2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSY
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
5LPNA 1UPTA 3K1JA 4MRVA 3B1XA 4ZDIA 5KOYA 4QBHA 1D9XA 3K0EA 3N2IA 4PPGA 1N5KA 4DZZA 1TEVA 4JL8A 1BS1A 1BYUA 1VG0B 3BIFA 2FOLA 2R2AA 4BFTA 3I5XA 4FINA 1E94E 3C5CA 4B6EA 4ZDWA 1TU4A 4FCWA 1NRJB 1E2KA 4LI0A 1HQCA 2I1VB 2ODWA 2ONKA 2WSMA 3THYB 1YU9A 4Q7JB 4CT4B 5JEEA 2DYKA 4BUJA 2HF8A 4JS0A 2PJRA 1VYTA 2WAYA 3X1WA 1OIWA 1KAGA 3KXLA 3LY5A 1QHSA 2QE7D 3U5ZB 3RS7A 2VEDA 3JVVA 3WMEA 1JR3E 5CJ2A 5TB5A 1CF4A 1KMHB 1S3SA 4DUGD 3TLXA 3D31A 2FSIA 4LUCA 4G0NA 4ZKEA 5SZHB 5J4KA 1T5IA 2O0KA 1MH1A 1WQ1R 1OH6A 1XZQA 2O0JA 3PITA 4Z54A 1F2TB 3AVXA 4IXMA 2J7PD 2D62A 2HXSA 3B13B 4AC9A 4B76A 4NH0A 2BMFA 1MR3F 3PUVA 5G41A 2VSFA 3UKDA 3OEHA 3AKYA 4IFEA 4PC1A 4TYWA 3U2QA 4W9MC 5CK5A 3ZGXA 1KI7A 3GLGE 1NLZA 2C9CA 4TYQA 3SBEA 3U3MA 3UMFA 4ILEA 4BZPA 4ARZA 4WBSA 1FMLA 3ZVMA 2BEKA 3SJZA 4BGDA 1X1RA 2IYVA 1E4VA 1KSGA 3VNVA 4KSCA 4GMDA 3K8YA 4ESHA 3ZLJA 1KSFX 2WV9A 1E2NA 4DLWA 2C77A 2VHCA 4PC2A 3KFVA 1SXJD 2H17A 5AWFC 1Z47A 1COWA 2C04A 4PQFA 5EJEA 2GAAA 2ZRMA 1GIAA 3W5JA 3VQTA 5KHOC 1XTRA 2ZSDA 4G01B 1E99A 4ZDKA 2YHSA 3B82A 2VBCA 2XTZA 3NBZC 3GD7A 4FCTA 2BC9A 1MO6A 3SBDA 4BRUA 4K8OA 3KL4A 2GXAA 4OYHA 3T5DA 3RC8A 3AKEA 1NVUQ 2GBLA 2VHUA 5A4JA 1C4OA 4Q01A 1XF9A 4CVNA 2C03A 4YXWA 1J70A 4FMBB 1KDTA 2XSZA 5KDDA 2X2EA 3HJNA 2AR7A 2ZE7A 4F38A 1QDEA 5CM9C 4NCKA 4HZIA 2JLUA 2FSFA 4LGMA 4IDOA 1E2IA 4LPSA 5H70A 1AKEA 1QBKC 1QHNA 1G3MA 2NIPA 1NBME 1ZBDA 2QMOA 3Q8XB 3SS8A 2IYSA 1M7GA 1YE8A 4BWYA 1XXHB 1AZTA 3ADCA 1EFUA 4OI4A 1XDBA 2PH1A 2AXPA 2ZI4A 3AVPA 3NH6A 3OEHD 4HUQA 4DDTA 1TTTA 2GK6A 2J7KA 4FMCF 4LOAA 1Z0KA 4M1SA 1G291 4RZ3A 4PO9A 5JCZA 2XITA 2OILA 4NPHA 1FQKA 3HU1A 5GADl 3B2EA 2W6JA 3D6TB 1ZUIA 5JEDA 2GCOB 4A8JC 1W5SA 1ZINA 5KPDA 1M1YE 2CE2X 3PFIA 2WKQA 3TUIC 2ZPTX 4AG5A 4IW3B 4B43A 1PZNA 2F9MA 3FPAA 3IQXA 3KJHA 4V0ME 3KUDA 5EXPA 4DSTA 3K0AA 2GEUA 4N3NA 3FMIA 3KQUA 1GNRA 1WDTA 4BLOA 2R6GA 3WHLA 5JMTA 2IUSA 3NKVA 2W2XA 1E98A 4DEXA 1GWNA 2FMXA 1CJTC 4PAOA 5UKDA 3GEIA 4LV5B 4KYUA 2OE2A 4LHXA 1CBUA 5DHFA 1CRPA 1VECA 1S1MA 2PLFA 2HF9A 2P6NA 1W2HA 1G8GA 2FFAA 2A9KA 2QG6A 4E09A 2W0SA 3TW8B 3CF0A 2FEMA 2XGJA 5C4MA 2JDID 3R7WA 2OBNA 1DAKA 4V03A 3JZAA 4PAQA 2F43B 4GOKA 1SXJA 1JQLB 3AP2A 1U8AA 1OKKA 2PZGA 1R8SA 1Z0JA 3IHWA 3MGCA 1IM2A 1R2QA 1VIYA 1W4AA 2C8VA 3B8HA 3H0KA 1IJEA 1NLYA 1OFIA 2V3CC 2FPLA 4KLNA 4GPTA 4L15A 2ZRPA 3Q72A 1E2JA 3RLFA 3KTAA 1T9HA 5HCIA 3THWA 2IYRA 2P67A 3FB4A 1W49A 1DO2A 3Q85A 1N6KA 2WSSD 2R8RA 3U7GA 3L0IB 5CJPA 4IXNA 4C0QC 3KDSE 2VO1A 3O8RA 3Q5DA 4TL9A 1IN6A 1XD2B 1AIPA 3ETLA 3AQ4A 3ZDQA 1AN0A 1W0KD 3TK1A 3QQ5A 2J1LA 3RS0A 2QMHA 2VTKA 4B44A 4OQMA 3VHLB 5LB4A 4JZKA 4BECA 2DBYA 1XX6A 2IHBA 1NI3A 1VCMA 3N70A 1NP6A 1T6NA 3QG5A 2O8EB 1Z06A 1KI9A 3K70C 1P62B 4YMSA 2OBMA 4M21A 4QRHA 2BBSA 1CRQA 1XJQA 3AUXA 4LBZA 2XZLA 3GJ8A 4KU4A 4DLYA 1JR6A 1XTKA 2J0UB 4CEJB 1EGAA 4F92B 1PJRA 2FZ4A 4Q4HB 4TQAA 1E1RD 1NBMA 4RZ2A 3A4LA 3DHWC 3NDBB 2YKGA 1GP2A 3KQHA 3M0EA 1N5IA 2AWNA 4Q4LA 1G5PA 2IXEA 3DPUA 4M9SA 3LRPA 2VL7A 2WBLC 1VHTA 4Q9LA 3WNBA 2F55A 1F3OA 3UG6A 2IYWA 1T91A 3B6EA 3CPJB 3TE6A 3GLFB 3DZDA 1RRCA 1Z29A 3VFDA 3PV0A 4MKFA 5ANRB 1DG1G 1HA3A 3K9NA 3R8FA 4XVRA 1YR8A 4NYJR 3THXA 1DARA 5HZKA 4PO8A 2CHGA 3PUXA 4M0LA 5DGXA 5DYGA 1G3QA 3F8TA 2FZLA 3TH5A 1ZNXA 2FF7A 2FX3A 4UNNA 1E79A 1KK0A 1T0JB 4WZ6A 1TPZA 4NYIQ 1KGDA 3EA0A 3KQLA 1CR4A 2IUUA 2YWHA 3SHWA 4ACBA 2QSYA 5G53C 4KVGA 2BCGY 5DISB 1W48A 3KB2A 4IDQA 1OXXK 1UKVY 3AGQA 4KBFA 1XCPA 4A6PA 2ZIAA 2IYYA 1N6HA 3NEYA 4PO1A 4ZCIA 1FNNA 1BO6A 4US0R 2NZJA 3CNOA 1CJUC 4TMTA 4Q66C 4KLZA 3ASZA 4GI7A 3UG7A 3W8NA 1US8B 5FOVA 2LWIA 2KE5A 3SJAA 1F6BA 3BH0A 2FA9A 2CLCX 2GJ8A 1II9A 1R10A 5BYJA 1EFRD 2ZS9A 2XOKA 5J40A 4QBGB 3WP1B 1N25A 5DI3B 3HPRA 3NBFA 4Q21A 1SVSA 1UKEA 2A5JA 2V1XA 3K9HA 1CR0A 4AURA 2H92A 1EK0A 3X1ZA 1KHTA 3NIBA 5LD2C 1XEFA 4HLDA 4MKIA 1W2GA 1FNMA 1ZP6A 3RS3A 4NCHA 2REOA 3PIRA 3LLMA 4HDOB 1UKZA 1XPOA 2A3RA 3P27A 4I1UA 4RD2A 2C78A 4DDUA 5JHGB 3TGPA 2J0VA 1OJLA 1P7CA 4MUBA 2IW3A 5JLJA 3RSLA 1ZUHA 4PHGA 2QBYB 3CRQA 1TQDA 5FBQB 1T4GA 1F60A 1LB1B 4FCVA 1TQ4A 4LRWA 2HCJB 1KK3A 2ZE6A 5AUPB 1E9DA 4ZCLA 1Z8FA 1L8QA 2IX3A 1TX4B 3QF7A 3WRXC 3E2IA 2G83A 4B2LA 4FD2A 2V7QD 2CHVA 3UATA 4BFSA 1GUAA 4F4JA 2BBTA 1OLOA 2XTNA 2O0HA 4FN5A 5FOUA 4P33A 5FBRB 2FH5B 2PZEA 1BMFA 1LW7A 1FFHA 4TMZA 2JATA 1FQJA 2N1BA 2ZSFA 4QJ3A 1JQJC 2QPOA 2WOOA 2MSEB 2QM8A 2NOAA 2GAOA 2GXUA 121PA 3OIWA 4PQRA 4ZKDA 2RGGA 1A5TA 5IK2D 1YZKA 4HATA 4D4KA 4RVCA 4B32A 1U90A 3KZ1E 4IOKA 2DY1A 4P31A 2CCJA 1P60A 1MABB 3C4JA 5DE3A 5L3SB 4MDEA 4HLQB 5EQTA 3I1FA 1JALA 1P6XA 1AS0A 1M8PA 1KY2A 3RABA 4Q47A 5FOTA 1I2DA 2H16A 3KKOA 5LBIA 3ONWA 4GNKA 5GVRA 4BFWA 4RFSA 2HDNB 4QHSA 4B6FA 1ZJ6A 2P0EA 1Z0DA 2XSZD 3B1ZA 1G16A 1IXRC 2HT6A 3AVQA 4KVAA 1I4LD 2WWHA 4LC0A 2VP9A 1J2JA 4JIMA 3FKQA 4TL8A 3M4YA 1LNZA 4C0KA 5CDFA 4Z1MD 3GLHB 4O0MA 4RCZA 1RYHA 1WCV1 4LYJA 4AKGA 5TDHA 3LFUA 3F0TA 4IKEA 1D8TA 1W44A 3T1OA 1EESA 3IO3A 4Q1CA 2V7QA 3TR0A 3NTUA 4AI6A 3BK7A 5JS7A 2VF8A 1KO1A 3QVUA 4FMCB 1NVWQ 3EXAA 4U7DA 2VH5R 4DVGA 4TLDA 2OO7A 2CNWA 1G6HA 2VHTA 2W6JD 3H4MA 3MUFA 3MWKA 2WWYA 3BFKA 4LY6A 3LLUA 1MO5A 4MYUA 4EFLA 1JR3A 3JVUA 4TWZA 1NMZA 1P9NA 1ZD9A 2R6CA 4CYMA 5EP1A 3ZVLA 1E3MA 2HEIA 5IHPA 4HAVA 821PA 5FL7A 3Q7QA 2VLIA 3TRFA 2J0QA 3X2SA 4XSHA 3U4QB 2JLXA 2D2FA 4EAQA 2RHMA 3BD9A 3QI2A 1P9WA 3NEJA 4NHOA 2OT3B 2IS1A 3AVVA 2FV8A 1II8B 2WSSA 1K5GA 1E9SA 1G7RA 4C0SA 2HYIC 1Z6XA 4LSGA 2V1UA 2SHKA 2VA8A 1DEKA 5EUMA 4BPBA 2YOGA 1U98A 4DHEA 5JJLA 2X19A 3IBYA 1AM4D 1JEEA 4RY2A 1CR1A 1CLUA 4M2LA 3GJ5A 1RYFA 4Q18A 1KOFA 1UADA 4M1MA 2IUTA 4JLAA 4MKGA 1SHZA 3SE0A 2O52A 4OI2A 5K8LA 4Q1AA 1G4AE 3TQFA 2JLVA 1ZW6A 2GCPA 1QG4A 1PVOA 2Q6TA 4D4LA 3P1JA 4EJSC 1JAIA 4PAMA 1E9AA 2IYXA 2QT1A 3KXKA 4P0TA 3MFYA 1TADA 2ZEJA 1NVVQ 1EX7A 1DOAA 1UM8A 3GJ3A 1ODFA 3K0CC 3WYGA 3EPLA 5J5CA 2DFKB 3VX4A 1NIPA 1QG2A 1XRJA 3NC1C 1GVNB 1QZXA 1WB9A 1KY3A 1GAJA 1N5LA 2V6IA 2V6JA 4OL0A 3U7EB 2YOHA 1V43A 1OYYA 4IDNA 3QKRB 1MT0A 4KITB 1YZQA 3NVAA 2GXQA 2VIIA 2FPMA 1G8YA 1Z6TA 2Q3MA 2R6DA 4LWZA 1GRQA 2GJAA 3QXJA 2B8WA 4M1TA 1E2GA 3MD0A 5KU1A 3P20A 1XP8A 2J87A 5CITA 4JSYA 2P5TB 4Q1FA 1GL7A 4O2LA 2X77A 5J4YA 1S4QA 1NIJA 2EQBA 4B71A 4JMPA 4G5OA 2ZRCA 3DM9B 3E70C 2XB2A 1OHHD 3LBNA 4JLOA 1SVMA 1S0UA 1RVDA 1FP6A 2IEZA 4A92A 5JS8A 1AS2A 4GDFA 3MWYW 2W0MA 4EJSB 3L0PA 2ZITA 1E2LA 3I72A 2Q9CA 2R9VA 1CULC 1U0HC 1ZUNB 5KO2A 3P4YA 4V0LA 4Q7LA 4P4TA 3PUYA 1RJ9A 3WNDA 4A1FA 2CE7A 1KMHA 2IYTA 4B47A 3OESA 4DXAA 1RFLA 3IIMA 1GKUB 3KB1A 4G5SA 4PPQA 3WP0A 1FX0A 4POAA 5J4VA 2DB3A 3OF5A 4TZ0A 2QP9X 2PX0A 1IY0A 2ZI9A 1DAEA 1UBFA 3FFBA 1HURA 2HUPA 2KB0A 4JVMA 1G9XA 4C2TA 1J8YF 1QHXA 2Q9BA 2B7CA 2E9SA 3K70D 4AIIA 3BORA 4OHWA 1OXUA 3V00A 2GKSA 1YZGA 4LV6A 4AKIA 5EE0A 2DFTA 2WICA 1XFAA 4HUQB 2CL0X 4E03A 5KSOA 5TARA 2GJSA 2CVFA 3K09C 4QGAA 2FJUA 4J0QA 1LF5A 2PEZA 3NC0C 4B2IA 4MUAA 5EZ5A 1QVAA 5HZHA 1SGWA 2OM2A 3SYNA 5HE9A 1NY6A 2AN9A 3CBQA 2AK3A 1KIMA 1SKYB 3H86A 2B6HA 2EFDB 3RNLA 1II8A 2QPAA 3EASA 2UZIR 4B3XA 3DM5A 4F93B 2WJHA 2B21A 1SHKA 3QXCA 3K0AB 1MKYA 2WPDA 3WNCA 2NO1A 4HAYA 4NDZA 2YWEA 5TVKA 3R9XA 1P2UA 3LVQE 3T35A 5LB2A 5EE1A 1KMQA 2IF0A 2ZI5A 2GZAA 2NO7A 1MOZA 2OCAA 1NG9A 3RRYA 1G64A 1PLLA 1MO3A 2ZRLA 3HR8A 5HPYB 5G3YA 4N0EA 4LBWA 3ZVRA 1WGWA 2OAQ1 1IAQA 4E22A 4YONB 2BMJA 2GVDC 3ASYA 1GRNA 5KTYA 4DT1B 3QSYA 2ZANA 1G7TA 4DIEA 1AS3A 2MSDB 5FOXA 1AQYA 4KJZA 4URWR 1W4RA 4FW9A 5C2JB 3SYLA 3CM0A 4Q19A 2H8KA 1Y3AA 5JZVA 1G3UA 1KI4A 5BWMA 1BIFA 2Z6VA 1ZCAA 2CK3D 3IQWA 1W36D 1SVOA 2F1JA 4GRAA 1VYUA 1A2KC 4URZR 4BLPA 3BGWA 2Q3HA 1NF3A 1PLKA 1BYIA 1Q1EA 2J5XA 2VF7A 3C16C 1W0KA 4K81B 4RCYA 4DLSA 1KAOA 5C18A 1G19A 2JJ1D 1Q1QA 4HZUB 3CX6A 1FZQA 4EQ6A 3MWJA 4OI0A 4CEIA 3RSOA 1DAFA 2HYDA 1Q21A 1HT1E 4X8MA 3THOA 3I62A 2VRWA 1VDZA 3M1IA 3QF4B 1U81A 5C4GB 3HU3A 1R0YA 4HAXA 4AG6A 2WTUA 3K9GA 4LYAA 1Z6YA 1Z2CA 1ZVQA 4EDHA 2WJVA 4M1OA 1Q20A 2ZU6A 4HLUC 4M1KA 2XNSA 1BH2A 2QUZA 4F4CA 4OK3A 3VKGA 2RGBA 3L82B 3I5YA 3RWMB 3I61A 3WY9A 4NYIR 4PSKA 4B3GA 1TEXA 1CJKC 2WPDD 5EP3A 2D7DA 3CF2A 2RGCA 3T1VA 5H68A 3UMSA 1OXTA 2Z4RA 3SFVA 2XAUA 3ADBA 2ZM5A 1UBEA 4Q4AA 5CB8A 2RGAA 2WWWA 3BWDD 4CEHB 2ORWA 3WYAA 4HAZA 1Y63A 3RYTC 2QU8A 2IC5A 1EFTA 5HCNA 1RZ3A 3EWSA 3A4MA 1XTJA 5IK2A 4B3CA 2F3TA 1ZIPA 2ZAOA 4CEIB 1YHNA 2IF2A 3RRMA 3K0SA 2CDNA 1X8JA 4JL5A 4M4SA 3T15A 4ARZB 1OH5A 2A5DA 4G1UC 2BM1A 3X1XA 1KTVA 1KSJA 4C7OA 2GF0A 2G6BA 1R4AA 4BFZA 5KSYA 2ZI6A 4DCSA 4R7ZA 3CW2A 1XJCA 1ZM2A 2VP5A 3ZYCA 1XPUA 1EWQA 2DR3A 3AH8A 3GLHE 4IDPA 2KBFA 5TV2A 2XXAA 3BB1A 2IS4A 2IYLD 2QAGB 1U8ZA 4C0LA 2JJ8A 4QXAA 5LD2B 1KDOA 3LDAA 1ZM7A 5E7MA 1JR3D 4BLQA 4AYTA 3QNUA 5FPYA 4YMTA 1Z0AA 2V8OA 3AVOA 5JJKA 4MGZR 5D3MB 4DLRA 2J3EA 4ZDJA 1WA5A 2BJWA 1P9RA 2H5EA 1EXMA 3SC3A 4WOPA 1XD8A 3CWQA 3T1TA 4DSOA 2A7QA 1LFDB 5H8WA 5HKKD 1M6NA 4DIDA 4R98A 1UAAA 3GLIA 2W6IA 3GLIE 1K8RA 3AGPA 2AWOA 4YMWA 3CB4A 1GITA 2BWJA 4K46A 5JFGA 2QENA 1E6CA 1KNQA 1ESMA 4DJTA 4PZLA 1A7JA 2GZDA 1NMXA 3D7MA 5FBVB 3LXXA 5KNDA 5FPSA 2YJTD 3B9PA 1Q57A 4TL7A 2CJWB 1CR2A 1A4RA 2ZRKA 3TAHA 3BFVA 3RWOA 4EPTA 1H8HA 1XXHA 2PL3A 3PVSA 4QNRA 4QJ5A 2WM9B 3C14C 2QPTA 2WVJA 3MSXA 2QZ4A 2VP0A 3H1TA 2FDCA 1GZSA 3BAFA 4PXAA 2C9YA 2Z43A 4C0AC 1Z08A 3A58B 1OXSC 4WZBE 2YINC 4PHTA 2IA5A 4KODA 2RB4A 1OW3B 2QQEA 2RAPA 1AGPA 5AJZA 3QKRA 2ZJZA 1VTKA 4TLAA 5DLQC 1Q1ZA 4MGYR 2OFOA 3BFXA 3GJ4A 3QBTA 3BB4A 3BOSA 2Q9AA 3CONA 4OBEA 1R7RA 5JHHB 3BS4A 2JIZD 2IBMA 1J99A 3P26A 4CGZA 4V02A 2WMOB 3GP8A 3VR2A 3CZQA 4XIGS 1S9HA 4BFXA 2C96A 1CKEA 1QHYA 2PT5A 4I81A 3RS4A 4MRRA 5DSZA 4US1R 4OHVA 2BCJQ 2CMKA 1DG3A 4QNMA 1E9BA 3QF4A 3A1UA 4IOLA 3NDPA 2WIAA 3RDPA 3TIFA 3ZZUA 4Q7MB 5JI2E 3ADDA 1YR7A 1DBSA 3AP1A 3PENA 4DCUA 5BW8A 5JWOA 3NXSA 3B60A 4NZYA 2I1QA 4IDHA 1UDXA 5KYKA 1ZIOA 3VNUA 3BXZA 1MO4A 2W83A 2EFEB 1KZ7B 1W0JA 3TAUA 4TYNA 5B30A 1OT3A 2AKAB 2ATXA 4NONA 2HCBA 1AK2A 1A82A 1JAHA 1OF1A 1E2PA 3F3YA 2OG2A 3ZQ6A 2NGRA 4H1VA 1IONA 1XZPA 4D0GA 5DHAA 5E7JA 3MJHA 4CRWB 4DSUA 4HEJA 4CEHA 5F9HA 4DCNA 5K8UA 5EXSA 4DUGA 4GMXA 4I99A 3SI7A 2F1RA 4GZLA 1PLJA 4LK2A 2VP6A 2QAGC 1G6OA 4M22A 4U5XA 2OZEA 1TF5A 4QBFA 3UXMA 1W4BA 1V5WA 4TQUS 3WXMA 3PEVA 2GHIA 2JAQA 1ZNYA 3LBIA 4N1AA 2AL7A 3RS5A 2I4IA 5KPJA 2QBYA 1QHGA 4LHWA 2IS6A 4RFSB 1NJFA 2CCGA 2VHQA 4L16A 1PUIA 4OHXA 1NSTA 1S3GA 4BFVA 3UK6A 2A5FA 1C9KA 4EUNA 4QGHA 2GXSA 3NWJA 3J81k 1N5JA 3GFTA 3CRVA 1M34E 4MITA 3R8CA 4O2RA 4BLSA 2XXAB 2IYZA 2P6UA 2A5YB 2BMDA 1IBRA 3B1VA 2CLSA 3P4XA 4JT2A 3HU2A 4B3BA 1YQTA 2JCSA 4LX0A 5B58C 3H2YA 3I3SR 4B73A 4GL2A 4D25A 1DTSA 5CIQA 3R7WB 3CPEA 5AUOB 2CXXA 2YC4C 4YMVA 4Z1MA 1KDPA 3RRNA 4P3YA 1DAGA 2VPPA 1T5LA 2XZOA 3UPUA 1MRNA 1COWD 3LQRA 4ON9A 4EFNA 3GCGA 1Z07A 1JECA 2YVUA 5TY0A 2H1LA 4M9QA 3REFA 3FHTA 1E2EA 4UNRA 4LHVA 4ACAA 1G1MA 2K5UA 2XTMA 3OE7A 4P4SA 4TN1A 5CM8B 2ZR7A 2V4ZA 3TNFA 3DMDA 2GNOA 4PC3A 3PXGA 5FUYA 1HEIA 2LCFA 2QAJA 3W90A 2IK8A 1LTQA 2QE7A 2ZVPX 3AP3A 2PJZA 4TZ6A 4V0OA 5HR5A 1ZYUA 4D4JA 4NKRA 1FTNA 4D82A 4D6PA 2ORVA 2ZVQX 4S2EA 4GZMA 1ETUA 4A0HA 2OCPA 4NCJA 3VMFA 3KKQA 2ZYUX 1KO4A 3THYA 1VCOA 3IEVA 4PC7A 5FPTA 1NVVR 2O8FB 1L7VC 4ZCMA 1FUKA 1FMJA 1DO0A 1OE0A 3LWNA 1P2TA 2WOJA 1G5TA 3QVVA 3ZIAA 5IT5A 4LBVA 4UNSA 2AHOA 2QQ0A 1NY5A 3I73A 1M7BA 5FBLB 3HDTA 3I32A 2O8DB 3SU8A 1G3RA 4BASA 1KJYA 2GWHA 2GZHA 1TF2A 2QAGA 3BB3A 3EA5A 4B35A 3UANA 5K8IA 2DPXA 4TLBA 2ODEA 2PMKA 5E3HA 2D7CA 3EZ6A 4W5HA 2IL1A 3KJGA 3ND8A 3TQCA 5L8VA 4XJXA 1SQ5A 3SYKA 4D0NA 2H57A 1IOZA 4LJ6A 3VTKA 3L0SA 4JVSB 4X8LA 2P65A 4ZI2A 1GILA 1M2OB 2JGNA 2BBWA 1N0WA 1R6BX 1JNYA 2OFXA 1L2TA 1UEJA 3A4NA 1WBBA 1D9ZA 1W47A 2GEDA 1D2NA 2A2ZA 3KXIA 4I4LA 2XJ9A 2RH5A 4OJKA 3U6KA 3V4RA 1AKYA 2GEVA 1N0VC 3LAWA 4A2PA 4KFRA 1RIFA 3SJCA 4R71A 1UJ2A 5E95A 2P6RA 4V0KA 4PSVA 1SVLA 3K9LA 3AVTA 2N46A 4KSBA 3K0FA 4IEIA 5TXGA 1GRRA 1IN5A 3C15C 5IRCD 3U44B 4QM7A 1XMVA 4JBXA 3NG1A 4HLUA 5G40A 2OSBA 2ZSBA 3AF0A 4Q03A 2ERYA 4FIDA 2QTFA 2FNAA 3BJIC 1SVIA 2BOVA 4O3MA 2AXNA 1KSHA 1YR6A 2X2FA 5FTMA 1U9IC 3AF2A 3CRW1 4PFSA 1E9CA 2G88A 4CT5A 2Q21A 4C0HA 4Q5IA 1DE0A 5FR1A 4EPYA 3QBVA 2YV5A 1KDRA 1KI8A 5FPKA 1VCNA 3MAAC 1XCGB 3FKSA 4MGIR 1EFCA 4Y0VA 3SJBA 5KSZA 1XEXB 4AY2A 3DEFA 1T8UA 3QKSA 4FMDB 4JLBA 4XOIA 1ZM4A 2E1RA 2J0UA 2VYFA 5JRZA 3EZ9A 3FHOA 2O8DA 4YXWD 1DELA 3DL0A 2ERXA 5FFMA 5DO9A 2PEYA 3ECCA 4II7A 1K5DA 2JA1A 1E2HA 1FPMA 3KQNA 1HE8B 2LKDA 1GL9B 1W36C 1Z5ZA 2RKOA 4MQBA 4LYFA 1J8MF 1JPJA 3A37A 4H9GA 4RD1A 1E4YA 2RGNA 3L8ZA 4NBSA 4WA7A 3Q9LA 3PG5A 3RHFA 1GOTA 2H18A 1GNPA 2QP4A 1SKQA 3GJ7A 1NKTA 5P21A 4LHZA 2O8CB 2QSZA 2JLYA 4AWXA 4UNQA 2ZRBA 1VCIA 3S1AA 2AD1A 3LQQA 2JIZA 3W6OA 1GL6A 4Q48A 4B48A 1R0WA 1XMIA 1HH4A 2WJGA 1XD9A 4M8NE 1N0UA 1K6MA 4EPXA 2GTPA 2UZ3A 3ADKA 4HSEA 4TLEA 3SEAA 2IS2A 2CVHA 4BE7B 1HTWA 1JXOA 1H65A 4HZUA 4A82A 3NBYC 5DI3A 4B33A 4B3DA 3GLHA 2JLRA 1ELOA 2YZ2A 4KFTA 4ASUD 5L3QB 2HJGA 4DEYA 3KUCA 2QI9C 3TKLA 4RD0A 2ZJ5A 1N6LA 1KNXA 3IHLA 3I8SA 2WJYA 4KYIB 4M53A 4QHYA 521PA 2UVQA 1G17A 4A2QA 4D2IA 3DO6A 3SZRA 1VMAA 1XEWY 3OFNA 2ASEA 3VHXA 1FOEB 3IDQA 2UKDA 2JJ2A 4BQSA 4R2HA 4KXFB 4HYYA 4QC2A 3EZ2A 1N6OA 2EWWA 2FSHA 2KWIA 2FFHA 4GT1A 1HT2E 1VG1A 1YZNA 3S1AB 1BOFA 1J7KA 3SHFA 4YC7A 3THWB 1S2MA 2F1IA 4DLXA 4M9ZA 2RGXA 1SULA 2WKPA 3CF6R 3QOFA 4L9SA 4LCBA 1FW6A 1TQ2A 1CXZA 5KDLA 4A15A 4A0FA 5EE3A 3FWYA 1ESNA 4HAUA 3QXSA 4CIDA 2QEQA 1UBCA 1DAHA 1GSIA 3QKUA 3HYTA 1NSFA 3FDIA 4P4SB 2JLWA 1Q1BA 1TAGA 2C9OA 4ZPXA 4NTZA 1L4YA 4TQ9A 2OUKA 8OHMA 2BJVA 3W34A 1IN7A 2LKCA 3NHBA 4WIAA 1TUIA 1E9RA 4IVRA 5K8TA 4Q4HA 3WMFA 4H1UA 1X3SA 2IEYA 2AK2A 1WBDA 4QL3A 4TMVA 4A0GA 6Q21A 2QTVB 1F2UB 2OESA 3CRRA 3C5HA 1GFIA 5A5GA 3VKHA 1IY1A 4KI0A 4A4DA 5FOWA 1JJVA 1AQUA 2GVZC 3PUZA 3DOFA 4FMDF 4PX9A 2EFHB 3BE4A 3IIJA 4LJ7A 4ASUA 3LVRE 2ZJAA 1LVGA 1E0KA 2VSOA 3VU9B 2ZSEA 4C30A 4HB3A 1P3JA 3C8UA 3O8BA 3TSZA 2ZI7A 2CL7X 1QHIA 3WHKA 3TUZC 3U7HB 4M1WA 5EP2A 3QXHA 4GOXA 3QPWA 2ANBA 1SXJE 2ZR9A 5B57C 1X86B 1FX0B 1HYQA 1X6VA 3IGFA 2C2HA 2V9PA 1Z6AA 2NMVA 4DC9A 2ZS7A 1Z63A 4TMKA 4RZXA 4Q7KA 4EPVA 1A2BA 3GJ0A 4DWJA 3TR5A 1Q12A 3VU9A 2MMCA 4Q9JA 5FH9A 3EPJA 2ZJ8A 1T0HB 3FOZA 5CLQA 2ZXUA 3IBGA 5F98A 2R62A 3CIOA 3EWAA 2BKUA 1E9EA 5DYIA 1OIXA 1NJGA 1Z83A 1W46A 2WWGA 5L3RA 5F3WB 2QGZA 4V0NA 2PCLA 1XNJA 2CHQA 5AUQA 3FVQA 3IIKA 4KHZA 5GJVC 1KI6A 4WAUA 2BKEA 4V0MA 3RVBA 3DZ8A 1P73A 2ZE8A 4ZIRA 1II0A 4IHQA 4A8JB 1RKBA 1OHHA 2HJVA 2ZYWX 4R2IA 4XH9B 4LZZA 2L0XA 3DVLA 2ZUCA 5FTNA 3WBKA 4JKIA 2ZUDA 4BEBA 1S8FA 4DLUA 4NCNA 2ZJYA 1GTVA 4XTRA 1XJ0A 3ICEA 1ZRHA 5CLLA 1FL9A 3OEEA 5FPHA 5EE9A 5BN3A 1RJ9B 4P32A 4UXJA 1ZM9A 2G3YA 3A8TA 4QKQA 2QA5A 1M74A 4JLJA 5HKKA 2WMNB 5GJWC 3SQXA 3V9PA 3KKNA 1YR9A 4OHYA 3MCAA 1UF9A 4F7WA 4U02A 5CYOA 2CEAA 2NTYC 3K53A 4ITRC 5DN6A 2F6RA 4OQXA 3W6NA 4IVPA 2ZRHA 1LS6A 1ZNZA 2ONJA 2WWIA 4PTLA 5HE8A 4G5QA 3SR0A 1IXSB 5G3ZA 2G77B 3EG5A 4TL6A 3Q3JB 1D2MA 3CRMA 5FR2A 4R9UC 4JVNA 1E1QD 5FBWB 3QENA 2QROA 3DDCA 3G0HA 1G7CA 1IY2A 721PA 4PC6A 3VX3A 1OKKD 4MRSA 1P5ZB 4BLTA 3LXRA 1G18A 5KNCA 4TTQA 1IN8A 2REBA 1XBTA 3BH7A 1IN4A 3IPXA 4Q9HA 1E9FA 4FWIB 3SOPA 3KFXA 2RHDA 4URVR 1ZC4A 4C3ZA 3PEWA 5H1YA 1HE1C 1E2MA 1DADA 3A6PC 4TYYA 3EAQA 3IILA 4WXRA 4MKHA 3GLIB 1VPLA 1NMYA 1HV8A 3NH9A 5D3QA 1OH7A 1YZLA 4CF7A 1KJZA 4RD4A 1U9IA 2PMDA 4NL4H 3WBJA 4DLVA 3K70B 3PJRA 4LPKA 3KJIA 1X1SA 2BEJA 1CIPA 4JVLA 5DH9A 1YJ5A 4Q1DA 2GCOA 2WJJA 5EP4A 3E5HA 5FL7D 1LV7A 1VIAA 4B74A 1P4SA 2EFCB 4XSGA 5FL3A 5C1BA 4ZIRB 3NHAA 3OZXA 3LA6A 4BEJA 1R8QA 2A78A 4D26A 5C46F 4YMUA 3GLGB 1FTSA 1TF7A 4XWOA 3CPHA 2ATVA 4CDGA 1MV5A 2W2TA 2O5VA 3I8XA 4X8OA 2OCYC 1QHHB 4EQ6B 3T34A 2G9NA 2ZRIA 4Q4JA 1UEIA 2F3RA 4C0BA 4UQOA 1GG2A 1SZPA 2WZQA 1RE0A 2GBLC 1R5OA 3U3RA 4BLRA 1G41A 5IDVA 4LJ4A 3EX7C 4W5WA 2QRNA 1CP2A 4RD6A 2KJQA 4G5RA 2OAP1 4MYCA 1E79D 4DB4A 1Q3HA 2IXFA 1E1RA 2J9RA 3QPUA 4IEEA 2GJKA 4I1VA 3AVUA 4XVQA 3X1DA 2JEOA 3ZS9A 2AFHE 1RRPA 3U4QA 4WW0A 4PANA 5KNBA 2ANCA 4JYBA 1E2QA 2XEXA 3V4FA 2B8TA 3TSOA 1WP9A 5BYKA 3PEUA 1YRBA 1S9DA 2VQSA 4QGFA 5FI1B 3GJXC 2DFLA 3E1SA 2BM0A 1OIVA 4NMMA 4UXHA 2ZI3A 4MH0R 3CH4B 2BHRA 3U3KA 4WXPA 2P5SA 4KV9A 4DKXA 3EIQA 3CZPA 4A6XA 2NPIA 2KBEA 4D81A 4Z8YA 4UNPA 2RMKA 2B92A 4Q9KA 5CB6A 4PPFA 1G3IA 1O87A 3QKTA 3K0CA 1JJ7A 3B9QA 1JEDA 4D4MA 2ECKA 3LBHA 3QE0A 4GSYA 2TMKA 3FMOB 5KSPA 4E5UA 3TJZA 4GFDA 3HPQA 4LJAA 1OV4A 1F2TA 2ZETA 4MRNA 4AYXA 3B5JA 1Q44A 3ZJYA 1SVKA 1JBKA 3IEUA 1G8HA 4DLTA 5KUTA 2QTHA 1Z0FA 2J45A 3VR3A 3ZH9B 3GEHA 2CLDX 3A1TA 1OB2A 3AKDA 5D3MA 4DDVA 1RRGA 1EFRA 1U8YA 2GF9A 1XU4A 2IWHA 2WKRA 3AF4A 1CJVC 2R6AA 4JLMA 4DSNA 1QRAA 3GFPA 4MYTA 1SVWA 5LDDC 3W8RA 3C7KA 1OXVA 2Q3FA 3PEYA 2Z0MA 1AJEA 3GPLA 4XD7A 4JLVA 4JBWA 3SQWA 2EYUA 2ZAMA 2GESA 4A8JA 2Q0HA 1ZU4A 3AKCA 3OE7D 3VR5A 2DWOA 2RCNA 3EIEA 2QRZA 3W3AA 1Z6GA 3OAAD 4C0JA 3T5GA 2NG1A 1BMFD 1VKJA 3M6AA 3OFND 3R9IA 3WYFA 421PA 1JB1A 4KFUA 3A1SA 3I4LA 3CKLA 4D80A 1SXJC 2BBOA 4KAXA 3W3ZB 3AVWA 3PR1A 3G5UA 3AVYA 3B7GA 1WMSA 1KI1A 3AF3A 2OXRA 3PCRB 5EZ6B 2ZROA 3P32A 4IFBA 4NCIA 2ZJOA 2AFIE 4B2PA 1N2CE 1N6PA 1WF3A 2OBLA 3WMGA 2IWRA 2IXGA 2C99A 4QOSA 3UWOA 4BRWA 4C9BA 4EPRA 5BN4A 1OPXA 3GLGA 4GBMA 1OB5A 1EFHA 4JJZA 3T1QA 4IOMA 3TSWA 1Z22A 3OIVA 1DVRA 1E96A 4AD8A 4NYMR 4HB0A 1DAMA 2FWRA 4KFSA 4PZYA 3T61A 4LHYA 5HTKA 1W5TA 1ZC3A 3K09A 3FE2A 4Q4AB 5FTKA 2O8CA 5EUQB 3CH5A 4S35A 1HY3A 2GDJA 1XD2A 1ZNWA 2FGJA 2ODNA 3KJEA 5AJYA 1XTSA 2MSCB 3PQCA 2D06A 2JJ1A 3GLFA 2GRJA 3QY0A 5FUVA 2W00A 4PHFA 4KO8A 1CJMA 4LJ9A 4LJ5A 5J4LA 4MDFA 3HWSA 4C2UA 1S1CA 1KK1A 221PA 3TUJC 1OH8A 4DBLC 5GJBA 4TYPA 1B0UA 3FMPB 4XD7D 2J7PA 1KI3A 1E0SA 1EG7A 1UBGA 2GILA 2Z4SA 2ZTSA 3G82C 4IJMA 2Y8EA 3B1YA 1W0JD 1NNEA 5AR1A 4JLDA 2NPFA 3U6BA 3FKSD 3SNHA 5F2EA 4A0RA 1NLFA 4B75A 1RW4A 5ELXA 3GLFE 1ZD1A 4LBYA 4RFVA 2YC2C 3FGNA 3GMTA 1N3BA 3UIEA 3SFZA 3JZMA 4MA4A 2CNWD 4QM6A 4ZI3A 1IJFA 3DOEA 2OFWA 3GEEA 5CIWA 1R5BA 2OLJA 2HXYA 3L43A 2N42A 4LDJA 2ZRNA 4HLCA 3EW9A 4G3XA 4L8GA 5J47A 1ANKA 3FTQA 1MRSA 4F91B 5KDOA 4HDQB 1P75A 4EKDA 2QMEA 2CL6X 2EW1A 2YNMA 4Q00A 2C5LA 1G20E 1YKSA 5FOSA 5B2ZA 1OSNA 1G7SA 1GKIA 4MRPA 1VG8A 1KKMA 4JKYA 2ODBA 5JCPA 3EZFA 3DMNA 1Q22A 5FTJA 5DI9A 1ZCBA 1TMKA 3CR8A 1LY1A 5DN6D 2QM7A 2O8BA 1KI6B 2DWQA 4URUR 2ZRFA 1Q3TA 4MGKR 2PT7A 3SN6A 1X8LA 2HLDA 3U61B 1XTQA 5SZKB 3ZZTA 3BRWD 4GOJA 3MJRA 4KCGA 2RGDA 4B3FX 4LV8B 2ZUBA 2QN6A 1X8KA 3OEED 3PUWA 3RS2A 3ZQJA 2CJWA 1GKYA 1P61B 4QFMA 3CX7A 4PZZA 1I4TD 4O25A 1E1QA 1U0LA 4YDSA 2BMEA 4OHZA 2WWXA 2FPKA 1R0XA 5AUNB 1NN0A 2FN4A 2HV8A 3EIHA 3VR4A 1XEWX 2F7SA 4JL6A 5CYPA 2AX4A 1DAIA 2NQ2C 1KO5A 1E2FA 2QORA 1NN3A 4JBYA 5A0FA 1KO7A 4A2WA 1P2SA 4QG7A 1Z0IA 2FFQA 3LW8A 5IF9A 1XPRA 1WRBA 2OCBA 4BZQA 2PZFA 1XMSA 1I2MA 1I4DD 3BC1A 3VR6A 5AJVB 3KQKA 4X8HA 1FUUA 4IRUB 4PSAA 4HAWA 4W5JA 3SDZA 2ZS8A 3DKPA 621PA 2XZPA 4NYMQ 3O47A 4PHHA 1NVXQ 5BQ5A 2KSQA 1EX6A 1D2EA 4NP6A 1O3YA 3T06B 3EZ7A 4RSGA 2V54A 3LX8A 1KI2A 1XCMA 4YDHB 2D2EA 4I1SA 2WJIA 5FTLA 4W7SA 4L5BA 2G0NA 1OYWA 3L0OA 2ZREA 3H84A 2PLRA 4HDCA 4JLPA 4Q1EA 4RD3A 1E0AA 1TU3A 5L3VA 2G1KA 4L4UA 3HP1A 1H8ED 4Q02A 1JI0A 1YZTA 3AEZA 1XMJA 1US8A 1XXHE 4OK6A 4BFYA 3D3QA 4HI0E 3ZS8A 3ZVNA 1KO8A 2H7VA 2WIBA 2HLDD 4LYHA 4QHTA 4JT4A 4EIWA 2ZRJA 3Q7PA 4RZUA 2WHXA 1H8HD 1T3SA 2OXCA 1AGRA 3KKMA 4PR0A 3BERA 1VG9B 2IYQA 1M7HA 4NE2A 2R65A 4U00A 4DCTA 1ZMXA 2ORIA 3Q5EA 5EXXA 5JSZA 3HYRA 2ZRDA 1IQPA 1LS1A 1D6JA 1R0ZA 2XNDD 1RPZA 1E69A 1TNDA 3FHCB 3K0FB 4JJKA 5GJCA 1XTIA 1CS4C 2QNRA 3QJYA 2NO9A 3I92A 4ABYA 1T8TA 2ZYVX 3B85A 3VR1A 2FE4A 2G1JA 4DT1A 1DPFA 3R9WA 3EPKA 4AYWA 3OIYA 5AK0A 4URXR 1OFHA 4NU0A 3F5FA 1NG1A 3MMPA 4QBIA 5CK4A 4HB2A 4US2R 1E2DA 4Y0AA 2P2LA 2FFBA 2XJ4A 4UKDA 3B78A 1Z3IX 3GJ6A 4TMXA 1CEEA 1U94A 3W9YA 3CNLA 4DCVA 1AZSC 1B23P 1F2UA 3AF1A 4DDWA 1G21E 4CZ2A 1L4UA 2PCJA 4ZV4A 3QIAA 2MMGA 4LJ8A 2JASA 4LJYA 3GQBA 4OQFA 4PPNA 4Q4JB 1EWRA 4UJ5A 1PUJA 3OAAA 5E7IA 1NBMD 2FU5C 4GP7A 1W36B 2CK3A 1JPNA 2B7BA 4C7OB 2BVNA 5BXQC 4JSTA 4HUTA 1Q0UA 5TMPA 4I1OA 2ZU0C 2J41A 4OQLA 5AJWA 2VP2A 3VAAA 4PQYA 5CDFE 2REXB 4WVFA 2NO0A 2GETA 3LX5A 3QUSA 4P4UA 1IXZA 2QT0A 2QL6A 3A1WA 5E4FA 2O8BB 3CLVA 3FYHA 4QJ4A 3RC3A 2YOFA 3CR7A 2O8FA 3REGA 5JECA 2ZR0A 4TSFA 2EWVA 3OIUA 1JXMA 3RANA 4XWKA 1UKYA 2JLZA 1P2VA 2EYQA 3DKVA 2A30A 2XOKD 2QMUA 4DB2A 3LNCA 3AB3A 4XVUA 1NKSA 4TT3A 3HR7A 2EFGA 3IO5A 3EC1A 5M04A 1ZD8A 1UDWA 2I3BA 1P72A 5JSZB 4LC1A 2C95A 3AM1A 4G5GA 2A5GA 1R5NA 3KTAB 4XWAA 2F43A 3THXB 2AD5A 3TBKA 3KX2A 1H8EA 1ZM3A 3T12A 1BKDR 3IUYA 3D8BA 4JYCA 1D5CA 1HQYE 2FEOA 3BH6A 4TTPA 5L3QA 5GVSA 2D74A 4FI3C 2D3WA 4MYHA 3ICQB 2V55B 2RGNC 3EPHA 1KKLA 2AKYA 1ZU5A 1G8PA 2J59A 5JWHA 2C98A 1G5RA 1OFUX 2BIFA 3BBPA 5JJIA 4OJQA 2PX3A 4CEJA 2PBRA 5B64A 1N6IA 2Z5FA 4RJLA 3LH5A 5JI3E 1HUQA 4OK5A 1E32A 1YRAA 4FXPA 4IVQA 3EC2A 3CX8A 2EU8A 3U3JA 3LV8A 2NO6A 4HB4A 3IPYA 3ZIAD 2O8EA 1N6NA 2X1VA 3CNNA 3UMRA 3W5IA 2ZYTX 1S96A 2JJ2D 4C4PA 3NBXX 1U99A 5JWRA 1QF9A 1ZAKA 3N5CA 3ND9A 4OKSA 5FUWA 1KYIA 4M9XA 4Z8XA 5SZIA 4FWTA 2W58A 1E0JA 2DFNA 3IKJA 5L3SA 1AA9A 1CU1A 3LD9A 3TW4A 2ZJBA 4Z51A 4EJSA 4ESVA 1KZGB 4KBGA 2BV3A 1RC8A 2NZ8A 3AUYA 2D4HA 2R6FA 1W7AA 4WZAE 4TTRA 2JLQA 1G8FA 2WAXA 4IOJA 1YZUA 2W2VA 4TT3D 1TL7C 1F48A 3MG9A 3L2OB 1T3HA 2DCUA 3FMFA 4AK9A 2F9LA 5F9FA 1LF0A 4Q9IA 4Q1BA 4AKEA 1TUEA 4BZXA 3B1WA 2GJ9A 3ZZ0A 2IYUA 5JBQA 2ZE5A 2DWPA 2QP3A 4EPWA 4YQFA 2JDIA 1WXQA 2VP4A 2ZSAA 4B34A 5J4HA 2CBZA 2BDTA 1G4UR 3UWKA 2JLSA 3MRSA 2Z83A 4TSFD 5DIFA 1KK2A 2ZRGA 3QEOA 4YLGA 1XWIA 2F1HA 2E87A 1PV4A 5FI0B 2VSXA 3U60B 3LO5A 5BN5A 3EARA 2OHFA 4ZO4A 3ZD7A 4TLCA 1VHLA 5EXTA 2YWGA 4JLKA 2HT1A 1IHUA 3RRZA 2VHJA 1WE2A 3GFOA 1DS6A 4L9WA 2OLKA 4QGGA 2FGKA 3CO5A 1OFTA 1XB2A 4A9AA 5DNYB 3X1YA 3TMKA 3RAPR 3A1VA 4E07A 2GK7A 4RKEA 4DRZA 3ZD6A 1SXJB 2QY9A 1MABA 4XTCS 1F5NA 3OHMA 1A1VA 4URYR 3QPVA 3MWLA 3U7FB 3MLEA 3CUEF 4CW7A 3QEJA 1U0JA 3U3OA 1J90A 1C1YA 2J0SA 3LW7A 1NN5A 2OEPA 1XEXA 1RRFA 2W6ID 2WWFA 1UFQA 3TVDA 5FUXA 3W6PA 4BFUA 1W1WA 4AKHA 2J46A 4A36A 2ZRAA 4RKFA 1KJWA 3O8DA 3TVTA 4D0LB 4UJ3A 5SZJA 4EFMA 3QG1A 3CWZA 1NL3A 4N0DA 5JRJA 3L8YA 1ONBA 1FP7A 2GA8A 2P3SA 1SKYE 1U2RA 4OI1A 2XX3A 2GCNA 2ZQ5A 1GM5A 1QVRA 3AV0B 3N2EA 5EE5B 2EVWX 2IHYA 3U44A 4ERNA 4JLNA 3KKPA 3R20A 1GDDA 2KI5A 2XNDA 2FSGA 1VYVA 1W4CA 3WRYC 4TMWA 2YWFA 2QGNA 3FFAA 4OQNA 2ZJ2A 1N6RA 1GNQA 4NYJQ 1NN1A 4GP6A 2R44A 2FG5A 2CCKA 1T3LA 4UXIA 1CTQA 2G0TA 5AJXA 4F4IA 1YVDA 1Z28A 3A36A 2DHRA 2OV2A 3C41J 1Z2AA 2X8AA 2YYZA 3QXXA 4DLZA 3VKWA 3O8CA 3QKSB 2IT1A 2XB4A 4M1YA 1QHHA 2RGEA 1TQ6A
chains in the Genus database with same CATH superfamily
4MRVA 3K1JA 1E7SA 3SS9X 1UMDB 2OWDA 3M4ZA 1XP5A 3L7AA 4N9QA 5DBGA 4D43A 5B4UA 5KOYA 1D9XA 1FJ2A 3OT4A 1FSPA 1EVJA 1OR3A 6PFKA 1J07A 3R3YA 4FYVA 5M29A 1RXVA 3VO1A 3CVXA 1PJSA 1TEVA 1TU0A 2PUBA 1MMNA 1VG0B 4B8WA 3F7MA 3JQAD 3EEOA 3JQGB 2JCXA 2OV1A 1UBKS 2TSYB 3Q10A 3C4QA 1O5IA 3IBCA 4U7PB 4HP8A 2XUIA 3CV3A 4OOFA 4X90A 1JBQA 1EA5A 1HQCA 2WSMA 3L05A 4QBTA 2HIAA 5CA0A 5U4QA 1YU9A 3THYB 1PNVA 3IP9A 4CDMA 3FHDA 2Z2YA 1YFKA 1JZSA 3G9TA 1C30A 1YDHA 3F1LA 5H3HA 4RHUA 3X1WA 3QUTA 1QSGA 5KDOA 1QHSA 5TS3A 1SHUX 3RIPA 2FPXA 3R3JA 5JQGB 1IOVA 1KOJA 1JR3E 3ESCA 5CJ2A 3V8QA 3WMEA 6ABPA 2AQHA 2BM9A 2X0JA 2R8BA 4RH0A 1CF4A 1KMHB 4J16A 1IY8A 1S3SA 1XR3A 1YQDA 2OLEA 1NP7A 2XCLA 4K7BA 4BVBA 4K9KA 3ORHA 3U56A 2QLTA 4G0NA 4ZKEA 4GZ6A 5G4KB 4YRCA 4DG9A 5A04A 3IDOA 3PFKA 3MYYA 2P78A 1DP4A 1OH6A 2HPVA 3KT3A 4G09A 3AGUA 4PGMA 2WUVA 2UV8A 1QIGA 1QLWA 3PITA 5AKIA 1E3WA 2A84A 3LWDA 1F2TB 2W42A 4U7GA 1U0TA 2DTDA 2GEKA 3CVUA 5CT8A 3N76A 4JZAA 2PGAA 4NH0A 1B73A 3RVZA 2X76A 1TAHA 3QVGB 4GOND 4DQLA 3KWMA 1M6EX 3IUJA 3U2QA 4TYWA 4AUNA 3EJWA 1NBAA 3IKLA 1T5BA 3P2YA 5DHQA 4RMHA 1AK1A 3UMFA 2L9JA 3G5MA 3GPCA 1PVVA 2PZKA 3BCSA 1ZOOA 1Z18A 1NFRA 2IYVA 2FUKA 1FLDA 1U8TA 2WU1A 3FYTA 3R5KA 2I1LA 1W6RA 1MMDA 4RL6A 1KSGA 3DTVD 1BA3A 3BN3A 4N3CA 3KOUA 4GMDA 4ESHA 2JH3A 3VNVA 4JIOA 2HD4A 1KSFX 2WV9A 2VJMB 3Q7TA 2C77A 4Q1VA 2GK3A 3K0KA 3OE1A 5DHSA 3WV5A 2H17A 1L6IA 4OVKA 3PDIA 1OCZC 5EJEA 3T1YB 2R9RB 1A76A 1V1MA 1V9CA 2E49A 2G5GX 3GRZA 1GIAA 3W5JA 5K6TA 3NMIA 3QIVA 1H2AS 1W6UA 5DU2A 1JIJA 1XTRA 2G07A 2ZKIA 2VVTA 3PQ5A 5TT1A 3TIIA 1WXIA 4INAA 2YHSA 3B82A 4MVJE 3ZGZA 4O1HA 2GYVA 1YB1A 2BC9A 1MO6A 3LUAA 4K8OA 3KL4A 5E4TA 1M6VA 4ER0A 1TGYA 3DOHA 4GM4A 1FUIA 3AKEA 2G62A 3ZC4A 4CVNA 2XKJE 3GIDA 1LCIA 3JZIA 1U1IA 1CPRA 4XRGA 1LRJA 1WNFA 1VPDA 2I8LA 3HCEA 1EAYA 1V3VA 3ZCXA 2N9UA 2PF4E 3H2SA 3OVMA 3QKIA 2D5BA 1QDEA 3N6VA 4ZCSA 1FBNA 1WM1A 2OK8A 4CN9A 1QKRA 4KQJA 2JLUA 4R5HA 2GDZA 4RTPA 4LPSA 5EIXA 1XAGA 1AKEA 1QHNA 3S0JA 1XHEA 4UUQA 3Q8XB 1YNSA 4IV5A 3LBAA 2IYSA 4HXYA 1MPXA 1JTFA 4BO0A 4LDQA 2M1XA 5K45A 4XPXA 2E4ZA 4OFBA 4HX2A 1AZTA 4H4CA 1SKBA 4OXIA 3LMKA 5DM4A 2PH1A 1O89A 1V9LA 4HXEB 4OATA 4YR7A 5KQMA 1EGQA 2WB4A 3HYSA 2GK6A 3RJ9A 3ZR4B 1QLJA 1N2IA 2R4QA 3HVIA 2Y0CA 5LP6C 2QRUA 2ZCUA 4BAZA 3I04A 4ES6A 2ZSIA 3E48A 3F6EX 1FQKA 1Z3CA 4UE3S 5C46F 3D3WA 1YQGA 1KQPA 2O3TA 3RT9A 1KEVA 3THSA 1ZUIA 5JEDA 3EJNA 2GCOB 2GA0A 3BXOA 4RS3A 1U9CA 3EFOA 2C83A 5JNUA 1EWVA 5T3UA 3AINA 2XNJA 3PFIA 4R4JA 1KE2A 3VSBA 2W9XA 1JB9A 2P2ZA 3CMMA 4B43A 1Q7EA 1LLDA 1H0SA 3SM3A 4II3A 1Y7TA 5LYJA 2IODA 2Q9UA 2YHIB 2VTDA 4FNAA 5EXPA 4KYVA 4DSTA 2R0QC 2GEUA 2RC5A 3EHEA 1MJHA 1HT0A 3FMIA 9GPBA 3S8YA 3ACBA 2PKXA 2XSEA 5BSHA 1Z4PX 2WDPA 1X42A 3BE5A 3CJTA 4JGGA 2IUSA 1LFAA 1G9TA 2UUOA 3AY3A 3W5UA 1Q0KA 1E1DA 2AW5A 2FMXA 3CVOA 3GEIA 4OYLA 1UQRA 4D9KA 2I1WA 3NHLA 1GZ7A 5F7ZA 5DHFA 2FHPA 1CRPA 2O7SA 1S1MA 1GPNA 1GTJ1 2EEPA 4PVDA 3V5ZA 1PT7A 3GARA 5C5CA 4EM6A 4PYIA 3F2VA 2PUVA 1TVEA 2FFAA 1G8GA 5BRJA 3G13A 2A9KA 2CV1A 3UJHA 1KRWA 2Z6AA 2W0SA 3O1JC 1PV1A 4RSRA 1I9CA 1QKIA 4R69A 5C4MA 2YX1A 1Q15A 4AX2A 3GJYA 1REQB 3RK1A 1EZ4A 3JZAA 2P9HA 3AFIA 4R31A 1P0FA 1OREA 3LVBA 1YC5A 3L34A 2BMWA 4R1UA 4ZQFA 4BVLA 3K9QO 5AVQA 5L4NA 3T95A 1R8JA 3G2LA 1LE2A 4CV2A 4JEUA 1PZHA 3LFHA 2H00A 1CFZA 3LS0A 1MC1A 4KLNA 4XIYA 2FRDA 3A6PC 3HLYA 3B51X 3AJRA 3JY6A 4J1NA 4KXYA 4M0EA 1U5AA 3RLFA 4WBNA 2HXGA 1IJBA 4EFDA 4Z49A 1QWOA 2PSJA 3AEQB 1DO2A 3Q85A 3ZWPA 4REQA 4PS0A 2R8RA 2P1AA 2F1OA 4C0QC 2VO1A 3CLTC 3O8RA 1GY8A 1PYDA 1XD2B 3H9BA 4ZRMA 2R8OA 3AQ4A 2ZXRA 4PQEA 3TQTA 1OZ0A 5K4AA 1Z38A 2HMUA 5FOQA 1JMYA 2VQ6A 5CA1B 1SF8A 2VTKA 4K40A 3VHLB 3ZCPA 5LB4A 5JALA 4JZKA 3R5XA 1XX6A 3N70A 3QG5A 1XRRA 1R4MA 1GQRA 1NBHA 1X9GA 3O3NB 1KI9A 1N5RA 1NQUA 3O2SB 5CYFA 3K70C 1P62B 4I50B 4M21A 4RORA 1DJPA 2BP7B 3F1KA 3GU3A 5ALEA 3IEIA 1TFOB 1XJQA 3KQYA 2P2CA 3K4PA 3DWWA 2DYSC 1IBKB 1W2WB 4IDFA 2I9KA 1JFFB 4P08A 2TECE 4F92B 2C59A 2HSWA 1PJRA 1E1RD 4ZVTA 4D3SA 1YARO 1WX1A 3ZCTA 1UMCA 2Q5QA 3IYLW 3DHWC 3AQBA 1YRWA 4RY8A 2YKGA 3KQHA 1GAWA 3CUVA 2I6FA 4YWJA 4DHWA 3MOSA 5BVGA 4H15A 2VG8A 4KXXA 5JISA 4K0RA 3DPUA 3QPDA 3HNJA 3LRPA 4HXGA 3L4KA 1VHTA 2KPOA 1QORA 4J90A 2IYWA 3B6EA 3CTPA 3I1YA 4I50A 2R84A 1KAQA 4QDJA 3O73A 4WACA 3WLAA 4B7UA 4DMLA 3DJYA 4TVSA 1RRCA 3PV0A 4MKFA 2FXVA 1DG1G 5BQIA 4XIFA 1RXUA 2C00A 1XZBA 5JDCC 3H5WA 6GPBA 4D0SA 1Z4OA 3ZDBA 3UWPA 3L7BA 4FW8A 4BMOB 3HUTA 4DVZA 3RF7A 2CHGA 3WGVA 2VS1A 2CXQA 5BV7A 3DXJF 3UUFA 3DBRA 5JU6A 3CSDA 1ZNXA 5COFA 3I4UA 2BC5A 1WMEA 2FX3A 2QYOA 1S2NA 2J33A 4YMIA 1KK0A 1I4ZA 1Z0SA 4OUDA 5IUKC 1Z5VA 3KKBA 1Z5PA 4ETNA 5KVSA 3VKFA 3CLSD 2M64A 1AV6A 3ET4A 2HA5A 5G53C 3SVTA 4GI2A 4G1EB 4I9UA 5SY4A 3NASA 4U2BA 2WFMA 3KB2A 4N39A 1OXXK 2BFDA 1XCPA 2P7IA 2W7TA 4EI2A 2ZIAA 3UB2A 1VFPA 4BO7A 1G8XA 2IYYA 3EGXA 1E59A 1N6HA 4LYEA 1V8DA 1ORDA 4ZCIA 3DBVO 1X0VA 2EKLA 1F6WA 1WPQA 3QE9Y 1C3EA 3QPAA 3W8NA 1ES9A 3UW1A 2LWIA 5K0TA 1WTCA 1U3VA 1F6BA 3BH0A 1VL5A 2AXQA 4XLZA 3TGLA 3DAGA 3JQBC 2V58A 1II9A 4TKMA 4Y2PA 3W78A 3H87A 2INGX 1LPPA 2XUFA 2ZS9A 3VH1A 3H11B 5BNIA 1U5BA 1VMEA 4PLCA 4QBGB 3WZMA 4WNAB 4DV3B 2IUFA 2H31A 2DBRA 2NZXA 2C2BA 2V1XA 4RMIA 1SIUA 4J6FA 1F8FA 1QIIA 2HV9A 4AURA 1A04A 5ES4B 4JYAB 1ICIA 1KHTA 4JC7A 1QH0A 3A27A 4HOYA 3VRHA 5LD2C 4MKIA 1WD7A 4L8LA 4G86A 1P0QA 4NCHA 3W5BA 2C7QA 2IEIA 1UM9B 3KWJA 1E6KA 1K3TA 1Z4IA 3P96A 1N1EA 4GU5A 4HDAA 1C7IA 1SHJA 5ALUA 2C5AA 2NVUA 4ENRA 1N1MA 3TGPA 1YCHA 1OJLA 1P7CA 1UR5A 4MUBA 3QX7A 2ZUTA 1TO1E 4B6PA 4NOLA 1W76A 1EFPB 2BDUA 1QUEA 2QQGA 4N49A 2YJ3A 3CRQA 1SUAA 4PHGA 2QBYB 1XZCA 4H1TA 4FCVA 3NZEA 1DZIA 2HCJB 3I30X 1KK3A 4K9DA 4LRWA 3SIRA 4DA6A 4MK4A 5K0ZA 3INYA 1GGNA 3AL3A 3C7TA 2J9VA 4B2LA 4C4YA 5GINE 4DUZB 2F00A 3ID6C 3TULA 3LWBA 3TZKA 3GHHA 4BMSA 3NANA 1VP9A 3DD1A 3PSHA 2JFXA 5D7BA 4DKJA 5G4LA 1YR3A 4R1MA 1FFHA 4TMZA 3NTOA 1XPJA 3KEMA 2Q50A 5L3ZA 4FHCA 2JKVA 3MOGA 1PJ2A 4IZHA 1K8QA 2OV4A 3KG2A 3ZU2A 2QM8A 2YXNA 4YL0A 3TZHA 2AN5A 3AR2A 4C04A 2EIMC 1RYBA 1JR4A 2FI1A 3FPHA 5AVSA 5IK2D 1YZKA 3GRFA 4JNCA 5EINA 4HGZA 3A0RB 1EUCB 2W6ZA 1UBRS 4IOKA 2MYUA 3LCJA 5E1MA 3OCXA 4CDRA 4PLPA 2XRYA 3QVTA 1H2XA 5JMWA 4MDEA 1R0LA 3RU3A 1FYXA 3QWFA 1WXGA 1P6XA 3BD8A 2BR5A 5AI6A 1MG0A 4FFOA 5H5JA 3RABA 3ZZNA 4Q47A 1EP2B 1SVNA 2H16A 4IMPA 2R7AA 4ZV9A 3T6GB 5LBIA 4BFWA 2RC6A 4ND2A 4Q3BA 4CF4A 5A0TA 4RFSA 5IBPA 4BQEA 5C34B 3ZUPA 4B6FA 1AUEA 3ND5A 4G24A 4K9NA 2GPYA 1M8JA 1J0EA 1Z0DA 3IR5A 5DLJA 3QQPA 3DTNA 1M1XB 3SD7A 4WNAA 1MOPA 3STXA 4AU1A 3OKAA 3BRJA 4J4HA 4XYBA 5DW3A 5H82A 4BO4A 2YEVA 4Z0TA 2PMWB 1FJHA 2O59A 1J2JA 4XQ9A 2EPLX 3U2LA 3NYJA 1DZ3A 1PKEA 1LNZA 1YT5A 1TJ5A 3AJAA 1WD5A 3I6YA 1SZDA 4AZSA 4ER6A 5C80A 4YJ3B 3WA7A 1WCV1 1L5VA 4CR7A 3PHIA 4AKGA 2YV2A 2HSGA 4DZTA 2WFZA 1Z26A 3F0TA 3GFGA 1JLKA 2XA9A 3GG9A 5AHKA 4EJ6A 2HFIA 4J1SA 4Q1CA 4AI6A 3GMSA 4J49A 1AVOB 3VDNB 4S24A 5JS7A 2VF8A 4C5CA 4Q4DA 4FMCB 1NVWQ 3L1VA 5BWOA 2VH5R 2Y93A 4DVGA 3KAJA 2OO7A 3GVPA 2VHTA 3BM5A 2W6JD 1DIOB 4MW4A 4TLDA 1GG9A 3NRBA 3BFKA 4X1IA 3L6DA 4LY6A 4YK7A 3I0ZA 4PZDA 4D4GA 4EF6A 4NBRA 1BXRA 3OKPA 2FETA 4EFLA 3JVUA 4NR0A 4TWZA 1NMZA 3UK1A 1EG2A 1F38A 1T8SA 1XXLA 2IZ0A 4IGIA 5A3VA 3V4PB 3ZVLA 1XTZA 3TLKA 4IM7A 1TZJA 1RABA 2QLBA 1A3CA 3L7JA 4HAVA 2AQ8A 1HYBA 3TRFA 2IU4A 4WKNA 2J0QA 1V1RA 3HA2A 4RTJA 5BY2A 4YBZA 5SY6A 4RYDA 2WU8A 3LPAA 3V2HA 4QPZA 2FPIA 4EAQA 2PLAA 3G8YA 4BMDA 2RHMA 3QI2A 3NEJA 4Q3EA 4P54A 2IS1A 3LG2A 3AVVA 1HOXA 3UV3A 4JOSA 1ORVA 1Z6XA 4ILKA 2WR8A 2HA6A 3DE2X 4BIMA 1HFJA 2V1UA 1ZICA 2QRGA 5TLSA 4JYPA 1C7QA 1H1DA 3SC6A 4DHEA 3IDSA 4M0FA 3IBYA 2DU8A 4R6WA 2P0NA 1FP4A 5ALLA 4C7XA 1IDN1 4BN5A 3X43A 5D92A 4O4JA 1ZGJA 2WPNA 1RQ7A 1KXZA 1E7WA 1EGVB 3GJRA 1SIBE 1Y34E 4N8EA 2WUGA 2CVPA 4DIKA 1YB6A 1P7WA 1RYFA 2XRFA 3BKWA 4RY0A 4EECA 1BHJA 1UADA 2GFIA 4F7DA 1I30A 1R0RE 4JLAA 3SE0A 1SHZA 2VSNA 4F21A 1IHYA 3WBBA 3DTYA 3TQFA 4M1ZA 1ZW6A 2GCPA 1BKSB 1WMAA 4Q3DA 1Y80A 2ZAYA 4BEVA 5DS6A 2FR8C 3JQFA 5FQOA 3K3PA 3OT1A 1UZUA 2GMWA 1EYZA 3R0QA 4HPXB 2AE2A 4D4LA 1KU0A 3ZPXA 3TL2A 1SQFA 2XQIA 4FFDA 3T41A 4AJPA 5DLEA 3LXMA 1VE1A 2P8JA 3HWX1 1CZUA 1U2GC 2ZJ1A 2L18A 4ARCA 1P4HA 5IYZB 2IYXA 3C6KA 3WGUA 8ADHA 5JVDB 1VJ1A 5LM3A 2JF0A 1ZN8A 1FMFA 3O82A 5IN5A 1GD1O 3NFYA 1QR2A 2H1VA 2EIXA 1EX7A 3CA8A 3NTLA 1AF7A 3WYGA 3EISA 2H1RA 1TTHA 3AUSA 4J0JA 1D5WA 1SD2A 1HGXA 2G06A 3JQ8B 1NIPA 1XRJA 2W6MA 4IQFA 4N5MA 5TQ0B 1XQYA 1UJCA 1KY3A 2HBQA 2V98A 4C43A 3RUCA 1Y9ZA 1CRZA 3ZDEA 1V43A 3E84A 3FVVA 3SYMA 3NM5A 1YZQA 3EVNA 3L46A 1G2PA 5H16A 4AS1A 4Y2UA 2HRDA 3H4VA 9ATCA 2FSPA 3D1VA 3FPLA 1Z6TA 2PAAA 1XRPA 2Q3MA 4W1PA 3KSBC 5GAJA 4LWZA 4OHCA 3STTA 1ZKDA 2GJAA 1W96A 4QSHA 1E2GA 2PS0A 5KU1A 1FLNA 1JDUA 3RVSA 1XP8A 2J87A 4K87A 4PIVA 1W87A 1GL7A 1LQTA 2X77A 4FFWA 4O2LA 4EYOA 2EQBA 2JBAB 4G7HF 1T36A 2OZLA 2VZ9A 3GQBB 4PWYA 1ZR4A 1QR6A 1OHHD 1VJCA 4NATA 2RGWA 4U63A 4QVIA 3SXKA 3W9BA 1S0UA 2IEZA 1MVOA 4PICA 4F1WA 4C88A 3AILA 1UXHA 5JS8A 4E5DA 2W0MA 3EXEA 3I72A 5LQMA 5KZMB 1D0ZA 1U7UA 3OZEA 4J1TA 4R1PA 4TVKA 4YIHA 1ZUNB 3V34A 3SR3A 3TTUA 5KO2A 4QVKA 4KAAA 3P4YA 2EKZA 5EN4A 2GX6A 3EFEA 1CWUA 4QECA 4P4TA 1NNI1 4ZAYA 3OESA 4N9WA 4BP8A 3HJAA 4G5SA 4IAOA 2P75A 1T9ZA 1GU0A 3KB1A 4O4JF 3IMEA 1DDOA 3A6LA 2OV6A 4FMPA 4M0UA 3V8VA 4NPCA 5J4VA 1ML3A 5A4DA 4JXZA 2O1WA 1IY0A 1Z56C 2IZ1A 5ESRA 1RPTA 5KWSA 3VPCA 3FFBA 1PDVA 2D1YA 2PA3A 1V35A 2C2KA 2ONZA 2XYRA 4UM7A 1WPGA 1VE3A 2EPOA 4C2TA 4OJTA 1J8YF 2Q9BA 2B7CA 3K70D 1EIWA 3NP9A 1QNLA 4OHWA 2D54A 1BNCA 4NDAA 1YZGA 3H04A 5FLXA 2ONCA 1PJCA 2A86A 2GERA 3PVZA 2WICA 5KSOA 4E03A 5BWCA 4OIFA 2I4MA 4DCOA 4JJEA 3E1GA 3IALA 4WJ0A 1E85A 3MOIA 4FSXA 1GJRA 4J4TA 1GZ6A 1Z34A 1QMGA 3IE0A 2X1HA 4J0QA 1LF5A 1G63A 1OAKA 1QGOA 1UJBA 5E3AA 3FCAA 5MF6A 3AOUA 5LDHA 1S8AA 4BKMA 3EGDB 2PTHA 1QVAA 1VSQA 4QUJA 2XM0A 5D51S 5EZ5A 4Z3OA 4ETMA 3SYNA 1HLPA 5HE9A 1NY6A 2CLFB 4HFJA 2XWJI 4MXDA 1FXSA 1D8AA 2ZJ4A 2ZRQA 4RKYA 1GA6A 5LQJA 3U44B 3OCVA 2QPAA 1RWOA 2UZIR 2O2YA 4B3XA 4Z0PA 4H7FA 4F93B 1SA0B 1Q16A 3GLKA 3K0AB 2YXDA 1I5NA 5BNWA 1K68A 3VH3A 5K0JA 4HAYA 3R9XA 1GAEO 2YWEA 4OXKA 4QICA 3T35A 2RK3A 3BG5A 3KCNA 4OXRA 1RQGA 3ANMA 1MOZA 3BVPA 1A9ZA 1NG9A 2VWHA 1G64A 1TRKA 2ZRLA 4ZVVA 1LBQA 4NIMA 3L8DA 4XQEA 4IDAA 3ZVRA 3IJRA 4LBWA 1WASA 1WGWA 1PDOA 2OAQ1 3MEQA 3MQFA 1Y89A 1LPEA 1OX6A 1ZX1A 2C4VA 1MH9A 3ASYA 1GRNA 3KZKA 2QJFA 4G0WA 4DT1B 3UHFA 3QSYA 1V45E 3RBVA 2VA9A 1AS3A 3DJUB 5FOXA 1O94A 1YULA 1QK5A 2FX5A 3O4IA 4KJZA 1GZ4A 4URWR 1C1XA 3SZUA 2G1AA 3ZIBA 4AFNA 4O2AF 4ZARA 4F45A 1IBLB 3W3AH 5C2JB 3O03A 4RM2A 5BPHA 4I6JA 5JZVA 1XZJA 2HRBA 2Z6VA 1R6XA 5DFAA 2PMBA 1W36D 1SVOA 1DQRA 2F1JA 4CFSA 2OGWA 1CE8B 1PLKA 1BXZA 4RCYA 3FFXA 3K33A 1W85A 4KQXA 1Q83A 2NZVG 4U4AA 5G02A 1LLCA 2JIOA 1XHFA 4ITVA 3H8JA 3JWEA 3EQZA 1D1PA 1DAFA 1QTIA 1CZOA 1HT1E 3K6BA 2B4TO 3CYFA 1MDFA 4V1CI 1Q17A 4RHTA 3I62A 1ZSVA 1WHTB 2QRQA 2VRWA 4HAXA 3K9GA 2CZCA 2IE8A 2EF1A 1Z6YA 4YHBA 4GMGA 4M1QA 3LT0A 4Y1EA 1Y1SA 2WJVA 5JUWA 2WZFA 3D2LA 4HRYA 4QTTB 2AMYA 1UOPA 1PHRA 4M1KA 2EIKC 1L1RA 4L6RA 2E21A 2Y27A 3EEYA 4OK3A 1KZ1A 2JEZA 4J2TA 7YASA 4F4CA 3NAQA 2E18A 2IXOA 1QFSA 4KR3A 2HO4A 2YWDA 4KOEC 1EFDN 4PSKA 3KVVA 3R40A 4IIFA 3A9CA 2WPDD 5EP3A 2WB2A 3O8OB 3GH3A 2O48X 1CC1S 1OXTA 2VF5X 2WG2A 1H1LB 2XAUA 4HGYA 3SFVA 2OBYA 2ZM5A 1NJ5A 2AJLI 2VPQA 1DX6A 3Q6IA 4YV2A 1ZMBA 3EXHB 1QO7A 1F5SA 3MMZA 3AXSA 2W6PA 3DYIA 3NWBA 1I7SB 1EFTA 4AKSA 1RZ3A 2YL1A 3A4MA 5EJIA 5IK2A 2A68F 9ABPA 3FUVA 2J5KA 2JC3A 3RRMA 1BHSA 1Y98A 2GAJA 4CEIB 1SMYF 1JMVA 4MQEB 2XVXA 1IMJA 2Q8QA 2D1QA 1TK9A 1SCAA 3MINA 1EUDB 3CEHA 4UDNA 4AMBA 1U4NA 4O5AA 1H2YA 4P3OA 2BUAA 1VQ1A 1KTVA 4UATA 3X1XA 1E3QA 2PQ2A 3NGXA 1R4AA 2O2IA 3Q8KA 5H7XA 2ACEA 4NK5A 4AMUA 4L4YA 3WSVA 1OZGA 1UODA 2XF2A 1YJBA 3CW2A 4UEOA 3QXGA 4K9SA 3LOQA 3O83A 3T6JA 1BQ4A 3AIMA 1YQQA 2ZBFA 4XEUA 4BTEA 4RPJA 4PG5A 3VVBA 3STYA 2XXAA 4I9GA 2SKDA 1M2WA 3QFRA 2OORC 1QYCA 2FK8A 5A06A 2IS4A 1PJZA 1ZGHA 2X5JO 5M7EA 3TLGA 1U8ZA 1LW6E 2P5YA 2JJ8A 3O8QA 4HQOA 4QXAA 1KYTA 1GTMA 5J1TB 3LZDA 4ERXA 3LUKA 4CIVA 4E30A 5TPWA 4YMTA 1QGZA 2VBIA 4LJRA 3IKTA 4EAAA 5JJKA 1JG1A 4MGZR 5D3MB 1OWOA 4IS2A 4UMVA 5G0WA 4UD2A 3PEFA 3SC3A 1KQFA 3D4OA 4KPFC 4XUEA 2XMZA 1UXJA 3PQ7A 2GD1O 1LFDB 3ILXA 1M6NA 1TK2A 1UAAA 3IQIX 4FYMA 2DERA 3G2KA 4YMWA 5CX4A 5ALDA 3AK4A 3ZOKA 1GITA 2BWJA 3FSRA 5F5FA 1D4FA 1FA9A 3KC2A 2ZVDA 4K46A 3T6BA 5E6UA 3PF9A 1CUCA 3CE9A 4NBNA 1KNQA 4GUAA 3T9OA 4XM1A 5FCLA 5EWJA 5JCJA 5IC6A 3GPDG 4MUJA 4RESA 5C7OO 6AT1A 1KAEA 1QFJA 2WF9A 1HK7A 2VSYA 3LXXA 4ZP1A 1HDEA 3IDZA 3LXUX 1P1JA 4TT8A 3S3TA 5C7YA 5KKCA 1OVMA 2CJWB 2JAHA 3L0ZA 4G25A 4HAOA 1I7DA 1A4RA 2ZRKA 4XW2A 2PSEA 4KQFA 4S1VA 3RWOA 1A27A 3WKEA 5LOVA 3PVSA 3U17A 3W4KA 1E7RA 2QPTA 3WRVA 2W11A 1SD5A 2VYQA 3MSXA 3PR2B 3OIFA 3WWCA 1C1DA 5HTOA 3FRHA 2BFPA 2QD3A 3KVOA 3BAFA 2VT6A 1RBZA 2DX7A 3PNOA 4L22A 4MIKA 1K89A 5T4EA 3RTGA 3FAJA 2NSGA 1U6KA 3QVMA 3OURA 4C76A 4PHTA 3EPPA 5EG5A 1AA6A 4I50F 1YS6A 4ZVPA 1J20A 1AKUA 4E94A 4GW3A 1JW9B 2A4MA 2AOWA 1Y5RA 2YWRA 2R60A 4MW2A 3AO0B 1VTKA 4LXQA 3ERCA 1MQVA 3GC6A 1OILA 2OGZA 4GLOA 2GA9A 3FPSA 4PQGA 4QI2A 1NTOA 2QF7A 3CONA 4OBEA 5AO9A 2FWNA 4BOYA 4JI7B 4XB2A 2A92A 2JIZD 4X65B 1Q2XA 2WG1A 3SXJA 1GFWA 2WMOB 1PG5A 4AN4A 1K05A 2DGDA 1PUXA 2HOQA 2PT5A 4I81A 2UXBB 3HJRA 3QA9A 4MRRA 5DSZA 3WSTA 3HM9A 1FZTA 4F6RB 1PQUA 2FJPA 4R9SA 4ZZ1A 2J9FA 4MI3A 4D3FA 2FEWB 4ZT7A 2G8NA 3QF4A 4CIPA 4UTVA 3T7RA 1ZUD1 3N8IA 3DL7A 1NULA 5JI2E 4LZLA 4Q7MB 3ADDA 2YFYA 1YR7A 4EL5A 5JWOA 3AV3A 3JAWA 3B38A 4NZYA 1XDZA 3WWZA 1UDXA 4X00A 1ZIOA 4CKBA 3BXZA 5FWXA 4G8JA 1HEUA 1Y4ZA 1KZ7B 2X5KO 5EHQA 4QQKA 1TXGA 3IQZA 4ESOA 3L0YA 3O26A 3A6FA 2ATXA 4ZYYA 5EKTA 1PZMA 1PR0A 2FPWA 1A82A 2HCBA 3CZ9A 1OF1A 3E0QA 3N2GB 3DBIA 4IIDA 2R11A 1IL0A 2BDEA 1YA9A 2QUIA 2B69A 1IONA 1GGJA 1P3DA 3UBTA 3BMXA 3D6AA 1HDXA 4D0GA 3ZCRA 2W6OA 1JT9A 3AEKB 1B6TA 3ITNA 1FFSA 4FE4A 3CNEA 3L7YA 4HPJB 3ZWIA 1MA0A 3KK0A 3NYLA 4W1SA 5AKZA 3C3EA 3SIXA 3GA0A 3IJPA 3ZY6A 5I9SA 2C9BA 2DQ4A 1N7HA 1PKXA 2VP6A 3HB7A 4CXMA 1JJBA 1EI7A 5EGYA 3UXMA 1P7PA 4XR4A 2OUIA 2OSVA 1QAMA 2GHIA 2P6PA 2LD4A 3PGLA 3RS5A 2ROQA 2IS6A 4DLBA 2CYDA 3MHPA 3OFSA 3ZTMA 7AT1A 3F90A 1KYYA 4L16A 2QBYA 3H9EO 4N76A 2REQB 1I24A 1WPRA 4XCXA 1NSTA 1S3GA 1J9EA 4BFVA 1NR7A 1RI4A 1DV2A 2A5FA 2QRPA 4JP3A 1C9KA 1KZ9A 2PUHA 4QGHA 3C7CB 3V3KA 2BKAA 2AA3A 2ADMA 3NWJA 4MUYA 4CKCA 1N5JA 3J81k 1TA0A 1M34E 1SBZA 3PX3A 1YTLA 4MITA 1X9HA 3ZEIA 4BLSA 2EEZA 3MCWA 4QVGA 1Y9AA 2A5YB 3GFFA 3P4XA 3VGJA 3QELB 5HVNA 3NVDA 1YQTA 2JCSA 5B58C 1EP3B 5DX1A 5IP5A 4B73A 1WCYA 4KGDA 3CPEA 2XMCA 1NVBA 4UHFA 1YDMA 3RKUA 5JPIA 3OOYA 2O2DA 4OQZA 3RRNA 4QQ8A 2PNJA 3EXHC 3JD0A 2XZOA 5BW4A 1VI6A 1RLIA 3UPUA 2NU6A 1MRNA 2IPOA 2DPHA 3LQRA 3RKRA 1A7DA 4BGIA 5LQRA 4J0EA 2NXJA 4IIUA 3EXG2 3T5MA 3S29A 2Y1CA 3KWFA 4M9QA 4FHDA 3ZWWA 1OXKA 5C32A 1P9LA 2K5UA 2XTMA 1Q0SA 5CM8B 4ZT5A 3DMDA 2GNOA 1BVYF 1HEIA 1SOVA 1Q0HA 2R7RA 1GADO 2LCFA 4KOAA 4HEAJ 1ENYA 2XM4A 4DE5A 2IK8A 2C54A 2QE7A 3AP3A 2ICWG 2PJZA 3FNRA 3HYLA 4V0OA 3ETDA 3M3PA 5DT2A 4RKQA 5LZ9A 3NKEA 2ZVQX 3CSUA 2NTJA 4D6PA 4CKCB 4REQB 3VAZA 1Z2NX 4XPZA 4A0HA 1Y9DA 5GIOE 2OCPA 3CCFA 3VMFA 3VDXA 1GEGA 1KO4A 4PV7A 2HJ3A 4KDRA 1K2WA 3IEVA 1EQ2A 2DVMA 2G5TA 4W9NA 4Z9XA 5BMVF 1L7VC 3LA8A 1FUKA 1DO0A 4OQQA 3FFTA 4YNBA 1P2TA 2WOJA 1IHXA 1X7ZB 1YK1A 5IW8A 5BSGA 4W6QA 1CHNA 1P1CA 2DQYA 1UDBA 1WW3A 2PXAA 2RJ3A 3C6MA 5BSTA 2LGJA 3PJDA 3ESQA 2YJNA 3VPAA 1A69A 5DB4A 3I32A 3U9TA 3LL4A 3NM6B 3D8TA 1MB2A 3QJGA 3U3BA 3OX2A 4L8FA 1TF2A 1XZMA 2QAGA 1O95A 2C2OA 4R6XA 4S1PA 4D4IA 3UANA 4RDHA 4QYMA 2YUTA 3ZE8A 1YHYA 2BT4A 2JL1A 2ODEA 2W93A 4TLBA 4WKOA 2D7CA 2PH5A 4W5HA 5G1OA 2IL1A 3TLYA 2QUJA 4NLLA 1VPVA 1NRIA 1PSWA 4IKOA 3STUA 4XJXA 2VP3A 3DFFA 1PS9A 1DUIA 3WLJA 1QO0A 3U49A 1ZVJA 5DM60 4MVSA 1C29B 3SYKA 5ADVA 5JC1A 4PSCA 4DA7A 1S5PA 5JTUA 3IAM6 1UT5A 2JJMA 1UOQA 3EGEA 4HLNA 4X8LA 2P65A 3AJ8A 4ZI2A 4Y2SA 2E3JA 1M2OB 2ODPA 4WUVA 3RQSA 1N0WA 1C3JA 4YRTA 3Q8MA 2X4GA 4BNXA 4KREA 2C2GA 5EKUA 1L2TA 1UEJA 2VF2A 4NMWA 1D9ZA 1FTGA 2ASVA 4RUKA 5IBCA 4GQHA 1YFZA 1OLUB 2A2ZA 2NT4A 3KXIA 5D91A 3A31A 3OWOA 5LYJB 1JEQB 2QRVA 2GEVA 2CZQA 3LAWA 2A0XA 1V1RB 3L79A 4F9GA 4D7AA 1RIFA 4XARA 4ZOAA 4POOA 5KQLA 1JQBA 5B3LA 3GVXA 2IY9A 3QLUA 5E95A 4DCGA 2YH2A 4EHLA 3SP1A 2AEEA 4L5YA 2JVKA 3T38A 4PSVA 3K9LA 3AVTA 3CINA 5BQGA 1J8DA 4IEIA 3FWHA 1APBA 1Y1KE 2OP1A 1FCJA 4ZU3A 1F3LA 3G0DA 1OXMA 3GXBA 1KVSA 1K5HA 3RSGA 1EEXB 2HWKA 3SBOA 4F85A 3T7IA 4HX9A 4EW3A 4U5HA 2BKVA 2QTFA 3HUFA 2Y1DA 4NSNA 4NZMA 1SVIA 2QM3A 2BGKA 1KSHA 4UHCA 4MMYB 1U9IC 3CRW1 4PFSA 3A6ZA 1E9CA 4AY5A 4BVEA 4D9IA 5K03A 2Q21A 5KSWB 2OD9A 2HNBA 2QRJA 1VJ0A 1X1TA 4DJAA 3QBVA 1Y4SA 5C4IA 3KZNA 1ODKA 1U8CB 2X9QA 3R77A 4XCQA 1HRKA 4M83A 1KDRA 1KI8A 5F64A 3MAAC 5LLSA 5JS2A 1T10A 4KWIA 1XCGB 3GBSA 4O08A 1Y6RA 1RJGA 3DULA 3FKSA 1JXAA 3KU1A 1QVXA 2XCSB 2CMGA 4DNFA 1T8UA 4JLBA 3C3MA 2J0UA 2O8DA 3FHOA 1O3UA 3ROXA 1YLMA 1DELA 2QX9A 2VPYA 3CLUD 1GFSA 1ORIA 2BRUA 2PSFA 1CUEA 1D6SA 4HYEA 1N92A 2QYHA 3PJGA 1X2EA 3VPSA 3MPOA 1UZMA 1L0BA 1H1LA 4DABA 4URFA 2ZK7A 2LKDA 2HHLA 1HNNA 1XTBA 3UW3A 3AQCA 1JPJA 5D3ZA 1HLGA 2Q2WA 3BFPA 3GM3A 2DT8A 2KQUA 5IBQA 2QTZA 2RGNA 4U7JA 3QPCA 4WA7A 1F0YA 4PBRA 3V2UA 5J9FA 3RHFA 1UDAA 1HYGA 1GOTA 2AEFA 1BJKA 2H18A 2QP4A 2YHIA 4ZRDA 4PZCA 1SM4A 4X6YA 3DKAA 1TFKB 2DKFA 3I9V1 3PR3A 3LCUA 2BONA 3RUEA 3IV9A 4GE0A 2P2DA 1PQWA 3BQNB 4WEOA 2O8CB 2QSZA 2C94A 2X8BA 3NQ41 4M6WA 5DXAA 2IBTA 3S1AA 2BZSA 3K32A 4EG3A 4XQ0A 5COGA 2JIZA 2BSAA 2VI5A 5CX1A 3MXOA 5LP1A 2TRSB 1XMIA 1HH4A 5TC4A 4ZZ0A 5B1SA 2UZ3A 4DMRA 4BKQA 1E1YA 1BCSB 4FPXA 4EHDA 2UVPB 3RVNA 4MS3A 3D3EA 3RFCA 4MR8B 4EL0A 2XKKA 2XE8A 5DI3A 3R8XA 3UMMA 1J23A 4OSPA 5JPDA 2F8SA 1CZRA 2GPSA 4EG4A 2E1PA 2QI9C 4UE2A 4V0QA 3TKLA 4IF6A 3R3XA 1RCUA 3QRWA 4D0RA 2WTEA 2YJZA 3AHCA 3D1JA 1VL8A 2P3QA 3EH1A 5BUOA 4WZAA 3HGMA 2WVNA