2FAPB

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
b'VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 37
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2fapB00
4DRJB 4FAPB 1FAPB 2GAQA 1AUEA 1NSGB 4DRHB 2NPUA 5GPGB 4DRIB 3FAPB 2RSEB 2FAPB
chains in the Genus database with same CATH superfamily
4JKVA 4XQ1A 3F47A 3UMIA 4J30B 3RQFA 2NUPA 1Y4CA 4P9FA 3TJ6A 4AX2A 4DRHB 2X0CA 4IRUA 3GANA 2VASA 4GYTA 4MTGA 3EPVA 2FGYA 3H2UA 4JJFA 1W2WA 4FWVA 1JR8A 1AUEA 2R25A 4N6CA 4ONSA 4JURI 4RDAA 1D0ZA 1WWPA 2AU5A 2XM0A 2EIMC 3K33A 3FVYA 5KYXA 1LI7A 3AQCA 3VAYA 4G7OF 4YJWA 5JRAA 3Q7GA 1ZZPA 3S84A 2CNWA 3AG3C 4C3EA 5A6BA 1LI5A 3UMKA 2J7PD 3JCUQ 3J06A 2L6HA 1N1CA 2A0BA 2Q9CA 3R2PA 3JZ0A 3N2ZB 2NUTA 3QZCA 3ZVRA 5L0JA 3GEIA 1ZHYA 1FFTC 1ORSC 3AG1C 3ABLC 1CGOA 2L9JA 3L8JA 4K0DA 2XM4A 4Z9JA 2E87A 1GGQA 3US6A 1D1CA 1EA8A 3S29A 3EGXB 1A7EA 5AC4A 4JZAA 1GS9A 3LLIA 2EILC 1FTSA 2VCAA 2KK1A 5COGA 4CS7A 5HSWA 1T6IA 3B29A 3EQLF 3SYNA 1O5HA 3MBGA 2W4MA 2KNHA 2GA0A 3JT1A 2YEVA 1BDJB 4XPWA 2Q7RA 4CJGA 4OIRF 1LS1A 4KNWA 3K66A 2Q3TA 4MW3A 4XPYA 3SXKA 3SP1A 2VH3A 5DQTA 4EBJA 1YARO 2KGOA 4PACA 3I5QA 1RMVA 2Y3GA 2BE5F 2HSQA 1A7DA 3IHUA 1QZXA 3U2LA 2PBEA 2MYSA 4EIYA 2OOCA 3TQOA 3QMKA 4A2NB 2D4UA 2OJQA 2KSFA 3M4CA 3ABMC 5F5HA 1BZ4A 3HNLA 1K04A 3DJNB 2WVNA 1Z6AA 2P1AA 3T6BA 2ETSA 4J7TA 2TMVP 4E7ZA 1VLTA 3RQGA 4PK4A 3M79A 2HZ8A 3X2QC 5KYWA 3HNJA 2LFFA 3JSEO 2LIGA 5DQZA 2J0WA 4YL0A 3IQ6A 4MW8A 2V3CC 3WG7C 2KQ9A 2UUHA 4MS2A 2CYDA 1H7IA 1YJGA 3EH1A 4U5FE 2X51A 5BUOA 3DD7A 4LERA 4O6MA 1JMWA 1OW6A 2Q9AA 3IPMO 1H9GA 4CIHA 2IBFA 3TD7A 1XWJA 2P61A 3NKEA 2A6HF 2YQYA 4DBQA 3EH2A 3C8GA 2MWQA 4MTOA 4O7GA 3SXMA 1CPQA 1G8XA 1OKKA 4O6NA 3R7CA 3ZWIA 4U5GA 2A68F 4AK9A 3WAQA 1LVKA 4K1OA 1KNYA 2LD6A 3T6GB 2CDQA 2DGJA 1C03A 2IM8A 4MVUA 2IXPA 2G3KA 1NLXA 5HV9A 4XPXA 1YA7O 3ZC4A 1E86A 2ZXPA 1TWHA 2RSEB 3TJ5A 4CS8A 4NCQA 1YZAA 2YRFA 4IAQA 4YK5A 1E85A 4CX9A 2IXNA 1LPEA 2BL2A 1G4US 1Q0MA 2V26A 3NMIA 5JSLA 1KU2A 4ZLCA 4R32A 1JRAA 1FR0A 2Q4FA 4MQ9F 3C18A 4PR9A 3UGPA 4FAPB 2HKVA 2J7PA 4XEFA 3W2WA 3RVZA 5KYYB 3LS1A 3SXYA 3S0XA 1Z5ZA 4ULWA 1KTMA 3EHMA 1S05A 1H9TA 1WTYA 2DYRC 3HTKC 4M63A 3C7JA 1IW7F 3O10A 3RQEA 3UGOA 3S27A 3EFOA 3LEVA 2OJED 3ITFA 5B1AC 3SZRA 3MX3A 2XL4A 2I15A 2J9WA 2NPUA 3I5PA 2QLAA 1HE1A 4LDQA 4YWQA 2R7WA 2LK4A 2ZPAA 1ZW2A 1K40A 3DAGA 4CDAA 1YZCA 2ZXRA 2IXMA 1ZU4A 2HUJA 1QLEC 4Z9HA 5JS5A 2KC3A 1NFNA 1Z23A 1U89A 3SNHA 2MHRA 4Q4ZF 5AC5A 5CI8A 2P0NA 1PCXA 2R9RB 1XZPA 3IQ5A 3KL4A 2H7OA 4H54A 4J32B 1I4ZA 4E18A 2QUPA 1AVOB 4DJ9A 2XS8A 3KMIA 2WVOA 256BA 3GM3A 3ZQVA 4U5HA 2AWYA 4U9EA 3G4ZA 2R7UA 2YL3A 4KBLA 3MYFA 4NTBA 3V5XA 3OA1A 3JSZA 2KW3C 4YT8A 1M2VB 4PJJA 3DE8A 3ZG1A 5BQIA 4JIOA 3U9MA 4CJOA 3U5SA 4Z9IA 3SEOA 1F1MA 4U5BE 3FOOA 3T6JA 3CQZA 1K05A 4JW1A 3HNKA 4XTKA 2Y3BA 3VYWA 4AE4B 4C3BA 2EPNA 1RKEB 1TFOB 4IGGA 3GM1A 4HE8D 1YDIA 2HMZA 4OINF 4JEBA 1QKRA 2XLMA 3K1IC 1L3PA 2Q00A 1I5NA 4JE9A 4QDLA 4N6HA 3MYIA 1FNTc 1SMYF 3N24A 3EHNA 2J45A 2XLDA 2XS1A 3TOMA 3B0VC 3VF0A 2XLVA 2D5RB 5KYNA 4KI2A 3K7DA 1V55C 5IY5C 4QI2A 4Q5SF 1S7ZA 3AG2C 4WGZA 3ABKC 3BRJA 2EPLX 3W8IA 5DS5A 4D4XA 1Q0DA 3UNGC 4I1OB 4JEAA 5F5FA 1CGNA 3L8IA 1J8YF 3W8HA 3UMHA 2LSEA 4CS9A 4C7OB 4G78A 4YN0B 3HLZA 4MVZA 2QY9A 2A0UA 2YVKA 3GM2A 2YLGA 4O6YA 3JRMO 1OCCC 1TWCA 3LESA 3RFYA 2XRHA 1RKCA 1WGWA 3TK0A 4QI0A 3G50A 1NG1A 1OW8A 1TWAA 3EZHA 2Q9BA 3EGDB 1SF8A 1ORJA 3HKKA 2J0XA 2PNOA 1YAUO 3CAXA 4YL3A 3LS0A 2KYHA 3TULA 3FAPB 3U8VA 4DOZA 1A7VA 2J9BA 2M64A 3C8ZA 5CIVA 1R4TA 4BEMJ 2GDCA 4E0IA 1ZYRF 3V5ZA 5TJ5E 3EG9B 3GWNA 4FESA 1MMGA 1OR2A 2R03A 4WABA 2AP3A 3U2MA 4JCZA 1NSGB 3DXJF 3LEOA 4WJ0A 3DAFA 3Q6MA 1E84A 1UFBA 5EGYA 2NUPB 4KNVA 4P9TA 4XEVA 1FAPB 3W2VA 2HSBA 2C03A 2IXOA 3N0TA 3NMKA 1OXKA 2I8BA 1VLSA 3NRHA 1MMDA 4EWCA 3CSKA 4HFFB 1BBHA 1JPJA 3FHDA 2P7VA 2R7VA 2VB6A 3ZTZA 1ZVZA 2NSFA 2F22A 3QVZA 2VCCA 4BJTA 3ZSUA 2EIJC 5JVEA 2R02A 1YVIA 2PF4E 4CS9C 1NBBA 1Z3IX 4BEJA 1FFHA 3DJUB 1HMDA 2FAPB 2JPUA 2W4BA 3FAJA 2XXAB 1VMAA 2KJGA 3PCVA 2OEXA 1OCRC 2Y3HA 4U5DE 3MLGA 2NUTB 3DE9A 4IB4A 5A6KA 5B3IA 1M2VA 1Z63A 2WVQA 4U5EE 2HJ3A 1EKYA 4EBBA 3H2VA 1TWGA 4XLNF 4G7ZF 1OCZC 2XLWA 2L81A 2YZSA 5B1BC 4H4KC 1JAFA 2XSEA 5L0CA 1DOWA 1LS4A 1ZHTA 4OD5A 3NKDA 4X0RA 1OQCA 1OCOC 3FMSA 3GORA 3KKBA 4AE4A 3SXZA 3B0PA 1RCPA 1T9KA 2YLDA 3WHNA 3S90A 4CSAC 5DS6A 3KYIA 1ZHXA 2OU6A 1V54C 4BG0A 5L0DA 3L34A 4Q7CA 4ULVA 3EJNA 3U9JA 4J7YA 3KH2A 4E0HA 1WN0A 2O9XA 3IEEA 5F28E 3RW0A 4YT5A 3W4YA 2HV6A 3K1IA 1DOVA 4JJGA 2ASRA 5E2QA 1OR3A 4E17A 3L1MA 3EGXA 4I3MA 4C3DA 1ZU5A 3RYLA 2H7BA 2L6FA 2CW0F 4IARA 3NMJA 5A6AA 2G3VA 1G4WR 3DI5A 1VK5A 3GEHA 1SR2A 2XL6A 2G62A 3AG4C 4OD4A 1MNDA 1PD0A 1OW7A 5JT4A 1LM3B 1IZMA 4PFOA 4U5CE 3IQCA 3S9OA 3MFNA 4NY3A 2EPMX 3JRTA 4BJ6C 1V74B 3NYMA 5E3CA 3WODF 4OIPF 2JD3A 4DXWA 3JYYA 3LNRA 4NQFA 1XZQA 3O39A 4DRJB 1FMWA 2LFDA 2LCHA 1A0BA 2CCYA 1WATA 2HS5A 1NU9C 2OKUA 2IOQA 3FXHA 3POVA 1HW1A 1RXQA 1NZEA 4JRZA 5D91A 1QQ3A 1RJ9B 1AEPA 3DM5A 3T4RA 5K0IA 1U0BB 3B71A 3RF3A 1WOLA 1JOGA 4P6IC 3V7OA 4PJNA 1QPUA 3DWWA 1BR2A 4MTFA 3U3FA 3ZTMA 2OQMA 3I4UA 2QTVA 2HJMA 2QNLA 1TQGA 4UDVA 3ASOC 3FDQA 2EPKX 2J9VA 3E9VA 5DS4A 5L0IA 1D1BA 2L7AA 3B9QA 3U8PA 4IAOA 2B0HA 1LIHA 2ZXWC 4B6IA 4EKWA 4BJ5A 1B68A 1J8MF 2AVKA 3QW0A 2OCCC 4ER9A 3LUTB 4CDVA 5BQGA 5COFA 1CGME 2OEVA 1GM5A 2VCBA 3GODA 2YL1A 3NG1A 2HV7A 3NYJA 5A6JA 2YL7A 4MNDA 1E83A 5T1DB 3NYLA 4LLCA 4XEKA 2XXAA 3EFOB 1MQVA 1EQ1A 5T3TA 4JTDB 1Y6DA 1GQAA 2PX0A 1VTMP 1EI7A 3C62A 4LLEA 2P6VA 2R05A 3E70C 2JX0A 4W8KA 1BR4A 2WZLA 2XLHA 3AOUA 2NSGA 3BEHA 3LNMB 4ANJA 2YHSA 4IWBA 4PJMA 1ZHZA 5KYYA 3PHF2 4OIOF 4ZLDA 1BR1A 1VB5A 1D1AA 1D0YA 4LDRA 5EK0A 2GFHA 3F46A 3OWTA 5KYUB 4XLPF 5D92A 1MNEA 1NU7D 3KPHA 3PDMP 2ZD9A 2BC5A 1L7CA 5COMA 4I1MA 2HMQA 4I44A 1H6GA 2W9YA 4N4WA 4F4BA 2A69F 3B0UX 4MVMA 2R7RA 2L6GA 2DB4A 1YYJA 1YYXA 2H8AA 2PP4A 4EBKA 1SZIA 3RVYA 2R7XA 1QSPA 4JVSA 3S28A 3HNIA 3AQBA 5L0HA 1M57C 1LKXA 1QVXA 3ZIBA 1VOMA 3LAYA 2GAQA 1NFOA 2A6EF 2J46A 4BJ5C 4EHPA 1O87A 2DYSC 1VYIA 4G0HA 3T9OA 2NG1A 3EZIA 3G4XA 4FX5A 3U0CA 2CGEA 2FFHA 1UG7A 3X1OA 3HJCA 1E2XA 4MVOA 5KYXB 1V4AA 2YKZA 3PMRA 4AL0A 2R7TA 1WASA 3Q6NA 2YLIA 4LDKA 1CPRA 2A1DD 2GWWA 3H65A 4MVQA 2WB7A 2Y69C 3QW1A 3ECSA 1HW2A 4CSAA 1I4YA 1HMOA 4JTCB 4PFPA 5T3WA 5L3VA 5BQHA 4G7HF 4L6RA 5FCLA 3ZQYA 4BJ6A 3M4BA 1OXBA 4KC9A 2CNWD 1G5ZA 5A6BD 2AWCA 1YLMA 3RH3A 2R7SA 1MMNA 1Q0KA 3FOPA 3QTHA 5DLJA 1HE9A 1FMVA 4JCHA 2YWAA 2R7OA 2W45A 2C04A 3VRCA 4D4NA 3K1HA 4MVSA 1M56C 3AGUA 5EHHA 1RJ9A 4IJJA 4CBEA 2Y39A 1TR2A 2IYLD 1U6HA 4WGYA 5JLIA 3NDBB 4HEAJ 1YA9A 1RKEA 2LQGA 4MVRA 3AJMA 1ST6A 1TFKB 4YL1A 4YT4A 5L0GA 4OIQF 1PD1A 1R5ID 1C02A 2HFIA 4LACB 3QVYA 3ZDLA 1HY5A 1Q0GA 3UR3C 1SYQA 4DBRA 2XL8A 2WL8A 3DM9B 4DRIB 4E7SA 5FZTA 3AGTA 4GQHA 4A4AA 4NTAA 2OG2A 3RIPA 1LE4A 5JUAA 3O55A 4JTAB 4XWJA 1A41A 1ZW3A 3DMDA 1LE2A 1T6QA 3RKOF 2Z15A 3GWLA 4CDYA 1T5OA 5L0FA 2J9UA 4O79A 4EUKB 2UUIA 1VYKA 2EPOA 2DI3A 2J8WA 2VC9A 3KYJA 1T01A 4RBNA 4C7OA 4NC3A 3M15A 4GEHA 5KYWB 2XLOA 3Q7LA 2PX3A 4HFKB 3LJBA 4RD9A 3V5YA 2EIKC 2H7VC 3ATPA 2RD9A 2YL0A 5CI9A 2LP4A 3JTLO 1TKNA 3DKAA 4YT2A 1PV3A 2R7QA 5DVWA 5GPGB 1D0XA 1Z7Qc 1M2OA 4BPMA 3CZ6A 4CIPA 3GEEA 4N06A 4PJLA 3LLKA 3EGDA 3OEOA 4U9DA 4W8PA 3M1CB 2PFDA 2WZGA 2Y3DA 3VM6A 4AL1A 3DZAA 5E33A 2XLEA 1MMAA 5L3QA 1Q0FA 3C63A 1M6TA 1O3UA 1C17M 1T6UA 3C8GB 4JC7A 5KYUA 5AGFA 1JPNA 3O6XA 4BJ1A 3TOLA 3A9CA 3K6BA 2QE9A 2M4EA 3A11A 1ZHWA 3C8GD 3U3BA 3IQTA 4NTFA 3EG9A 1OKKD 1ORYA 3ASNC 4K7BA 5E3AA 2WZFA 5JP7A 4CS8C 3CEXA 2ICWG 4DVYP 5B3SC 2EINC 4DVZA 2ZXOA 2B0JA 3JYHA 3L0IA 1APCA 5A69A
chains in the Genus database with same CATH topology
4DRJB 4FAPB 1FAPB 2GAQA 1AUEA 1NSGB 4DRHB 2NPUA 5GPGB 4DRIB 3FAPB 2RSEB 2FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRJ B;  4FAP B;  1FAP B;  2GAQ A;  1AUE A;  1NSG B;  4DRH B;  2NPU A;  5GPG B;  4DRI B;  3FAP B;  2RSE B;  2FAP B; 
#chains in the Genus database with same CATH topology
 4JKV A;  4XQ1 A;  3F47 A;  3UMI A;  4J30 B;  3RQF A;  2NUP A;  1Y4C A;  4P9F A;  3TJ6 A;  4AX2 A;  4DRH B;  2X0C A;  4IRU A;  3GAN A;  2VAS A;  4GYT A;  4MTG A;  3EPV A;  2FGY A;  3H2U A;  4JJF A;  1W2W A;  4FWV A;  1JR8 A;  1AUE A;  2R25 A;  4N6C A;  4ONS A;  4JUR I;  4RDA A;  1D0Z A;  1WWP A;  2AU5 A;  2XM0 A;  2EIM C;  3K33 A;  3FVY A;  5KYX A;  1LI7 A;  3AQC A;  3VAY A;  4G7O F;  4YJW A;  5JRA A;  3Q7G A;  1ZZP A;  3S84 A;  2CNW A;  3AG3 C;  4C3E A;  5A6B A;  1LI5 A;  3UMK A;  2J7P D;  3JCU Q;  3J06 A;  2L6H A;  1N1C A;  2A0B A;  2Q9C A;  3R2P A;  3JZ0 A;  3N2Z B;  2NUT A;  3QZC A;  3ZVR A;  5L0J A;  3GEI A;  1ZHY A;  1FFT C;  1ORS C;  3AG1 C;  3ABL C;  1CGO A;  2L9J A;  3L8J A;  4K0D A;  2XM4 A;  4Z9J A;  2E87 A;  1GGQ A;  3US6 A;  1D1C A;  1EA8 A;  3S29 A;  3EGX B;  1A7E A;  5AC4 A;  4JZA A;  1GS9 A;  3LLI A;  2EIL C;  1FTS A;  2VCA A;  2KK1 A;  5COG A;  4CS7 A;  5HSW A;  1T6I A;  3B29 A;  3EQL F;  3SYN A;  1O5H A;  3MBG A;  2W4M A;  2KNH A;  2GA0 A;  3JT1 A;  2YEV A;  1BDJ B;  4XPW A;  2Q7R A;  4CJG A;  4OIR F;  1LS1 A;  4KNW A;  3K66 A;  2Q3T A;  4MW3 A;  4XPY A;  3SXK A;  3SP1 A;  2VH3 A;  5DQT A;  4EBJ A;  1YAR O;  2KGO A;  4PAC A;  3I5Q A;  1RMV A;  2Y3G A;  2BE5 F;  2HSQ A;  1A7D A;  3IHU A;  1QZX A;  3U2L A;  2PBE A;  2MYS A;  4EIY A;  2OOC A;  3TQO A;  3QMK A;  4A2N B;  2D4U A;  2OJQ A;  2KSF A;  3M4C A;  3ABM C;  5F5H A;  1BZ4 A;  3HNL A;  1K04 A;  3DJN B;  2WVN A;  1Z6A A;  2P1A A;  3T6B A;  2ETS A;  4J7T A;  2TMV P;  4E7Z A;  1VLT A;  3RQG A;  4PK4 A;  3M79 A;  2HZ8 A;  3X2Q C;  5KYW A;  3HNJ A;  2LFF A;  3JSE O;  2LIG A;  5DQZ A;  2J0W A;  4YL0 A;  3IQ6 A;  4MW8 A;  2V3C C;  3WG7 C;  2KQ9 A;  2UUH A;  4MS2 A;  2CYD A;  1H7I A;  1YJG A;  3EH1 A;  4U5F E;  2X51 A;  5BUO A;  3DD7 A;  4LER A;  4O6M A;  1JMW A;  1OW6 A;  2Q9A A;  3IPM O;  1H9G A;  4CIH A;  2IBF A;  3TD7 A;  1XWJ A;  2P61 A;  3NKE A;  2A6H F;  2YQY A;  4DBQ A;  3EH2 A;  3C8G A;  2MWQ A;  4MTO A;  4O7G A;  3SXM A;  1CPQ A;  1G8X A;  1OKK A;  4O6N A;  3R7C A;  3ZWI A;  4U5G A;  2A68 F;  4AK9 A;  3WAQ A;  1LVK A;  4K1O A;  1KNY A;  2LD6 A;  3T6G B;  2CDQ A;  2DGJ A;  1C03 A;  2IM8 A;  4MVU A;  2IXP A;  2G3K A;  1NLX A;  5HV9 A;  4XPX A;  1YA7 O;  3ZC4 A;  1E86 A;  2ZXP A;  1TWH A;  2RSE B;  3TJ5 A;  4CS8 A;  4NCQ A;  1YZA A;  2YRF A;  4IAQ A;  4YK5 A;  1E85 A;  4CX9 A;  2IXN A;  1LPE A;  2BL2 A;  1G4U S;  1Q0M A;  2V26 A;  3NMI A;  5JSL A;  1KU2 A;  4ZLC A;  4R32 A;  1JRA A;  1FR0 A;  2Q4F A;  4MQ9 F;  3C18 A;  4PR9 A;  3UGP A;  4FAP B;  2HKV A;  2J7P A;  4XEF A;  3W2W A;  3RVZ A;  5KYY B;  3LS1 A;  3SXY A;  3S0X A;  1Z5Z A;  4ULW A;  1KTM A;  3EHM A;  1S05 A;  1H9T A;  1WTY A;  2DYR C;  3HTK C;  4M63 A;  3C7J A;  1IW7 F;  3O10 A;  3RQE A;  3UGO A;  3S27 A;  3EFO A;  3LEV A;  2OJE D;  3ITF A;  5B1A C;  3SZR A;  3MX3 A;  2XL4 A;  2I15 A;  2J9W A;  2NPU A;  3I5P A;  2QLA A;  1HE1 A;  4LDQ A;  4YWQ A;  2R7W A;  2LK4 A;  2ZPA A;  1ZW2 A;  1K40 A;  3DAG A;  4CDA A;  1YZC A;  2ZXR A;  2IXM A;  1ZU4 A;  2HUJ A;  1QLE C;  4Z9H A;  5JS5 A;  2KC3 A;  1NFN A;  1Z23 A;  1U89 A;  3SNH A;  2MHR A;  4Q4Z F;  5AC5 A;  5CI8 A;  2P0N A;  1PCX A;  2R9R B;  1XZP A;  3IQ5 A;  3KL4 A;  2H7O A;  4H54 A;  4J32 B;  1I4Z A;  4E18 A;  2QUP A;  1AVO B;  4DJ9 A;  2XS8 A;  3KMI A;  2WVO A;  256B A;  3GM3 A;  3ZQV A;  4U5H A;  2AWY A;  4U9E A;  3G4Z A;  2R7U A;  2YL3 A;  4KBL A;  3MYF A;  4NTB A;  3V5X A;  3OA1 A;  3JSZ A;  2KW3 C;  4YT8 A;  1M2V B;  4PJJ A;  3DE8 A;  3ZG1 A;  5BQI A;  4JIO A;  3U9M A;  4CJO A;  3U5S A;  4Z9I A;  3SEO A;  1F1M A;  4U5B E;  3FOO A;  3T6J A;  3CQZ A;  1K05 A;  4JW1 A;  3HNK A;  4XTK A;  2Y3B A;  3VYW A;  4AE4 B;  4C3B A;  2EPN A;  1RKE B;  1TFO B;  4IGG A;  3GM1 A;  4HE8 D;  1YDI A;  2HMZ A;  4OIN F;  4JEB A;  1QKR A;  2XLM A;  3K1I C;  1L3P A;  2Q00 A;  1I5N A;  4JE9 A;  4QDL A;  4N6H A;  3MYI A;  1FNT c;  1SMY F;  3N24 A;  3EHN A;  2J45 A;  2XLD A;  2XS1 A;  3TOM A;  3B0V C;  3VF0 A;  2XLV A;  2D5R B;  5KYN A;  4KI2 A;  3K7D A;  1V55 C;  5IY5 C;  4QI2 A;  4Q5S F;  1S7Z A;  3AG2 C;  4WGZ A;  3ABK C;  3BRJ A;  2EPL X;  3W8I A;  5DS5 A;  4D4X A;  1Q0D A;  3UNG C;  4I1O B;  4JEA A;  5F5F A;  1CGN A;  3L8I A;  1J8Y F;  3W8H A;  3UMH A;  2LSE A;  4CS9 A;  4C7O B;  4G78 A;  4YN0 B;  3HLZ A;  4MVZ A;  2QY9 A;  2A0U A;  2YVK A;  3GM2 A;  2YLG A;  4O6Y A;  3JRM O;  1OCC C;  1TWC A;  3LES A;  3RFY A;  2XRH A;  1RKC A;  1WGW A;  3TK0 A;  4QI0 A;  3G50 A;  1NG1 A;  1OW8 A;  1TWA A;  3EZH A;  2Q9B A;  3EGD B;  1SF8 A;  1ORJ A;  3HKK A;  2J0X A;  2PNO A;  1YAU O;  3CAX A;  4YL3 A;  3LS0 A;  2KYH A;  3TUL A;  3FAP B;  3U8V A;  4DOZ A;  1A7V A;  2J9B A;  2M64 A;  3C8Z A;  5CIV A;  1R4T A;  4BEM J;  2GDC A;  4E0I A;  1ZYR F;  3V5Z A;  5TJ5 E;  3EG9 B;  3GWN A;  4FES A;  1MMG A;  1OR2 A;  2R03 A;  4WAB A;  2AP3 A;  3U2M A;  4JCZ A;  1NSG B;  3DXJ F;  3LEO A;  4WJ0 A;  3DAF A;  3Q6M A;  1E84 A;  1UFB A;  5EGY A;  2NUP B;  4KNV A;  4P9T A;  4XEV A;  1FAP B;  3W2V A;  2HSB A;  2C03 A;  2IXO A;  3N0T A;  3NMK A;  1OXK A;  2I8B A;  1VLS A;  3NRH A;  1MMD A;  4EWC A;  3CSK A;  4HFF B;  1BBH A;  1JPJ A;  3FHD A;  2P7V A;  2R7V A;  2VB6 A;  3ZTZ A;  1ZVZ A;  2NSF A;  2F22 A;  3QVZ A;  2VCC A;  4BJT A;  3ZSU A;  2EIJ C;  5JVE A;  2R02 A;  1YVI A;  2PF4 E;  4CS9 C;  1NBB A;  1Z3I X;  4BEJ A;  1FFH A;  3DJU B;  1HMD A;  2FAP B;  2JPU A;  2W4B A;  3FAJ A;  2XXA B;  1VMA A;  2KJG A;  3PCV A;  2OEX A;  1OCR C;  2Y3H A;  4U5D E;  3MLG A;  2NUT B;  3DE9 A;  4IB4 A;  5A6K A;  5B3I A;  1M2V A;  1Z63 A;  2WVQ A;  4U5E E;  2HJ3 A;  1EKY A;  4EBB A;  3H2V A;  1TWG A;  4XLN F;  4G7Z F;  1OCZ C;  2XLW A;  2L81 A;  2YZS A;  5B1B C;  4H4K C;  1JAF A;  2XSE A;  5L0C A;  1DOW A;  1LS4 A;  1ZHT A;  4OD5 A;  3NKD A;  4X0R A;  1OQC A;  1OCO C;  3FMS A;  3GOR A;  3KKB A;  4AE4 A;  3SXZ A;  3B0P A;  1RCP A;  1T9K A;  2YLD A;  3WHN A;  3S90 A;  4CSA C;  5DS6 A;  3KYI A;  1ZHX A;  2OU6 A;  1V54 C;  4BG0 A;  5L0D A;  3L34 A;  4Q7C A;  4ULV A;  3EJN A;  3U9J A;  4J7Y A;  3KH2 A;  4E0H A;  1WN0 A;  2O9X A;  3IEE A;  5F28 E;  3RW0 A;  4YT5 A;  3W4Y A;  2HV6 A;  3K1I A;  1DOV A;  4JJG A;  2ASR A;  5E2Q A;  1OR3 A;  4E17 A;  3L1M A;  3EGX A;  4I3M A;  4C3D A;  1ZU5 A;  3RYL A;  2H7B A;  2L6F A;  2CW0 F;  4IAR A;  3NMJ A;  5A6A A;  2G3V A;  1G4W R;  3DI5 A;  1VK5 A;  3GEH A;  1SR2 A;  2XL6 A;  2G62 A;  3AG4 C;  4OD4 A;  1MND A;  1PD0 A;  1OW7 A;  5JT4 A;  1LM3 B;  1IZM A;  4PFO A;  4U5C E;  3IQC A;  3S9O A;  3MFN A;  4NY3 A;  2EPM X;  3JRT A;  4BJ6 C;  1V74 B;  3NYM A;  5E3C A;  3WOD F;  4OIP F;  2JD3 A;  4DXW A;  3JYY A;  3LNR A;  4NQF A;  1XZQ A;  3O39 A;  4DRJ B;  1FMW A;  2LFD A;  2LCH A;  1A0B A;  2CCY A;  1WAT A;  2HS5 A;  1NU9 C;  2OKU A;  2IOQ A;  3FXH A;  3POV A;  1HW1 A;  1RXQ A;  1NZE A;  4JRZ A;  5D91 A;  1QQ3 A;  1RJ9 B;  1AEP A;  3DM5 A;  3T4R A;  5K0I A;  1U0B B;  3B71 A;  3RF3 A;  1WOL A;  1JOG A;  4P6I C;  3V7O A;  4PJN A;  1QPU A;  3DWW A;  1BR2 A;  4MTF A;  3U3F A;  3ZTM A;  2OQM A;  3I4U A;  2QTV A;  2HJM A;  2QNL A;  1TQG A;  4UDV A;  3ASO C;  3FDQ A;  2EPK X;  2J9V A;  3E9V A;  5DS4 A;  5L0I A;  1D1B A;  2L7A A;  3B9Q A;  3U8P A;  4IAO A;  2B0H A;  1LIH A;  2ZXW C;  4B6I A;  4EKW A;  4BJ5 A;  1B68 A;  1J8M F;  2AVK A;  3QW0 A;  2OCC C;  4ER9 A;  3LUT B;  4CDV A;  5BQG A;  5COF A;  1CGM E;  2OEV A;  1GM5 A;  2VCB A;  3GOD A;  2YL1 A;  3NG1 A;  2HV7 A;  3NYJ A;  5A6J A;  2YL7 A;  4MND A;  1E83 A;  5T1D B;  3NYL A;  4LLC A;  4XEK A;  2XXA A;  3EFO B;  1MQV A;  1EQ1 A;  5T3T A;  4JTD B;  1Y6D A;  1GQA A;  2PX0 A;  1VTM P;  1EI7 A;  3C62 A;  4LLE A;  2P6V A;  2R05 A;  3E70 C;  2JX0 A;  4W8K A;  1BR4 A;  2WZL A;  2XLH A;  3AOU A;  2NSG A;  3BEH A;  3LNM B;  4ANJ A;  2YHS A;  4IWB A;  4PJM A;  1ZHZ A;  5KYY A;  3PHF 2;  4OIO F;  4ZLD A;  1BR1 A;  1VB5 A;  1D1A A;  1D0Y A;  4LDR A;  5EK0 A;  2GFH A;  3F46 A;  3OWT A;  5KYU B;  4XLP F;  5D92 A;  1MNE A;  1NU7 D;  3KPH A;  3PDM P;  2ZD9 A;  2BC5 A;  1L7C A;  5COM A;  4I1M A;  2HMQ A;  4I44 A;  1H6G A;  2W9Y A;  4N4W A;  4F4B A;  2A69 F;  3B0U X;  4MVM A;  2R7R A;  2L6G A;  2DB4 A;  1YYJ A;  1YYX A;  2H8A A;  2PP4 A;  4EBK A;  1SZI A;  3RVY A;  2R7X A;  1QSP A;  4JVS A;  3S28 A;  3HNI A;  3AQB A;  5L0H A;  1M57 C;  1LKX A;  1QVX A;  3ZIB A;  1VOM A;  3LAY A;  2GAQ A;  1NFO A;  2A6E F;  2J46 A;  4BJ5 C;  4EHP A;  1O87 A;  2DYS C;  1VYI A;  4G0H A;  3T9O A;  2NG1 A;  3EZI A;  3G4X A;  4FX5 A;  3U0C A;  2CGE A;  2FFH A;  1UG7 A;  3X1O A;  3HJC A;  1E2X A;  4MVO A;  5KYX B;  1V4A A;  2YKZ A;  3PMR A;  4AL0 A;  2R7T A;  1WAS A;  3Q6N A;  2YLI A;  4LDK A;  1CPR A;  2A1D D;  2GWW A;  3H65 A;  4MVQ A;  2WB7 A;  2Y69 C;  3QW1 A;  3ECS A;  1HW2 A;  4CSA A;  1I4Y A;  1HMO A;  4JTC B;  4PFP A;  5T3W A;  5L3V A;  5BQH A;  4G7H F;  4L6R A;  5FCL A;  3ZQY A;  4BJ6 A;  3M4B A;  1OXB A;  4KC9 A;  2CNW D;  1G5Z A;  5A6B D;  2AWC A;  1YLM A;  3RH3 A;  2R7S A;  1MMN A;  1Q0K A;  3FOP A;  3QTH A;  5DLJ A;  1HE9 A;  1FMV A;  4JCH A;  2YWA A;  2R7O A;  2W45 A;  2C04 A;  3VRC A;  4D4N A;  3K1H A;  4MVS A;  1M56 C;  3AGU A;  5EHH A;  1RJ9 A;  4IJJ A;  4CBE A;  2Y39 A;  1TR2 A;  2IYL D;  1U6H A;  4WGY A;  5JLI A;  3NDB B;  4HEA J;  1YA9 A;  1RKE A;  2LQG A;  4MVR A;  3AJM A;  1ST6 A;  1TFK B;  4YL1 A;  4YT4 A;  5L0G A;  4OIQ F;  1PD1 A;  1R5I D;  1C02 A;  2HFI A;  4LAC B;  3QVY A;  3ZDL A;  1HY5 A;  1Q0G A;  3UR3 C;  1SYQ A;  4DBR A;  2XL8 A;  2WL8 A;  3DM9 B;  4DRI B;  4E7S A;  5FZT A;  3AGT A;  4GQH A;  4A4A A;  4NTA A;  2OG2 A;  3RIP A;  1LE4 A;  5JUA A;  3O55 A;  4JTA B;  4XWJ A;  1A41 A;  1ZW3 A;  3DMD A;  1LE2 A;  1T6Q A;  3RKO F;  2Z15 A;  3GWL A;  4CDY A;  1T5O A;  5L0F A;  2J9U A;  4O79 A;  4EUK B;  2UUI A;  1VYK A;  2EPO A;  2DI3 A;  2J8W A;  2VC9 A;  3KYJ A;  1T01 A;  4RBN A;  4C7O A;  4NC3 A;  3M15 A;  4GEH A;  5KYW B;  2XLO A;  3Q7L A;  2PX3 A;  4HFK B;  3LJB A;  4RD9 A;  3V5Y A;  2EIK C;  2H7V C;  3ATP A;  2RD9 A;  2YL0 A;  5CI9 A;  2LP4 A;  3JTL O;  1TKN A;  3DKA A;  4YT2 A;  1PV3 A;  2R7Q A;  5DVW A;  5GPG B;  1D0X A;  1Z7Q c;  1M2O A;  4BPM A;  3CZ6 A;  4CIP A;  3GEE A;  4N06 A;  4PJL A;  3LLK A;  3EGD A;  3OEO A;  4U9D A;  4W8P A;  3M1C B;  2PFD A;  2WZG A;  2Y3D A;  3VM6 A;  4AL1 A;  3DZA A;  5E33 A;  2XLE A;  1MMA A;  5L3Q A;  1Q0F A;  3C63 A;  1M6T A;  1O3U A;  1C17 M;  1T6U A;  3C8G B;  4JC7 A;  5KYU A;  5AGF A;  1JPN A;  3O6X A;  4BJ1 A;  3TOL A;  3A9C A;  3K6B A;  2QE9 A;  2M4E A;  3A11 A;  1ZHW A;  3C8G D;  3U3B A;  3IQT A;  4NTF A;  3EG9 A;  1OKK D;  1ORY A;  3ASN C;  4K7B A;  5E3A A;  2WZF A;  5JP7 A;  4CS8 C;  3CEX A;  2ICW G;  4DVY P;  5B3S C;  2EIN C;  4DVZ A;  2ZXO A;  2B0J A;  3JYH A;  3L0I A;  1APC A;  5A69 A; 
#chains in the Genus database with same CATH homology
 4DRJ B;  4FAP B;  1FAP B;  2GAQ A;  1AUE A;  1NSG B;  4DRH B;  2NPU A;  5GPG B;  4DRI B;  3FAP B;  2RSE B;  2FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...