2IYLD

Structure of an ftsy:gdp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
284
structure length
271
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDATLRKLGFNPQKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title X-ray structure of the T. aquaticus FtsY:GDP complex suggests functional roles for the C-terminal helix of the SRP GTPases.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 86
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2iylD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iylD02
5B64A 3WHKA 2IK8A 4B32A 4I1SA 1T9HA 1OFIA 4QM6A 3HYTA 3V4RA 3RAPR 2GJ8A 3R8FA 2PMKA 1MH1A 4LRWA 3ZJYA 3PUZA 1CRQA 1UEIA 3A37A 4IDPA 4TLDA 4X8OA 1J90A 1W46A 1ZAKA 2HCBA 2ZI6A 4DLRA 3KXKA 5FTJA 2R6AA 4FWIB 2R65A 2O0JA 1OPXA 3ZS8A 5JJLA 1G6HA 2JLRA 2GBLC 5FPHA 2VPPA 2C9CA 3QXCA 5C1BA 1S9HA 1XPUA 4M2LA 3RSOA 1P62B 3LWNA 1SZPA 1VHTA 3HR7A 3EZFA 4LHZA 4IVQA 4MUAA 1KDTA 4DLSA 3PEYA 1PLKA 2WAYA 3TSZA 2ODEA 3SI7A 1U8AA 2ZRDA 2JIZA 2EYUA 1EGAA 2YC2C 3M4YA 1WQ1R 2AWNA 3ZS9A 4DWJA 4Z1MD 1N6NA 4KLNA 4R2HA 1QG2A 1VCNA 3K0FA 1KDRA 1SKYB 4LY6A 4D6PA 2NOAA 1LS1A 1G8HA 2KE5A 3IIKA 4NYJR 5D3QA 5IF9A 1DPFA 2ODNA 4US0R 1FPMA 2JIZD 3GJ4A 5KU1A 4G5QA 2A5DA 2YWHA 3SE0A 1WGWA 5IK2D 2GJ9A 4HUQA 1KOFA 2BMJA 4G1UC 1FTNA 2ZROA 5DYIA 3VR6A 2FFAA 4MRVA 4EJSA 3AKDA 3VFDA 1Z2CA 3FGNA 1GL6A 2RGCA 5JWRA 1E2JA 3LY5A 1IHUA 1W4RA 2QE7A 5DO9A 3L82B 1HA3A 4JSTA 4C0BA 1CJKC 3MD0A 1Y63A 1H8ED 2RGNC 2ZE5A 1W5TA 2BOVA 2P2LA 3WHLA 2IS6A 1ZUIA 4D0NA 4Q9JA 1PJRA 1VCIA 5FBVB 1ZNYA 4TWZA 3RYTC 3THYB 3DDCA 1A7JA 2QE7D 1DS6A 5FOXA 2ZSDA 5D3MB 2IHBA 1OXUA 1DOAA 2W83A 2ZJZA 1KI9A 3JZAA 3S1AB 4JYBA 1TQ4A 3IDQA 1Z5ZA 1Z6AA 4QJ5A 2ATVA 2XEXA 5FUVA 4DKXA 1YZUA 4MA4A 2EVWX 2I4IA 3OAAA 4FD2A 4LYAA 3WYFA 2J0QA 2ZSBA 3HWSA 4Q7JB 4LZZA 1OV4A 1GDDA 2W6JA 3P4YA 3Q7QA 3EAQA 4OK5A 3L8YA 1DE0A 4DRZA 4FIDA 4B76A 3OAAD 1E2NA 4I4LA 3IQWA 4TQAA 3BH0A 5FH9A 4UKDA 4BEJA 4RVCA 3K70B 3TUJC 3CRRA 3F8TA 4XTRA 2GXUA 2QM7A 2W6JD 2BMFA 1X8KA 5FOTA 5AR1A 2DWOA 3KUCA 1HE8B 2IEYA 2N1BA 1YE8A 5JCPA 3AGQA 1KI1A 5K8LA 4Q4LA 4PQRA 2ANBA 2QU8A 3RS5A 3BE4A 3BWDD 4BFVA 5L3VA 1W2HA 1UBCA 3D3QA 2GK6A 2IYUA 3NC1C 2AHOA 3SEAA 1KTVA 3IPYA 4IFBA 4BLTA 2F6RA 4DDUA 2CHQA 3SDZA 1S3SA 621PA 4M1YA 3C16C 4CDGA 4LI0A 3RDPA 1G3MA 1P72A 2ZEJA 4O25A 4PAMA 1N0WA 1CULC 2IYTA 2ZI3A 1NBME 4IVPA 1Q1ZA 1IJEA 4OI2A 3CRW1 3GP8A 2WIBA 2GF9A 2I3BA 2Y8EA 4C0KA 5LDDC 1A1VA 1FUKA 3SHFA 1E9CA 3THWB 1RRGA 4LV8B 3LD9A 3OE7A 3TQFA 2VP0A 3O8RA 4GDFA 3AF3A 5C4MA 3L43A 4WXRA 3VKHA 1J2JA 2O8BA 4RD3A 3ICEA 1YRBA 3GJXC 2RAPA 4B3DA 2H92A 1OLOA 1JECA 1FX0A 4E09A 1T0JB 2ZETA 1LTQA 1KO5A 3LQRA 2B7CA 2GBLA 1VG8A 1VIAA 4DSOA 1MRNA 1S3GA 4MGKR 4TSFA 1U8YA 3T34A 2J1LA 1AS3A 4MDFA 1MT0A 1N6HA 2DCUA 3FWYA 5JECA 2IYLD 1E9FA 4GBMA 2HDNB 1Z6TA 2A5GA 4WXPA 1G19A 1SHKA 1JPJA 4ZDKA 2QORA 4A8JC 5KPJA 4AWXA 2ZYVX 3FFBA 4G5SA 1Z6YA 2WJVA 2VHJA 1SKYE 1AKEA 3A36A 2JLUA 1TU3A 1DELA 1IY2A 1S2MA 1X3SA 1KJYA 3QXHA 2AN9A 2BMEA 3RABA 1KI8A 1G9XA 2XTNA 4D4JA 1UKEA 2R9VA 2QPTA 5TMPA 2CHGA 1W36C 3QKRB 2YOGA 5C18A 3AVUA 1Q3HA 4MRNA 4QBFA 1Z6GA 4QNMA 4DUGA 5HKKA 2FE4A 3E5HA 3T1QA 2SHKA 2C98A 1OXXK 5FPKA 4DDWA 4IXNA 5CM8B 3UANA 5HTKA 3EXAA 3RS3A 4FN5A 2AL7A 1ZIPA 3K53A 2GXAA 4V0LA 2FZ4A 1XCGB 4P0TA 2F43B 1Q22A 2ZJAA 4DUGD 5BYKA 5HKKD 1UDXA 1Q1BA 2WM9B 1ZM4A 3BFXA 2V8OA 2ZSAA 3TKLA 3X1XA 4GP7A 4TL8A 4GOXA 5E3HA 3OESA 1MRSA 4KLZA 3CNOA 2DWPA 2JJ2A 2IW3A 3BD9A 4IVRA 3B2EA 4Z54A 1KMHA 1IXZA 4CYMA 3PCRB 2FGKA 4AIIA 3UG7A 4A0FA 1P75A 1XD2A 2QRNA 4CEIA 3I8XA 3K0SA 3NHBA 3N70A 2JGNA 1JQLB 1A82A 2WSSA 3W3ZB 4D0LB 3CF6R 2JJ2D 4C7OA 4B33A 4EDHA 3WP0A 4IFEA 1TQ2A 4GP6A 1YZQA 3CUEF 5BW8A 1NL3A 1PLJA 1KMQA 2NGRA 4V0OA 1Z28A 3DKVA 3DVLA 2Z6VA 4TT3A 3OFND 3AH8A 3WBJA 2W00A 2WSSD 4NCNA 1UBFA 2R62A 4LSGA 1G5TA 3T1VA 4E03A 2DY1A 3CZPA 1YZTA 2CBZA 4D4KA 2ZJ8A 3AF0A 4N0DA 4DEXA 3KTAA 4B48A 1T3SA 5AUOB 2G6BA 3GLGB 3GFPA 2GWHA 5KDLA 4EFLA 5AWFC 4TT3D 3PQCA 1OH8A 3SYLA 2AK3A 2FH5B 3MRSA 1F2UA 2FEMA 4HSEA 4CEJA 1P6XA 1W0KA 4NDZA 5JHGB 5GJWC 2EW1A 3FVQA 1AN0A 2ZUDA 3SQXA 1GKYA 3U3JA 4A6PA 5LD2B 4OQXA 1XXHB 1PZNA 2CCGA 2WVJA 4NPHA 4MRRA 1OT3A 4TMZA 4TLCA 3VU9B 2IWRA 3KFVA 5DI3A 1F6BA 5F2EA 1ZU4A 3QPWA 1Z6XA 2PLFA 1ZNWA 3CW2A 3D6TB 2JLXA 4AKHA 1W0KD 1F60A 1ZCBA 1VIYA 5KSOA 1OJLA 3AVYA 1CJTC 2IYWA 4JLAA 3LAWA 4KFRA 4QRHA 2OO7A 4UJ5A 2AWOA 2GAOA 4P31A 3DZ8A 3Q85A 3EZ7A 3WNDA 4D0GA 1M34E 4WOPA 5FUWA 1UADA 1TQ6A 3K70C 2HT6A 4PZYA 3CO5A 1P2UA 2QEQA 2JLZA 1H8HD 1S1MA 3L8ZA 1KKLA 4M1WA 3CPHA 4PHGA 5E7MA 3TR0A 4EPTA 4B47A 1BKDR 2I1VB 5JI2E 1Q1QA 4F92B 3U60B 4B43A 1N5IA 1W4BA 4ZCMA 3B82A 4WZ6A 4ESVA 4PZZA 2IA5A 4PTLA 4D2IA 4MH0R 2UZ3A 1XEXB 5F9HA 3QIAA 3MMPA 4F4JA 2MSCB 3NKVA 5FBRB 3WNCA 4EFMA 1XMSA 2QAGC 4YONB 1KO7A 5KNBA 4QJ3A 1PVOA 3NEJA 1D9ZA 5CITA 3CF2A 1HQCA 2ZJ5A 4C9BA 4US1R 4Q7KA 1HY3A 3UIEA 2IL1A 3BB4A 2WJYA 4DCTA 4OQFA 3ND8A 3EZ6A 2ORVA 3E2IA 2QT1A 2Q9BA 5AJVB 4Q47A 2IYVA 4U02A 3P26A 3RS2A 1GG2A 4HAWA 3KXLA 2C2HA 3QY0A 5P21A 4X8MA 3VMFA 3B78A 1N0VC 1Q44A 3KKPA 4ZKEA 3QOFA 3QNUA 4IXMA 3SHWA 3U6BA 4OK3A 4YMSA 4WA7A 4B6EA 1L7VC 4NYIQ 1W36D 3TMKA 3R8CA 2AR7A 1SGWA 3OEHD 2ZRIA 3DOEA 2GETA 2NO1A 2ZYTX 3M1IA 5IHPA 3UPUA 1RPZA 2J9RA 3TIFA 1FX0B 1E9AA 2IS1A 1OFUX 2C78A 3QF7A 1YZNA 5FOVA 3TLXA 2ORIA 2ZI9A 2PJRA 2E87A 3OIVA 2WWIA 4Q4HB 2EYQA 2Z5FA 3WYGA 4KV9A 4BFXA 1JALA 4MRPA 3CBQA 5EP1A 3DPUA 3EZ2A 4ZDIA 2QGZA 1Z22A 1II8B 1XJ0A 4RD0A 2PBRA 1VCMA 1ETUA 5ANRB 3RHFA 5FR1A 5SZIA 1UM8A 3EWSA 3NEYA 1T0HB 2REOA 1E4YA 4P3YA 1BYIA 3AM1A 1GFIA 1R0WA 1GNRA 1Q57A 4LCBA 5E7JA 2ZS7A 3SJZA 3IEUA 3VR3A 2NO7A 2Q6TA 3KJEA 4XWOA 3GLGE 5AK0A 3W6NA 2F3TA 1ZC3A 4Z8XA 5KHOC 2DYKA 4JT4A 2CVFA 1QHXA 2CVHA 2RCNA 4LGMA 2B92A 2ZIAA 3CWZA 5A5GA 3OIYA 2GZHA 1LNZA 5EQTA 1DEKA 3THYA 4OI4A 1FQJA 3B1XA 2GCPA 2O8CB 1XXHE 5D3MA 3EIEA 1XPRA 2WBLC 5EE1A 1E9RA 1G3UA 3IHWA 1KNXA 4WW0A 3S1AA 3ETLA 3PEUA 5JI3E 4PC1A 4A2WA 1DO0A 1U99A 2YJTD 3SC3A 1SULA 1KKMA 2QMEA 1G64A 2IBMA 3NH9A 4HAVA 3TR5A 3IGFA 3TW4A 1H65A 3VR2A 3RWMB 821PA 3T5GA 2HJGA 1U8ZA 4JVNA 1E0KA 2OCBA 1EFRD 1DAHA 1E0JA 1S4QA 4R71A 3EC1A 3PIRA 3GLIA 4UNSA 1WCV1 2W58A 1AA9A 2NTYC 1P9WA 1P61B 4EPVA 2AD5A 3FB4A 1KSFX 4HDCA 1EX6A 2BJWA 2WWGA 4RCYA 5CJPA 1XCMA 4B71A 2KWIA 2WZQA 4NP6A 5KNCA 2J0VA 1P9RA 3QPUA 4YDSA 1XEWX 1M6NA 3SU8A 2AKYA 1LFDB 4HLUA 3A4LA 3ZVRA 3K70D 1IN8A 1DO2A 3LLUA 2XOKD 1MR3F 4FCWA 3Q7PA 1KK2A 2BMDA 3PUWA 3KKQA 5DH9A 2Q3FA 1KI6A 4QC2A 4RZ3A 4BLPA 4C2UA 1C4OA 4AK9A 4Q9LA 2HYIC 3FPAA 3FMFA 1T5IA 2RH5A 2WSMA 4RZ2A 3SBDA 1LF0A 4EKDA 3THWA 4Q9KA 5KDDA 1G17A 1US8B 3KFXA 4XVUA 1A2KC 2C9YA 3CLVA 4PSAA 1R5OA 1N5KA 1VKJA 3CPEA 3VKGA 4PXAA 4OQNA 4Q48A 3I3SR 4DBLC 4DLYA 1Z0IA 5K8UA 1FL9A 4Q00A 3CZQA 1Y3AA 2FGJA 1YZLA 5G3YA 1OW3B 4TLEA 2ZRNA 2PX0A 4POAA 3Q9LA 4IDHA 2B8WA 4JBXA 4A0GA 1G291 4L15A 3ADBA 1G4UR 1Q0UA 1D2EA 1XMIA 2XB2A 2FSGA 4OJKA 3I73A 4AYXA 4II7A 1ZYUA 2J87A 4D4LA 4HZUB 4XSHA 3H2YA 4US2R 1UAAA 3DMNA 2CL7X 4NTZA 3PXGA 3EC2A 5J4KA 1JJVA 5DHFA 4FINA 4MYUA 1U0JA 1TMKA 2XJ9A 1G7TA 2ZVPX 1D2NA 3DHWC 2VP2A 3FKSD 5HPYB 2ZS8A 4A8JB 1MOZA 5FL7A 3BFKA 4OQMA 3I72A 2PZEA 5CK5A 4KVGA 3CONA 3BIFA 5FFMA 2JLWA 1S8FA 1GSIA 3NC0C 3QKRA 3EA5A 3PJRA 1VYUA 4ZIRB 1N6LA 4DJTA 2BBSA 3K0CA 3K9LA 5JCZA 2OFWA 3VR1A 4A2PA 4LYFA 4P33A 2QTFA 4V0NA 4YLGA 4BZPA 2ZR0A 4KFUA 5FL7D 4FWTA 5JHHB 1CR0A 3QKSB 5E7IA 1NJGA 1NN0A 1W36B 4BZXA 3IEVA 4G5OA 4E22A 1E2FA 2CL0X 3WXMA 8OHMA 3CRQA 3UATA 2G83A 221PA 4QFMA 2PT5A 4XVRA 3O47A 2GDJA 2F43A 4DLUA 1WXQA 2VH5R 4B2IA 2ZSFA 4KSCA 3P32A 1NSFA 3U5ZB 2DB3A 4MUBA 4ERNA 2ANCA 4NCHA 2OCPA 4PPGA 1RRPA 3ZZTA 5EE5B 3P27A 3FOZA 4AYWA 2EQBA 2GXQA 4TN1A 4HAUA 1W47A 2WMNB 3REGA 3KJHA 2OBNA 5SZKB 5B58C 4NU0A 1NIPA 4Z1MA 1LB1B 3T61A 4PFSA 2A3RA 3VNVA 4OJQA 4IEIA 4TL6A 2VHCA 5DSZA 3TAHA 3BJIC 1LY1A 3U3RA 1AZTA 1V43A 3FKQA 5E4FA 1OXSC 4NYIR 2A2ZA 1IN7A 2OILA 5IK2A 2OT3B 2AFHE 2ZUCA 1RE0A 1HH4A 2H18A 1B23P 2R6GA 3GJ8A 1M1YE 1G8FA 4DLZA 4KU4A 1S9DA 3ZVNA 4ZPXA 5JZVA 2QMOA 1SVLA 2QENA 3LNCA 2NMVA 3UWKA 2Z83A 1G7CA 5FOSA 3EZ9A 2ZE7A 4N1AA 4ASUA 2CCKA 3UMFA 1H8EA 4LBZA 4Q4AB 4XOIA 3SOPA 4PANA 4TZ0A 1GTVA 3LVQE 2FMXA 1EFUA 3B1VA 3LBIA 4J0QA 3GLGA 1JR6A 1UKYA 3C5HA 1XF9A 2FEOA 2YWEA 3CF0A 1OIXA 4TMTA 2F3RA 3P4XA 1L4UA 3GJ6A 1QHSA 1BH2A 4HDQB 4JVSB 1CR2A 4ASUD 1KI4A 1F48A 4QG7A 1IBRA 1WE2A 3MGCA 1XXHA 1FMJA 1KO4A 2WOJA 4BFSA 1L8QA 4DCNA 3QBTA 5F3WB 1AGRA 1TPZA 3VU9A 5M04A 2BV3A 2QP9X 3B6EA 4WAUA 2R6DA 3T1OA 2ZJ2A 3TSOA 4ZDJA 4AG6A 1QVAA 5JS7A 3QG1A 1JI0A 3FHOA 4KODA 1Z08A 3K8YA 2J0SA 1KK3A 4DEYA 3CX6A 4JLJA 4TMXA 4ZCLA 1FFHA 4C0SA 4HB3A 4OYHA 2P65A 2O52A 1AK2A 3QE0A 4MITA 3D31A 1NJFA 4EPXA 4LHVA 2P67A 2J0UB 1Z3IX 1CF4A 1NKTA 2W6IA 3W5IA 2XB4A 1JBKA 4RZXA 4BEBA 4EIWA 3CNNA 1NLZA 2B21A 1OH7A 1GRRA 1GIAA 5IRCD 3GLIB 1NG1A 3CR7A 5HCNA 1ZRHA 2HV8A 4LJ7A 5FL3A 5CB6A 1E9DA 2WJJA 4FCTA 1E3MA 2O8FB 3X1ZA 2GZDA 4LHYA 2OXRA 4Q66C 1IJFA 2HXSA 2W6ID 5JRJA 5B30A 2QROA 2A5JA 3AUXA 1XEXA 4HYYA 4MYTA 2PH1A 5HZHA 5JJKA 1HQYE 4PQYA 1JXOA 4GI7A 5BQ5A 4CRWB 1E9EA 3U7EB 4K81B 1KIMA 5FPTA 4JLBA 4PPNA 1NMYA 4MRSA 2RGEA 3AKCA 3KB1A 4HB2A 3LV8A 4PPQA 5TVKA 4EPYA 4KAXA 3CB4A 1E4VA 5FPSA 3W5JA 4AKIA 4RD2A 1ODFA 4V03A 2KBFA 1VTKA 2QAGB 1L4YA 1E2DA 5HE8A 3ZQJA 5KNDA 2IHYA 1JXMA 1KI6B 4QHTA 2ZXUA 4XH9B 1NY5A 3LQQA 1LS6A 3OEEA 3FMOB 1EFTA 2VO1A 3IPXA 3QEJA 3R9IA 2FV8A 1WP9A 3OZXA 5E95A 2WWXA 3L0PA 4WIAA 3U61B 1D9XA 1G7SA 2HUPA 1V5WA 2CHVA 2QPOA 3W6PA 2XXAB 2ERXA 4MQBA 2VLIA 2JLQA 2OCYC 4EUNA 1WBDA 4PHFA 5EXSA 3IKJA 3RS0A 4BZQA 4D82A 4QGAA 2V55B 2YINC 3OEED 3W6OA 3GLHB 4HAZA 1JR3E 1XU4A 3IILA 1CS4C 3RC3A 3ADDA 1HEIA 2VYFA 4Q1DA 3BB3A 4B75A 5IT5A 2WKQA 1OH5A 4LJ4A 4WZAE 3K9HA 2GHIA 3AP1A 3LVRE 4QKQA 4DDTA 2FF7A 2JAQA 2OCAA 2PMDA 3Q3JB 1YJ5A 4Q5IA 3EPJA 4IDNA 3NHAA 4Q4HA 4LUCA 3THXB 3HU1A 2JLYA 4PAOA 1E2GA 4N0EA 1AS2A 2V9PA 3QXXA 2UVQA 4NE2A 4O2LA 2QMUA 3SYNA 4NZYA 3U7GA 3MWJA 1XX6A 1G3QA 1JB1A 1II8A 2DWQA 1RKBA 2A9KA 4OHXA 3T35A 2GRJA 1S96A 1RYHA 1NN1A 3SFZA 1W7AA 5L3QB 1VYTA 1GAJA 3WBKA 1N6IA 3K0EA 2ZI7A 1ZW6A 3L2OB 4RCZA 4D4MA 1OB2A 1OIVA 4LK2A 4LJAA 2OESA 4Q4JA 5DE3A 2FU5C 3CWQA 5C4GB 2OUKA 1Q1EA 4S35A 5EZ5A 2EWVA 4LPKA 1G3IA 1N6KA 4XWAA 1R0YA 2GJAA 2G0NA 1SHZA 2VP4A 3ZZ0A 1FNNA 1Z06A 1COWA 121PA 4HLCA 1J8MF 1FW6A 1KAGA 5DNYB 1J7KA 4KYUA 2O8CA 3PITA 3VR5A 2RGNA 3QF4B 4G5RA 4PHHA 3GEEA 2UKDA 4NCIA 3TRFA 2YNMA 5EXTA 1KSGA 2CLCX 4FI3C 4D81A 5BN5A 3DL0A 4XTCS 5KPDA 2JASA 2OE2A 2RGGA 4LYJA 4H1UA 1COWD 1FNMA 3X1WA 1GKIA 2D74A 1KDPA 1X86B 1ZBDA 2N42A 3L0SA 4PO8A 3DO6A 5LBIA 3TK1A 2ODBA 2WOOA 2XZPA 2O8DB 2C9OA 4YDHB 1G6OA 3MAAC 1CLUA 3HPRA 1TADA 4K8OA 1E2MA 1I4LD 2JEOA 3KQNA 1KYIA 3FE2A 3DM5A 5CYPA 4RD1A 3OFNA 1DAMA 5J5CA 1KY3A 5AUQA 4ABYA 3CM0A 3LA6A 4M8NE 3RWOA 3JVVA 4WZBE 1UEJA 4UXJA 1PLLA 4QBGB 3QVUA 3BFVA 3GLIE 3EPHA 1R0ZA 2YC4C 4KFTA 1RRFA 3K09C 3C15C 1GKUB 2IX3A 2WWWA 4B3FX 1HUQA 1DADA 1EX7A 3A8TA 1BO6A 3TSWA 4I1OA 2GVZC 1R2QA 2QTVB 2ZREA 4K46A 4QXAA 4OBEA 2ZYWX 4FW9A 4LHXA 4M21A 4PZLA 1TU4A 2FSIA 3IO3A 3R7WB 1K5DA 1JJ7A 2YOFA 4EPRA 3B9QA 4JBYA 3TW8B 1Z0AA 2ZRKA 3C8UA 4JVMA 2NZJA 3F3YA 1G18A 4NL4H 1P3JA 4OKSA 4UQOA 1W44A 3HP1A 2NZ8A 3KKNA 1I4DD 1PUJA 2P6UA 1TL7C 2ZUBA 3NDBB 5FOWA 1QVRA 3KUDA 1US8A 2CLDX 1OSNA 5DISB 4E5UA 3TAUA 5DLQC 1SVIA 3GCGA 2ZJBA 2IF2A 1TQDA 2YOHA 1QHGA 3U4QB 4P4SB 3RRNA 1VYVA 2NO0A 2WHXA 4B35A 1WRBA 4C2TA 4MYHA 4YQFA 3FHTA 5AJWA 2F1HA 4QL3A 2P6NA 3X1DA 4A4DA 1N25A 1H8HA 4R7ZA 4CEHB 4B2LA 1N5JA 2CK3A 3ZDQA 1XTIA 2B6HA 1GP2A 3K0AA 5JEDA 4MDEA 3IUYA 3NDPA 3T12A 1DG1G 3IIMA 3TUZC 2QM8A 1KY2A 1C1YA 2WWHA 1WA5A 1RIFA 1KI7A 2F55A 2QT0A 3QUSA 2ODWA 4URXR 4HZUA 2QRZA 4GZMA 4GMXA 5KO2A 1R5NA 3KKMA 5G53C 2IT1A 2X8AA 2CK3D 1SVSA 3GJ0A 3KZ1E 5JEEA 4NH0A 4BRWA 5EE0A 3B8HA 1GL9B 2XGJA 1KDOA 1M8PA 3SYKA 5CB8A 3QG5A 2RGXA 4XIGS 4TL9A 2RGAA 1SKQA 4LV5B 4W5JA 5GVRA 4A6XA 4A8JA 1ZVQA 3WRYC 2ZAMA 4OHVA 3BOSA 3B5JA 4LJ5A 3TQCA 3VTKA 1E2EA 1HYQA 1GOTA 2W0SA 3N2IA 2WAXA 3NVAA 3BAFA 4ZIRA 1YR6A 1OIWA 4LHWA 4QOSA 4OI0A 2O8EB 4KCGA 1KHTA 4PSKA 1P2SA 4XWKA 4RFVA 3F5FA 2G1KA 5DYGA 4JLVA 2GEDA 1VCOA 3PUYA 4HB0A 2V4ZA 3QKSA 1OF1A 1GILA 1YVDA 1RZ3A 2ZTSA 3W90A 5CJ2A 4JLDA 1KK1A 3OEHA 4MKGA 4DCSA 4F38A 2JA1A 4DC9A 2FA9A 2VHQA 2NG1A 3KB2A 3CR8A 3AP3A 1G21E 1LW7A 1CIPA 1HT2E 2X19A 1JR3A 4JZKA 1G1MA 3FHCB 3N2EA 4C0JA 2XJ4A 3I32A 2BBOA 3EASA 2XZOA 2H1LA 4JBWA 3EARA 3P20A 3W9YA 1F3OA 1GVNB 1U0HC 3WMGA 2C95A 1A2BA 1OH6A 4M9XA 4JYCA 1R7RA 4KI0A 4H1VA 5FBWB 2Z0MA 2BJVA 4XJXA 2QP4A 1JR3D 1T91A 2OAP1 1P73A 3AVTA 2D62A 1XD8A 3AF1A 4IDOA 4Q1EA 5EP3A 1ZNXA 4DCUA 4DLWA 1XMJA 2O5VA 3X1YA 3AVQA 4Q9HA 3AB3A 4IRUB 1WF3A 2GJSA 2VHUA 2Z4RA 4IOMA 4KFSA 2ZRJA 3TVDA 3RVBA 3G82C 3CKLA 4EPWA 3NXSA 3PG5A 1HV8A 4P32A 1KSHA 1NSTA 3WNBA 3EPLA 1JNYA 4Q4AA 1DAIA 4URVR 5BYJA 1ANKA 5JWHA 4C30A 5EUQB 1RJ9B 1QF9A 3PUXA 5GJCA 2NPFA 4F93B 2J7KA 2RMKA 3R9XA 2DFKB 3NWJA 5FBQB 3UMRA 2RB4A 3Q8XB 4Q4JB 4B3BA 3GMTA 3K9NA 4FXPA 2VTKA 3DMDA 1VPLA 2KB0A 4DIDA 1SXJC 2O0KA 5TY0A 3SS8A 3WRXC 3CRVA 2OFXA 5JS8A 2BKEA 2GTPA 4FMDF 1AGPA 3VX4A 3ZVLA 1VHLA 3SJCA 1NNEA 2YHSA 3NH6A 1U81A 1FUUA 5CIWA 1E98A 1G4AE 4KBFA 1N6OA 3CH4B 2WPDA 3U44B 3VHXA 1YKSA 5FTLA 4W5WA 4CIDA 1Z07A 5J4VA 4TYWA 1EFRA 2BM1A 3RS7A 1W5SA 4M1OA 4P4UA 4IEEA 2ZRHA 5CLLA 1JPNA 1EWRA 3UMSA 3D8BA 3TBKA 2WJGA 2CNWD 1I2MA 1BIFA 2J0UA 4EQ6B 1NVUQ 1KO1A 2WPDD 1G8PA 1OYYA 4OI1A 4F7WA 3O8CA 4IW3B 1N0UA 4MYCA 3H1TA 4BFUA 3FDIA 4HUTA 3ZYCA 3ZD6A 4QBHA 1JAHA 1G8GA 2PEZA 5IDVA 2JLSA 4QHSA 3ZVMA 1TF2A 2IYYA 2JJ8A 5H68A 2GA8A 5LB2A 1E6CA 1NN5A 2O8FA 4ACBA 4GMDA 2OG2A 4C4PA 1X8JA 5DIFA 5KUTA 5J4HA 1XP8A 2NO6A 3PR1A 5GJBA 1Z29A 2F9LA 2XOKA 2EFEB 1YR7A 2DR3A 2LCFA 3V00A 4DLVA 3BH7A 4BGDA 1QHYA 2X2EA 4TZ6A 3H4MA 1AQUA 2JDIA 4M1TA 3BB1A 4B6FA 3I5XA 1N5LA 3CX8A 4H9GA 2QTHA 4YMUA 2C96A 3AP2A 1XEFA 2DFNA 4BWYA 5K8IA 4Q02A 3W34A 2QAGA 4V0MA 1XTQA 2RGBA 4W5HA 2V1XA 2JDID 2WICA 2PCLA 2WJHA 3AKEA 4PC7A 5JRZA 2BC9A 1U98A 4EJSC 1AZSC 2BDTA 5FI0B 2FPLA 3Q5EA 1GNPA 2HYDA 2GAAA 2FJUA 4HDOB 2UZIR 2J3EA 4JL5A 2VL7A 4GRAA 2C5LA 4JJKA 2XXAA 4Q03A 1J99A 4JMPA 4OQLA 2FFBA 4GZLA 1E1QA 5EP4A 4HEJA 1KZGB 3RC8A 2IS2A 3EIQA 4ZDWA 1Z2AA 1SVOA 1DAKA 1TUEA 3GLHA 3K9GA 1WBBA 1GL7A 3VNUA 4A0RA 4EAQA 4A2QA 2OLKA 4GT1A 1NN3A 2BBWA 2OV2A 4M22A 4M1SA 2WWYA 1UKVY 3MWYW 4URYR 3H84A 2WV9A 1WDTA 5DGXA 4TLBA 2DFLA 1E1QD 4Q19A 3K0AB 2HLDA 3UKDA 1EFCA 1ZM7A 2GEVA 1IXSB 4TTQA 4M9SA 3THXA 1E2IA 2PL3A 4IKEA 4URWR 3A4NA 3FKSA 4Q21A 1K5GA 1WB9A 1UF9A 3MJHA 2R8RA 1KAOA 1Z0KA 4GSYA 3ADKA 3SJAA 3M0EA 2HLDD 2J7PD 2J41A 1OKKA 2VEDA 4AI6A 1F2TB 3QEOA 4M1KA 4V0KA 4WVFA 5GJVC 4B3XA 1Z0FA 4LC1A 2YV5A 4I1UA 4BLSA 1HT1E 2IF0A 5L3QA 4GFDA 2C04A 1NVXQ 5CYOA 5B2ZA 5DN6A 3SFVA 1ZUNB 2YWGA 4ZI2A 5LPNA 1YU9A 2TMKA 5HCIA 2ZRGA 1P2TA 3ZQ6A 3OIUA 3WMEA 1OKKD 1MV5A 1ZM2A 3BS4A 2ECKA 3AVXA 1IM2A 1JAIA 1SQ5A 3U3MA 2FN4A 1P2VA 5JLJA 4RFSB 4XVQA 2IC5A 5DN6D 3BH6A 3D7MA 3GLFB 3VX3A 2H16A 4I81A 1S0UA 4ARZB 2FZLA 4YMVA 2REBA 1M2OB 3V4FA 4DB4A 1IOZA 4DT1B 3QF4A 2EWWA 2QY9A 3HR8A 1CJUC 4XD7A 3UXMA 2HF9A 3LW8A 5AUNB 4IOLA 4DCVA 2WTUA 2HT1A 4I99A 4L5BA 3BERA 5SZHB 3C5CA 4O3MA 4AURA 1M7GA 2ERYA 1GRNA 3QXSA 3B1YA 1YZGA 4IDQA 3UG6A 1TUIA 5DI9A 4RKFA 3SZRA 3KQLA 4JJZA 2ZRFA 2Z43A 2XZLA 5JBQA 4B74A 1SXJD 1OFTA 3GPLA 2O8DA 3A1SA 4XD7D 2GXSA 4M1MA 1TF5A 2ZPTX 3MWLA 3OHMA 4KHZA 3WP1B 4A82A 4B44A 3HU2A 3QJYA 2AXNA 3T06B 3A1WA 3IIJA 4JLNA 2ONJA 3R9WA 2MSDB 4PO1A 4GPTA 4AD8A 1EXMA 1KO8A 2Q9AA 4PC3A 4AC9A 1J8YF 2R2AA 5AJXA 1VG1A 2VSXA 2PJZA 4A0HA 4G3XA 2XX3A 1CRPA 2BHRA 1ONBA 1FTSA 5JSZA 5KTYA 4M0LA 1VDZA 3NIBA 5AUPB 4NBSA 3T1TA 2QP3A 4NCKA 1Z83A 3IHLA 1CEEA 2YKGA 1AKYA 3MFYA 4Q18A 4UNRA 4A15A 1FOEB 2BKUA 4KITB 1ELOA 4PX9A 4CT5A 1N3BA 2WKRA 2CLSA 2PEYA 3R7WA 4DIEA 3KX2A 2WMOB 2ASEA 1E2KA 2CL6X 1T3HA 3K1JA 3I8SA 4BFYA 2AXPA 3GJ7A 3QI2A 3ZZUA 5KOYA 4LV6A 4TTRA 2WKPA 1R5BA 1VG9B 2OHFA 2CEAA 1N2CE 3V9PA 1PV4A 1P7CA 4XSGA 1KZ7B 3KJGA 5CDFA 4CT4B 2GESA 1II9A 2OLJA 4TLAA 1TNDA 4P4SA 3U4QA 1IXRC 2GCOB 1MABB 1MO5A 4RD6A 3UWOA 1NY6A 1LV7A 5JFGA 4RKEA 1D2MA 4NCJA 1OB5A 2BM0A 4CEHA 3ZLJA 1JQJC 4UNPA 4CW7A 2KI5A 5C2JB 1E94E 2O0HA 3REFA 4HZIA 2V7QA 1FQKA 4U5XA 3LW7A 4QGGA 2CJWB 1XMVA 1U2RA 3SR0A 1GRQA 3PEWA 1NP6A 1GM5A 4JSYA 2CE2X 2QL6A 4LBWA 3T15A 1A5TA 4A9AA 1IQPA 2C99A 4BE7B 2GILA 5TDHA 2FX3A 2NPIA 2C8VA 4TYYA 4Q1FA 1W4CA 4OHZA 3IBGA 1T3LA 2V7QD 1FP6A 3A1UA 4D80A 3HU3A 3HYRA 3NG1A 2QNRA 3CNLA 4G0NA 2A5FA 4UNNA 1E32A 2CMKA 3H86A 1NVVQ 3J81k 4KYIB 2E9SA 4GOKA 4Q7LA 3F0TA 2Q9CA 2AFIE 4IHQA 2W2TA 2LKDA 3KDSE 2ZYUX 2DHRA 4FMBB 2A7QA 4TYNA 2FNAA 1T5LA 1G5PA 1U90A 2O8EA 2J59A 1W48A 1ZM9A 2JATA 4GOJA 4YXWA 2VA8A 1MKYA 4LX0A 2IUUA 3FMPB 1AS0A 3GFTA 5C46F 2JJ1A 2OXCA 3NBYC 3SQWA 4QM7A 1AJEA 2VIIA 4JLKA 2Z4SA 2WJIA 1XWIA 4PC2A 2ZVQX 4UNQA 3WYAA 3AVOA 3P1JA 5A0FA 5DHAA 4FMCF 1ZD1A 3BBPA 3X2SA 4YXWD 3GLFE 2QG6A 3BORA 3LO5A 3AF4A 4LOAA 3RRZA 3T5DA 2JJ1D 3BGWA 1IY1A 4JT2A 2N46A 1OYWA 1WMSA 2GKSA 1XEWY 2RHMA 3PUVA 3A6PC 4F4IA 1YHNA 2Q3MA 1HURA 2R44A 3DKPA 1G20E 3IQXA 5J47A 2XTMA 3MWKA 4BLQA 4ESHA 1Z0JA 1RW4A 1UDWA 2K5UA 1TTTA 1CR4A 1Q21A 1XZPA 1O87A 2BEKA 3MG9A 2Q3HA 2ZRMA 4QGFA 1KJZA 5FTMA 5G3ZA 1ZM3A 3ND9A 2PZFA 2QAJA 3MSXA 5FBLB 1P5ZB 2QSYA 2QA5A 2PT7A 2HCJB 4IOKA 3A1VA 5CIQA 4ZKDA 4Q1BA 4R2IA 1Q12A 4PR0A 1XJCA 4MGIR 1KGDA 2V6IA 4ACAA 1N6PA 3RANA 4O0MA 3OIWA 4LJ9A 3TJZA 1E2QA 2G1JA 2V3CC 1XPOA 3W8RA 3ECCA 3NBZC 3JZMA 4CF7A 4HATA 1OFHA 2FSFA 1E0AA 2X77A 3OE7D 4NYMQ 3AVWA 3I61A 1MO4A 2FDCA 1J70A 4UXIA 1RJ9A 4Y0AA 4FMDB 4TQ9A 1Q3TA 1IONA 2P0EA 3GD7A 5L3SB 2A78A 4NKRA 4BUJA 1LVGA 3SNHA 2OSBA 1R8SA 3ZIAA 1XBTA 2PLRA 2ZRBA 4QGHA 3Q5DA 5FOUA 4GL2A 1EESA 2F9MA 4Q1CA 2B7BA 2EFHB 4AKGA 5ELXA 2QUZA 4JLOA 4M9QA 1I2DA 4TSFD 3B85A 1E2LA 4PSVA 4LYHA 5LB4A 2A30A 3WMFA 4B2PA 4DLXA 5KSYA 2ATXA 2ZRAA 2HXYA 4JL6A 3ZIAD 4UXHA 3SJBA 3C41J 5JJIA 1SXJB 4P4TA 1E99A 3U44A 3U7FB 3B1WA 2IXFA 4HI0E 4PQFA 3LLMA 3QVVA 4F4CA 1SVKA 1F5NA 4ON9A 1QHHB 5A4JA 4JLMA 5FI1B 1ZP6A 4Q7MB 4BFZA 3SN6A 1UJ2A 4DHEA 2QBYB 4EQ6A 1RRCA 4R98A 1SVWA 2JCSA 2BIFA 2QMHA 3VQTA 4IJMA 4ZI3A 3AQ4A 4RSGA 4R9UC 3GJ5A 1P9NA 2OFOA 3TUIC 3PFIA 2NQ2C 4C0AC 4ZCIA 3CX7A 4C0HA 5HR5A 3QSYA 2GVDC 3QPVA 3DEFA 1DAFA 2XAUA 1G7RA 1M74A 2AX4A 2L0XA 1YRAA 4KJZA 5GADl 5FR2A 2IEZA 2OEPA 1GITA 1K6MA 1Z47A 5JSZB 4DVGA 2Q21A 1YR9A 521PA 5KSZA 3PENA 2RKOA 1E9SA 2ZR9A 2XTZA 3IO5A 3NBXX 4M4SA 2IYQA 1NG9A 2VSFA 3BXZA 1QHNA 3U6KA 3WY9A 1QHIA 3HPQA 3KJIA 3PEVA 2ZU0C 3LX8A 4PO9A 1M7HA 2QPAA 2FFQA 1ZD8A 3L0OA 3QENA 3ASZA 1Z63A 2V1UA 4RY2A 2XNSA 2B8TA 2EU8A 2IYSA 2VHTA 4LJ8A 1XTSA 1IAQA 3CRMA 1DBSA 1QZXA 5J40A 5KSPA 2F7SA 3K0FB 4MKHA 4Q01A 2NIPA 1YR8A 2P3SA 2QQEA 1QBKC 2IWHA 1ZUHA 2QI9C 4V0ME 4EFNA 1TX4B 2ZU6A 4TMVA 2ZAOA 4BECA 4HUQB 2KJQA 3AEZA 4DDVA 2EFGA 3TNFA 3A4MA 3TH5A 4EJSB 5L3RA 2C77A 3LRPA 1FZQA 5GVSA 1CU1A 2AK2A 4NONA 2FG5A 1KK0A 4TTPA 2G77B 4DB2A 2ZR7A 3HJNA 4DLTA 3GLHE 4G5GA 1XTKA 3LDAA 3RRYA 5F9FA 1I4TD 1KNQA 5EP2A 3GJ3A 3U3KA 2OBLA 3L0IB 4L9WA 1P4SA 2IS4A 4GNKA 1UBGA 1R10A 4L9SA 4WBSA 4JL8A 1DAGA 5UKDA 4KSBA 421PA 4JKYA 2J5XA 1EK0A 4TQUS 2IYZA 2REXB 1TF7A 2BWJA 2GJKA 3MUFA 1AM4D 2RHDA 5EZ6B 2AKAB 2R6CA 5JMTA 4TYQA 5KYKA 1X6VA 3DZDA 2OM2A 4YC7A 1F2TA 2V6JA 2ZRPA 1G16A 1IN5A 1EG7A 2P6RA 4Y0VA 3AVVA 3B60A 3I92A 2G3YA 4FCVA 4M9ZA 4F91B 1NRJB 5BN4A 3M6AA 2BCJQ 3KQUA 3IBYA 2H17A 3TVTA 4A92A 2YZ2A 1YZKA 2D2FA 4RZUA 4C0QC 2H8KA 1ZINA 1IN4A 2J45A 4DZZA 3DOFA 1C9KA 3G0HA 1SVMA 1NKSA 3LBNA 4QJ4A 3LXRA 1GWNA 4RD4A 4DSUA 3CPJB 5H70A 1ZMXA 4D25A 5EJEA 4RFSA 4HLUC 3GLFA 2LWIA 1NVVR 3FMIA 4ARZA 2X1VA 1GUAA 1RYFA 2VP5A 3GEHA 4PAQA 4B3GA 3RS4A 3A1TA 4DT1A 1UPTA 3FYHA 2D7CA 2OAQ1 1E9BA 3AGPA 6Q21A 5F98A 2EFCB 2J46A 1NI3A 3ADCA 1XD9A 4QHYA 4RJLA 2JLVA 2D4HA 3GFOA 1SXJE 1NBMA 4DSNA 2LKCA 5TV2A 2ZANA 4BLOA 1VG0B 4OL0A 1D8TA 3EPKA 2XSZA 5G40A 2F1RA 3O8DA 3EX7C 1CP2A 4LJ6A 4KXFB 1UKZA 4AYTA 1U9IC 2IXEA 3NTUA 4JIMA 1Z8FA 2KSQA 4MGZR 3KQKA 1E2HA 4CGZA 4CVNA 2GZAA 3R20A 1W4AA 1NBMD 3QKTA 3TGPA 1HTWA 1L2TA 3KL4A 3Q72A 2BBTA 2QZ4A 1E1RA 1Z0DA 2XSZD 3EIHA 5EE9A 5SZJA 5BWMA 3PVSA 2WIAA 1VECA 3N5CA 2BVNA 1TEVA 3E1SA 3QBVA 2XITA 2CXXA 1IY0A 4ZO4A 4X8HA 4DSTA 4DXAA 5HZKA 1ZIOA 2O8BB 2VF7A 3LFUA 2VBCA 3HDTA 1MO3A 1X1SA 1BS1A 3BRWD 4NYJQ 2BEJA 3B13B 2KBEA 3UK6A 1KSJA 2QSZA 1E1RD 4C0LA 4CZ2A 1R6BX 1NMXA 1XTRA 3K09A 2VQSA 3B9PA 3EG5A 4MKIA 2GK7A 4ITRC 3W8NA 4N3NA 2ZJOA 3VAAA 2X2FA 3QQ5A 1O3YA 2OBMA 2MMGA 1OE0A 3H0KA 2H7VA 2VRWA 3C7KA 4JLPA 1JEDA 2ZI5A 3JVUA 4BQSA 5BXQC 4NYMR 2YWFA 4S2EA 3EWAA 3LH5A 3K0CC 1E2PA 3SBEA 2IUTA 2ZM5A 3AV0B 3B1ZA 5FUXA 1LF5A 2V54A 5L8VA 2CNWA 1DAEA 4U7DA 3OF5A 2GCOA 1MABA 2ZQ5A 2FFHA 2ORWA 5EXXA 3RNLA 1U0LA 3LXXA 4BFWA 1X1RA 4KO8A 4V02A 1XCPA 5CDFE 1NVWQ 1TAGA 1G3RA 4PHTA 5EUMA 4AG5A 1QG4A 3NBFA 3U7HB 1QDEA 1XB2A 4URUR 3RLFA 1OXVA 3ZH9B 1CBUA 1QRAA 3I4LA 3A58B 1KI3A 2PZGA 3O8BA 3ZD7A 3ZGXA 5J4LA 1XTJA 3C4JA 2CJWA 2GF0A 3VKWA 3THOA 4W7SA 3KKOA 1X8LA 4A1FA 2P5TB 1UBEA 2QQ0A 2PX3A 4TMWA 5CLQA 2D2EA 3AKYA 1E79A 1MO6A 2FPKA 2HF8A 1CR1A 3EA0A 5FTKA 1CTQA 1XRJA 5TB5A 4E07A 3RSLA 2YVUA 1ZJ6A 3MCAA 3PV0A 3U3OA 4PPFA 4YMWA 5FTNA 1CJVC 2CDNA 5FPYA 5TARA 1NF3A 5B57C 2IYRA 1E79D 1BOFA 1KMHB 1ZNZA 3ONWA 1N6RA 2ZS9A 2W2VA 4LJYA 4Z8YA 1XD2B 2CCJA 2MSEB 4TMKA 2F1IA 4CEIB 1XZQA 3CIOA 1PUIA 2DFTA 1D6JA 1W1WA 1FMLA 1XDBA 4FMCB 1ESNA 3CH5A 4YMTA 4C7OB 1W2GA 2DPXA 1E96A 4JKIA 1GZSA 1XFAA 4NHOA 1NMZA 4PC6A 2G9NA 2YYZA 3QXJA 1HE1C 2F1JA 3ASYA 3I62A 3G5UA 2NO9A 2I1QA 3LX5A 1GNQA 3C14C 4G01B 1AIPA 2RGDA 3LBHA 4A36A 4LWZA 4O2RA 3KXIA 1E69A 5H1YA 1ZCAA 4BLRA 1BYUA 3DM9B 1G5RA 5G41A 4HLQB 1P60A 1R8QA 3MJRA 3I1FA 1EFHA 4Q9IA 3AF2A 4KVAA 3GEIA 1ESMA 4X8LA 2ZJYA 3KTAB 2AD1A 1G41A 4Z51A 4URZR 2E1RA 1BMFA 5LD2C 4KBGA 1NIJA 2VP9A 1JEEA 1OXTA 2R6FA 4HAYA 2Q0HA 3FTQA 2D7DA 1FP7A 2ZRCA 4TYPA 4BPBA 5FUYA 3E70C 2H57A 4TL7A 3BK7A 1F2UB 2G88A 3GQBA 4CEJB 2GNOA 1CXZA 2ZSEA 1EWQA 1W0JA 1CKEA 2HEIA 2ZRLA 1Q20A 4NMMA 4JS0A 1TEXA 2G0TA 1IN6A 2FSHA 4L8GA 4ZV4A 3I5YA 1T8UA 4ILEA 1D5CA 2J7PA 1BMFD 2ZI4A 4L16A 4OHYA 1ZU5A 1M7BA 2ZE8A 5CK4A 4B34A 1YQTA 1AQYA 1U9IA 1UFQA 5DI3B 3MLEA 4HB4A 4U00A 5EE3A 4OK6A 3VHLB 5TXGA 2XNDA 1T8TA 2D3WA 1W0JD 1NLYA 4UJ3A 3W3AA 5CM9C 4BFTA 721PA 2C03A 2GCNA 2QGNA 1DG3A 5BN3A 5HE9A 1A4RA 1DARA 4M53A 3TE6A 4B73A 1RFLA 2W2XA 1B0UA 1II0A 2EFDB 4LPSA 4OHWA 1KJWA 3B7GA 4QNRA 1R0XA 4D26A 2PCJA 2VP6A 1DTSA 2ONKA 2XNDD 2W0MA 1K8RA 2GEUA 4LC0A 5KDOA 1CJMA 2ZE6A 2VF8A 5L3SA 5JWOA 4Q1AA 5J4YA 3KQHA 4AKEA 3QKUA 4BRUA 1T4GA 1VMAA 2WWFA 3EW9A 3FFAA 4JVLA 3U2QA 1DVRA 3VR4A 1U94A 2FPMA 2IXGA 4HLDA 4AY2A 5AJYA 4LDJA 4LBVA 5H8WA 4W9MC 4MKFA 2ZITA 2CE7A 5AJZA 3RRMA 1OHHA 1XNJA 2FOLA 4B3CA 1RC8A 1KI2A 2IUSA 2IYXA 2BCGY 2QN6A 1T6NA 2MMCA 1S1CA 2VSOA 1NLFA 1W49A 2DBYA 3ICQB 1E0SA 1G8YA 1ZC4A 2H5EA 2A5YB 1ZD9A 2OZEA 4HAXA 5EXPA 1SXJA 2D06A 4MGYR 1RVDA 3BC1A 4I1VA 4LBYA 1XJQA 5K8TA 1R4AA 1OHHD 4IOJA 3AUYA 1QHHA 2P5SA 2HJVA 4QBIA 4C3ZA 4BASA 3AVPA 4L4UA 2FWRA 2QBYA
chains in the Genus database with same CATH superfamily
1SC1A 4RSMA 1Z16A 1I6WA 3ZJYA 4BDTA 1Q0GA 3RH0A 3RLIA 1PVDA 1WPRA 4UZSA 5GGYA 4D57A 3U7QB 1S9HA 1XPUA 2G8NA 4M2LA 1UFRA 3K3PA 3BM5A 1WDKA 3GARA 5D6NA 1BWQA 2AWNA 2NYUA 5IY5C 1VIVA 4UUBA 5LZ4A 4AF7A 2KE5A 3TD7A 1T4BA 1FFXA 1S2IA 3IXQA 5DYIA 3CCBA 3AKDA 1GL6A 1W2WA 2COKA 2XD4A 3GHHA 2I62A 1CSEE 1H8ED 3AX6A 4ZVQA 2ILVA 4U5DE 4QUBA 4QYXA 2IOYA 3VXKA 2ZSDA 3KZMA 2IHBA 4ARIA 1DOAA 4Q3KA 4K9SA 1LK5A 4L3VA 3REQA 5EJMA 1WMAA 4LYAA 1YUBA 5BQGA 3S68A 3WO1A 4NE9A 1OTHA 1SQSA 4B76A 1E2NA 3CGWA 5FH9A 4N7MA 2OV8A 4PINA 4RVCA 2X4DA 1XIVA 2QS9A 2YIVX 1XROA 1ISFA 5F4ZA 1QAMA 5C8VA 4BLTA 4AXXA 4F85A 3C16C 3RDPA 2R7MA 2A1DD 3DWWA 3BF8A 4DRIB 3B70A 5HTOA 1I01A 1E9CA 4BTLA 1J1UA 3O8RA 4ER6A 1H2YA 4LK3A 2AMLA 5LBTA 4KPFC 3G6WA 4NTFA 4PG4A 3VOBA 3WFJA 2XUJA 1R3DA 2I8LA 1VHDA 3FYTA 2O5CA 2A5GA 5CEEA 5DTMA 3FNHA 2GN4A 1XRRA 3FVTA 2GBPA 1DELA 1H5UA 3FWKA 2GPYA 1I7DA 2ZIWB 3T7AA 3A70A 1IB0A 3IHTA 2WNIA 2BFDA 5D3ZA 3NIFB 4IXNA 5CM8B 5JY6A 1V8ZA 4ISBA 3FW1A 3A3KA 5HKKD 5C3MA 4LJLA 4GOXA 1A4UA 1Z35A 1Z6QA 3C6QA 1J23A 2Z2KA 1T2NA 1QU2A 2QVZX 1U2EA 4CR6A 1A82A 4L6RA 1UJ4A 2AA3A 4ER7A 4GX5A 5D92A 3CUEF 3GA5A 1L4MA 3ABRB 3ZPXA 4P3OA 2O50A 3AH8A 1IIRA 2REQB 3KOWA 4F9GA 1KQFA 4BO6A 1L3BA 1Z4JA 4I6GA 4D4HA 3GLGB 4EW1A 1BWSA 3QW2A 4HSEA 2W4QA 1W0KA 2H2WA 4Y1RA 4MV4A 1NU9C 4MULA 1A50B 3RSZA 3WB9A 5A6BA 1QZUA 5C81A 3WAKA 2O5RA 3F8WA 3NBMA 2C4KA 3USES 1PV2A 1NQTA 5KTTA 3TZ6A 4EHHA 3IPAA 1BNCA 1TIKA 2X2PA 3CPHA 2AEJA 2AR9A 4V0QA 4I9GA 3UMKA 3BE8A 1RC0A 3NFYA 1KYZA 3NKVA 1WQ3A 2YBEA 5JZ9A 3Q7TA 4ENSA 2DLDA 4GNRA 2FZGA 2GZ2A 3GDWA 2CSUA 1I6KA 2AT1A 1Y0BA 4MUIA 3UWMA 3O7MA 2OBBA 1TO2E 4QNNA 3PNBA 2ZZNA 2JLAA 2WG1A 2ZYTX 3T3EA 1XCOA 5ECWA 4BRSA 1WDWB 1H6CA 4Y1EA 4FFLA 3C1TA 5KTOA 2HCRA 3EZ2A 5IFKA 3TDMA 1UBRS 4PS1A 3ETGA 1SBZA 1R0WA 1KBQA 3KJEA 1Q74A 3K8OE 1V11A 1T13A 1DJPA 3OIYA 1LNZA 3O2JA 2YL7A 2IZ0A 2WBLC 1CUVA 1FBTA 4GQHA 1UJCA 2IBMA 3QEBZ 2O54A 4F3TA 1E92A 3A6EA 5AK3A 2VNJA 3EBPA 3AERA 1SEVA 5CJPA 4B71A 1RWVA 1UQRA 5A5FA 1XELA 5SY9A 3BTOA 4ED9A 3D6MA 1WETA 1H4QA 1QWSA 1RABA 4EF6A 3L8GA 2P9BA 4FCWA 3BIWA 2QJWA 4K28A 3K05A 4C4XA 4QDKA 4QC2A 4ZC1A 2HYIC 1HW1A 4OA5A 4PFOA 4XVUA 2EPLX 2NUTA 4BN0A 2JARA 1W6RA 2RE8A 3HUDA 1C7ZA 3PR2B 1ZI6A 2UYHA 3LBFA 4JLSA 3L7DA 1VJ0A 1ZYUA 2J87A 4H7PA 4US2R 4NTZA 1QS0A 3KKKA 3ZV7A 3CJQA 1QRTA 1OD6A 4IWBA 1UXGA 5EC8A 3BFKA 4WBXC 4LZNA 2R8YA 4AUNA 3K0CA 5JCZA 2OFWA 2O1SA 1PT8A 2YASA 1HR0B 5JHHB 4ENUA 4NEQA 2QV7A 4QFMA 1VA5A 2VH5R 2CYBA 2DB3A 4AECA 5DNWA 4QELA 1W47A 4G0QA 1W52X 2MJLA 4LMBA 2QL9A 4P2GA 3GLTA 3AQIA 1XWWA 1PZEA 1X8XA 5ALHA 2QJOA 2VDWA 1OX4A 2JEZA 2JCXA 5DX1A 3KS9A 3H16A 4PZ0A 3GMSA 4BNVA 5BYAA 3QOXA 3PC8C 2W98A 1VPTA 4LBZA 3CQZA 3IXMA 1N2SA 3CF0A 2YVAA 5KWVA 3IV9A 2F3RA 1KJQA 1QHSA 3OJCA 1WE2A 3FDQA 1SMKA 4UOQA 4FYJA 4ZDJA 3Q4GA 3K8YA 2J0SA 4RAOA 2R1ZA 1L5YA 3CX6A 4C0SA 4TMXA 3TEMA 1PG5A 5KWIA 5E1BA 4EPXA 3BRQA 3DL4A 3W5IA 5E33A 3TOMA 2WNHA 4G24A 1ZRHA 3K5HA 1VMDA 2MINB 4HYYA 3RVJA 3NKLA 2PL5A 2GNPA 1AO0A 1GGJA 1Q0SA 4QDLA 4AZ3A 3OZVA 1C0EA 2FR0A 4X7RA 3TQHA 2UXCB 2QAGB 1JDTA 3ZQJA 1TB4A 4MI6A 5EK0A 4GQIA 3FMOB 1IM8A 2WWXA 5JAMA 2HUPA 2CHVA 3R7CA 1U3UA 4PHFA 2EFYA 4OXRA 4ETIA 4YJ2B 4UCXA 3PGLA 2R8EA 1MQ8B 4JYMA 4O7GA 2AMJA 1SPBS 2H9YA 3NHAA 3E22A 1XTBA 3HU1A 1G6KA 3FMSA 1ICIA 1XX6A 4I5EA 5BVHA 4H7DA 3V32A 1YDWA 2J9ZB 3WBKA 3FAJA 4BO9A 1BJTA 3OJOA 2NYRA 2OENG 2OOCA 1CIVA 5IKPA 3DBRA 4BBAA 1M8GA 2IXDA 3N2KA 1COWA 3A27A 3G23A 3D6HA 4F3YA 1SOVA 1MQSA 3SYTA 4YALA 4MP6A 4L4SA 4IL5A 3MCWA 4FI3C 1HMOA 4H3VA 3X1WA 3JQ9C 3L0SA 4YT8A 4WN9B 1ESZA 5DM1A 2R5FA 5AUQA 4RHYA 4Q6BA 1NWHA 4M8NE 3C1OA 5DNVA 4C0XA 3OETA 3ROPA 5FNZA 4ZHQA 4KKXB 2NP6A 4I1OA 3PQ5A 4QXAA 1BD4A 3PNQA 4PZLA 1QO9A 2FSIA 4BHTA 2Z5VA 1P3JA 3S2SA 1MJFA 1W19A 1ZW3A 5AKYA 4AMVA 1M2VB 4LQ4A 5DISB 4E5UA 2NO0A 2V97A 1X9IA 3LWDA 4AICA 2P6NA 4CEHB 4YRJA 2FRXA 3NDPA 3WAQA 3IIMA 1ZDMA 2PGIA 3QUSA 1IQ0A 2W6CX 1MT3A 4IZ6A 3T7RA 2C3OA 5CB8A 5LFAA 1UM9A 1TQGA 3BOSA 1WOLA 4TVSA 1KY4A 1ZVMA 1B15A 3QLTA 5DZSA 4NR0A 3FSGA 3L04A 5ICSA 3QI7A 4G36A 1SD1A 4J0CA 4YO8A 2NUBA 5K09A 2JFNA 2YUIA 4RMGA 3KB2A 3LU1A 2QRUA 5EIXA 3CN7A 3VSAA 1ODIA 3RF6A 1TW3A 2BGUA 3V55A 3RQGA 1RJGA 1LNQA 1TZKA 2JZNA 1JR3D 3JAWB 3AVTA 1NF2A 1U5AA 4C6HA 1E1DA 2O5VA 4Q9HA 2A1TS 3ANYB 1O95C 1D2AA 1YCHA 1LTKA 2XLOA 3WNBA 5BYJA 4GWGA 2D5RB 2QT9A 1I5EA 3SKXA 1VTMP 4MMYB 3PL5A 4J7TA 2Z2ZA 4EDFA 1NNEA 2V65A 1E98A 1NUQA 1GGQA 1Y82A 4H17A 1EGQA 3RS7A 1W5SA 2ZRHA 3D8BA 3MWDB 2R7QA 2W2PA 4FFBB 1AD2A 3AF6A 5K4AA 3GFVA 4D8WA 2J8ZA 4XQ0A 4O1IA 1WP4A 1YQQA 3IKMB 4RHEA 2XH8A 4L2IB 2ZYRA 5GIPE 4EARA 3SXZA 2QRHA 4DM7A 4BGDA 5K0FA 4QARA 3S3TA 2UUBB 3CX8A 4HUJA 1XTQA 2PCLA 4N6CA 3ZD8A 3LYAA 5CA0B 4TKVB 3VVBA 4D56A 4JL5A 1WB5A 4YAWA 4JMPA 1YA4A 2FFBA 2WTMA 3RV4A 3FN4A 4KR3A 2ZUWA 3HTXA 3QOWA 4JXXA 1KYQA 2E82A 4D9JA 5BWOA 4XFKA 3UJ7A 3O95A 3JVDA 4TTQA 1E2IA 4IKEA 1RMVA 4K2AA 1TKAA 3J7AC 3KE8A 3M0EA 1PTJA 4M1KA 5AOBA 4B3XA 4OG2A 2H5IA 3SFVA 2ZRGA 1AMOA 1V7ZA 1YJAA 3I6QA 3D7KA 1T5SA 2XMDA 3PPVA 3IALA 4MINA 4H7JA 3ZG6A 5PNTA 4XD7A 3I5MA 3PVCA 4UOEA 2PZJA 3VNBA 1E7QA 4O3MA 4N82A 3C3PA 3BL5A 4IGIA 4B74A 1A8HA 4Q12A 4RMJA 3QJYA 1YKFA 3S4YA 3R9WA 4LF7B 2CJXA 2ZYAA 3EGXB 2XX3A 1CRPA 3DMYA 2WU4A 5JSZA 1ZMOA 1VSBA 1RHJA 1MEEA 4N18A 3MPUA 5JDCC 3QE3A 2BKUA 1LK7A 3QVTA 3R7WA 4R16A 3SMVA 4OX9B 3O94A 2WKPA 3S2YA 4RORA 5JY1A 1R5BA 2ZXFA 1PV4A 3S0XA 2OLJA 5LKRA 1J33A 2B4QA 2C4TA 4ZALA 1YVIA 4YRKA 3V7YA 2O0HA 3IQEA 3EQ9A 3G6KA 4W6ZA 2WSBA 5BMVF 2CEKA 1ECBA 3GLVA 1M67A 4KXYA 2TRSB 1DPGA 3EVEA 4YR7A 1W5AA 2VJCA 3PUHA 5EA2A 1RHUA 4G0NA 2A5FA 1OGYA 1PR4A 4R41A 2KM1A 5TPZD 4N3GA 2ZYUX 4I55F 2FNAA 2ZW9A 4LJRA 5B3SC 4M9RA 4GOJA 2I71A 2UZ0A 4Q0MA 4C03A 4WNIA 1YQEA 2BP7A 5B6JA 1E6UA 4OQZA 4ZEOA 1IJKA 2EJTA 4ZJYA 5HOQA 3JYPA 2L2QA 3FLAA 4HWSA 3ZDEA 4J2OA 1Z0JA 5JPIA 4L0QA 4ENQA 3GQBB 3CLTD 3IAEA 2DHEA 3HC7A 4RPLA 3BL6A 3V6LA 3KQWA 1J8QA 5K05A 3OT4A 3HKDB 3HB0A 4DOMA 4OB6A 4ULWA 5DRTA 5JCJA 2HHHB 1P77A 3KEFA 2HSDA 2LCQA 4D1YA 4NKRA 1D1TA 4EHFA 3OTHA 4F3CA 1VGQA 3CMCO 3G85A 3TD2A 5FAKA 4DLXA 1A0BA 1LRLA 2A30A 4OQDA 2A58A 4Z3DA 3EY9A 4UXHA 3L40A 1BTOA 3I0ZA 1ID8A 1BEZA 3UJHA 4HFNA 4LGYA 5AH0A 2Y3HA 1HO3A 2HCTA 2AKEA 4IDFA 3O39A 1OPRA 1NFFA 3B3GA 3Q3IA 4XIJA 2HBYA 1NMEA 4KJZA 1YA8A 2XYHA 4DRJB 3RK0A 2Q21A 2IYAA 3KZCA 1NG9A 4CF4A 1YZCA 5DCUA 1S8OA 1M7HA 2V1UA 1T2EA 2B5WA 5E9AA 2VHTA 5JC1A 4EG8A 5KSPA 1YMQA 3ANTA 4PM4A 5KTNA 1B3RA 2OLEA 4QXMA 2ZRQA 4DUYB 2QLFA 2QX7A 4YJFB 5IAJA 3W5VA 1AOXA 3TNFA 2G40A 1G63A 4IDEA 5DTQA 2FG5A 2L82A 3K1TA 3UJBA 1ZK4A 3L6OO 2VJDA 2WB4A 4HJXA 1KNQA 3L0IB 4OVKA 4Z9AA 4DAEA 4RA6A 1Z9BA 2Q62A 2XXJA 421PA 4NFYA 2R6CA 1RKVA 3STVA 3U19A 4MYRA 2YZ2A 4GLOA 4YFVA 1CB7A 4EKNB 2J48A 4HDSB 4GPEA 1VLHA 4PAQA 1IB6A 3LT2A 3D3EA 3AGPA 1XD9A 2X6QA 3AR8A 2FUNB 4DSNA 4DXHA 4G6ZA 1AH2A 1UINA 4OL0A 2PL9A 2YYYA 3L4EA 1NC3A 1IVNA 1OBHA 5BOSB 4HQFA 4J4BA 2GZAA 3CV3A 1C3VA 5I7FA 1HTWA 4J6EA 1E2UA 3C43A 4CKBB 3B3FA 1Y7TA 1W75A 2J4FA 4D4NA 2Q8NA 1RI3A 1JV2B 2EHDA 4YRMA 3TM4A 1L7OA 4C0LA 3ENVA 2Q7XA 2VQDA 3K09A 4G84A 3A1CA 3EWNA 1W29A 4MKIA 4ITRC 5AT1A 1KETA 1NU6A 4AVYA 1GTL1 3FFWA 2QQ5A 1JFFB 4KPYA 1LF5A 3OTWA 2IEIA 4H7KA 3OFKA 2CNWA 4UUQA 5JVDB 3RNLA 3HBLA 4KR6A 4BFWA 1FW8A 1NVWQ 2B2CA 3UM9A 4W8HA 3O2SB 3BCHA 1QDEA 3M33A 2CBXA 1CBUA 1QRAA 2XODA 2QTMA 3C4JA 2CJWA 3DONA 3ONFA 2P5TB 3AEQB 3R7DA 3FX2A 1P0MA 3ZOKA 3EA0A 1CTQA 1X9GA 4PBRA 2VR1A 3K1IC 1IZYA 4GW3A 4PLFA 4KQEA 3ONWA 5B1SA 1S05A 1U2GC 5J2TB 3EY4A 4JZAA 1APCA 4Y6RA 1ESNA 4E5SA 2G3VA 1E96A 4XGQA 2GK4A 1P4GA 4EABA 3IQZA 3DZJA 1C4XA 4CTNA 3R0XA 1A9PA 2NQ8A 1AQJA 4JGBA 2ALJA 4C4AA 1J1ZA 2WD8A 1U1IA 2L42A 4URZR 3PT5A 2R6FA 1SBTA 3RK4A 1T1EA 4TL7A 1WY5A 2R8PA 4KNYA 1EWQA 5CA1F 3OH8A 3WJ7A 2Q5OA 2NSHA 1SIBE 3CUWA 2BFBB 3G59A 2IIPA 1NVEA 1X3LA 3I58A 1RFLA 3W2WA 5B3IA 4OEHA 2WA2A 1DTSA 2XA9A 2ZE6A 5K6AC 3O2NA 3QKUA 5TQ2B 5C8ZA 1YZAA 2HDWA 4WCVA 1A8PA 3GBSA 1ZD9A 2PBLA 4GI2A 4O63O 3W9SA 4X60A 1DIOB 1UWKA 2YHBA 1QGZA 4QRDA 3D2LA 3GRKA 2HQOA 3PUZA 4HMOA 1AZWA 4F5DA 4F46A 4JASB 3HR7A 1BJRE 1NPDA 5A9SA 4BTEA 1U6JA 1U8AA 2ZRDA 2ZR8A 3DEAA 2Z95A 2PJUA 2J09A 5K3FB 3K0FA 1JWBB 4KVFA 4D6PA 5D3QA 1DPFA 3G13A 3E7DA 1ZQ1A 4MWCA 3WGJA 3M81A 1KOFA 4TKUA 5LMNB 1PYOA 2RGCA 2ZTUA 4L75A 4ZQFA 4PYLA 4Y98A 4DN6A 2RGNC 3Q11A 3MK31 2ASVA 4Q9JA 3KOMA 3L0DA 1PSZA 5DBFA 4UU0A 5AVWA 1M6VB 1A77A 3DYBA 2AEMA 1T6UA 3O73A 4PNZA 3TLGA 4AJNA 4FD2A 2P9YA 2CCYA 1LC0A 3QVXA 3E5NA 1E1NA 3I76A 2MYSA 2ZTLA 4C4TA 3OAAD 1TYAE 3E7WA 3PHF2 5AR1A 5CR9A 1QV7A 3MHTA 5JMWA 1M6HA 2ANBA 1P2DA 1V0JA 5I01A 2YLGA 2ZI3A 1V2HE 1EWKA 5ES4B 3LX6A 1J2JA 2J3KA 3X2EA 1KQPA 4L4YA 1CDZA 2ZETA 1ENYA 3L6UA 3DKRA 3C3JA 4TM7A 4TV9A 1NXVA 3EDCA 2VDRB 4TQGA 4TSFA 1V95A 4UATA 3AI1A 5JBNA 1GO2A 2IVZA 1Y4AE 1SKYE 2F8SA 4M7WA 2XTNA 1NFRA 3OQ6A 2H4XA 2R9VA 5HJ7A 5B7QA 1Y3FE 3SLKA 3EXEA 1LKZA 3IOBA 1NGSA 4JCCA 1G0NA 2SHKA 1EFDN 4FN5A 2I2FA 4XQCA 1VKZA 1A69A 1P4RA 5DRYA 2WYIA 1DAOA 4EZEA 1O94C 3JY6A 4Q3EA 1MRSA 3K92A 1RC1A 1IXZA 1P8JA 1Z4QA 3UG7A 3LL7A 1OLSA 2JGNA 2SNIE 1L5LA 2JJ2D 2OQ2A 4OB7A 1G55A 2XLCA 5A06A 4FI3F 1FVOA 3HSSA 3T0FA 2Z6VA 2WSSD 4UVGA 1RXSA 3DD1A 3QU4A 1G5TA 2CBZA 5DCWA 1TT5B 1UBTS 3KO8A 3MRSA 4CEJA 3ZDFA 4ZYXA 3U3XA 1N7IA 1Y6FA 1Z6XA 3D6TB 1ZNWA 3T4EA 1CY1A 2GD2A 1VIYA 1T34A 2OJQA 4JLAA 3LAWA 5B7NA 4UJ5A 2UUOA 2OQRA 2IPXA 3IQ5A 2D4AA 2P9ZA 5LZ8A 1BRTA 2JLZA 3TR0A 4B47A 3QELB 1C14A 5JS1A 1JQDA 2E5WA 5I4IA 2QMQA 2ZBPA 1I1NA 1T1GA 3DHNA 4E5VA 2DUJA 3MS2A 4L78A 3L41A 2J08A 4M6WA 4TWRA 1FFSA 1DHRA 5AJVB 2AHRA 3H4TA 3VMFA 2KYRA 2W5UA 4RKRA 5KCMA 5ALEA 2EX4A 2QRKA 2EINC 2GETA 2NO1A 2Y1DA 5E6RB 2AVKA 3KD3A 3W2FA 2PJRA 2PXXA 2WABA 4MVJM 3PNKA 4KPEC 2HMQA 5CYFA 4ZYZA 1VM6A 1GFSA 3UH0A 5CBKA 2FOIA 4XWOA 1ULUA 3BMOA 3LO8A 4EUKB 3PWSA 2E4YA 5D3MA 2IDKA 3ABSB 4MKZA 1QFZA 5KYUB 4OJMX 2YL3A 4LMPA 2SCUB 3D8UA 1DO0A 4FEGA 3A4IA 5IWAB 3OECA 3T5GA 3SY8A 1N92A 4GR4A 4FJ1A 2G8LA 5FF9A 3KC2A 1NUPA 4Z9IA 3WODF 4CQMB 4MEJA 1XEWX 3KLMX 1RLMA 5M7EA 3KKQA 1CDOA 2QVYX 3MTIA 4BLPA 3V4PB 5KHAA 5DULA 4LXTA 5D8DA 3DOCA 2O4CA 3GBVA 1G17A 2IXTA 2HBRA 4R0NA 2ATCA 3DGFC 3H5TA 4OQNA 4Q48A 1GZ4A 2GX6A 1GEGA 2FGJA 3DJNB 5KX5B 4I9HA 5FYDA 3H65A 1JRLA 3T95A 2ZXOA 1K92A 1G4UR 4WGGA 2DQKA 3T38A 4D4LA 4P9FA 3WWYA 4Y9UA 3D6NB 3K71B 1VB3A 2R7LA 4FNGA 4N06A 3N8DA 2ZS8A 3JX9A 4A8JB 5EHXA 1XPJA 2G4VA 2OCIA 2O23A 1PK8A 4J0DA 1NW5A 1W36B 4IX1A 1V4NA 4NNOA 3CRQA 3FWNA 3R3JA 1G20B 2OCPA 3SZ3A 3EJNA 1C30A 3REGA 3ZUPA 5EWLA 3K6SA 1TWGA 2ZXRA 4B6PA 2AQHA 1VXOA 3K16A 3U3RA 1WCIA 5E4FA 2PKQO 4G4GA 3JATB 2R6GA 1Y5MA 3OCXA 3FCSB 4DQLA 3VPCA 3IJ5A 3ZJTA 3ZWNA 1AUPA 5ERYA 5T6MA 4UQLA 1EFUA 2LK4A 2WT9A 3IR6A 2HX1A 3GJ6A 2RGWA 1CR2A 5C7OO 4TV8B 1SZIA 2WOJA 4DY4A 3F9CA 2ID7A 1IWBB 5JNRA 3FTPA 2EPOA 2VNKA 3ERCA 4F2HA 2JKVA 1OROA 4HB3A 2DJIA 4BQQA 4RVNA 2UDPA 3EH2A 2AQIA 5IG2A 2XM0A 4E31A 1YB6A 4C2BA 3GLIB 5FI5A 5JRJA 2C84A 3M83A 2QROA 1V9CA 1XEXA 4I2VA 2HMWA 1ZRMA 1TJ3A 3AK4A 3ECAA 2EJBA 5FPSA 2G7ZA 5WRFA 5AM3A 1VTKA 1QYCA 1SK8A 1KI6B 2ZUFA 3S5UA 3X2QC 2NO4A 5F64A 2JLQA 2HU2A 3UMJA 5KYXB 1CY2A 4KQXA 1CS4C 1HEIA 1ZK1A 3BB3A 4JH0A 4LJ4A 3K9HA 4MW7A 1JKJA 13PKA 1HRKA 4PYRA 256BA 1UPBA 4B3JA 3DOJA 1LPNA 1K2VN 2VDMB 4LUCA 4E4TA 1AS2A 3BYZA 3QXXA 4QQRA 3DC7A 2QD2A 5IWCA 2D0PB 4X20B 1SOUA 4DIKA 5HYVA 3HV2A 5KOHA 1K6IA 4RMHA 2OESA 5DE3A 2J3QA 2G72A 2OUKA 3P9YA 4AE4B 2VKQA 1Z06A 4RDXA 2K2WA 2VWPA 1SRRA 1N0HA 4PHHA 1T01A 1KSGA 5GOTA 4G23A 3ZDAA 2RGGA 4DV6B 2Q5IA 3DM5A 5CFPA 4ABYA 3CM0A 3RTGA 1PLLA 2H7OA 3VKUA 3FOCA 4K0RA 5EI5A 2QTVB 1L3IA 4OBEA 1X15A 1RLIA 2YOFA 4CDYA 5CG2A 2IQIA 4Z9HA 4D8VA 1WSWA 1MDFA 4OP2A 5K0SA 2YS7A 5I6DA 1Y6GA 2OV4A 3KUDA 1E4EB 2CLDX 1U0NA 2C2KA 2X5KO 1E60A 4O2BB 5DIZA 4JLUA 1TEHA 3K0AA 2BGGA 2PMCA 3T12A 5AHRA 2XUQA 2PA3A 1RIFA 1EP3B 2BRUC 3KKMA 5LXTB 2FLVA 1ID1A 3QG5A 1H2AS 1SKQA 4CS8A 1RD4A 3L6CA 3ESZA 3UK1A 4AMZA 1NATA 4KCGA 1PJ2A 4H6PA 3V1UA 2WNSA 4PEVA 2CZCA 4LLCA 4JOQA 2G5PA 1EFVB 2EP8A 3F4LA 2Y05A 4KI0A 4IP0A 3LG2A 2AGVA 4HE8D 2I4RA 2Y6VA 4EL0A 4IDOA 5HNKA 3IE0A 3AVQA 4PLZA 2VHUA 3EG9A 2PK3A 4UU8A 4DCOA 3HBJA 1HTTA 1E1CA 2W9YA 2UAGA 1ZRSA 4FGUA 4AS2A 3OLCX 3AQCA 1UOQA 4QOFA 1DZ3A 4GKKB 2D5IA 1HY5A 1YI0A 4X45A 2VB6A 1VPLA 4D3ZA 3EE6A 4EB8A 5CIWA 2XRZA 2QW1A 2BFOA 4XJVA 3U44B 4C3EA 4V0SA 4CIDA 4L7VA 3UMSA 1FFTC 2OCGA 1OAAA 1I2MA 4OI1A 4IJJA 1U02A 5DWDA 3ZD6A 2ACKA 2VJAA 3DP9A 1TZJA 3BD8A 3DFKA 3HLZA 5K5EA 4ZZ2A 1RLJA 4DBVO 5KUTA 1JG2A 5J4HA 1THTA 2R7NA 3C7JA 2NZWA 3V00A 3E9VA 4AJLA 4XDZA 2XRYA 1C3OB 4HTAA 4JD5A 5MGBA 3QVKA 4LISA 3RT1A 4RTQA 1HMPA 1AZSC 1EVJA 3T1YB 4HDOB 3HKCA 4MWBA 4JB8A 3BCSA 4F6CA 1XFDA 2HMUA 3MBIA 1KZ4A 4A0RA 2Z56A 3WK4A 4H2DA 5KMGA 4Q19A 3LK6A 1EFCA 5FAXA 3EC7A 3FZNA 3CLRC 1XDDA 2HLDD 2CLHB 2XYGA 4YRSA 1Z0FA 4I1UA 1HT1E 3PQEA 1FB5A 3A6FA 3H8WA 5I8WA 1M66A 4G9EA 4S0XA 3ZDRA 4EY7A 3AUFA 3TECE 1AVOB 4H77A 2X4GA 2R7XA 3TMYA 2IPNA 2FZLA 4YMVA 1WN0A 1M2OB 3W06A 2FI1A 1EA5A 3HR8A 4YJGA 1SVUA 2AOTB 4O4HF 3HA7A 2WTUA 3BERA 2XLDA 3TVYA 3LQ4A 4BB5A 4EI8A 4EYSA 3BN3A 2GXSA 2X1HA 3WP1B 3B8EA 4OFWA 3T7SA 3S8YA 1AT1A 4Z4EA 3AI7A 1PWHA 4C21A 1NFOA 4G3XA 3ZBQA 4AZTA 5EJIA 3E2MA 2FMIA 3RYIB 1NNLA 2OY0A 4Q18A 1FC0A 4GI3A 2J6HA 3HDVA 1Q7EA 3ZDBA 3MCZA 3B3QA 3KAKA 3B12A 4D3XA 2H9IA 4TTRA 4GO1A 5F7JA 4BJ6A 1PJ3A 2G4CA 4CT4B 1R6VA 4U5HA 4MS1A 1IXRC 2JX0A 1Z5VA 4I1IA 3M7IA 4G2NA 1ZI9A 3VZDA 3REFA 4U5XA 3FGPA 2V26A 1U2RA 2C8LA 4LBWA 3T15A 4X85A 3NCTA 4TYYA 2GS9A 1W4CA 4OHZA 3M4XA 5A3RA 3CNLA 4D3DA 2VYNA 2CXNA 1OFVA 3F9IA 4TYNA 2YN4A 4UUAA 1MKYA 4B31A 3C3EA 1A9QA 1U7UA 1SUFA 1Y4ZA 4UNQA 3BBPA 4B0OA 3GNSA 3BGWA 2G71A 3IQXA 2XTMA 3HJFA 1TTTA 3W6ZA 2DFVA 2XUHA 5CB0A 4I1RA 4DCCA 2J9FB 2OGSA 3E23A 2QSYA 4C7BA 4EHKA 4MGIR 4I50A 4RVGA 2ERCA 3FUUA 1H6BA 3W1VA 2HRBA 4NRDA 1EM8B 4JJ7A 3AVWA 4YL0A 1MU0A 3EBOA 1Y1TA 3D8SA 4QO8A 4OO3A 2PLRA 1XU9A 5L0IA 1VLJA 2DPHA 5G4KA 5IN5A 3E9MA 1K4YA 1SXJB 2Q4RA 4YUYA 1L4KA 4NZNA 4JLMA 3FPEA 4KQ9A 2OFFA 4UHHA 1PHRA 4ZGGA 4XWGA 2JCSA 4R68A 5TIIA 5AW7A 4C0AC 2JJQA 4FHGA 3IAM1 3AEKA 3E8MA 1FSPA 4PN7A 2XR1A 4QAQA 4AJPA 2CW0F 4WKGA 2ZT8A 2FETA 1E9SA 1LSJA 1QHIA 3LX8A 1E6LA 3HLTA 3FBWA 2H7VC 4XZ3A 3NTLA 3WA7A 1HSOA 1M5RA 2OC9A 1PR2A 2EKQA 2J4CA 1KEPA 2QI9C 1JYEA 3IHUA 2ZAOA 4C7MA 3KHSA 5F4BA 2EFGA 4YWHA 2F4VB 1V45E 2YWBA 4LDAA 2HI0A 1KFBB 5GTDA 1YJGA 4S12A 2GPBA 2REXB 1D2HA 4XGKA 2QN9A 4IS3A 2CBGA 1E5VA 4BX3A 2AFIA 3HYLA 3EIWA 1IN5A 2RHTA 2FWMX 4H1HA 2H9AA 1JDBB 3D6FA 3QTTA 5EWMB 1UODA 4R5HA 2PMWB 3PD7A 1KC1A 4D25A 2O1EA 4HLUC 4QPJC 3PHHA 1PGPA 1GUAA 4YI3A 4OUKX 1G4WR 4DT1A 3Q7EA 1V16B 4XB1A 3GFOA 3GWGA 2D1RA 3DD5A 2VCAA 2ZANA 2YL0A 2ZUTA 3RADC 4AYTA 1Z8FA 2JFZA 5A0VA 4WX2B 1I2BA 4CGZA 4HR7A 1RZVA 2C0QA 2WIAA 2LFDA 1ZIOA 5LQCA 4A3SA 1T4CB 2GBCA 1S8NA 1WATA 1E1RD 3D5TA 2WVGA 1C7FA 4PLCA 2YXEA 4FOPA 5AXAA 4G78A 1LBQA 1M33A 4O4JB 3ZWCA 4H3HB 4INOA 3C7KA 3RIHA 1HM5A 4TRJA 2ZM5A 1GQOA 4FNMA 4I19A 3HCWA 4O8CA 3FD8A 3I2KA 1GT6A 1FFBA 1XCPA 1T0PA 5CXXA 4PBTA 1BN6A 4URUR 3Q2IA 3FWZA 3T4UA 4BMDA 2WAMA 4Y2VA 5DXAA 2WINI 5BNZA 4W7SA 3WGGA 5JNVA 2IIVA 4HPXB 2KMLA 1ZJ6A 5D2CA 4QLOA 2FSPA 2PT9A 3EQ7A 4TMKA 1XZQA 3JYQA 1XDBA 3IESA 2O4UX 4B84A 4N01A 2WFLB 4JU9A 2NO9A 4G01B 1E6KA 2C7VA 4O2RA 4HAIA 3X44A 3IQGX 1SG0A 3IAS6 3KTAB 4K87A 5HVNA 1CUAA 1OWLA 3AY7A 1CD5A 3GUCA 4HDKB 1MLDA 2M32A 4L8GA 4EW2A 3U1VA 1XRPA 1V8FA 3FUWA 1M7BA 1YQTA 2Y9PB 3K6RA 2A9RA 4MI1A 1WQ4A 4DG9A 3RBAA 3T6GB 2OGZA 2FPOA 4KH1A 1T8PA 3I9KA 3JZIA 1EE2A 3B48A 2PCJA 2HMVA 1YCFA 4AKEA 3VAZA 4R51A 1T4GA 1C3JA 2FPMA 2IXGA 1OXBB 3FVVA 3V1LA 1Z5NA 4EI7A 1RKEB 5CFQA 1M1NA 5HBRA 1MVNA 1GCAA 2H5EA 4F6LA 3WK5A 1RVDA 1GZ7A 4LBYA 3RD5A 1QHHA 1WB4A 3CR3C 3EMKA 2IV2X 4NESA 3WHKA 4KO3S 2XUPA 4AJEA 3R8FA 5FA5A 3WLAA 2M2IA 1J90A 2V3VA 2ZI6A 3NOVA 2FMKA 2OHXA 1LLCA 1VHTA 2WZLA 4DWOA 3QEKA 3DEIA 1YJBA 1FLNA 3E8SA 4NBUA 2XE7A 4IMJB 3U31A 3M6LA 1L5VA 2JIZA 4RDAA 2YY7A 1SZJG 1KDRA 3JASB 3IIKA 4NYJR 1DDIA 4Z2YA 4HS4A 4Q3DA 3ORQA 2ENUA 5GV7A 4XPWA 4NV1A 1EFPB 2Z5LA 4UFNA 4QBTA 4OJYA 4CQNA 3EXHA 1HA3A 3KB8A 1NXOA 3T7KA 3H1AA 2SICE 4YECA 3VR6D 3E6AA 3FNRA 1X1TA 5FBVB 1LLFA 4UZFA 3WK6A 5B2EA 2ZJZA 3K1AB 1ECGA 3LJKA 5HCUA 4D8UA 5F35A 3CUUA 1Y4CA 1DE0A 3M15A 1RWXA 3QNWA 4I4LA 3KEQA 1YAUO 1TYBE 3PNYA 2YMQA 3BL8A 2C54A 5FOTA 5I7RA 3QVOA 5T3UA 4N5IX 2QU8A 2D2XA 4BFVA 4CCYB 1UBCA 1L8XA 3MJ4A 5JSHA 4DIFA 4DDUA 1VP3A 1NBAA 3ZK9A 1KE1A 2WV7A 4QUHA 3TW0A 4CN8A 3TQFA 3I53A 5C4MA 1CUWA 2VTDA 4MI9A 1ZXXA 5KYWB 1PVVA 2AE1A 3MRTA 1SUPA 3OZFA 2V59A 3NMUF 5IEJA 3LQRA 1VG8A 1I14A 4IX9A 4FU0A 1YJQA 1JG7A 1N6HA 4RVFA 2YJ4A 2PRYA 5B7GA 3RVSA 4UTNA 4N47A 2PWAA 1PI3A 4C3DA 2PS1A 5CCDA 1Z25A 3GUHA 5EKSA 1I5OA 1P29A 2OWEA 5AOAA 3OC6A 4MNTA 1QGYA 1QRDA 2F62A 2H4FA 5JAHA 3DZBA 2OP0A 2BONA 3MQ4A 1MXFA 2OHVA 5ILGA 4IIDA 2QRNA 2MYNA 3OZCA 3DO8A 3PHLA 1QH1B 3ZQVA 3GRRA 2D1QA 2ZM6B 2I7VA 1DFGA 4PVCA 5HF6A 3SJ7A 2R25A 4AX8A 5CCXA 1MJGM 4E03A 3QTBA 9ABPA 1AY0A 3FBTA 2A33A 1FPQA 3A6LA 2GWHA 5THXA 3EWIA 1LLQA 3BMXA 2X86A 2IWRA 4HGZA 3VJKA 1JG4A 4JYAB 2H63A 4FYKA 3A4VA 1CETA 5KSOA 3AVYA 3RQEA 4HWPA 3HV0A 1PEYA 3EFHA 3KAQA 4CMAA 1WXDA 4B45A 1GAXA 4B43A 2BUBA 2QN8A 1VPVA 2H4JA 2MSCB 2OGUA 3TZHA 4O1MA 1KO7A 5KNBA 2A84A 3I04M 4ZTZB 3KV1A 5CITA 4RQUA 3IBFA 2B0CA 3BB4A 4JV5B 3WV4A 1I94B 3B0UX 2Q9BA 1Q0RA 4W1SA 1YIDA 3QY0A 4WLFA 5EMLA 1GPJA 3QOFA 3SHWA 4HFMA 4OKIA 4WA7A 1BXRA 1FR0A 1AN9A 4PX2A 3T5CA 1JIUA 5CNKA 4J0IA 1A7VA 1FE8A 4H0CA 2L18A 2IS1A 5EZYB 1RZUA 5EJFA 3ZWMA 1RPAA 2JC3A 1OFUX 1D07A 2PM8A 4YJ2F 5BURA 3W8FA 2GPJA 5M2QA 4WLOA 2VASA 4Q4HB 4IINA 2P91A 4PWYA 1U2DA 3EHNA 2VZLA 3NEYA 4LCBA 1PQWA 1O9HA 3QQPA 4UCFA 2P2DA 2QR5A 2FMHA 4B0PA 2CVHA 4LGMA 3UHAA 2BM8A 1P0QA 2FPPB 5DS4A 3UB4A 3DE7X 3BJZA 3JZ0A 3TR5A 1B14A 4WLNA 3RWMB 2BM9A 4EYOA 5JU6A 4QAJA 4BXOB 1DAHA 1ZD3A 3G2JA 1QGAA 1E0JA 3EC1A