1IQPA 3ZIAA 3BBPA 1IY1A 1DOAA 4JLMA 2ZITA 3TVDA 4IDNA 1G8PA 2RH5A 3TRFA 3W6NA 3KZ1E 3T1VA 4ARZA 4B43A 1CRQA 3A37A 1OPXA 3OFND 2YINC 2Z43A 3ZZUA 2JJ2D 4LC1A 4QJ4A 4WZBE 3AVXA 1E9DA 4N0EA 2ZU6A 2C9OA 3OAAA 2VF8A 3QXCA 1R8SA 3H86A 3NHAA 5GADl 2KSQA 4B73A 3O8DA 4LC0A 2QQ0A 2BEJA 4MKHA 4D82A 5JSZA 1ZNWA 4Q48A 1P2TA 1JI0A 4QNMA 4BASA 3KXIA 3C14C 1TQDA 1J90A 1OFIA 4Z54A 4PSKA 3T35A 2BHRA 3C7KA 1CKEA 1T9HA 1W48A 1E3MA 2XITA 1QBKC 1ZU5A 2GEVA 3R8FA 4JMPA 1XBTA 1CJTC 3EXAA 3VR6A 1AQYA 1Z63A 3PEVA 1N5JA 1RJ9A 1KO5A 2QAGC 4JLJA 5FPSA 2HLDA 3Q72A 5IHPA 4LV8B 1YR8A 3BXZA 5SZJA 3TK1A 3THXB 1P9WA 2WV9A 5TB5A 4EAQA 3I8SA 1G21E 4Q4JB 1ZD8A 2AK3A 4A2WA 3LBHA 1NNEA 1E2PA 3LAWA 2QUZA 4I4LA 1FPMA 4KAXA 4KLNA 4Q47A 5L3QB 1BIFA 1BOFA 2RHDA 4TLDA 2REOA 1XWIA 3H0KA 2FFAA 3RVBA 1G3QA 1N5IA 4TN1A 1Y3AA 3VR3A 1IXZA 1RFLA 4RFSA 1G6HA 1HE1C 1XXHB 4YMSA 3ND9A 1CIPA 2GJ9A 4UNRA 4MYUA 2LWIA 3PENA 4HB0A 4OJKA 1I4DD 4EFLA 3MMPA 2GBLC 1YU9A 4QBGB 2AKYA 4GP7A 1CJVC 3G5UA 3JZMA 4OYHA 4ACAA 4POAA 3ZS9A 4JLOA 4V0NA 3PV0A 1CRPA 2NGRA 2W0MA 1PZNA 3AVTA 2GJSA 1E0KA 5GVRA 4HYYA 4LV6A 1W1WA 1Z0FA 2CMKA 2HUPA 2WSSA 4W5JA 1AKYA 1GP2A 1GRRA 1HA3A 1OYYA 2CJWB 2JAQA 4A9AA 3GLFB 1HUQA 1YZTA 4LHXA 4RD3A 2QSZA 4C2UA 3QY0A 3U44A 1DADA 5DI9A 4JZKA 4DEYA 4E5UA 5JWRA 2XTZA 2GKSA 4O2LA 2IS4A 2H92A 2P5SA 1TL7C 2QMEA 3EIQA 3U7EB 2R8RA 4GDFA 3H4MA 2A5GA 2FSIA 1N6RA 4TSFA 4GZLA 4EJSB 1R0ZA 4I1SA 1G17A 2RMKA 2P2LA 3K0FB 5JHHB 2FFBA 2YC4C 4LI0A 3IUYA 4JIMA 2F7SA 3UG7A 1VPLA 2F1HA 1DS6A 3OAAD 3THYB 2VSOA 4X8OA 5FBQB 4HZUB 4QBIA 3QPVA 2C8VA 1G41A 5G3YA 3K70B 1PLJA 4LHZA 1Z47A 1G3IA 2VP0A 4KVAA 2XXAA 4PHFA 4YONB 4RD1A 5GJBA 1G8HA 2F1IA 2GEUA 2FEOA 3MWLA 3KUDA 4PPQA 5FBVB 3BH7A 4FD2A 4X8MA 3ADDA 721PA 4DCNA 4M9XA 3PCRB 2CHVA 2ZYTX 4G01B 3ZJYA 2IF2A 1GKUB 4KV9A 2IS1A 2WZQA 1P72A 1XD8A 3U2QA 2HLDD 1VECA 4TMZA 1E9SA 3SYKA 3B9PA 4Y0VA 1ZM4A 2G1JA 4O25A 3T34A 1TUEA 3ECCA 1UBGA 5B30A 3HU2A 1KSJA 3F5FA 4BLTA 5AUNB 4KLZA 4ITRC 1A1VA 3QXXA 1UDXA 4A8JC 3IEVA 4DBLC 1J8MF 3IPXA 3NBXX 1TQ6A 4KCGA 4O0MA 4AD8A 1IHUA 2A9KA 4GL2A 4PC6A 4B34A 3KXKA 1YR7A 3MUFA 5KNBA 1Z07A 3QKTA 4Q7KA 3SOPA 1X86B 3F3YA 1W7AA 4ZCMA 3RRZA 2ZE8A 1XTJA 4JYBA 3BRWD 4MUAA 3UKDA 4Q1FA 1J8YF 4IEIA 1J99A 3GJ8A 4V02A 2OE2A 2IXFA 1HT1E 1PUJA 1QHHB 2RGDA 2BMJA 1R6BX 2RGXA 2GXQA 3RAPR 3SFZA 4PHHA 3RWOA 2R6GA 3VFDA 2WSSD 4QNRA 2X2EA 3E1SA 1G3RA 3GFPA 5HPYB 1KDRA 3K9NA 2MSDB 5CYOA 2BVNA 3FKSA 5EXXA 1IN7A 1Q44A 1X8KA 4ZDWA 2IXEA 2GJ8A 3QXJA 1FMLA 5C1BA 2QBYB 3GLGA 4B2PA 2J0UB 3FMFA 1KJWA 3PITA 4RKFA 5CYPA 3VQTA 1VCIA 5C4GB 4TSFD 1OJLA 4Y0AA 1YHNA 2VHCA 3RDPA 1G7CA 4RD6A 1NLYA 1FUUA 2FGJA 2HT6A 2VO1A 1NP6A 3GJ0A 2FJUA 1F2UB 1S0UA 3SFVA 3M4YA 3CO5A 3GLIB 3B2EA 1DG1G 3TUJC 4D2IA 3VR5A 5IK2D 2OCPA 2QQEA 1KI2A 4NBSA 1VHLA 1EFCA 2G3YA 4LJYA 2GCNA 5HCNA 2IEZA 2D7CA 2QPTA 4FMDB 4BRUA 1GZSA 4BFWA 5JFGA 2O0JA 1Z2CA 3TSWA 4IVPA 1GDDA 3B85A 3KDSE 2V4ZA 4B3DA 1XEXA 2G9NA 4NDZA 2WVJA 4RJLA 5GJWC 1BH2A 2G0NA 4F38A 2J0QA 1E2HA 2VTKA 3NBYC 4CT5A 4JKYA 3FMOB 1S1CA 1KK2A 5CJ2A 1KMHB 2JLVA 2GJKA 4R7ZA 3T12A 4HUQB 3GPLA 1P61B 2NO6A 3RSLA 5F9FA 1YR6A 1KSGA 4AIIA 1FTSA 1Q21A 5FTNA 2QP9X 3A1VA 2ZUDA 2GAAA 2QM7A 1LTQA 2QA5A 1SVOA 1BYUA 4RCZA 5JCPA 4Q00A 2ONJA 2ANCA 4NYIQ 3DOFA 5KPDA 1E2NA 4DIDA 2NG1A 2EU8A 1HY3A 4AKIA 3LV8A 3FPAA 4R2IA 2VP2A 1E9FA 1KI4A 1HEIA 4QGHA 4XH9B 3CPHA 4ZIRA 1GKYA 5JSZB 1FFHA 1P73A 3MLEA 1W5SA 1XJ0A 4XWAA 4TL7A 1MO6A 4ASUD 2HXYA 1MABA 4C7OB 4PO9A 1EG7A 1LY1A 2PJRA 1IXRC 4CEHA 2B92A 1XZQA 2XGJA 3ZD7A 3CPJB 1MKYA 2Q3FA 2O8FA 1RJ9B 1NVXQ 3KKNA 5B57C 1DE0A 3IEUA 2A30A 2ZETA 1MO4A 2OM2A 4S35A 4OHWA 3KTAA 1LS1A 2V55B 1W0KA 5D3QA 2IXGA 3QG5A 1UKZA 4JBYA 1OIXA 3P20A 2HXSA 2BBTA 2FFHA 1UBCA 4GOXA 4HDQB 4EPTA 3THWB 3IHWA 1Z6XA 1XFAA 4TYPA 2D3WA 1MV5A 1HTWA 1RRGA 2PT5A 4DSOA 3DM9B 1OW3B 2Z4RA 3GLHA 1GM5A 3HPQA 4BFTA 2ZQ5A 3AH8A 2DFNA 4DLYA 2OFOA 1TUIA 4B3GA 2PZFA 1W36B 4TLEA 5JI3E 3SJZA 2OLKA 5AJWA 1D6JA 1VIAA 3CRMA 3Q85A 4TMWA 5FI1B 4G1UC 5GJVC 1OFHA 3KQKA 5E7JA 3AM1A 3A58B 3BOSA 4BUJA 2ZRDA 4HAUA 4Q9KA 4PPFA 2IX3A 2GHIA 2UZ3A 5LB2A 5JBQA 2YC2C 4B2LA 3OIWA 2BC9A 4TQUS 1Q22A 2QPAA 3B1ZA 1U8YA 1I4TD 2AXNA 4PSVA 4TT3A 3KX2A 5J47A 3M1IA 3V00A 4BZPA 3EW9A 2H17A 4KYIB 5EZ5A 4NU0A 4XOIA 3I32A 3SNHA 4M9SA 2A5FA 4KODA 1AS0A 3VKWA 1YZKA 1LNZA 1OT3A 1X6VA 2XOKA 4LPKA 4RD4A 2FH5B 3WP0A 2RGEA 1K8RA 1U8ZA 3Q8XB 4DSUA 3QXSA 3U44B 2NMVA 1KAOA 4I1VA 1AS3A 4RZ3A 2AX4A 5FPKA 1P9NA 2I4IA 2C99A 3B7GA 5CDFA 3LXXA 1Z6AA 1P6XA 1JR3A 4EFNA 1SXJC 3C16C 1D9XA 3EA0A 4HLDA 4RVCA 1W46A 2UKDA 5AR1A 3ICEA 4PAMA 3L0OA 1VYTA 4KSBA 2D2EA 4GMDA 5P21A 5FPHA 4NCNA 3K0AA 2GZAA 2IBMA 1SGWA 1DAHA 2GBLA 2XXAB 2WSMA 4N1AA 2NPIA 1FW6A 3EA5A 4KFRA 1EFRD 1KI1A 1E0SA 1YZLA 5JZVA 3RS2A 3K09C 2WTUA 621PA 1OIWA 1RW4A 2OXCA 5FUYA 4URYR 1GVNB 3PXGA 3QSYA 1DEKA 1Z08A 3VX4A 2PMKA 4MKIA 4MRRA 4NZYA 1KI6A 1N6HA 2VL7A 3B5JA 1QDEA 1T6NA 4C0LA 2W2VA 3SEAA 3ZZTA 4Q4JA 4JSYA 1FMJA 3AEZA 4YDHB 5AUOB 1KDTA 5FTMA 4L9SA 1M7GA 3CNOA 4CYMA 4QGGA 1UF9A 2VIIA 3K0EA 3UK6A 4CEJA 1X1RA 1ZU4A 4RFVA 1MR3F 3NH9A 3GMTA 2HF9A 2JLXA 3DPUA 1CP2A 4ESVA 1XTRA 4AKGA 3EAQA 1GKIA 1TNDA 3NDBB 4B47A 1KY3A 1N5KA 2E9SA 4W5HA 4UNSA 2CCGA 4UNQA 4F4CA 2QY9A 1VG9B 4DLUA 2PH1A 4TLAA 5FL7A 2YVUA 3BD9A 1CJUC 5LD2B 2ZVQX 1NN0A 1YR9A 2BKUA 2ZM5A 2G0TA 2YNMA 4D0NA 3SI7A 5G41A 4CIDA 5JRZA 5DN6D 4D6PA 3OIUA 3W5IA 1DAIA 2CJWA 1S1MA 2A2ZA 3SC3A 4JLDA 4QHYA 2SHKA 3JZAA 4URUR 5DLQC 5FOXA 3ZDQA 5L3SB 4EPWA 2VP6A 1ZBDA 2O8EB 2WIBA 4LZZA 2ZAOA 1XDBA 2A5DA 3DOEA 1E9BA 4FCWA 5TVKA 4C0BA 2F3TA 4DDUA 5E3HA 1PLKA 2G83A 3VX3A 4F7WA 2GESA 3VTKA 3KFXA 4HUTA 2FWRA 4LV5B 2FEMA 4OHVA 3HP1A 3K0FA 3UIEA 1CJMA 4NCJA 1E79A 2PJZA 1UM8A 4N3NA 4OQNA 4YXWA 4DWJA 4M1SA 3THYA 3P26A 4JLVA 2GK6A 4PZZA 1D2EA 1JR3D 4HZUA 4DSNA 4OKSA 1OXSC 4JJKA 2OZEA 3QPWA 5LBIA 1FX0B 1E1RD 1NN3A 1CJKC 2JLRA 2XSZD 2W0SA 2IT1A 3D31A 1IN8A 1MRNA 4Q02A 2P0EA 2YOHA 1S96A 2ZRJA 1Z6TA 1IN6A 1KJYA 2ZI9A 1HURA 4LHVA 1KOFA 2BM1A 4I81A 3I3SR 1U2RA 2QTVB 1NI3A 4NHOA 4Q9IA 2ZJOA 2QI9C 4MRPA 3V9PA 5J5CA 2C2HA 4QL3A 3CRQA 1OFUX 2QP3A 5DGXA 3AP2A 3SHFA 1XEXB 1COWA 2VPPA 2C77A 2G77B 1J70A 1NMXA 1KYIA 2WBLC 3VMFA 2IA5A 3O8CA 1OV4A 1DAMA 1Z83A 1ZCBA 1IBRA 3TW8B 3SQXA 1N6NA 3H2YA 4XTRA 1Q1ZA 3P1JA 4AY2A 4V03A 1ONBA 5M04A 2EVWX 3CF6R 1KO4A 1JXMA 3KJHA 1E2MA 1I2DA 4FI3C 3WMFA 4YC7A 2KBEA 2X1VA 1H8HA 5JHGB 3BS4A 4AG6A 1Q20A 2ZSDA 5FL7D 1YRBA 4UQOA 1KNXA 4Q1EA 2JASA 2V3CC 1TU4A 4EIWA 1HYQA 1QHHA 3M0EA 4M0LA 3SBEA 1KK3A 1MABB 1XMVA 4DEXA 2PEYA 1AJEA 5CIQA 4B3XA 4BEBA 3GEIA 1UAAA 4CEHB 4PC3A 2VHUA 2YWHA 1GWNA 2RHMA 3K8YA 4C0AC 1JEDA 1UEIA 5BN3A 2O8FB 3AF3A 1AIPA 3ETLA 3LA6A 1ZM9A 1DAEA 3TW4A 3UWOA 1T8UA 1SHZA 1SVMA 3QEOA 3TAUA 3KTAB 1YZUA 5JMTA 3AVYA 1Z3IX 1GRQA 2ZJ5A 3NTUA 1OXTA 4PC7A 1ZCAA 1SVSA 4JL6A 4F4JA 1ANKA 1VDZA 4UKDA 1A2KC 2WOJA 3AF4A 3ND8A 3OF5A 4R98A 2FN4A 2W6IA 1E79D 2Q6TA 1NN1A 2GWHA 2FA9A 4DZZA 3I73A 5CITA 1ZNYA 2EYUA 1NBMA 2GZHA 3A4MA 3GLHB 4H1VA 2FSFA 3R7WB 4OHXA 1FP7A 4LHYA 3LD9A 5BYJA 2YKGA 3VKGA 4LYAA 4Q9JA 3WNCA 1P60A 3OE7A 3K1JA 5BW8A 2D62A 4BFVA 3NC0C 2AR7A 2JIZA 4TQ9A 4LBZA 1XX6A 1JQJC 1P75A 4Q19A 2IW3A 4PZLA 1NL3A 2R6DA 2OEPA 2VP4A 2A3RA 2FZ4A 2KB0A 4E09A 4P4SB 5KSOA 3RRYA 1G8YA 3LQQA 1XMIA 2BMEA 1NSFA 1IN5A 2VF7A 4PHTA 5KDOA 1IONA 2C9YA 3FHOA 1KMHA 2QAGB 1G16A 2VP5A 4HB4A
chains in the Genus database with same CATH superfamily
1ZA2A 1MB4A 1RYYA 2HH9A 1H4QA 1WW8A 2X6QA 3EUAA 2WFLB 3O10A 1QU2A 1PR4A 4FYMA 3FUVA 2DOKA 4GR4A 3NHLA 4A8PA 4DY6A 5I7OA 3DMTC 4LX8A 3KQNA 3HDVA 4RK6A 3ID6C 4B0OA 1KP3A 1FTQA 1TK3A 4HLQB 2LXNA 3OD1A 1X92A 1E1YA 3P2YA 3VPGA 3ZE8A 2H59A 4X65B 4KRYA 3NIDB 2E4VA 1UZMA 2AL7A 1MA0A 2ZAGA 5FUQA 2IQ5A 3L8YA 4RH3A 2FY8A 5I01A 1IY0A 5AI0A 3KQTA 1QMGA 3KLNA 2H00A 1A7DA 2BFBB 4AL0A 3N59A 4C76A 5JU6A 5DM1A 2FU5C 1FFCA 2PUBA 4ZJPA 2XUPA 1X74A 4IIVA 1MN6A 2Q2NA 2R44A 2O9JA 4DV1B 3F97A 1GPKA 3B71A 4ER5A 1A9PA 3W0LB 3VBCA 2WYVA 2XF8A 2OQRA 5L3VA 3EZNA 2X51A 1EWRA 4PJLA 3QVXA 4PBRA 4EW3A 1ZD2P 4DDMA 3C97A 3F3MA 4ES6A 1TYDE 1YS7A 2NU8A 5FTJA 1GUAA 2AZTA 2O5VA 4H08A 5EY5B 4XPXA 5KREA 1M8FA 3RFVA 5CBPB 3BTUA 4YRNA 3ZY4A 1JWBB 1GILA 3D7NA 2PQMA 3OZDA 2Q41A 3I37X 1FTNA 2WIKA 3K70C 1T6UA 2Q9BA 1BQ4A 3TG2A 2G7ZA 3E82A 1C8VB 3CZAA 2GZ1A 2QZ9A 1ISSA 4KN5A 5FPYA 2PIAA 3FFXA 3ZVKA 1KOJA 3H4TA 3R09A 3B1KA 1W2GA 3WYNA 2GPAA 1D8AA 1ZHFA 3KAQA 4ZVOA 2DGDA 4QPPA 1K08A 4A1FA 2VHQA 3IJPA 4E94A 3DE8A 1LEHA 5FBWB 1MTOA 1OAOC 2HBZA 2WIAA 3MILA 4TZ6A 1DWOA 4D4LA 2EIJC 5BWNA 4Q1AA 5I8WA 2XQKA 5M5BA 5FCDA 5CA0A 4MW4A 3Q4GA 3LLVA 5CG1A 1WSWA 2HHAA 4DHWA 4NP6A 4RENA 3RTDA 4AL4A 2FW6A 3FBTA 4X8HA 2Z8ZA 1FYXA 1T34A 4L57A 4BKOA 1DG3A 2X0NA 1G5IA 4TUYF 1C1XA 3NYQA 2EFEB 4U63A 2VCEA 3HJNA 5B1AC 4OREX 4MV4A 3K31A 2ODAA 5EZ6B 1V4VA 4HL6A 4JL5A 3O55A 3NBFA 2FNAA 1QF9A 5SZKB 1M56C 1V8DA 2JFVA 1MAWA 3M5WA 3TTVA 5FA5A 5NLLA 3ZW9A 2E6KA 3IKJA 4FUTA 4V0QA 3C4VA 1CUFA 1LS6A 1QZ3A 2YBEA 1SU6A 3BL6A 1ILEA 2J45A 2JAUA 5AM1A 4R2HA 2ZIAA 1J7KA 3MHTA 4L8WB 4BJ6A 4UTVA 5HZGA 2ZLBA 3HBMA 1BA3A 3PDIB 5B58T 2ACKA 4HGNA 1ODIA 1W0KD 2QX9A 2RK6A 4CDGA 1WRBA 2QVGA 1T9GR 4RKQA 1DB3A 2EC5A 3AOEC 3SBDA 3VRCA 1VKJA 4JX8A 3IQFA 4P1ZA 4EHPA 1BXKA 1SU7A 1R0WA 3RASA 1YYXA 3B9BA 4GT1A 4C7MA 2UZ1B 1R0BA 4LDRA 1XRNA 2FX2A 1D4AA 3TUZC 4K9QA 3Q0TA 1CR1A 5CFQA 1W0JD 2ZXUA 1E5VA 5FWYB 3S81A 4F56A 3V1KA 3PHF2 3CX6A 1DC8A 2EBFX 5AM2A 1ABBA 3DZKA 1WMSA 4MI1A 5CEEA 4L78A 1D3AA 1QBGA 1FFXA 2JFZA 3EVFA 3HN2A 4FSHA 4NPHA 2H29A 1K86A 1WOMA 3SQNA 3NAMA 3GNQA 5B1SA 3I30X 5CB8A 3INYA 3MRVA 2QE7A 4BWYA 2VJQA 2GERA 4JI3B 4HBZA 1HT2E 4Y2JA 1E6LA 4Q7QA 2JC3A 2O5EA 5G2OA 1V3UA 4DZTA 5EZQA 4H7PA 4BQFA 1BEZA 3JAKB 2IZ1A 3TGLA 4PC2A 3T9EA 4CW7A 1G98A 4G0QA 1SUPA 3SM9A 3K9CA 5CCDA 2JLAA 2XTNA 3GJXC 3OESA 5SZHB 1G21B 1XB2A 1NBAA 4V2IA 4U5BE 1UMKA 3MNFA 3L0IA 4NR0A 3O8QB 4OI2A 5LP6F 3DLIA 4AF6A 4P4LA 1KSHA 2DFKB 4CMHA 1B43A 1U6HA 4MW9A 3DHYA 4WKBA 2BE5F 4QSHA 3ZWAA 3AM4A 4ZVKA 2QXUA 4C7XA 3OM9A 2JCXA 4ZOCA 3MOSA 3KJXA 2OCAA 5H8WA 3MTBA 4BP8A 3U3MA 4TXJA 4YLYA 5C8VA 2Z9DA 3DBLA 5D84A 2GN4A 3CJTA 4AP6A 2F1OA 4RVGA 3L43A 5D3MA 2P5UA 2EWWA 3K6RA 3ZGXA 5CEFA 4Z9AA 1ZOPA 3ZI4A 1ZRMA 3BWYA 4BX2A 3EWIA 2ZSBA 2A78A 2ZVPX 2IV7A 1CUVA 3LH5A 1N5DA 2I66A 3K5IA 4EHBA 3OP4A 5B7PA 2ZIUB 1WXDA 4DLSA 3QX7A 5JMPA 1JR3E 3II6X 2OORA 2FRXA 1FR0A 2GXSA 2PUGA 2AWCA 1JV2B 1KRWA 1P4JA 3R7CA 4F46A 4DXAA 1NG1A 4FESA 1RABA 2CUKA 2CN1A 1VLLA 1GA4A 1G5RA 1AQUA 5BQFA 5EUCA 3NPAA 4ZO9A 4COOA 2Z83A 2YLIA 2PXCA 1TM2A 4J29A 4QA9A 3UFXB 1XXHE 3FBWA 1HGXA 1ZSVA 3FIUA 4U4AA 4AF7A 1ZM3A 2XWSA 1SXPA 2PKCA 3HB5X 4JR1A 3AHDA 1O94A 3ZNNA 3N24A 1XQYA 5IVDA 4YUWA 4RDCA 3QJYA 5CFNA 3FTFA 4QUHA 1E1QD 5M3BA 4BBJA 3NBQA 4NYMR 4O4HF 6GPBA 3E7DA 3R5HA 2BT4A 2XDYA 2RH4A 2LE0A 3W1VA 3OKAA 1M7BA 4NATA 1TKNA 1HE8B 1O87A 1YA4A 5AVKA 1Y37A 3RNLA 3V33A 2ECPA 4MKFA 5IMBA 3GO4A 1RZRA 2WZCA 3PUWA 2CZGA 4IDBA 3FUXA 2BCJQ 1Q0HA 4AQDA 3ZXIA 3UJPA 4ARZB 3GVPA 1XAIA 2BC5A 2XLVA 3YASA 2ABWA 5DTIA 4Q5IA 4E5KA 2C4VA 4J1TC 5B7NA 1VE5A 4BJHB 4WJZA 2IWRA 3PFBA 3BJEA 4Y1FA 3CZ9A 4PHGA 4D25A 2DEUA 1PWEA 2FPMA 4B80A 5LSAA 3RV3A 2QJRA 5IT4A 1IZ7A 1IEQA 3OU6A 2H54A 2QN8A 3EJ6A 5ER9A 3D6NB 1Z2AA 4GMXA 2QL6A 2L19A 3EUWA 1LSSA 1WDMA 3N0XA 2NNLD 4B33A 1BDJB 1B8OA 4L7QA 3IE0A 1B0PA 1KJZA 4KR9A 3R23A 4ILEA 4YRKA 1P80A 4H18A 2ZCJA 2FEXA 2UZAA 4EUFA 4ND8A 2IH2A 221PA 2O3JA 4JCZA 3EIFA 1M7HA 2G4CA 1TFKB 3VVBA 4R5MA 1QYWA 1SOVA 3SS8A 2AMFA 3ORQA 4MUGA 4TTTS 2JRCA 4PCAA 4W63A 5EIAA 1NBOA 4MGEA 5L3QA 3HB9A 1SUSA 1ZZEA 5AKZA 5B1BC 1U28C 3W2VA 4S2UA 5KYXB 3AOUA 2WPDD 3CLVA 1XXHA 3T99A 4MWCA 3JQRA 1JVSA 1OXXK 1QANA 4X1OA 5K8CA 3KUKA 2XKJE 4V0MA 2EF0A 2G88A 3RQIA 1L4GA 4LBVA 5DLDA 1N5MA 5KQPA 4E88A 3HUUA 1U2DC 3H9CA 2JFGA 2GPWA 4GLLA 4P3XA 4CLHA 1R10A 5FR1A 3KFVA 3AUSA 4LE2A 2EDCA 3UXMA 2B8NA 5IFKA 5JCZA 4HP8A 3MUEA 3IB6A 4ZQCB 2HJHA 4MQUA 3PEFA 3W8HA 2HYIC 2P9FA 4V1CB 3MOGA 4PLPA 2ZSEA 2CEKA 3UYKA 3VPFA 3MRSA 5A4KA 3GQBA 1OFVA 3VHLB 3H3JA 4BZZA 5ALPA 3RVSA 2Z9CA 3JRTA 2LFFA 5SY6A 4B8ZA 5BURA 1ST6A 3FNQA 4EKEA 3EFBA 4J49A 3FWHA 4YMGA 4ZI5A 2V4MA 3TG8A 3KQMA 5JWHA 2WZGA 1EK5A 1ZXBA 2ON6A 2NUPB 1H6GA 1Y3HA 1V9SA 4RXUA 1X1QA 3ZGLA 1DOVA 3GLRA 2I4TA 3U7GA 1TF2A 1NBEA 3OCUA 4DLPA 3LQ2A 1JG4A 3L77A 5BWBA 3OX1A 7ABPA 5FUWA 2X8BA 3HDHA 4WXHA 2C2GA 1XVIA 3UHOA 4AJ4A 2E21A 2Q1TA 5KHAA 5C1OA 3UGJA 2IEBA 3G02A 1AO3A 4OFXA 3VR0A 4UAVA 2B21A 3OTHA 4IP0A 4MVJD 5LWQA 1I7NA 2ZJFA 3DYVA 4RQAA 3T1VA 1CRQA 1S05A 3G8BA 3ZZUA 5CVTA 4GKJB 3BKXA 3SF8A 1T6ZA 3R9XB 3H19A 5ELMA 1MGOA 5GADl 2C3PA 3QWAA 4R51A 3VC7A 2R7WA 1ZU5A 2GEVA 1CJTC 3ZQUA 3EXAA 4EENA 1IIBA 1L6RA 3Q72A 4LV8B 3VH1A 2C3MA 2FK7A 2O59A 1ZD8A 1NZEA 4WXEA 3KYDB 2P30A 3OF3A 1TM4E 3NWPA 1RFLA 4YMSA 1Z12A 5AW9A 1KOLA 3RARA 3MMPA 1XK7A 2B0JA 2Q4RA 1I1NA 1QP4A 1SKMA 1CRPA 1KORA 2N3ZA 1HA3A 1OYYA 2B3DA 1VZ2A 1Y82A 4M1QA 2GKSA 1MTZA 1P0QA 4J1NA 3H4MA 4Q7CA 3NANA 2F7SA 3OAAD 5IARA 1U5BB 1KZ6A 4X8OA 3QPVA 4OLJA 3CVVA 3WGNA 3UK0A 1EZ4A 2ZJ6A 4YHHB 3KUDA 3WLNA 2UUAB 2I03A 3BH7A 1L8XA 3OOHA 4DRHB 1HZZA 4C04A 2JEZA 5AK4A 1UBGA 5AUNB 1A1VA 5EJ5A 1IZZA 2BFWA 3AI2A 4GL2A 4PC6A 2HPHA 3VR3D 4ID9A 1GNTA 2ODPA 2PZLA 4IDCA 1VHWA 3A04A 4EHNA 2ACVA 1J99A 1MJFA 2F62A 4NZPA 2RGDA 2H4YA 4MSUA 4PG5A 1OTYA 4ER0A 3GF4A 4TTJA 3E1SA 5HPYB 5CB4F 5CYOA 4F86A 3KR9A 4EM6A 2YVQA 4XX1A 3A14A 1QIMA 3HB1A 3VR5A 3ADPA 5T8KC 4XWJA 2Y1XA 2QUAA 4MWGA 4BFWA 4KQEA 1FW8A 1Z2CA 2CFTA 1FNTc 1E92A 2V4ZA 2WVJA 4N4WA 3Q41A 4RJLA 4RKRA 1E2HA 2CNOA 4J6FA 5J58A 2XCQA 5CLIA 1GYRA 4YMIA 2BGMA 3DOFA 4LRQA 5E6RA 4GYTA 3LQ4A 1GKYA 3KJFA 3ANTA 1WCYA 1XZQA 2Y2UA 4S35A 4YJKA 3CGWA 4CKEA 1MOSA 2QLMA 5TF4A 4ZMBA 1YTLA 1C3EA 2BZ1A 2HXSA 4L1KA 4HDQB 4PG6A 4EPTA 3IHWA 3SZMA 1QNLA 4TMYA 1ADJA 3PXUA 3HPQA 3UZUA 3U4GA 2Y0EA 1EDEA 3ANMA 4G23A 4WZAA 4V3BA 5BT9A 2ADFA 4X54A 1Q22A 4YWJA 3STVA 3M1IA 3MCVA 4BZPA 5JH7B 1JMYA 2QZJA 1VJ1A 4KODA 1SCAA 2XOKA 4N82A 9ATCA 5G1NA 5FPKA 2YY7A 3GLVA 4J07A 4DBVO 4B7AA 2V97A 3B7GA 3RGWS 3DMGA 5JJCA 5LQUA 5BNIA 1QV7A 4W7HA 3U3FA 2QYOA 3V8PA 4N1AA 3IDZA 2HBYA 2OXCA 3HRIA 1T0IA 3KBOA 2JZOA 2BLNA 2CDRA 2R68A 1H0SA 3TTYA 1LD3A 4IQGA 5HV9A 3PHBE 3LHDA 1MR3F 1QO0A 1WSAA 2HF9A 4ZOQI 1V41E 3IVGA 4ESVA 4AMUA 1TNDA 1V0JA 5ARBA 1MQ9A 1VG9B 4DLUA 2B98A 4WK2B 5JDIA 4TLAA 3BD9A 1VI6A 4NMLA 1NQAO 1YR9A 2BKUA 4RFLA 4D0NA 4FZVA 3WOHA 1LE4A 1ZBDA 2A5DA 5E3HA 3MEQA 3TECE 2G3KA 1ACMA 1M6TA 1E79A 3DCYA 2OC4A 2IUEA 3C6YA 4U7JA 2GK6A 2WRZA 2ZJ0A 4HZUA 4XQ1A 4I5DA 1NZFA 1A2QA 3D8SA 4P3KA 1EVQA 3MJEA 4CM6A 3QYJA 5CCBA 4HRAA 3BIWA 1HZJA 3V9AA 1SEPA 1VGVA 3IAAA 4W1SA 1SU8A 5DWVA 1NI3A 3P0IA 4Q9IA 3V9PA 1GHTA 4QL3A 5CD1A 3ETEA 5K3FB 1Q91A 1NXSA 4LQLA 3V3KA 2FEKA 3F67A 5JQGB 2R1TB 1QH8B 3BRQA 1HEYA 5B3IA 1RXSA 2PSEA 3DYBA 5JD4A 1HTBA 3OT1B 4C0WA 3KB8A 3PNOA 2SKDA 3GFFA 4X93A 1TD1A 4I5EA 2GAQA 2WW8A 1E7RA 3B36A 3CVJA 3T4RA 4HGZA 2RHMA 1EJ0A 1I2CA 3LQKA 4YQZA 1OXTA 2A57A 1P8AA 2XH8A 5K8IA 4WK4B 3OF5A 1GQAA 2B8EA 4FJ0A 3ZV6A 1NBMA 1R15A 2B36A 2WTAA 4OQZA 2WAAA 5BW8A 2GUGA 1OGYA 3G0GA 1P75A 1TXGA 4IAOA 3STUA 4S1NA 5KWEA 2C9YA 3JQGB 2VQ6A 2AG5A 4EGQA 3BK7A 2NAPA 1COWD 1KEEA 5FBRB 5CM9C 1E2JA 1F8YA 3LRXA 3NDIA 4P0PB 2UZ0A 4HH3C 1UUFA 4P5EA 4D9NA 2SKCA 1NF3A 2ZU0C 3LC7O 3P9IA 3RTCA 1JE1A 4I9FA 5DWQA 3K0AB 3B1VA 2XTAA 5IH3A 3H5VA 1YKGA 3QPCA 5EP4A 2HRDA 2B25A 5IDQA 4O79A 1D1TA 3THWA 1NASA 2DUWA 3C15C 3OO1A 4FPXA 5E8JA 2WLSA 2OKGA 2NZ8A 1Z4LA 2MSLA 1VBFA 4AULA 1Q7BA 3HGTA 2GYYA 2EPOA 1LK0A 5JNVA 2JH3A 4I8IA 3OE7D 4UEQA 3KAJA 5AKXA 2XMPA 2GI4A 3OZCA 1DU4A 5FTLA 5E6UA 1FDVA 3DMDA 1ZONA 2PJDA 1XA0A 2YJ5A 5ITSA 1CUDA 3KQHA 2EJWA 5IJ0B 4UHKA 5DHRA 3R3UA 1SELA 1T8RA 2QGFA 5T1DB 2I2XB 5JAPA 2R6R1 2QAJA 1XKTA 1GFWA 3M6XA 3OJWA 1M2VA 4P3YA 1DRVA 1FTGA 1XZKA 3R0XA 4DABA 3OLZA 3GRRA 3PXXA 1ZNXA 3O82A 2JJMA 1JHMA 1KOGA 4IO1A 2A92A 3KIPA 5EIWA 3ZU3A 1XG5A 2FG5A 2Y9MB 2HMAA 2FPRA 3WYBA 4BECA 2PU5A 1QRDA 3RRXA 3TLGA 3VNBA 2WILA 2HF7A 2JPDA 3VZQA 1PT6A 3V3TA 4EYEA 3A6LA 1TT5B 5FI5A 1XYYA 1SU4A 1YDGA 4JZAA 1BKDR 1NVWQ 5LVAA 2G67A 5SZIA 1UPXA 2JJ1A 2ZBFA 1FYFA 3DPIA 3U9LA 5J2UF 3V4PB 1NU8A 1XN4A 2G07A 1XMJA 1X1BA 1KAHA 3MCZA 3HXTA 3TW8A 1NM5A 1YL7A 1WBDA 1G9SA 5AOCA 3VPSA 3K96A 1QPGA 4M86A 5GPGB 2A9JA 4YASA 4FAPB 1Z37A 1GNPA 3GN2A 2IBSA 4BNVA 3O5AA 2MSWA 3EGVA 2RKBA 4EKDA 1V4NA 4W82A 1JR2A 4MARA 1LDNA 5JD6A 2EKDA 1XK6A 1K4KA 3QJGA 4NYJQ 1VXRA 1O6GA 5BOSB 1TFRA 4OH1A 3UAVA 3PK0A 3GROA 1Z8NA 3PXAA 4CKCB 3EPHA 2CL6X 3WLRA 4WLFA 1G0NA 1T36B 4TROA 1DUIA 3EYWA 2R96A 5FWXB 5LZ8A 5CLJA 3ZDXB 1AVOB 1TJ3A 4CIHA 1C1HA 2A0YA 4CBEA 2QYHA 5IJWA 4YO8A 5DB4A 3AFMA 4OGLA 2Y99A 3VGJA 3SDSA 3FSRA 3WICA 1Q0MA 3JQAA 2WYOA 2R7TA 4IJMA 1WJGA 3RFXA 1LPAB 3RU9A 2BI8A 1RMVA 1ZHZA 3FH0A 4TKZA 2P8JA 5FOVA 4JODA 2A9FA 4LXIA 4JT2A 3H9EO 5A02A 4FMCF 4QICA 3UMIA 4IVNA 5FIUA 3OOYA 3KKQA 4TMXA 3VH2A 2AOUB 1JR8A 2OORC 2LPMA 3I58A 2BHSA 4S12A 5DHPA 3DAOA 4BATA 1KYVA 4COKA 2CLCX 2QR3A 2CD9A 3AEUA 3GDWA 4PX2A 1U0NA 2XBLA 4L0MA 2HUJA 1IG0A 4MIYA 2OOSA 1PK9A 3PTZA 3A9UA 1IVNA 5J43A 3E84A 3PGVA 1DQSA 1EU1A 2VA8A 4WUVA 1W4RA 2X15A 3MW8A 4W6ZA 4Z4CA 2QL9A 2JLBA 3B48A 2BELA 2OEXA 3FE2A 2VT6A 1KEZA 1IBKB 1V5FA 2VSYA 1E2GA 4CFZA 4R0VA 4YJDA 3EEFA 1H6AA 2VT3A 4YFYA 1O94C 2NUTA 3AGUA 2PKQO 3A1TA 3OLVA 3UJBA 4R8SA 2CCKA 5JMWA 3D0KA 1LBTA 1A7AA 2FCRA 2GLXA 4BWFB 4ANFA 1DBPA 5AOBA 4E7ZA 4BO5A 4QEDA 1O0SA 5CNJA 3V1UA 4PR0A 1XLWA 4QGFA 3Q10A 4M1WA 1Z0KA 5DGTA 3RK1A 1SFRA 3O8NA 4TYWA 4DOZA 3CGGA 4JP1A 1D9ZA 5FYDA 1M0TA 2DHQA 3E0XA 4D8VA 5BSTA 1HE4A 2V8OA 3PXCX 1YRAA 1CRWG 5CB0A 3LDGA 4HEJA 4FT2A 3T1OA 1MW9X 2XCUA 2QN3A 5ECGC 3MT0A 3UT5B 2YYYA 2P7VA 1QX3A 4OL9A 1SVNA 1Y1LA 4KSYA 1UIRA 3PUHA 2OUIA 1DARA 3RVKA 3GLSA 3WB0A 3GD7A 3KKBA 4MXDA 1T6BY 3IURA 1KKUA 1CUIA 4O4JA 4YCLA 2FWJA 4URHA 1A97A 3KCQA 3AKDA 1XD9A 2XS8A 1LTHR 1JEEA 5EHQA 3AV3A 4PGGA 1HQYE 2YTZA 5DHAA 3LUAA 4QYIA 1RMQA 1E9VA 3GRAA 4GLJA 4CDAA 1NURA 3IR7A 1RPJA 2DGJA 2WSBA 3OWHA 4GWKA 1DBQA 4DAEA 2WMOB 3C4QA 5DXFA 3EWAA 4G8BA 1Q0QA 2IWHA 1JQLB 2XTMA 2GPBA 2QLTA 3EZFA 1JTFA 1D1AA 5K8TA 1L5ZA 4Z9HA 3GBVA 3IMKA 3T54A 1B2RA 2X7HA 1CFJA 4RF2A 5CIVA 1JKXA 1LQTA 2B30A 4BVFA 2OBXA 5FFNA 3WK9A 3QKRB 5DRTA 1U1DA 3EF1A 2FFQA 3BK2A 1QZTA 3ZJTA 4ARCA 3A6PC 1SUCA 4FIDA 3Q7EA 4MX8A 1HFWA 2DTXA 4JVNA 4CM4A 3L4SO 5B1YA 5EE5B 4QFMA 5KO2A 4WNYA 2GA8A 3RUAA 3KWLA 1R6DA 2PQ2A 3OWOA 5CDHA 1Q1QA 3EZ7A 4Q4DA 2G6BA 2QN2A 3I9V6 4HAYA 1KO1A 5K9ZA 2A9QA 4N41A 3A6FA 2XD4A 6PFKA 3UAXA 4NBWA 2XTJA 3KPYA 1NKSA 2Z4SA 1N1DA 2G4LA 3WFZA 1Z6PA 5ALWA 3RK4A 4IDQA 3FPGA 1N2IA 2CDQA 1D5CA 5HA5A 4YLGA 1BEEA 4CL2A 1XPUA 5EIEA 5KC9A 2IXMA 1Y9DA 2XY4A 5EHHA 2QVCA 5DE3A 5K6RA 4EHFA 3FYSA 3G7SA 1SCUB 2NADA 4QATA 2V58A 2YW2A 2Q50A 4UU0A 1QH1B 1MC1A 2A67A 1YULA 3WYCA 2HV7A 1U0LA 2UZIR 3M15A 2XSEA 4FCTA 4JNKA 1Z5WA 3RC3A 4IX1A 1OU0A 3PMRA 1AUQA 3W5UA 1PJTA 4CKWA 2J9FB 4OPMA 3GJ7A 2BH9A 4EGCB 3D1JA 3EISA 4K87A 3GQVA 4AN0A 4D6XA 1DO2A 4X94A 3OA2A 3W7BA 5FAKA 1C30A 1NJSA 3B78A 3JYQA 4RZIA 3CNEA 4IGAA 4FWTA 4IV5A 4QU8A 4IXMA 4QJ5A 1CZUA 1TZBA 1A95A 2VDWA 1XCBA 2O5CA 2R9VA 3RS8A 4MPTA 2DWUA 1Y42X 2WZBA 5IF3A 1E2DA 3CSUA 4J76A 3HEBA 3HA5A 2GCIA 2DB4A 2Y1LA 2NZ2A 1O6ZA 1YQWA 2RI1A 1SZJG 5A7GA 1Q57A 1II9A 5DKFA 4C89A 2ZTHA 3AW9A 3O95A 3M79A 1B0ZA 1YOBA 1OHHD 2RHTA 3AWDA 1UK7A 4BO3A 4U9IS 4JU8A 4M63A 1MC5A 3VDQA 5H5JA 3A9VA 3PLNA 2DPXA 1Q17A 4HATA 4M7PA 1AURA 2LQGA 3HUTA 3UJNA 4XX0A 3RG8A 4ZO8A 1V9CA 1IL0A 1SA0A 1PGNA 4JB0A 4NU6A 4M60A 3UJ3X 2H7VA 1AF4A 3OPNA 3DB1A 4ZO6A 3B3AA 1XIVA 3SKVA 4UZFA 1NKVA 2VWQA 1SD2A 4WBSA 2CNWA 3Q3VA 5B4VA 1QV9A 3SMVA 2W6JD 2AFIA 5ADHA 4BP1A 4X61A 5I7EA 4FGUA 1KZ7B 5AJVB 3GP8A 3ABSB 1PP4A 1O9BA 1XDDA 3PJDA 2WA2A 5KJEA 3UGTA 2B1GA 4YUZA 1KHHA 1C8LA 1WOYA 3GRZA 4YRRA 2ZXPA 2G62A 4HDMA 1KE1A 1A7EA 4GSYA 4YB8A 1XZPA 7REQB 4CIAA 2J9XB 5AW6A 2I91A 1TKAA 1W49A 2WU1A 4YP7A 3VH3A 5C46F 1PT7A 3P2EA 4MJ7A 4DDWA 2X6TA 4QOHA 3WNVA 3OQJA 4DDKA 4RK5A 1N2ZA 1NVEA 2PIDA 3L6UA 3UWMA 2VRNA 5BSMA 1O9GA 5IAGA 4CM1A 1HZZC 2HJSA 3RYFB 3CE9A 3QNMA 4QDZA 3R0JA 3GJ5A 3LGAA 3BULA 1SXIA 4TWAA 1LFDB 3OJXA 2OQMA 1GQRA 3K8QA 1H0KA 3RLFA 3T4EA 1QHNA 2OY0A 1I4LD 5A6VA 1TK2A 4EJSA 4LDQA 1ZD3A 3P9QA 2OCCC 5K2OA 3GLGB 3NGXA 4P5PA 4X1YB 3U7QA 1V2GA 5KNCD 4M6WA 4DWWA 1HE2A 5JZ9A 3KR0A 5F73A 2QZSA 2WHEA 2PS3A 4M0MA 3GFRA 5FBZA 1ELOA 4BG0A 2GARA 2CNKA 2A4KA 3TX6A 2H1VA 3SCZA 3VI3B 4IIDA 3CA8A 2POQX 4L76A 4Q9HA 4L4XA 5HK9A 2J67A 1ES9A 3NTLA 2NXCA 4O8CA 5DHFA 1PCXA 1YB2A 1JZTA 4IQFA 3SX4A 3JRNA 4QTXA 4WASA 1KI9A 2WICA 2J1LA 3HYLA 2H51A 4WVLA 3BE4A 4MVXA 4ER7A 4I2NA 3ZWDA 3O8LA 4EP1A 2IYOA 2AGVA 4TUYA 5CVJA 4MGYR 2J0UA 3RVOA 2JI9A 4B4VA 5BNTA 1F20A 4JYAB 3M5PA 4HDCA 3X1OA 4EO9A 2LIPA 1IC6A 4DLAA 3W5JA 3CRRA 3A06A 1E18A 1YACA 3M8KA 5IJAA 3BBPA 2VXBA 3HCBA 4XWYA 3OFND 1DBIA 3RUIA 4PTYA 3HCWA 1TZKA 2VDRB 2Q4EA 1K04A 4QBTA 1R8SA 5MF6A 2I76A 3H16A 3GLTA 4IJJA 1A27A 1T9HA 4D96A 4ARVA 5EKSA 5LXTA 2ZIVB 4ZAFA 2HLDA 5SZJA 3CYFA 3KT3A 1FZTA 4ER9A 1LI4A 1U7TA 3LAWA 3PZBA 4Y9UA 3ITNA 4BLWA 1UXKA 3S2FA 1QQ5A 1LH0A 2FHSA 4PBSA 4L74A 3RQSA 4HB0A 5KYYB 2C0PA 4DJDC 5A4AA 5KTMA 1Z7BA 4RLQA 3RTBA 2GJ4A 1VSBA 1ZJJA 4D3ZA 5AHKA 2UVPA 2C82A 1EHYA 4YHBA 1UBUS 3X1MA 2P7IA 1N5RA 2AU5A 4HWKA 1Q0KA 2P2LA 4IV0A 5FORA 5JHHB 1UJBA 2F1HA 4EVIA 5JDIC 5AVRA 3HY3A 2LRHA 2VP0A 2XXAA 5CBKA 3MUNA 1AUVA 1G8HA 5FOQA 3IVRA 3PCRB 1PR3A 3KQYA 4JITA 4QQ8A 5EVCA 4O25A 3ECCA 4DARA 1C5KA 1H1LA 1KSJA 3IUBA 1YE5A 4GQAA 2PF4E 5EMJA 2HIAA 4CN8A 3QVGB 2C9MA 1RNLA 3TOLA 1I0IA 1Y33E 2P0YA 1TFOB 4JYBA 4MUAA 1QAOA 1TZJA 3PD7A 3MAJA 4PZ9A 1UJNA 2R25A 4K2HA 3LDUA 2P9HA 3AUJB 4KTTE 4NHEA 4JXJA 2R6GA 3JWJA 5EXXA 1L5WA 2Q3DA 3BD7A 1Y8RB 4ZDWA 3UMJA 4B2PA 4M1ZA 3PPWA 3DC2A 3ZWYA 4OXKA 2YZ7A 3JS5A 3HN6A 1QR2A 2ASRA 4RV5A 2G3YA 2D7CA 2CFIA 5LOVB 4YK5A 2HSGA 3JQCA 4IVPA 4F7DA 2DKOA 4DA6A 2OR3A 2G1AA 5LP6A 5BW6B 4OIFA 2Y2VA 3DBIA 3JPYA 5IN5A 3EFHA 4M7RA 4MEAA 4DR5B 3F7TA 2QM7A 3COVA 4DIDA 1HY3A 4R68A 2QLLA 3GD5A 4QGHA 5KNBD 5A06A 4XH9B 3TF5A 2C20A 1MO6A 4JYZA 4C7OB 4IF4A 4F5YA 4ZO7A 3CPJB 3L8MA 4EW6A 1KFJB 1R4TA 1ZMBA 3CVUA 2NU7A 1T1GA 5BMVF 3RADC 3WIDA 4I4TB 3GEMA 3GOHA 3CRZA 1OIXA 2OSVA 4TYMA 3QFTA 3Q11A 4TYPA 5INTA 2HJ9A 2JIBA 1HTWA 1Y98A 3LIIA 1B6SA 3ZHQA 3Q15C 1TUIA 4Y6LA 4ZMRA 2J6BA 1SNYA 4ZOEA 3Q85A 2Q3EA 3IOCA 3WRWA 4TQUS 1L5SA 5ALHA 2AXNA 4PSVA 1XCOA 3WWPA 3DE0X 4V24A 3LUJA 1XZHA 3LLCA 1K8RA 5AW7A 1V1MB 3K6BA 3P9PA 4Y2UA 5EXDA 4Q3EA 3CF4G 5A6BA 2LW7A 4HLDA 1I32A 1HE1A 1VYTA 4KSBA 1NUTA 1R3DA 1RZVA 4FS3A 2IBMA 1FW6A 3A9CA 4ZC1A 3VPXA 5JZVA 1OIWA 4DRYA 2JLCA 1DJLA 3KTDA 3B5JA 1QDEA 4C0LA 4XPYA 1YUBA 3VU0A 1B16A 3INRA 2AN3A 5AUOB 4GMKA 2JHAA 1VL1A 3DFMA 1UF9A 4U2EA 1N2CA 4YJ3F 2JLXA 3TLBA 4UNSA 2CCGA 1YVPA 4MHOA 4ENSA 1G63A 2YVUA 3L18A 4Y2VA 2X8LA 1UP7A 1PG5A 3BBLA 2AI3A 4EW1A 2CJWA 5FOXA 1SPXA 1ODLA 1R5JA 2O8EB 2ZATA 3K8ZA 3LNTA 3JARA 1U7HA 3N8HA 4PLFA 1NBWB 5D5PA 5FFFA 4DSNA 1S2LA 2OZEA 4O4HA 2W0SA 5H80A 3H04A 2BSAA 1P4HA 4PZ0A 3QLTA 4Y6QA 2X42A 4D9IA 2JIRA 3I3SR 2ZJOA 2I67A 4LRXA 1XMOB 1SKUA 2VPPA 3OE1A 1PU2A 2G77B 4BY9E 2WUDA 3ASNC 1DAMA 3V5YA 4Z7OB 4DMKA 1PFGA 3SS9X 4KOAA 5HF5A 3O4VA 3HBJA 2I7CA 3WMFA 1VLSA 1N8SA 2R86A 1S89A 1KNXA 4P7KA 3UOAB 2DQSA 1XGKA 1OTHA 1UXIA 5BN3A 1DXYA 1HDZA 3TRKA 3TW4A 2R7NA 4JB3A 2I6QA 4F4JA 1A2KC 3K71B 3DZBA 3RUPA 3AR2A 1F38A 1P1RA 3T9FA 3A4MA 1NLXA 3O73A 3PX3A 2JGMA 4MW5A 3K1JA 3S2GA 4BFVA 3AUKA 4C0XA 4OHOA 1EB8A 2KB0A 2BMEA 2MYSA 2AOWA 1FDOA 5KYGA 2OCYC 1NVGA 1DAOA 5KHOC 5LL6P 1PYDA 3E1KA 3UQZA 3MMZA 2OVBA 1PFVA 1EUDB 4ETIA 3OTOB 2NV6A 4D46A 3EPPA 3T3GA 4RY2A 1ZLYA 2PH3A 1O0BA 1FP4B 2P67A 3ZGOA 3IERA 2JI4A 4IDOA 5A3SA 3BAZA 1L7EA 4JC8A 1VPEA 4GKVA 2WUEA 1GADO 4IX9A 1XTZA 1HL7A 3LO8A 3QNUA 4E5DA 3RD5A 3AB3A 4DWOA 4IDGA 1EGAA 4LY0A 3EXEA 1IBMB 2BBWA 1SQ6A 5KJFA 4E0BA 2XHEA 2K2WA 4MIKA 4MK4A 4YI3A 4P80A 1ZW3A 1MEJA 1F0YA 3L1UA 4GYKA 1M6VA 3L8ZA 1TQ8A 2OL4A 2PMEA 3RVDA 4EOGA 2Q99A 1POXA 3TR6A 3KK0A 1GU7A 3ZK7A 4DG5A 1E8MA 2ORVA 3JY6A 3T5GA 4A8JB 3MFNA 3S27A 1XTUA 4CX9A 2PKYX 2E4YA 3KHKA 1ZGAA 1KFKB 1Z5NA 4PLCA 4CN9A 4MWOA 1I94B 1EFLA 3GFTA 3KJEA 1FTWA 4JKVA 2JA2A 3A25A 1H8EA 4H7FA 5JCJA 4ZJYA 3F8SA 3VHQA 4V0ME 1FMFA 4W5RA 4G1FA 1UMDB 1IEWA 1W2WB 5M34A 2ACWA 4ADSG 2VJOA 3LY8A 3X43A 1A9RA 1R4AA 3RVRA 1GFIA 1OXBA 3R8XA 3VR1A 1I33A 3O90A 2YL0A 1RHRA 4WBNF 1Q0PA 4B5LA 1HSOA 3U4QB 3TLYA 3JD4A 1PZGA 4GC5A 3HU5A 4Y7DA 3PYLA 3IT0A 3EXIA 3BYZA 1LLQA 2XT0A 1XCMA 3BN3A 4L85A 2DP4E 4KXFB 1Z5VA 4FN5A 1E98A 1GV1A 4MVJP 3IUSA 3ZE9A 5DNEA 1ORRA 2GVDC 3ITFA 1J42A 3W1WA 1YBFA 4HAOA 3DUFB 4ESEA 4UTRA 3UNGC 3DFKA 2ZPTX 4HWPA 3JQ8A 5A62A 3EZHA 2BM9A 5AKHA 4KK4A 4E4TA 5SICE 2IC5A 4R01A 1A0BA 3H5NA 6REQB 2XNHA 3LXRA 4DF3A 4Y1RA 1ECJA 1V1RB 2PGDA 4NZZA 4XB6B 2AMJA 1HV8A 1GRCA 3RFFA 3ZNOA 4WLNA 1QK4A 3WJAA 4E1VA 3UUGA 2GDCA 4N0DA 1Y3FE 4NSNA 1YH3A 3H2IA 1RRKA 1H9AA 3IDQA 5DASA 4RETA 2IHNA 2B2CA 1LC3A 1M0WA 3DB2A 2XNDA 2JGAA 5HS6A 4Z51A 4QO8A 4P2GA 4DIUA 2Y3BA 4CMIA 4JJ8A 3VM6A 4EIYA 2ZUTA 4EARA 5E0KB 1C7RA 2R87A 1RM4A 4LE1A 3T15A 1CUHA 1X8JA 3EDYA 2X5KO 2ZTLA 5CA1B 4WERA 3UA4A 2J7PA 3ABOB 3O6VA 4EG1A 1WXQA 5I7HA 3P0EA 5H4HA 3HXQA 3C8GA 3ZY2A 1BQEA 2EBUA 3MBGA 1JRLA 3A3YA 1IM8A 3UANA 3WMWA 2KM1A 3NUGA 3OIYA 4CQMA 3RTGA 2FUKA 5AK6A 5FH9A 4G1EB 2YN4A 1R8XA 1WCWA