3U0CA

Crystal structure of n-terminal region of type iii secretion first translocator ipab (residues 74-224)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
151
structure length
151
Chain Sequence
NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasin ipaB
publication title The Structures of Coiled-Coil Domains from Type III Secretion System Translocators Reveal Homology to Pore-Forming Toxins.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Cell invasion
total genus 72
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3u0cA00
3BRJA 1K40A 2PBEA 5F28E 1WOLA 1V4AA 3C8GA 1KTMA 1WWPA 4XEKA 3AJMA 1UFBA 2LK4A 4XEVA 3TULA 3RQFA 1KNYA 3GM3A 1PV3A 3K7DA 3MFNA 1O3UA 3C8GB 2JPUA 4XEFA 2YWAA 1OW8A 3S9OA 2JX0A 2L6HA 2KK1A 3C8GD 1OW7A 2L6GA 1JOGA 1K04A 3U0CA 3JYYA 2HSBA 4NQFA 2L6FA 3L8JA 3O10A 3C18A 1ZZPA 2Q00A 3L8IA 4EBKA 3RQGA 4R32A 1QVXA 3U3FA 3GM2A 3GM1A 3RQEA 1K05A 1WTYA 3JZ0A 3B71A 4EBJA 1OW6A
chains in the Genus database with same CATH superfamily
2RSEB 5L0JA 2PP4A 3M4CA 1YVIA 1FFTC 2KNHA 1HE9A 2LP4A 4Q5SF 2IYLD 3IQCA 1U6HA 5COGA 3CZ6A 4QI0A 4ER9A 1PD0A 3R2PA 1CGME 2R7VA 1N1CA 4IRUA 3IQ5A 2HUJA 2Q9AA 4OD4A 1NZEA 3VRCA 5JT4A 4ULWA 1EA8A 1PD1A 4JJGA 1SZIA 1ST6A 3CSKA 2Y69C 4MTGA 1VB5A 4MVRA 4LLCA 2XLWA 3X2QC 4MW3A 5L0IA 3US6A 5A6BA 3LNRA 2OEVA 1V54C 3NKDA 1A7DA 1MMGA 2P1AA 3RF3A 3JRTA 1FAPB 3AQCA 3FOPA 4J7YA 3HLZA 3QZCA 4MVZA 3TOMA 4CDAA 4EWCA 4YWQA 1NFNA 2A68F 4YL0A 4ZLCA 5HV9A 3PDMP 4U9DA 3LUTB 3U9MA 3N24A 1XZQA 1V4AA 1TR2A 3AJMA 3HNIA 3EG9B 4XEVA 1G5ZA 3K66A 3NYMA 2J0WA 1LM3B 2R9RB 2A0UA 4G78A 2Y3DA 1NU7D 4XTKA 3DKAA 4U9EA 2J9WA 2NUTA 3POVA 1JAFA 1ZVZA 3ASOC 3UMHA 2V3CC 4DRHB 3ZC4A 4C3EA 2G3KA 4EKWA 3GORA 1ZW2A 2EPMX 2W9YA 4KNVA 4Q4ZF 1UG7A 1FMWA 1E2XA 2R7OA 3T9OA 4CIPA 3IQTA 1WTYA 5FCLA 3ZDLA 5KYWA 4EBJA 1LI5A 3NRHA 3DZAA 4N06A 4G7ZF 3ZQVA 2HV6A 2IXPA 4NTAA 1QKRA 3E9VA 4JCHA 3SZRA 1YYXA 2JD3A 4PJMA 3LS1A 2ZD9A 5DQTA 1FTSA 2XXAA 2LSEA 1VLSA 1I5NA 1DOVA 4PR9A 1ZHYA 2WL8A 3ZG1A 2DI3A 2E87A 3AG3C 2Y39A 2KK1A 3GANA 1R4TA 1KU2A 4X0RA 5AGFA 3VF0A 4CS9A 5TJ5E 5JVEA 1MNEA 2CGEA 1OCZC 3KKBA 2NUTB 2YL0A 3HNJA 3FAPB 4N4WA 4YN0B 3V5XA 2Q9CA 1LKXA 1CPRA 4C3DA 1YLMA 5BUOA 4OIRF 2VASA 2R7QA 5COFA 3SYNA 1VTMP 4DVYP 4GEHA 3BEHA 1XWJA 4C7OA 2YLIA 2DB4A 1WGWA 3M4BA 2YVKA 2J7PA 3SP1A 4GQHA 4E7SA 1V55C 1ZW3A 2LK4A 2NPUA 3C7JA 3EPVA 2AWCA 1M57C 2OQMA 5KYWB 3KYJA 5BQHA 1TWAA 2VCAA 4BJ6A 4JTAB 2AP3A 4LLEA 4D4XA 3EHNA 5KYYA 1Z3IX 2YLDA 1BR4A 1L3PA 3EZIA 3UR3C 5F5FA 3V5YA 2HMQA 1QLEC 2L6GA 3EZHA 4HFFB 4K0DA 2HSBA 4OD5A 2CYDA 4WGYA 5F5HA 1YZAA 4DRJB 2R7TA 5L0FA 1GGQA 2DYSC 1D0ZA 4E7ZA 2XLVA 2H7VC 4PFOA 4RDAA 3JSEO 2XL4A 3ZSUA 2GA0A 4LDKA 4MVSA 4AX2A 1ZYRF 2CW0F 3B71A 3ECSA 3JRMO 1OW6A 2L6HA 3QW1A 3A11A 4JW1A 2P7VA 3S29A 4O6MA 2HMZA 4NTFA 4XLPF 2AWYA 1Q0KA 3DE8A 1JRAA 5COMA 1T6UA 1S7ZA 2KYHA 1OKKD 3W8HA 3S0XA 2IM8A 1U0BB 4G7OF 4C7OB 1Q0FA 2QUPA 3C8ZA 3HJCA 2ZXOA 3O39A 1O3UA 2L81A 2JPUA 1ZHZA 2XS8A 3EJNA 2R25A 5BQGA 3T6JA 4A2NB 2R7XA 1I4YA 3S9OA 2DGJA 2H8AA 5KYNA 3S84A 3KH2A 3ZTMA 2GFHA 1Z6AA 2J9BA 1RKEA 3JYYA 4J32B 2A1DD 1WN0A 2YQYA 4DXWA 2WVQA 1AUEA 2Q00A 3K1IC 4H54A 1I4ZA 5KYYB 4QI2A 4O6YA 4U5EE 4U5BE 1JMWA 1U89A 3EGDA 4JCZA 1NLXA 3EG9A 5AC5A 1W2WA 4P9TA 2NUPA 1LVKA 3EH1A 2D4UA 4C3BA 4BJ5A 4XEKA 3G50A 3CQZA 1WATA 3FOOA 4IWBA 4O6NA 5E2QA 1TFKB 3S27A 3QTHA 2WZGA 5B3SC 1D1AA 2P0NA 1SF8A 3HKKA 4P6IC 3KMIA 3H65A 1GS9A 5IY5C 3RYLA 2A69F 3AGTA 1O5HA 2NSFA 2EPLX 3N0TA 4XLNF 4KI2A 4FESA 4HEAJ 2R7WA 3K1HA 1NBBA 3KL4A 4CJOA 3NKEA 3TD7A 1VYIA 4LERA 4I44A 4WABA 5AC4A 3C18A 4B6IA 4HFKB 5KYUA 1V74B 3GM2A 3ZTZA 1T9KA 2R7SA 1K05A 1RXQA 4FWVA 3VYWA 2XXAB 2IXOA 1RKEB 2R02A 1VLTA 3GODA 3I5QA 1G8XA 3JZ0A 1A0BA 4MTFA 3B9QA 1ORJA 4PJJA 4XPWA 4MQ9F 1FNTc 2OU6A 1K40A 2NG1A 4WGZA 5E3CA 1KTMA 5DS6A 3EGDB 3I4UA 5K0IA 3B0UX 2O9XA 4IJJA 2GWWA 2NUPB 4AL0A 4YL1A 1C02A 3IEEA 4CS7A 3DE9A 2YEVA 4KBLA 3L0IA 4YL3A 3RVZA 1CGOA 4CDYA 3AG1C 1TQGA 3IPMO 3C8GD 1L7CA 3WG7C 5B1BC 4DVZA 2FFHA 5CI8A 3MYIA 2WZLA 5HSWA 3JTLO 3SXZA 1OR2A 1A41A 3AQBA 1ZHWA 2OEXA 4AE4B 2PX3A 3NG1A 3OA1A 1J8YF 2WZFA 3U9JA 3PMRA 4PFPA 1A7VA 1SYQA 2RD9A 4CBEA 2DYRC 2LQGA 1M2VA 2YKZA 3SXYA 3ZIBA 5L0CA 3QVZA 2ETSA 1QSPA 2EINC 2QNLA 2H7OA 2PBEA 5F28E 3FXHA 2VC9A 1BZ4A 1VYKA 3HNKA 5L3VA 5KYUB 3DM5A 4DBRA 4E0HA 1YA9A 1HY5A 4BEJA 2L7AA 3SXKA 5BQIA 5A69A 4BPMA 3DI5A 1RKCA 1TWGA 2W4BA 3K7DA 3M1CB 3FDQA 3FAJA 3QVYA 3UGOA 3MX3A 1APCA 4YJWA 1E84A 4P9FA 2IBFA 4DRIB 2XSEA 3U3BA 2A6HF 2B0JA 2H7BA 4I3MA 1BR1A 1OW7A 4I1MA 3RFYA 3FVYA 4JURI 2PX0A 4EIYA 1MMDA 3B29A 2IXNA 3RIPA 3W2WA 1C17M 5DLJA 4CDVA 5GPGB 1Z63A 2UUHA 2Q4FA 2OCCC 4YT4A 2EPKX 1NG1A 256BA 1JR8A 3LS0A 3IHUA 4NTBA 3H2VA 5DVWA 3NMIA 3EGXA 2I8BA 1T6QA 1YARO 2BL2A 2X51A 3UMKA 3ZQYA 1CGNA 2J8WA 4IB4A 1ZHTA 2EPNA 2J46A 4O7GA 1D1BA 1M2VB 2YL1A 4IAOA 1GM5A 2XM4A 1OXKA 2VCBA 1BDJB 2XS1A 4FAPB 3MYFA 4CJGA 4F4BA 2P6VA 3B0PA 4YT8A 1Z7Qc 2IOQA 3DAFA 4NCQA 3AG4C 1HMDA 2J45A 1T01A 3RQGA 3FHDA 1VMAA 3TJ5A 3WAQA 3Q7LA 1TKNA 2Q9BA 2Y3HA 2VH3A 3WODF 1IZMA 1H9GA 3UNGC 1YA7O 4YT2A 2WVOA 1FFHA 3ATPA 1VK5A 5FZTA 3MBGA 1HE1A 2VCCA 3LLIA 3TQOA 2C04A 5E33A 1M56C 2Z15A 2MYSA 3L34A 4NC3A 1UFBA 5A6KA 3M15A 3IQ6A 1JPJA 1EI7A 3CEXA 4LDRA 4M63A 4MVUA 3RQFA 2CNWA 5JSLA 1M2OA 2J9UA 2ASRA 3EGXB 4YT5A 3W8IA 1ZU4A 3LAYA 2LFFA 2KQ9A 3K6BA 1RJ9A 4K7BA 4WJ0A 4ZLDA 3EFOB 2W4MA 4JE9A 4OIQF 2EIMC 3UMIA 4IAQA 1Q0GA 4AL1A 3LJBA 3M79A 5T3WA 3W4YA 3I5PA 5A6JA 1XZPA 4R32A 1ZHXA 3H2UA 3U8VA 3G4ZA 3GM1A 1HW1A 5B1AC 3TJ6A 1OCOC 1D1CA 4RD9A 3DD7A 5D92A 2XL8A 4K1OA 3WHNA 2LD6A 2LFDA 2Q3TA 3EQLF 2Y3BA 3RVYA 3U2LA 3PHF2 5E3AA 2Q7RA 5A6BD 1WOLA 4MVMA 3JCUQ 4CSAA 5L3QA 3Q6MA 4U5FE 3RH3A 3VAYA 3F46A 2AVKA 2P61A 2IXMA 2UUIA 4FX5A 4BG0A 3TULA 2R7UA 1G4US 4CS8A 2ICWG 2XLEA 2V26A 3ITFA 4JJFA 4QDLA 2CCYA 1YJGA 3DAGA 4ANJA 4XQ1A 1VOMA 2JX0A 4JIOA 1ZU5A 4AE4A 3LLKA 1YDIA 4ONSA 4PACA 5CI9A 2B0HA 3T4RA 4EBBA 1K04A 1CPQA 1T5OA 3K1IA 1BR2A 4JKVA 2PF4E 2ZXRA 4MVQA 2HJ3A 2I15A 1RJ9B 1OKKA 1QVXA 2OG2A 3DWWA 3U3FA 3EHMA 3JYHA 4H4KC 2C03A 1RMVA 3A9CA 3UGPA 3ASNC 3C63A 3LEOA 3DMDA 2Y3GA 1TFOB 3DXJF 2J9VA 3GEHA 4A4AA 5JUAA 4JRZA 1Z5ZA 4PJLA 4BJTA 3KYIA 1LE2A 1MMAA 3JSZA 3V7OA 4N6CA 1G4WR 1KNYA 3GM3A 1PV3A 3U5SA 1SMYF 4UDVA 2M4EA 2GAQA 3GWLA 2BC5A 1MNDA 2PFDA 4XEFA 1H9TA 3U2MA 4MW8A 2OJQA 4U5GA 2YL3A 3TK0A 3LEVA 1OCRC 3MLGA 5L0HA 3KPHA 3GWNA 2XRHA 1QQ3A 3O10A 1ZZPA 3L8IA 3LNMB 4EBKA 3NMKA 4YK5A 2YL7A 3RQEA 1FR0A 1H7IA 3T6BA 5CIVA 5JRAA 4DBQA 2QTVA 2QY9A 1F1MA 3FMSA 3S90A 3F47A 2NSGA 3J06A 3SXMA 1B68A 4L6RA 5JP7A 3Q7GA 4IARA 4PJNA 2LIGA 4XPXA 2AU5A 1MMNA 1PCXA 2EIKC 1JPNA 2KGOA 2YLGA 2HSQA 1D0YA 4E17A 4BEMJ 4I1OB 4MNDA 1T6IA 1FMVA 1OW8A 4XWJA 2HFIA 2J7PD 3T6GB 3ABMC 3VM6A 2M64A 2WB7A 4KNWA 3SNHA 4LDQA 4JZAA 4Z9JA 1JOGA 5L0GA 4AK9A 4Q7CA 4JVSA 3U0CA 2MWQA 4N6HA 3NDBB 1EKYA 1LIHA 4GYTA 3TOLA 5T3TA 2XL6A 4CS9C 2OKUA 3ABKC 3NYLA 5D91A 1QZXA 1NU9C 2YRFA 2L9JA 3OEOA 2HJMA 4MTOA 2D5RB 1ORYA 1MQVA 3S28A 2KC3A 2CDQA 2XLOA 1OCCC 3C62A 1D0XA 3C8GA 1M6TA 3E70C 2HKVA 1YZCA 4OINF 2X0CA 5DQZA 1HW2A 2G62A 4JEAA 3EFOA 5KYXA 1YAUO 4JTCB 4Z9IA 5DS5A 3DJUB 1DOWA 2BE5F 4CX9A 1OR3A 2YWAA 1IW7F 2ZXWC 4JTDB 3GEEA 4BJ6C 2KSFA 1H6GA 1EQ1A 4G0HA 2WVNA 1A7EA 2XLDA 1LI7A 1C03A 3OWTA 4OIOF 5L0DA 1J8MF 3RW0A 2CNWD 2QLAA 2HV7A 2VB6A 2L6FA 2ZXPA 4E0IA 3ABLC 1AVOB 2TMVP 1OXBA 4NY3A 2KJGA 3ZVRA 3DJNB 3R7CA 3NYJA 2OOCA 2PNOA 2J0XA 4W8KA 1SR2A 4CIHA 1Y4CA 1YYJA 2FAPB 3QW0A 4HE8D 2ZPAA 3BRJA 3CAXA 3W2VA 1Q0MA 4KC9A 4O79A 2EIJC 5DS4A 4BJ1A 1LE4A 4DJ9A 1TWHA 2XM0A 4D4NA 2XLHA 3PCVA 5EGYA 3L1MA 2YHSA 2A0BA 1AEPA 2OJED 3G4XA 4ULVA 2YZSA 3AGUA 1OQCA 2W45A 3C8GB 3JT1A 3O6XA 3EH2A 4JC7A 1BBHA 4LACB 4J30B 5B3IA 2R7RA 1LPEA 4EUKB 5KYXB 4XPYA 4Z9HA 5EK0A 3AOUA 1HMOA 1QPUA 4NQFA 3X1OA 5JLIA 4MS2A 1Y6DA 2XLMA 3RKOF 1RCPA 1S05A 2FGYA 5EHHA 1NSGB 1Z23A 3LESA 3O55A 1LS1A 2MHRA 1TWCA 3L8JA 3QMKA 3MFNA 1Q0DA 3SEOA 1NFOA 4G7HF 4OIPF 2HS5A 4EHPA 1E83A 4PK4A 1WWPA 4MVOA 4BJ5C 4CSAC 1ORSC 1LS4A 3K33A 2GDCA 2A6EF 3V5ZA 5JS5A 3ZWIA 3AG2C 1WASA 2HZ8A 4CS8C 3B0VC 4W8PA 1GQAA 2F22A 1R5ID 3GEIA 4U5DE 2G3VA 3DM9B 3NMJA 2KW3C 2R03A 3U8PA 3Q6NA 4DOZA 5A6AA 4JEBA 1E86A 2EILC 4U5CE 2EPOA 5T1DB 1E85A 2QE9A 2R05A 4RBNA 1O87A 4IGGA 3N2ZB 3HNLA 3HTKC 4J7TA 2LCHA 4E18A 4U5HA
chains in the Genus database with same CATH topology
3BRJA 1K40A 2PBEA 5F28E 1WOLA 1V4AA 3C8GA 1KTMA 1WWPA 4XEKA 3AJMA 1UFBA 2LK4A 4XEVA 3TULA 3RQFA 1KNYA 3GM3A 1PV3A 3K7DA 3MFNA 1O3UA 3C8GB 2JPUA 4XEFA 2YWAA 1OW8A 3S9OA 2JX0A 2L6HA 2KK1A 3C8GD 1OW7A 2L6GA 1JOGA 1K04A 3U0CA 3JYYA 2HSBA 4NQFA 2L6FA 3L8JA 3O10A 3C18A 1ZZPA 2Q00A 3L8IA 4EBKA 3RQGA 4R32A 1QVXA 3U3FA 3GM2A 3GM1A 3RQEA 1K05A 1WTYA 3JZ0A 3B71A 4EBJA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRJ A;  1K40 A;  2PBE A;  5F28 E;  1WOL A;  1V4A A;  3C8G A;  1KTM A;  1WWP A;  4XEK A;  3AJM A;  1UFB A;  2LK4 A;  4XEV A;  3TUL A;  3RQF A;  1KNY A;  3GM3 A;  1PV3 A;  3K7D A;  3MFN A;  1O3U A;  3C8G B;  2JPU A;  4XEF A;  2YWA A;  1OW8 A;  3S9O A;  2JX0 A;  2L6H A;  2KK1 A;  3C8G D;  1OW7 A;  2L6G A;  1JOG A;  1K04 A;  3U0C A;  3JYY A;  2HSB A;  4NQF A;  2L6F A;  3L8J A;  3O10 A;  3C18 A;  1ZZP A;  2Q00 A;  3L8I A;  4EBK A;  3RQG A;  4R32 A;  1QVX A;  3U3F A;  3GM2 A;  3GM1 A;  3RQE A;  1K05 A;  1WTY A;  3JZ0 A;  3B71 A;  4EBJ A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 2RSE B;  5L0J A;  2PP4 A;  3M4C A;  1YVI A;  1FFT C;  2KNH A;  1HE9 A;  2LP4 A;  4Q5S F;  2IYL D;  3IQC A;  1U6H A;  5COG A;  3CZ6 A;  4QI0 A;  4ER9 A;  1PD0 A;  3R2P A;  1CGM E;  2R7V A;  1N1C A;  4IRU A;  3IQ5 A;  2HUJ A;  2Q9A A;  4OD4 A;  1NZE A;  3VRC A;  5JT4 A;  4ULW A;  1EA8 A;  1PD1 A;  4JJG A;  1SZI A;  1ST6 A;  3CSK A;  2Y69 C;  4MTG A;  1VB5 A;  4MVR A;  4LLC A;  2XLW A;  3X2Q C;  4MW3 A;  5L0I A;  3US6 A;  5A6B A;  3LNR A;  2OEV A;  1V54 C;  3NKD A;  1A7D A;  1MMG A;  2P1A A;  3RF3 A;  3JRT A;  1FAP B;  3AQC A;  3FOP A;  4J7Y A;  3HLZ A;  3QZC A;  4MVZ A;  3TOM A;  4CDA A;  4EWC A;  4YWQ A;  1NFN A;  2A68 F;  4YL0 A;  4ZLC A;  5HV9 A;  3PDM P;  4U9D A;  3LUT B;  3U9M A;  3N24 A;  1XZQ A;  1V4A A;  1TR2 A;  3AJM A;  3HNI A;  3EG9 B;  4XEV A;  1G5Z A;  3K66 A;  3NYM A;  2J0W A;  1LM3 B;  2R9R B;  2A0U A;  4G78 A;  2Y3D A;  1NU7 D;  4XTK A;  3DKA A;  4U9E A;  2J9W A;  2NUT A;  3POV A;  1JAF A;  1ZVZ A;  3ASO C;  3UMH A;  2V3C C;  4DRH B;  3ZC4 A;  4C3E A;  2G3K A;  4EKW A;  3GOR A;  1ZW2 A;  2EPM X;  2W9Y A;  4KNV A;  4Q4Z F;  1UG7 A;  1FMW A;  1E2X A;  2R7O A;  3T9O A;  4CIP A;  3IQT A;  1WTY A;  5FCL A;  3ZDL A;  5KYW A;  4EBJ A;  1LI5 A;  3NRH A;  3DZA A;  4N06 A;  4G7Z F;  3ZQV A;  2HV6 A;  2IXP A;  4NTA A;  1QKR A;  3E9V A;  4JCH A;  3SZR A;  1YYX A;  2JD3 A;  4PJM A;  3LS1 A;  2ZD9 A;  5DQT A;  1FTS A;  2XXA A;  2LSE A;  1VLS A;  1I5N A;  1DOV A;  4PR9 A;  1ZHY A;  2WL8 A;  3ZG1 A;  2DI3 A;  2E87 A;  3AG3 C;  2Y39 A;  2KK1 A;  3GAN A;  1R4T A;  1KU2 A;  4X0R A;  5AGF A;  3VF0 A;  4CS9 A;  5TJ5 E;  5JVE A;  1MNE A;  2CGE A;  1OCZ C;  3KKB A;  2NUT B;  2YL0 A;  3HNJ A;  3FAP B;  4N4W A;  4YN0 B;  3V5X A;  2Q9C A;  1LKX A;  1CPR A;  4C3D A;  1YLM A;  5BUO A;  4OIR F;  2VAS A;  2R7Q A;  5COF A;  3SYN A;  1VTM P;  4DVY P;  4GEH A;  3BEH A;  1XWJ A;  4C7O A;  2YLI A;  2DB4 A;  1WGW A;  3M4B A;  2YVK A;  2J7P A;  3SP1 A;  4GQH A;  4E7S A;  1V55 C;  1ZW3 A;  2LK4 A;  2NPU A;  3C7J A;  3EPV A;  2AWC A;  1M57 C;  2OQM A;  5KYW B;  3KYJ A;  5BQH A;  1TWA A;  2VCA A;  4BJ6 A;  4JTA B;  2AP3 A;  4LLE A;  4D4X A;  3EHN A;  5KYY A;  1Z3I X;  2YLD A;  1BR4 A;  1L3P A;  3EZI A;  3UR3 C;  5F5F A;  3V5Y A;  2HMQ A;  1QLE C;  2L6G A;  3EZH A;  4HFF B;  4K0D A;  2HSB A;  4OD5 A;  2CYD A;  4WGY A;  5F5H A;  1YZA A;  4DRJ B;  2R7T A;  5L0F A;  1GGQ A;  2DYS C;  1D0Z A;  4E7Z A;  2XLV A;  2H7V C;  4PFO A;  4RDA A;  3JSE O;  2XL4 A;  3ZSU A;  2GA0 A;  4LDK A;  4MVS A;  4AX2 A;  1ZYR F;  2CW0 F;  3B71 A;  3ECS A;  3JRM O;  1OW6 A;  2L6H A;  3QW1 A;  3A11 A;  4JW1 A;  2P7V A;  3S29 A;  4O6M A;  2HMZ A;  4NTF A;  4XLP F;  2AWY A;  1Q0K A;  3DE8 A;  1JRA A;  5COM A;  1T6U A;  1S7Z A;  2KYH A;  1OKK D;  3W8H A;  3S0X A;  2IM8 A;  1U0B B;  4G7O F;  4C7O B;  1Q0F A;  2QUP A;  3C8Z A;  3HJC A;  2ZXO A;  3O39 A;  1O3U A;  2L81 A;  2JPU A;  1ZHZ A;  2XS8 A;  3EJN A;  2R25 A;  5BQG A;  3T6J A;  4A2N B;  2R7X A;  1I4Y A;  3S9O A;  2DGJ A;  2H8A A;  5KYN A;  3S84 A;  3KH2 A;  3ZTM A;  2GFH A;  1Z6A A;  2J9B A;  1RKE A;  3JYY A;  4J32 B;  2A1D D;  1WN0 A;  2YQY A;  4DXW A;  2WVQ A;  1AUE A;  2Q00 A;  3K1I C;  4H54 A;  1I4Z A;  5KYY B;  4QI2 A;  4O6Y A;  4U5E E;  4U5B E;  1JMW A;  1U89 A;  3EGD A;  4JCZ A;  1NLX A;  3EG9 A;  5AC5 A;  1W2W A;  4P9T A;  2NUP A;  1LVK A;  3EH1 A;  2D4U A;  4C3B A;  4BJ5 A;  4XEK A;  3G50 A;  3CQZ A;  1WAT A;  3FOO A;  4IWB A;  4O6N A;  5E2Q A;  1TFK B;  3S27 A;  3QTH A;  2WZG A;  5B3S C;  1D1A A;  2P0N A;  1SF8 A;  3HKK A;  4P6I C;  3KMI A;  3H65 A;  1GS9 A;  5IY5 C;  3RYL A;  2A69 F;  3AGT A;  1O5H A;  2NSF A;  2EPL X;  3N0T A;  4XLN F;  4KI2 A;  4FES A;  4HEA J;  2R7W A;  3K1H A;  1NBB A;  3KL4 A;  4CJO A;  3NKE A;  3TD7 A;  1VYI A;  4LER A;  4I44 A;  4WAB A;  5AC4 A;  3C18 A;  4B6I A;  4HFK B;  5KYU A;  1V74 B;  3GM2 A;  3ZTZ A;  1T9K A;  2R7S A;  1K05 A;  1RXQ A;  4FWV A;  3VYW A;  2XXA B;  2IXO A;  1RKE B;  2R02 A;  1VLT A;  3GOD A;  3I5Q A;  1G8X A;  3JZ0 A;  1A0B A;  4MTF A;  3B9Q A;  1ORJ A;  4PJJ A;  4XPW A;  4MQ9 F;  1FNT c;  2OU6 A;  1K40 A;  2NG1 A;  4WGZ A;  5E3C A;  1KTM A;  5DS6 A;  3EGD B;  3I4U A;  5K0I A;  3B0U X;  2O9X A;  4IJJ A;  2GWW A;  2NUP B;  4AL0 A;  4YL1 A;  1C02 A;  3IEE A;  4CS7 A;  3DE9 A;  2YEV A;  4KBL A;  3L0I A;  4YL3 A;  3RVZ A;  1CGO A;  4CDY A;  3AG1 C;  1TQG A;  3IPM O;  3C8G D;  1L7C A;  3WG7 C;  5B1B C;  4DVZ A;  2FFH A;  5CI8 A;  3MYI A;  2WZL A;  5HSW A;  3JTL O;  3SXZ A;  1OR2 A;  1A41 A;  3AQB A;  1ZHW A;  2OEX A;  4AE4 B;  2PX3 A;  3NG1 A;  3OA1 A;  1J8Y F;  2WZF A;  3U9J A;  3PMR A;  4PFP A;  1A7V A;  1SYQ A;  2RD9 A;  4CBE A;  2DYR C;  2LQG A;  1M2V A;  2YKZ A;  3SXY A;  3ZIB A;  5L0C A;  3QVZ A;  2ETS A;  1QSP A;  2EIN C;  2QNL A;  2H7O A;  2PBE A;  5F28 E;  3FXH A;  2VC9 A;  1BZ4 A;  1VYK A;  3HNK A;  5L3V A;  5KYU B;  3DM5 A;  4DBR A;  4E0H A;  1YA9 A;  1HY5 A;  4BEJ A;  2L7A A;  3SXK A;  5BQI A;  5A69 A;  4BPM A;  3DI5 A;  1RKC A;  1TWG A;  2W4B A;  3K7D A;  3M1C B;  3FDQ A;  3FAJ A;  3QVY A;  3UGO A;  3MX3 A;  1APC A;  4YJW A;  1E84 A;  4P9F A;  2IBF A;  4DRI B;  2XSE A;  3U3B A;  2A6H F;  2B0J A;  2H7B A;  4I3M A;  1BR1 A;  1OW7 A;  4I1M A;  3RFY A;  3FVY A;  4JUR I;  2PX0 A;  4EIY A;  1MMD A;  3B29 A;  2IXN A;  3RIP A;  3W2W A;  1C17 M;  5DLJ A;  4CDV A;  5GPG B;  1Z63 A;  2UUH A;  2Q4F A;  2OCC C;  4YT4 A;  2EPK X;  1NG1 A;  256B A;  1JR8 A;  3LS0 A;  3IHU A;  4NTB A;  3H2V A;  5DVW A;  3NMI A;  3EGX A;  2I8B A;  1T6Q A;  1YAR O;  2BL2 A;  2X51 A;  3UMK A;  3ZQY A;  1CGN A;  2J8W A;  4IB4 A;  1ZHT A;  2EPN A;  2J46 A;  4O7G A;  1D1B A;  1M2V B;  2YL1 A;  4IAO A;  1GM5 A;  2XM4 A;  1OXK A;  2VCB A;  1BDJ B;  2XS1 A;  4FAP B;  3MYF A;  4CJG A;  4F4B A;  2P6V A;  3B0P A;  4YT8 A;  1Z7Q c;  2IOQ A;  3DAF A;  4NCQ A;  3AG4 C;  1HMD A;  2J45 A;  1T01 A;  3RQG A;  3FHD A;  1VMA A;  3TJ5 A;  3WAQ A;  3Q7L A;  1TKN A;  2Q9B A;  2Y3H A;  2VH3 A;  3WOD F;  1IZM A;  1H9G A;  3UNG C;  1YA7 O;  4YT2 A;  2WVO A;  1FFH A;  3ATP A;  1VK5 A;  5FZT A;  3MBG A;  1HE1 A;  2VCC A;  3LLI A;  3TQO A;  2C04 A;  5E33 A;  1M56 C;  2Z15 A;  2MYS A;  3L34 A;  4NC3 A;  1UFB A;  5A6K A;  3M15 A;  3IQ6 A;  1JPJ A;  1EI7 A;  3CEX A;  4LDR A;  4M63 A;  4MVU A;  3RQF A;  2CNW A;  5JSL A;  1M2O A;  2J9U A;  2ASR A;  3EGX B;  4YT5 A;  3W8I A;  1ZU4 A;  3LAY A;  2LFF A;  2KQ9 A;  3K6B A;  1RJ9 A;  4K7B A;  4WJ0 A;  4ZLD A;  3EFO B;  2W4M A;  4JE9 A;  4OIQ F;  2EIM C;  3UMI A;  4IAQ A;  1Q0G A;  4AL1 A;  3LJB A;  3M79 A;  5T3W A;  3W4Y A;  3I5P A;  5A6J A;  1XZP A;  4R32 A;  1ZHX A;  3H2U A;  3U8V A;  3G4Z A;  3GM1 A;  1HW1 A;  5B1A C;  3TJ6 A;  1OCO C;  1D1C A;  4RD9 A;  3DD7 A;  5D92 A;  2XL8 A;  4K1O A;  3WHN A;  2LD6 A;  2LFD A;  2Q3T A;  3EQL F;  2Y3B A;  3RVY A;  3U2L A;  3PHF 2;  5E3A A;  2Q7R A;  5A6B D;  1WOL A;  4MVM A;  3JCU Q;  4CSA A;  5L3Q A;  3Q6M A;  4U5F E;  3RH3 A;  3VAY A;  3F46 A;  2AVK A;  2P61 A;  2IXM A;  2UUI A;  4FX5 A;  4BG0 A;  3TUL A;  2R7U A;  1G4U S;  4CS8 A;  2ICW G;  2XLE A;  2V26 A;  3ITF A;  4JJF A;  4QDL A;  2CCY A;  1YJG A;  3DAG A;  4ANJ A;  4XQ1 A;  1VOM A;  2JX0 A;  4JIO A;  1ZU5 A;  4AE4 A;  3LLK A;  1YDI A;  4ONS A;  4PAC A;  5CI9 A;  2B0H A;  3T4R A;  4EBB A;  1K04 A;  1CPQ A;  1T5O A;  3K1I A;  1BR2 A;  4JKV A;  2PF4 E;  2ZXR A;  4MVQ A;  2HJ3 A;  2I15 A;  1RJ9 B;  1OKK A;  1QVX A;  2OG2 A;  3DWW A;  3U3F A;  3EHM A;  3JYH A;  4H4K C;  2C03 A;  1RMV A;  3A9C A;  3UGP A;  3ASN C;  3C63 A;  3LEO A;  3DMD A;  2Y3G A;  1TFO B;  3DXJ F;  2J9V A;  3GEH A;  4A4A A;  5JUA A;  4JRZ A;  1Z5Z A;  4PJL A;  4BJT A;  3KYI A;  1LE2 A;  1MMA A;  3JSZ A;  3V7O A;  4N6C A;  1G4W R;  1KNY A;  3GM3 A;  1PV3 A;  3U5S A;  1SMY F;  4UDV A;  2M4E A;  2GAQ A;  3GWL A;  2BC5 A;  1MND A;  2PFD A;  4XEF A;  1H9T A;  3U2M A;  4MW8 A;  2OJQ A;  4U5G A;  2YL3 A;  3TK0 A;  3LEV A;  1OCR C;  3MLG A;  5L0H A;  3KPH A;  3GWN A;  2XRH A;  1QQ3 A;  3O10 A;  1ZZP A;  3L8I A;  3LNM B;  4EBK A;  3NMK A;  4YK5 A;  2YL7 A;  3RQE A;  1FR0 A;  1H7I A;  3T6B A;  5CIV A;  5JRA A;  4DBQ A;  2QTV A;  2QY9 A;  1F1M A;  3FMS A;  3S90 A;  3F47 A;  2NSG A;  3J06 A;  3SXM A;  1B68 A;  4L6R A;  5JP7 A;  3Q7G A;  4IAR A;  4PJN A;  2LIG A;  4XPX A;  2AU5 A;  1MMN A;  1PCX A;  2EIK C;  1JPN A;  2KGO A;  2YLG A;  2HSQ A;  1D0Y A;  4E17 A;  4BEM J;  4I1O B;  4MND A;  1T6I A;  1FMV A;  1OW8 A;  4XWJ A;  2HFI A;  2J7P D;  3T6G B;  3ABM C;  3VM6 A;  2M64 A;  2WB7 A;  4KNW A;  3SNH A;  4LDQ A;  4JZA A;  4Z9J A;  1JOG A;  5L0G A;  4AK9 A;  4Q7C A;  4JVS A;  3U0C A;  2MWQ A;  4N6H A;  3NDB B;  1EKY A;  1LIH A;  4GYT A;  3TOL A;  5T3T A;  2XL6 A;  4CS9 C;  2OKU A;  3ABK C;  3NYL A;  5D91 A;  1QZX A;  1NU9 C;  2YRF A;  2L9J A;  3OEO A;  2HJM A;  4MTO A;  2D5R B;  1ORY A;  1MQV A;  3S28 A;  2KC3 A;  2CDQ A;  2XLO A;  1OCC C;  3C62 A;  1D0X A;  3C8G A;  1M6T A;  3E70 C;  2HKV A;  1YZC A;  4OIN F;  2X0C A;  5DQZ A;  1HW2 A;  2G62 A;  4JEA A;  3EFO A;  5KYX A;  1YAU O;  4JTC B;  4Z9I A;  5DS5 A;  3DJU B;  1DOW A;  2BE5 F;  4CX9 A;  1OR3 A;  2YWA A;  1IW7 F;  2ZXW C;  4JTD B;  3GEE A;  4BJ6 C;  2KSF A;  1H6G A;  1EQ1 A;  4G0H A;  2WVN A;  1A7E A;  2XLD A;  1LI7 A;  1C03 A;  3OWT A;  4OIO F;  5L0D A;  1J8M F;  3RW0 A;  2CNW D;  2QLA A;  2HV7 A;  2VB6 A;  2L6F A;  2ZXP A;  4E0I A;  3ABL C;  1AVO B;  2TMV P;  1OXB A;  4NY3 A;  2KJG A;  3ZVR A;  3DJN B;  3R7C A;  3NYJ A;  2OOC A;  2PNO A;  2J0X A;  4W8K A;  1SR2 A;  4CIH A;  1Y4C A;  1YYJ A;  2FAP B;  3QW0 A;  4HE8 D;  2ZPA A;  3BRJ A;  3CAX A;  3W2V A;  1Q0M A;  4KC9 A;  4O79 A;  2EIJ C;  5DS4 A;  4BJ1 A;  1LE4 A;  4DJ9 A;  1TWH A;  2XM0 A;  4D4N A;  2XLH A;  3PCV A;  5EGY A;  3L1M A;  2YHS A;  2A0B A;  1AEP A;  2OJE D;  3G4X A;  4ULV A;  2YZS A;  3AGU A;  1OQC A;  2W45 A;  3C8G B;  3JT1 A;  3O6X A;  3EH2 A;  4JC7 A;  1BBH A;  4LAC B;  4J30 B;  5B3I A;  2R7R A;  1LPE A;  4EUK B;  5KYX B;  4XPY A;  4Z9H A;  5EK0 A;  3AOU A;  1HMO A;  1QPU A;  4NQF A;  3X1O A;  5JLI A;  4MS2 A;  1Y6D A;  2XLM A;  3RKO F;  1RCP A;  1S05 A;  2FGY A;  5EHH A;  1NSG B;  1Z23 A;  3LES A;  3O55 A;  1LS1 A;  2MHR A;  1TWC A;  3L8J A;  3QMK A;  3MFN A;  1Q0D A;  3SEO A;  1NFO A;  4G7H F;  4OIP F;  2HS5 A;  4EHP A;  1E83 A;  4PK4 A;  1WWP A;  4MVO A;  4BJ5 C;  4CSA C;  1ORS C;  1LS4 A;  3K33 A;  2GDC A;  2A6E F;  3V5Z A;  5JS5 A;  3ZWI A;  3AG2 C;  1WAS A;  2HZ8 A;  4CS8 C;  3B0V C;  4W8P A;  1GQA A;  2F22 A;  1R5I D;  3GEI A;  4U5D E;  2G3V A;  3DM9 B;  3NMJ A;  2KW3 C;  2R03 A;  3U8P A;  3Q6N A;  4DOZ A;  5A6A A;  4JEB A;  1E86 A;  2EIL C;  4U5C E;  2EPO A;  5T1D B;  1E85 A;  2QE9 A;  2R05 A;  4RBN A;  1O87 A;  4IGG A;  3N2Z B;  3HNL A;  3HTK C;  4J7T A;  2LCH A;  4E18 A;  4U5H A; 
#chains in the Genus database with same CATH homology
 3BRJ A;  1K40 A;  2PBE A;  5F28 E;  1WOL A;  1V4A A;  3C8G A;  1KTM A;  1WWP A;  4XEK A;  3AJM A;  1UFB A;  2LK4 A;  4XEV A;  3TUL A;  3RQF A;  1KNY A;  3GM3 A;  1PV3 A;  3K7D A;  3MFN A;  1O3U A;  3C8G B;  2JPU A;  4XEF A;  2YWA A;  1OW8 A;  3S9O A;  2JX0 A;  2L6H A;  2KK1 A;  3C8G D;  1OW7 A;  2L6G A;  1JOG A;  1K04 A;  3U0C A;  3JYY A;  2HSB A;  4NQF A;  2L6F A;  3L8J A;  3O10 A;  3C18 A;  1ZZP A;  2Q00 A;  3L8I A;  4EBK A;  3RQG A;  4R32 A;  1QVX A;  3U3F A;  3GM2 A;  3GM1 A;  3RQE A;  1K05 A;  1WTY A;  3JZ0 A;  3B71 A;  4EBJ A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...