3U0CA

Crystal structure of n-terminal region of type iii secretion first translocator ipab (residues 74-224)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
151
structure length
151
Chain Sequence
NASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Invasin ipaB
publication title The Structures of Coiled-Coil Domains from Type III Secretion System Translocators Reveal Homology to Pore-Forming Toxins.
pubmed doi rcsb
source organism Shigella flexneri
total genus 72
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3u0cA00
1OW7A 2JPUA 1K04A 1OW6A 2L6FA 1KTMA 1WOLA 1QVXA 3C18A 2KK1A 2LK4A 2Q00A 3B71A 1PV3A 1KNYA 1O3UA 3JZ0A 1OW8A 2PBEA 3GM2A 1WTYA 2HSBA 3C8GD 3RQFA 3C8GB 3C8GA 1V4AA 3MFNA 1WWPA 2L6HA 3GM1A 3L8JA 2YWAA 3L8IA 4NQFA 3RQEA 3S9OA 1ZZPA 3O10A 5F28E 3AJMA 4XEKA 4EBJA 3JYYA 1JOGA 3U3FA 3TULA 3K7DA 4EBKA 3BRJA 2L6GA 1UFBA 4XEFA 3U0CA 4R32A 1K40A 3RQGA 2JX0A 3GM3A 4XEVA 1K05A
chains in the Genus database with same CATH superfamily
3NYJA 4FWVA 3FVYA 3SYNA 3UMKA 4DVZA 1QVXA 3C18A 3GODA 3KYIA 1LI5A 2LK4A 3FOOA 2H7BA 3EQLF 2Q4FA 3LEOA 5BQGA 2EPMX 4E0HA 4NTBA 4JC7A 1G8XA 2J0XA 2W9YA 1LE2A 2OJED 2QY9A 3NMIA 3V7OA 2KC3A 2XM0A 3GEEA 4QDLA 2Q3TA 3ABLC 3FMSA 1YVIA 4U5EE 1V4AA 3S9OA 2AWYA 2Q7RA 1OXKA 1SR2A 4X0RA 3UR3C 2KSFA 3JTLO 5COGA 1NU7D 3W2VA 4ANJA 4BJ6A 5JSLA 2YLGA 3PCVA 2L6GA 1XZPA 3GEIA 2WZGA 2YLIA 4GQHA 1GS9A 4YJWA 4XLNF 2X0CA 5CI9A 3E9VA 1J8MF 3U0CA 3NKEA 4C3EA 3OWTA 1OCCC 2NUPA 1ORSC 3QTHA 4Q7CA 2QTVA 1Q0DA 3GM3A 2ASRA 4BEMJ 4YT2A 4NTAA 1OW7A 4KNWA 3US6A 3FDQA 1WOLA 4MTGA 4BJTA 5JLIA 1PV3A 4JTAB 4MTOA 4MVOA 2YVKA 1BZ4A 4JURI 2PNOA 3GM2A 2EINC 4P9FA 4KI2A 4OIPF 4E0IA 2XLWA 1RCPA 3CQZA 4KNVA 1E83A 4XLPF 1JR8A 2O9XA 3S0XA 2WZFA 3F47A 3KMIA 4AX2A 3K1IC 1E84A 4AL1A 2WVQA 1JOGA 1RKEA 2NSFA 3O6XA 2Q9AA 2XLHA 3H2VA 4O6MA 3K7DA 4CS9C 4DOZA 4CSAA 2UUIA 4KC9A 3SZRA 3KL4A 3TD7A 1Q0FA 1O87A 5DLJA 1OCOC 2HV7A 1D0XA 2R7XA 3QW0A 3UGOA 3ZQVA 5JS5A 1YLMA 3NG1A 3T4RA 2FAPB 2HFIA 5B1BC 3ASOC 5EHHA 3TJ5A 2XL8A 2RSEB 3LESA 3RIPA 1VLTA 4CS7A 3C7JA 2YLDA 3CAXA 3K1HA 1LKXA 3VF0A 4MQ9F 1ST6A 1Y4CA 3M4CA 3ZIBA 1D1AA 1WN0A 1WTYA 3ASNC 2R05A 1S7ZA 1MMGA 4G7OF 5A6BA 1HW1A 2G3VA 3LLKA 1CPRA 3C8GB 3UNGC 4YT8A 3AQCA 3DAFA 5HV9A 2CNWA 4OIQF 2OEVA 2YWAA 2LP4A 3IQ5A 4GEHA 2FGYA 2AVKA 1C02A 1Z63A 2BE5F 4IARA 4D4XA 1YYJA 1ZHXA 3EH2A 1ZU4A 5HSWA 1NSGB 1NU9C 1Y6DA 2P1AA 3G4XA 1M57C 4ULVA 4EWCA 4G7ZF 4FESA 2J46A 1ZW3A 2WVNA 1RXQA 5A69A 1MMDA 1RJ9B 3C62A 3L34A 4M63A 5KYNA 3G4ZA 2R7TA 2BC5A 4E7ZA 4JVSA 3ITFA 3O39A 2WB7A 1MQVA 4MVSA 5COFA 1LIHA 4Z9HA 3EJNA 1G4WR 4QI0A 2J7PA 3JYHA 2AP3A 3LEVA 2R03A 5L0DA 3I5PA 4B6IA 4ER9A 2P61A 1UG7A 4FAPB 2NUTA 2HKVA 2HMZA 3H65A 3RVZA 5FZTA 4LLCA 4A4AA 4YT5A 4JCZA 4MNDA 5A6AA 3AGTA 3DWWA 4XEFA 5E33A 3IQTA 3LS0A 4YL1A 4N4WA 1ZW2A 2LIGA 3EZIA 1GQAA 1QZXA 1YJGA 2IBFA 2XS8A 3M79A 2NPUA 3U2LA 2V26A 3S27A 2PX0A 1Q0KA 3TULA 1NLXA 5COMA 2LFDA 2YEVA 3DMDA 5GPGB 1OXBA 1FMVA 2ETSA 3OA1A 4U9DA 1HW2A 4IAQA 1HMDA 3MYIA 3HJCA 3VAYA 1HE1A 3K33A 1RKCA 4KBLA 5L3VA 2Q9BA 3JRMO 4G7HF 2YZSA 1Z6AA 3DM9B 2KYHA 1NBBA 2VCBA 3I5QA 4EBJA 5F28E 2EPOA 1E85A 3SXMA 2ZXPA 4IRUA 2QE9A 4CDYA 4WGZA 3GANA 4FX5A 1LE4A 3AGUA 1GM5A 3NMJA 1VMAA 3WG7C 4WABA 3N2ZB 5DS6A 2W45A 3SXYA 3GEHA 2GDCA 1V55C 3V5XA 4MVZA 3U5SA 2Y39A 1LI7A 4BPMA 3EHMA 2J9UA 3SEOA 1SYQA 2GWWA 1U6HA 5D91A 3FHDA 3JT1A 5DS5A 5T1DB 1JRAA 2L6FA 3N0TA 3ZTZA 3I4UA 3HKKA 3FAPB 1C03A 5L0IA 4BJ5C 4PJNA 4EKWA 3CSKA 4DRHB 4BJ1A 5KYYA 3L0IA 2OQMA 4BG0A 4NCQA 3QMKA 2HUJA 2P0NA 2A6EF 4PJLA 1R4TA 2NUTB 3C8GA 1NZEA 2UUHA 2L6HA 3L1MA 3ABMC 3L8IA 1HMOA 2KGOA 1TWGA 2J8WA 4MW8A 2OU6A 4YK5A 2YKZA 3ABKC 2EIMC 4LERA 3U8VA 3VRCA 4Q5SF 2B0HA 2EILC 2XLVA 3K66A 2HJMA 3BEHA 5DVWA 4YN0B 3J06A 4YT4A 4YL0A 4DRIB 2OCCC 3S84A 1D1BA 2A68F 1T6QA 3LNMB 1S05A 1RJ9A 4NY3A 4Z9JA 1K04A 4K1OA 4ULWA 5F5HA 2J0WA 4MW3A 3QW1A 4MVQA 2CGEA 3DM5A 2GAQA 1LVKA 4J30B 4PJJA 1VB5A 3DJUB 1BDJB 3PMRA 4JW1A 2Y3DA 3S28A 1LS4A 3ZTMA 1WASA 1YA7O 1ZVZA 2A0UA 1TWAA 3U9JA 1WWPA 5EK0A 2KQ9A 2GFHA 3HNLA 5EGYA 2DGJA 3NYLA 3ZC4A 3EFOA 3ZQYA 2H8AA 1QLEC 4C7OB 3POVA 4LDRA 2XSEA 1T6UA 4JIOA 4CJGA 4OINF 2YL3A 3RVYA 3U8PA 2PFDA 2PP4A 1PD0A 4LLEA 4MS2A 5FCLA 2WVOA 2Y69C 4O79A 2CCYA 3RF3A 4U5HA 4O7GA 3F46A 4J32B 1YAUO 2OOCA 4K0DA 2HZ8A 2AU5A 5KYUB 3Q7GA 3TQOA 4H54A 2IM8A 2Y3GA 3B71A 2HS5A 4DJ9A 2I8BA 3DAGA 3X2QC 4E7SA 1JAFA 4JJFA 3A9CA 4MVMA 5KYYB 2HSBA 3EG9A 3AG4C 1FTSA 5KYWB 2DI3A 2HV6A 4UDVA 2E87A 5A6KA 2YQYA 2ZPAA 3DE9A 3MBGA 1DOVA 1OKKA 2J9BA 3DD7A 2WL8A 3IEEA 3JRTA 1TFOB 1LS1A 1Z3IX 4L6RA 2R02A 3O55A 4MVRA 1O5HA 4CBEA 4JTDB 1FFHA 1VLSA 2R7WA 3S29A 4U5CE 2J45A 2X51A 2M4EA 2RD9A 1JMWA 1YZAA 4NQFA 1L7CA 1D0YA 4JCHA 3GORA 2DB4A 2XLOA 5A6JA 2KK1A 2Q00A 2PX3A 3C8ZA 2L7AA 4MVUA 1KNYA 2QNLA 2CW0F 2WZLA 4I3MA 4O6NA 4XWJA 2PBEA 1EA8A 2EIJC 2OJQA 1ZU5A 1FFTC 3K1IA 4LACB 5DQTA 2Y3HA 2IXNA 2ZD9A 1FR0A 4CS9A 4EBBA 2Z15A 3ECSA 1TKNA 3GM1A 5BQHA 3ZDLA 3C63A 4P6IC 3NMKA 4RD9A 4CDVA 4XEKA 1OCZC 3NDBB 1WATA 256BA 3IQCA 2OEXA 2H7OA 3EFOB 1TFKB 3K6BA 3MX3A 1OR3A 2BL2A 3RKOF 3DKAA 1A7EA 3H2UA 3U2MA 4CS8C 1BR1A 4JZAA 3GWNA 3IPMO 1YZCA 2L81A 2VCCA 1H6GA 2KJGA 2GA0A 4U9EA 3SXZA 3W4YA 5L0HA 4Z9IA 3NYMA 3AG2C 1OW6A 2A69F 3HNIA 5T3TA 2IOQA 3JZ0A 4PR9A 5TJ5E 4IJJA 4J7TA 4W8PA 1NFNA 4PACA 1QSPA 1M2OA 4PJMA 2VCAA 3LJBA 3VYWA 4H4KC 2R7QA 3WODF 3EG9B 4DRJB 4DBRA 5F5FA 5AC5A 1J8YF 2IXOA 2OKUA 3EH1A 4EUKB 4C7OA 1HE9A 2R25A 5JUAA 1FNTc 4CX9A 2R7SA 4G0HA 4NC3A 2LD6A 3ZG1A 1Z7Qc 1I5NA 4R32A 2DYSC 5BQIA 3LAYA 3HNJA 4HFFB 1JPNA 3X1OA 4BJ6C 1RMVA 4W8KA 4MTFA 3DJNB 1N1CA 1PD1A 1BR2A 4IB4A 4N6CA 2OG2A 4WGYA 3FOPA 2JPUA 1T9KA 4IGGA 5KYUA 1AVOB 2YL7A 4XPYA 1M2VA 2J9WA 3TJ6A 5B1AC 1DOWA 1OW8A 1W2WA 3B29A 4IAOA 3ZSUA 2FFHA 4RDAA 5A6BD 2MYSA 4DVYP 4ZLCA 4AL0A 1ZHZA 2CNWD 3EGXA 1H9TA 4AE4A 3QVZA 1VK5A 1VOMA 3EHNA 5KYWA 5JT4A 4U5GA 2P6VA 4XQ1A 2MWQA 1TQGA 2KW3C 1LM3B 2LQGA 1H7IA 2R7RA 3OEOA 4A2NB 3N24A 2NG1A 3Q7LA 4CSAC 1M56C 4E17A 2A1DD 3A11A 4IWBA 1V74B 3T6BA 3KKBA 1KTMA 1Z23A 4HE8D 2G3KA 2HMQA 2ZXWC 5AGFA 2C03A 4E18A 2J7PD 2L9JA 2VH3A 1L3PA 1YARO 1Q0MA 1QPUA 1VTMP 2YL1A 3W2WA 1QKRA 1YA9A 4K7BA 2LFFA 3SP1A 2F22A 2YL0A 3U3BA 1TR2A 3LUTB 2LSEA 3UMHA 3B0VC 2EPKX 2Q9CA 3HNKA 5KYXA 1R5ID 3JYYA 1ZYRF 2HJ3A 1H9GA 3RW0A 3DZAA 4EHPA 2R7VA 1EQ1A 4JE9A 1A0BA 4RBNA 2EPLX 2R9RB 4WJ0A 1I4ZA 3KYJA 2C04A 3CEXA 4BJ5A 1FAPB 3RQGA 3E70C 4JEBA 2YRFA 4XEVA 2A6HF 2ICWG 2ZXRA 1NG1A 3NKDA 1G5ZA 4JTCB 1MMAA 3S90A 2TMVP 1G4US 2VASA 5L0JA 3KH2A 3LNRA 1M2VB 1NFOA 1U89A 2EIKC 3B0PA 3IHUA 1Z5ZA 2XLEA 5E3AA 3RH3A 1VYIA 4D4NA 2D4UA 2G62A 4EIYA 3AOUA 3MYFA 3JSEO 1KU2A 3R7CA 3RQFA 3EGXB 5AC4A 4PK4A 4AE4B 2XL6A 5DQZA 3QVYA 3M1CB 2XXAA 1CGNA 3DE8A 3U3FA 1CPQA 2D5RB 3B9QA 5JVEA 3BRJA 1EKYA 1T6IA 4G78A 2DYRC 2XLDA 3PDMP 4JJGA 3EGDB 3JSZA 3Q6MA 3HLZA 4OD4A 4XTKA 3T9OA 4CDAA 3G50A 3W8HA 5K0IA 4Q4ZF 3W8IA 4CIHA 1SZIA 2A0BA 1F1MA 1EI7A 1MMNA 5DS4A 3MLGA 5L0FA 3KPHA 3SXKA 2NSGA 4CJOA 3U9MA 1MNEA 4N06A 1E2XA 2VC9A 2LCHA 4OIRF 4I44A 4ZLDA 4C3BA 4O6YA 3EPVA 1JPJA 2VB6A 1BR4A 2KNHA 4U5BE 3C8GD 4DBQA 2CDQA 4GYTA 5IY5C 2ZXOA 3AQBA 1A7DA 1B68A 1SF8A 3WAQA 1BBHA 3AG1C 4HEAJ 3EZHA 3IQ6A 1ZZPA 1HY5A 5KYXB 1ZHYA 3LLIA 3TK0A 3AG3C 3HTKC 4J7YA 1SMYF 1WGWA 2P7VA 4JKVA 1U0BB 3CZ6A 5L0CA 4C3DA 1I4YA 2W4BA 3M4BA 4HFKB 4I1MA 3ATPA 1CGME 3QZCA 4F4BA 2NUPB 5L3QA 5B3SC 2M64A 3M15A 2QLAA 2QUPA 4DXWA 1VYKA 2W4MA 3NRHA 2CYDA 1E86A 3ZVRA 1TWCA 4LDQA 4YWQA 1A7VA 3B0UX 2IXPA 1CGOA 3LS1A 1OQCA 1C17M 4ONSA 1V54C 2IYLD 1A41A 4XPWA 4YL3A 5B3IA 2V3CC 4OD5A 3VM6A 4LDKA 3T6JA 2EPNA 2XM4A 3PHF2 1MNDA 1TWHA 3FAJA 3R2PA 1APCA 5E2QA 1ZHWA 3TOMA 1AUEA 3GWLA 1GGQA 2R7UA 3AJMA 2XXAB 1ORJA 1RKEB 1QQ3A 1ZHTA 1IZMA 2MHRA 2B0JA 4QI2A 5E3CA 1UFBA 1LPEA 3SNHA 3V5YA 2PF4E 1D1CA 3JCUQ 3T6GB 2H7VC 3RFYA 3WHNA 3FXHA 1K40A 3RYLA 2XS1A 5JRAA 2J9VA 1OR2A 1XWJA 1K05A 2JX0A 1XZQA 2HSQA 3UGPA 5JP7A 3TOLA 4CIPA 4U5DE 1T5OA 5T3WA 1O3UA 1Q0GA 2Y3BA 4OIOF 5CI8A 3DI5A 2IXMA 4PFOA 3ZWIA 1D0ZA 4AK9A 1PCXA 5BUOA 2XLMA 1YYXA 4NTFA 1T01A 3MFNA 2AWCA 3L8JA 4CS8A 1FMWA 5L0GA 3RQEA 1OKKD 3O10A 1M6TA 4JRZA 1OCRC 2R7OA 5CIVA 3V5ZA 3Q6NA 2JD3A 4EBKA 4PFPA 4BEJA 4N6HA 4U5FE 1ORYA 4XPXA 3DXJF 5D92A 1IW7F 1AEPA 2YHSA 4P9TA 3EGDA 2I15A 2XL4A 4JEAA 2XRHA 1YDIA 4I1OB 3UMIA
chains in the Genus database with same CATH topology
1OW7A 2JPUA 1K04A 1OW6A 2L6FA 1KTMA 1WOLA 1QVXA 3C18A 2KK1A 2LK4A 2Q00A 3B71A 1PV3A 1KNYA 1O3UA 3JZ0A 1OW8A 2PBEA 3GM2A 1WTYA 2HSBA 3C8GD 3RQFA 3C8GB 3C8GA 1V4AA 3MFNA 1WWPA 2L6HA 3GM1A 3L8JA 2YWAA 3L8IA 4NQFA 3RQEA 3S9OA 1ZZPA 3O10A 5F28E 3AJMA 4XEKA 4EBJA 3JYYA 1JOGA 3U3FA 3TULA 3K7DA 4EBKA 3BRJA 2L6GA 1UFBA 4XEFA 3U0CA 4R32A 1K40A 3RQGA 2JX0A 3GM3A 4XEVA 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW7 A;  2JPU A;  1K04 A;  1OW6 A;  2L6F A;  1KTM A;  1WOL A;  1QVX A;  3C18 A;  2KK1 A;  2LK4 A;  2Q00 A;  3B71 A;  1PV3 A;  1KNY A;  1O3U A;  3JZ0 A;  1OW8 A;  2PBE A;  3GM2 A;  1WTY A;  2HSB A;  3C8G D;  3RQF A;  3C8G B;  3C8G A;  1V4A A;  3MFN A;  1WWP A;  2L6H A;  3GM1 A;  3L8J A;  2YWA A;  3L8I A;  4NQF A;  3RQE A;  3S9O A;  1ZZP A;  3O10 A;  5F28 E;  3AJM A;  4XEK A;  4EBJ A;  3JYY A;  1JOG A;  3U3F A;  3TUL A;  3K7D A;  4EBK A;  3BRJ A;  2L6G A;  1UFB A;  4XEF A;  3U0C A;  4R32 A;  1K40 A;  3RQG A;  2JX0 A;  3GM3 A;  4XEV A;  1K05 A; 
#chains in the Genus database with same CATH topology
 3NYJ A;  4FWV A;  3FVY A;  3SYN A;  3UMK A;  4DVZ A;  1QVX A;  3C18 A;  3GOD A;  3KYI A;  1LI5 A;  2LK4 A;  3FOO A;  2H7B A;  3EQL F;  2Q4F A;  3LEO A;  5BQG A;  2EPM X;  4E0H A;  4NTB A;  4JC7 A;  1G8X A;  2J0X A;  2W9Y A;  1LE2 A;  2OJE D;  2QY9 A;  3NMI A;  3V7O A;  2KC3 A;  2XM0 A;  3GEE A;  4QDL A;  2Q3T A;  3ABL C;  3FMS A;  1YVI A;  4U5E E;  1V4A A;  3S9O A;  2AWY A;  2Q7R A;  1OXK A;  1SR2 A;  4X0R A;  3UR3 C;  2KSF A;  3JTL O;  5COG A;  1NU7 D;  3W2V A;  4ANJ A;  4BJ6 A;  5JSL A;  2YLG A;  3PCV A;  2L6G A;  1XZP A;  3GEI A;  2WZG A;  2YLI A;  4GQH A;  1GS9 A;  4YJW A;  4XLN F;  2X0C A;  5CI9 A;  3E9V A;  1J8M F;  3U0C A;  3NKE A;  4C3E A;  3OWT A;  1OCC C;  2NUP A;  1ORS C;  3QTH A;  4Q7C A;  2QTV A;  1Q0D A;  3GM3 A;  2ASR A;  4BEM J;  4YT2 A;  4NTA A;  1OW7 A;  4KNW A;  3US6 A;  3FDQ A;  1WOL A;  4MTG A;  4BJT A;  5JLI A;  1PV3 A;  4JTA B;  4MTO A;  4MVO A;  2YVK A;  1BZ4 A;  4JUR I;  2PNO A;  3GM2 A;  2EIN C;  4P9F A;  4KI2 A;  4OIP F;  4E0I A;  2XLW A;  1RCP A;  3CQZ A;  4KNV A;  1E83 A;  4XLP F;  1JR8 A;  2O9X A;  3S0X A;  2WZF A;  3F47 A;  3KMI A;  4AX2 A;  3K1I C;  1E84 A;  4AL1 A;  2WVQ A;  1JOG A;  1RKE A;  2NSF A;  3O6X A;  2Q9A A;  2XLH A;  3H2V A;  4O6M A;  3K7D A;  4CS9 C;  4DOZ A;  4CSA A;  2UUI A;  4KC9 A;  3SZR A;  3KL4 A;  3TD7 A;  1Q0F A;  1O87 A;  5DLJ A;  1OCO C;  2HV7 A;  1D0X A;  2R7X A;  3QW0 A;  3UGO A;  3ZQV A;  5JS5 A;  1YLM A;  3NG1 A;  3T4R A;  2FAP B;  2HFI A;  5B1B C;  3ASO C;  5EHH A;  3TJ5 A;  2XL8 A;  2RSE B;  3LES A;  3RIP A;  1VLT A;  4CS7 A;  3C7J A;  2YLD A;  3CAX A;  3K1H A;  1LKX A;  3VF0 A;  4MQ9 F;  1ST6 A;  1Y4C A;  3M4C A;  3ZIB A;  1D1A A;  1WN0 A;  1WTY A;  3ASN C;  2R05 A;  1S7Z A;  1MMG A;  4G7O F;  5A6B A;  1HW1 A;  2G3V A;  3LLK A;  1CPR A;  3C8G B;  3UNG C;  4YT8 A;  3AQC A;  3DAF A;  5HV9 A;  2CNW A;  4OIQ F;  2OEV A;  2YWA A;  2LP4 A;  3IQ5 A;  4GEH A;  2FGY A;  2AVK A;  1C02 A;  1Z63 A;  2BE5 F;  4IAR A;  4D4X A;  1YYJ A;  1ZHX A;  3EH2 A;  1ZU4 A;  5HSW A;  1NSG B;  1NU9 C;  1Y6D A;  2P1A A;  3G4X A;  1M57 C;  4ULV A;  4EWC A;  4G7Z F;  4FES A;  2J46 A;  1ZW3 A;  2WVN A;  1RXQ A;  5A69 A;  1MMD A;  1RJ9 B;  3C62 A;  3L34 A;  4M63 A;  5KYN A;  3G4Z A;  2R7T A;  2BC5 A;  4E7Z A;  4JVS A;  3ITF A;  3O39 A;  2WB7 A;  1MQV A;  4MVS A;  5COF A;  1LIH A;  4Z9H A;  3EJN A;  1G4W R;  4QI0 A;  2J7P A;  3JYH A;  2AP3 A;  3LEV A;  2R03 A;  5L0D A;  3I5P A;  4B6I A;  4ER9 A;  2P61 A;  1UG7 A;  4FAP B;  2NUT A;  2HKV A;  2HMZ A;  3H65 A;  3RVZ A;  5FZT A;  4LLC A;  4A4A A;  4YT5 A;  4JCZ A;  4MND A;  5A6A A;  3AGT A;  3DWW A;  4XEF A;  5E33 A;  3IQT A;  3LS0 A;  4YL1 A;  4N4W A;  1ZW2 A;  2LIG A;  3EZI A;  1GQA A;  1QZX A;  1YJG A;  2IBF A;  2XS8 A;  3M79 A;  2NPU A;  3U2L A;  2V26 A;  3S27 A;  2PX0 A;  1Q0K A;  3TUL A;  1NLX A;  5COM A;  2LFD A;  2YEV A;  3DMD A;  5GPG B;  1OXB A;  1FMV A;  2ETS A;  3OA1 A;  4U9D A;  1HW2 A;  4IAQ A;  1HMD A;  3MYI A;  3HJC A;  3VAY A;  1HE1 A;  3K33 A;  1RKC A;  4KBL A;  5L3V A;  2Q9B A;  3JRM O;  4G7H F;  2YZS A;  1Z6A A;  3DM9 B;  2KYH A;  1NBB A;  2VCB A;  3I5Q A;  4EBJ A;  5F28 E;  2EPO A;  1E85 A;  3SXM A;  2ZXP A;  4IRU A;  2QE9 A;  4CDY A;  4WGZ A;  3GAN A;  4FX5 A;  1LE4 A;  3AGU A;  1GM5 A;  3NMJ A;  1VMA A;  3WG7 C;  4WAB A;  3N2Z B;  5DS6 A;  2W45 A;  3SXY A;  3GEH A;  2GDC A;  1V55 C;  3V5X A;  4MVZ A;  3U5S A;  2Y39 A;  1LI7 A;  4BPM A;  3EHM A;  2J9U A;  3SEO A;  1SYQ A;  2GWW A;  1U6H A;  5D91 A;  3FHD A;  3JT1 A;  5DS5 A;  5T1D B;  1JRA A;  2L6F A;  3N0T A;  3ZTZ A;  3I4U A;  3HKK A;  3FAP B;  1C03 A;  5L0I A;  4BJ5 C;  4PJN A;  4EKW A;  3CSK A;  4DRH B;  4BJ1 A;  5KYY A;  3L0I A;  2OQM A;  4BG0 A;  4NCQ A;  3QMK A;  2HUJ A;  2P0N A;  2A6E F;  4PJL A;  1R4T A;  2NUT B;  3C8G A;  1NZE A;  2UUH A;  2L6H A;  3L1M A;  3ABM C;  3L8I A;  1HMO A;  2KGO A;  1TWG A;  2J8W A;  4MW8 A;  2OU6 A;  4YK5 A;  2YKZ A;  3ABK C;  2EIM C;  4LER A;  3U8V A;  3VRC A;  4Q5S F;  2B0H A;  2EIL C;  2XLV A;  3K66 A;  2HJM A;  3BEH A;  5DVW A;  4YN0 B;  3J06 A;  4YT4 A;  4YL0 A;  4DRI B;  2OCC C;  3S84 A;  1D1B A;  2A68 F;  1T6Q A;  3LNM B;  1S05 A;  1RJ9 A;  4NY3 A;  4Z9J A;  1K04 A;  4K1O A;  4ULW A;  5F5H A;  2J0W A;  4MW3 A;  3QW1 A;  4MVQ A;  2CGE A;  3DM5 A;  2GAQ A;  1LVK A;  4J30 B;  4PJJ A;  1VB5 A;  3DJU B;  1BDJ B;  3PMR A;  4JW1 A;  2Y3D A;  3S28 A;  1LS4 A;  3ZTM A;  1WAS A;  1YA7 O;  1ZVZ A;  2A0U A;  1TWA A;  3U9J A;  1WWP A;  5EK0 A;  2KQ9 A;  2GFH A;  3HNL A;  5EGY A;  2DGJ A;  3NYL A;  3ZC4 A;  3EFO A;  3ZQY A;  2H8A A;  1QLE C;  4C7O B;  3POV A;  4LDR A;  2XSE A;  1T6U A;  4JIO A;  4CJG A;  4OIN F;  2YL3 A;  3RVY A;  3U8P A;  2PFD A;  2PP4 A;  1PD0 A;  4LLE A;  4MS2 A;  5FCL A;  2WVO A;  2Y69 C;  4O79 A;  2CCY A;  3RF3 A;  4U5H A;  4O7G A;  3F46 A;  4J32 B;  1YAU O;  2OOC A;  4K0D A;  2HZ8 A;  2AU5 A;  5KYU B;  3Q7G A;  3TQO A;  4H54 A;  2IM8 A;  2Y3G A;  3B71 A;  2HS5 A;  4DJ9 A;  2I8B A;  3DAG A;  3X2Q C;  4E7S A;  1JAF A;  4JJF A;  3A9C A;  4MVM A;  5KYY B;  2HSB A;  3EG9 A;  3AG4 C;  1FTS A;  5KYW B;  2DI3 A;  2HV6 A;  4UDV A;  2E87 A;  5A6K A;  2YQY A;  2ZPA A;  3DE9 A;  3MBG A;  1DOV A;  1OKK A;  2J9B A;  3DD7 A;  2WL8 A;  3IEE A;  3JRT A;  1TFO B;  1LS1 A;  1Z3I X;  4L6R A;  2R02 A;  3O55 A;  4MVR A;  1O5H A;  4CBE A;  4JTD B;  1FFH A;  1VLS A;  2R7W A;  3S29 A;  4U5C E;  2J45 A;  2X51 A;  2M4E A;  2RD9 A;  1JMW A;  1YZA A;  4NQF A;  1L7C A;  1D0Y A;  4JCH A;  3GOR A;  2DB4 A;  2XLO A;  5A6J A;  2KK1 A;  2Q00 A;  2PX3 A;  3C8Z A;  2L7A A;  4MVU A;  1KNY A;  2QNL A;  2CW0 F;  2WZL A;  4I3M A;  4O6N A;  4XWJ A;  2PBE A;  1EA8 A;  2EIJ C;  2OJQ A;  1ZU5 A;  1FFT C;  3K1I A;  4LAC B;  5DQT A;  2Y3H A;  2IXN A;  2ZD9 A;  1FR0 A;  4CS9 A;  4EBB A;  2Z15 A;  3ECS A;  1TKN A;  3GM1 A;  5BQH A;  3ZDL A;  3C63 A;  4P6I C;  3NMK A;  4RD9 A;  4CDV A;  4XEK A;  1OCZ C;  3NDB B;  1WAT A;  256B A;  3IQC A;  2OEX A;  2H7O A;  3EFO B;  1TFK B;  3K6B A;  3MX3 A;  1OR3 A;  2BL2 A;  3RKO F;  3DKA A;  1A7E A;  3H2U A;  3U2M A;  4CS8 C;  1BR1 A;  4JZA A;  3GWN A;  3IPM O;  1YZC A;  2L81 A;  2VCC A;  1H6G A;  2KJG A;  2GA0 A;  4U9E A;  3SXZ A;  3W4Y A;  5L0H A;  4Z9I A;  3NYM A;  3AG2 C;  1OW6 A;  2A69 F;  3HNI A;  5T3T A;  2IOQ A;  3JZ0 A;  4PR9 A;  5TJ5 E;  4IJJ A;  4J7T A;  4W8P A;  1NFN A;  4PAC A;  1QSP A;  1M2O A;  4PJM A;  2VCA A;  3LJB A;  3VYW A;  4H4K C;  2R7Q A;  3WOD F;  3EG9 B;  4DRJ B;  4DBR A;  5F5F A;  5AC5 A;  1J8Y F;  2IXO A;  2OKU A;  3EH1 A;  4EUK B;  4C7O A;  1HE9 A;  2R25 A;  5JUA A;  1FNT c;  4CX9 A;  2R7S A;  4G0H A;  4NC3 A;  2LD6 A;  3ZG1 A;  1Z7Q c;  1I5N A;  4R32 A;  2DYS C;  5BQI A;  3LAY A;  3HNJ A;  4HFF B;  1JPN A;  3X1O A;  4BJ6 C;  1RMV A;  4W8K A;  4MTF A;  3DJN B;  1N1C A;  1PD1 A;  1BR2 A;  4IB4 A;  4N6C A;  2OG2 A;  4WGY A;  3FOP A;  2JPU A;  1T9K A;  4IGG A;  5KYU A;  1AVO B;  2YL7 A;  4XPY A;  1M2V A;  2J9W A;  3TJ6 A;  5B1A C;  1DOW A;  1OW8 A;  1W2W A;  3B29 A;  4IAO A;  3ZSU A;  2FFH A;  4RDA A;  5A6B D;  2MYS A;  4DVY P;  4ZLC A;  4AL0 A;  1ZHZ A;  2CNW D;  3EGX A;  1H9T A;  4AE4 A;  3QVZ A;  1VK5 A;  1VOM A;  3EHN A;  5KYW A;  5JT4 A;  4U5G A;  2P6V A;  4XQ1 A;  2MWQ A;  1TQG A;  2KW3 C;  1LM3 B;  2LQG A;  1H7I A;  2R7R A;  3OEO A;  4A2N B;  3N24 A;  2NG1 A;  3Q7L A;  4CSA C;  1M56 C;  4E17 A;  2A1D D;  3A11 A;  4IWB A;  1V74 B;  3T6B A;  3KKB A;  1KTM A;  1Z23 A;  4HE8 D;  2G3K A;  2HMQ A;  2ZXW C;  5AGF A;  2C03 A;  4E18 A;  2J7P D;  2L9J A;  2VH3 A;  1L3P A;  1YAR O;  1Q0M A;  1QPU A;  1VTM P;  2YL1 A;  3W2W A;  1QKR A;  1YA9 A;  4K7B A;  2LFF A;  3SP1 A;  2F22 A;  2YL0 A;  3U3B A;  1TR2 A;  3LUT B;  2LSE A;  3UMH A;  3B0V C;  2EPK X;  2Q9C A;  3HNK A;  5KYX A;  1R5I D;  3JYY A;  1ZYR F;  2HJ3 A;  1H9G A;  3RW0 A;  3DZA A;  4EHP A;  2R7V A;  1EQ1 A;  4JE9 A;  1A0B A;  4RBN A;  2EPL X;  2R9R B;  4WJ0 A;  1I4Z A;  3KYJ A;  2C04 A;  3CEX A;  4BJ5 A;  1FAP B;  3RQG A;  3E70 C;  4JEB A;  2YRF A;  4XEV A;  2A6H F;  2ICW G;  2ZXR A;  1NG1 A;  3NKD A;  1G5Z A;  4JTC B;  1MMA A;  3S90 A;  2TMV P;  1G4U S;  2VAS A;  5L0J A;  3KH2 A;  3LNR A;  1M2V B;  1NFO A;  1U89 A;  2EIK C;  3B0P A;  3IHU A;  1Z5Z A;  2XLE A;  5E3A A;  3RH3 A;  1VYI A;  4D4N A;  2D4U A;  2G62 A;  4EIY A;  3AOU A;  3MYF A;  3JSE O;  1KU2 A;  3R7C A;  3RQF A;  3EGX B;  5AC4 A;  4PK4 A;  4AE4 B;  2XL6 A;  5DQZ A;  3QVY A;  3M1C B;  2XXA A;  1CGN A;  3DE8 A;  3U3F A;  1CPQ A;  2D5R B;  3B9Q A;  5JVE A;  3BRJ A;  1EKY A;  1T6I A;  4G78 A;  2DYR C;  2XLD A;  3PDM P;  4JJG A;  3EGD B;  3JSZ A;  3Q6M A;  3HLZ A;  4OD4 A;  4XTK A;  3T9O A;  4CDA A;  3G50 A;  3W8H A;  5K0I A;  4Q4Z F;  3W8I A;  4CIH A;  1SZI A;  2A0B A;  1F1M A;  1EI7 A;  1MMN A;  5DS4 A;  3MLG A;  5L0F A;  3KPH A;  3SXK A;  2NSG A;  4CJO A;  3U9M A;  1MNE A;  4N06 A;  1E2X A;  2VC9 A;  2LCH A;  4OIR F;  4I44 A;  4ZLD A;  4C3B A;  4O6Y A;  3EPV A;  1JPJ A;  2VB6 A;  1BR4 A;  2KNH A;  4U5B E;  3C8G D;  4DBQ A;  2CDQ A;  4GYT A;  5IY5 C;  2ZXO A;  3AQB A;  1A7D A;  1B68 A;  1SF8 A;  3WAQ A;  1BBH A;  3AG1 C;  4HEA J;  3EZH A;  3IQ6 A;  1ZZP A;  1HY5 A;  5KYX B;  1ZHY A;  3LLI A;  3TK0 A;  3AG3 C;  3HTK C;  4J7Y A;  1SMY F;  1WGW A;  2P7V A;  4JKV A;  1U0B B;  3CZ6 A;  5L0C A;  4C3D A;  1I4Y A;  2W4B A;  3M4B A;  4HFK B;  4I1M A;  3ATP A;  1CGM E;  3QZC A;  4F4B A;  2NUP B;  5L3Q A;  5B3S C;  2M64 A;  3M15 A;  2QLA A;  2QUP A;  4DXW A;  1VYK A;  2W4M A;  3NRH A;  2CYD A;  1E86 A;  3ZVR A;  1TWC A;  4LDQ A;  4YWQ A;  1A7V A;  3B0U X;  2IXP A;  1CGO A;  3LS1 A;  1OQC A;  1C17 M;  4ONS A;  1V54 C;  2IYL D;  1A41 A;  4XPW A;  4YL3 A;  5B3I A;  2V3C C;  4OD5 A;  3VM6 A;  4LDK A;  3T6J A;  2EPN A;  2XM4 A;  3PHF 2;  1MND A;  1TWH A;  3FAJ A;  3R2P A;  1APC A;  5E2Q A;  1ZHW A;  3TOM A;  1AUE A;  3GWL A;  1GGQ A;  2R7U A;  3AJM A;  2XXA B;  1ORJ A;  1RKE B;  1QQ3 A;  1ZHT A;  1IZM A;  2MHR A;  2B0J A;  4QI2 A;  5E3C A;  1UFB A;  1LPE A;  3SNH A;  3V5Y A;  2PF4 E;  1D1C A;  3JCU Q;  3T6G B;  2H7V C;  3RFY A;  3WHN A;  3FXH A;  1K40 A;  3RYL A;  2XS1 A;  5JRA A;  2J9V A;  1OR2 A;  1XWJ A;  1K05 A;  2JX0 A;  1XZQ A;  2HSQ A;  3UGP A;  5JP7 A;  3TOL A;  4CIP A;  4U5D E;  1T5O A;  5T3W A;  1O3U A;  1Q0G A;  2Y3B A;  4OIO F;  5CI8 A;  3DI5 A;  2IXM A;  4PFO A;  3ZWI A;  1D0Z A;  4AK9 A;  1PCX A;  5BUO A;  2XLM A;  1YYX A;  4NTF A;  1T01 A;  3MFN A;  2AWC A;  3L8J A;  4CS8 A;  1FMW A;  5L0G A;  3RQE A;  1OKK D;  3O10 A;  1M6T A;  4JRZ A;  1OCR C;  2R7O A;  5CIV A;  3V5Z A;  3Q6N A;  2JD3 A;  4EBK A;  4PFP A;  4BEJ A;  4N6H A;  4U5F E;  1ORY A;  4XPX A;  3DXJ F;  5D92 A;  1IW7 F;  1AEP A;  2YHS A;  4P9T A;  3EGD A;  2I15 A;  2XL4 A;  4JEA A;  2XRH A;  1YDI A;  4I1O B;  3UMI A; 
#chains in the Genus database with same CATH homology
 1OW7 A;  2JPU A;  1K04 A;  1OW6 A;  2L6F A;  1KTM A;  1WOL A;  1QVX A;  3C18 A;  2KK1 A;  2LK4 A;  2Q00 A;  3B71 A;  1PV3 A;  1KNY A;  1O3U A;  3JZ0 A;  1OW8 A;  2PBE A;  3GM2 A;  1WTY A;  2HSB A;  3C8G D;  3RQF A;  3C8G B;  3C8G A;  1V4A A;  3MFN A;  1WWP A;  2L6H A;  3GM1 A;  3L8J A;  2YWA A;  3L8I A;  4NQF A;  3RQE A;  3S9O A;  1ZZP A;  3O10 A;  5F28 E;  3AJM A;  4XEK A;  4EBJ A;  3JYY A;  1JOG A;  3U3F A;  3TUL A;  3K7D A;  4EBK A;  3BRJ A;  2L6G A;  1UFB A;  4XEF A;  3U0C A;  4R32 A;  1K40 A;  3RQG A;  2JX0 A;  3GM3 A;  4XEV A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...