2FAPB

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 37
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2fapB00
1AUEA 4DRHB 2RSEB 4DRJB 2GAQA 4DRIB 4FAPB 3FAPB 5GPGB 2FAPB 2NPUA 1NSGB 1FAPB
chains in the Genus database with same CATH superfamily
3SXZA 3EHMA 3QW1A 3PDMP 2AU5A 3A9CA 2PX0A 1D0XA 3FVYA 3DE8A 3LS1A 5AGFA 2OJQA 1E85A 1QZXA 2R9RB 1T6UA 1ZW2A 4DJ9A 1Z7Qc 1L7CA 2XM4A 3SNHA 1Q0GA 1MMGA 2R7VA 4QDLA 2M4EA 1DOWA 2Y3BA 1YDIA 4YN0B 1ORJA 1WATA 2Q00A 5JS5A 2W4BA 4BJ1A 2A0BA 3IQTA 3C8GB 4RDAA 4YT4A 2NG1A 3E70C 3H65A 4IWBA 4CS9A 4OIQF 2R7TA 4N06A 3C7JA 5D91A 5DQZA 4IB4A 4HFFB 2DI3A 3LLIA 3RVZA 3EPVA 2YL1A 2J46A 2WZGA 3US6A 2CNWD 4RBNA 3WHNA 1TKNA 3IHUA 4EBKA 2ICWG 3EFOB 3EJNA 3UMKA 4DRHB 4JZAA 3PMRA 2ZXRA 4DRIB 4O6MA 2YL3A 1QQ3A 3FAPB 3LAYA 1LE4A 3ITFA 3POVA 1NFOA 1ZHYA 2L6FA 2YVKA 3W2WA 4A4AA 4DVZA 5HV9A 1QSPA 2IXPA 4JCZA 5L3QA 4JTCB 3R2PA 4MTFA 2YZSA 4JURI 4LDQA 4J7TA 2WVOA 3DI5A 3FMSA 2PF4E 4LERA 4PJMA 4C3DA 3EQLF 1A0BA 1JPNA 1OCCC 1JOGA 2WL8A 2XS8A 1CGME 3JYHA 5COMA 4C7OA 1M56C 3I4UA 2EINC 4JRZA 5GPGB 1YARO 1Z3IX 4U5EE 3RFYA 1LI5A 5BQHA 1OW7A 2W9YA 5E3CA 4I44A 1W2WA 1ZU4A 3BEHA 3H2UA 3LNMB 5BUOA 1OQCA 4YL1A 1AUEA 1T9KA 3RIPA 4C7OB 2NUTB 3V5ZA 1MMAA 1WGWA 4WJ0A 4MW3A 4MTOA 3RF3A 2YLIA 1CGOA 3JRMO 1TWAA 3Q6MA 4O6YA 1L3PA 3K6BA 1LI7A 3L0IA 4DRJB 3AGTA 1G4WR 3F46A 2XXAA 5T3TA 1LS1A 2WVNA 3FHDA 3A11A 4C3BA 1M2OA 1OW8A 1R5ID 3OA1A 2EPOA 4QI0A 3T6JA 2JD3A 3Q7LA 4BJTA 3HKKA 3AG1C 3OWTA 1H6GA 3HNJA 1WTYA 3O10A 1NZEA 1VOMA 3N2ZB 1WWPA 3RH3A 4CS7A 3ASOC 2ZXPA 4W8PA 5F28E 2J7PD 3C18A 3ZG1A 4WGYA 5L0JA 2ZD9A 2C04A 2IYLD 4JW1A 4NQFA 4E18A 2HSQA 3C62A 4NC3A 5FCLA 1BR2A 3PHF2 2UUHA 1PCXA 2XLWA 2HSBA 1YZCA 3DMDA 3SXKA 4PFPA 3DM9B 4KC9A 4CDVA 4JKVA 1Q0DA 1NG1A 2WZLA 3ABMC 2VC9A 3LUTB 5L3VA 4CS8C 3B9QA 3DJUB 4RD9A 3UGPA 4IARA 1EQ1A 1JR8A 4XPXA 4BJ5C 5E3AA 5JT4A 3JZ0A 1IW7F 3DXJF 3F47A 1QLEC 2YHSA 1TWHA 1YAUO 1ZVZA 2LP4A 3TULA 1D1CA 4OD4A 3E9VA 2OKUA 3FAJA 3GANA 5E33A 1M57C 4CS9C 3U8PA 1TQGA 5KYWA 3B29A 3GM3A 1APCA 3CZ6A 3L34A 1CGNA 2HFIA 1O5HA 4HE8D 3K66A 1NU9C 1HE1A 3ZDLA 3W8HA 1ZU5A 2DYSC 3HJCA 3ZSUA 5HSWA 3V5XA 3ZIBA 5JP7A 2Y3HA 3MYIA 3LJBA 4ULVA 3DD7A 3Q6NA 2H8AA 3CEXA 4J30B 1Y4CA 3LESA 4EKWA 1QKRA 5CIVA 4J7YA 4LLEA 2ETSA 5AC4A 3HNIA 2VASA 4IJJA 5COFA 1NLXA 2HUJA 1F1MA 1G8XA 2BE5F 3C8ZA 3DZAA 5F5HA 4BJ6C 4G7OF 1SR2A 3DM5A 4F4BA 1YYXA 1OXKA 4XPWA 1HW1A 3N24A 4XPYA 2KNHA 3C63A 4E0IA 1K40A 4LDKA 3TOLA 3G4ZA 1E83A 3LEOA 3KH2A 2J9UA 2J8WA 1AEPA 1A7EA 4O6NA 4N6CA 4BJ5A 3SZRA 2B0HA 3NYJA 4WABA 3C8GA 3EFOA 3QVZA 2WVQA 3VRCA 1WN0A 4AL1A 1PD1A 3QZCA 4Z9IA 2LD6A 4LDRA 3RW0A 1N1CA 1XZPA 3S29A 1FR0A 4GQHA 2FGYA 4XTKA 4EBBA 3S9OA 3B0VC 2MHRA 4YJWA 3U9JA 1NBBA 3QW0A 2A1DD 1FNTc 3EG9B 3SYNA 2KW3C 1RKCA 1SMYF 4K7BA 1D0ZA 4U9EA 4Q4ZF 1HMOA 5JLIA 1K05A 2R7OA 3RVYA 4XEVA 2KK1A 1Z6AA 2XL8A 5T3WA 2IXMA 4JVSA 4B6IA 4ONSA 3TK0A 3GEIA 5F5FA 3CSKA 3ABLC 3MYFA 1VMAA 2DGJA 2HV7A 2NUPA 3AQCA 3IQ6A 2NSFA 4YK5A 3T9OA 4CIHA 2PFDA 2QLAA 1GS9A 3NKEA 3NMKA 3W2VA 1BR4A 5KYXA 3WODF 1HY5A 1T5OA 4YL3A 2HZ8A 4CJOA 2J45A 4U9DA 4AL0A 4G78A 5BQGA 2JPUA 3SXYA 4PK4A 1PV3A 4KNVA 1C17M 3V5YA 2JX0A 3KL4A 1J8YF 1RKEB 5DS4A 4NTFA 4Q5SF 4GEHA 4PJJA 5DS5A 2IXOA 1OCRC 2R25A 1MNDA 4W8KA 1FFHA 1ZHXA 2J9WA 2OCCC 1T6IA 2Q9AA 1MQVA 1A7DA 4O79A 1GQAA 3U9MA 2HS5A 2Y69C 1WASA 1ZYRF 1FMVA 4H4KC 2PP4A 5D92A 1V55C 1KNYA 2GWWA 2RD9A 3EZHA 3LNRA 3Q7GA 4I1MA 2EILC 4U5FE 3VAYA 2EIKC 3ZVRA 4AK9A 4HFKB 1T01A 2R7SA 4YT8A 2LSEA 3GODA 2G3VA 1VYIA 4JJFA 3EHNA 1TWGA 1E86A 5B3IA 2OOCA 1D1BA 4AE4A 1M6TA 1YLMA 3LS0A 2YWAA 4IRUA 2D5RB 4D4NA 3ZTMA 3KYJA 5A6BA 3NDBB 1VYKA 3MBGA 2HKVA 2R7WA 4N4WA 3M15A 2QUPA 2L6HA 4GYTA 4EUKB 3EZIA 2NUPB 1HW2A 2J7PA 2PX3A 2F22A 5B1BC 3AOUA 3T4RA 3M1CB 1CPQA 1I5NA 1OW6A 1UFBA 2PBEA 3KMIA 4KBLA 4U5GA 5L0HA 3NMIA 5CI9A 4DVYP 4JC7A 1D1AA 2AVKA 1RJ9A 2EIMC 2OEVA 1RXQA 2LQGA 2Y3DA 3EH1A 3M4CA 3MX3A 4LLCA 4NY3A 3G50A 2XS1A 3PCVA 1ORYA 2KGOA 3BRJA 4KNWA 4MQ9F 4P9TA 2YKZA 2I8BA 4MVZA 4OINF 2P1AA 4MS2A 2OJED 3IQ5A 1FFTC 4EIYA 3U5SA 1BR1A 5KYWB 3I5PA 3JYYA 5EGYA 4YL0A 3HLZA 2QNLA 3UR3C 1SZIA 2YL7A 4HEAJ 2GDCA 1VLTA 3H2VA 4DOZA 1A41A 1OXBA 4K0DA 1MMNA 3S90A 5L0FA 2XRHA 3O39A 2DB4A 2LCHA 4WGZA 2HMZA 4OD5A 1GM5A 2Y39A 2L7AA 4PJLA 2IBFA 3TQOA 4A2NB 5DLJA 4EHPA 3K1HA 4U5CE 1RMVA 1XWJA 4PACA 2YLGA 4XLNF 4J32B 5K0IA 1HMDA 2VCBA 3DE9A 4N6HA 3EGDA 3L1MA 5B3SC 4NTAA 5A6JA 1PD0A 1Q0FA 4Q7CA 2AWYA 4U5BE 1U0BB 3RQGA 2BC5A 2P6VA 1FMWA 1KTMA 2I15A 1H7IA 3RQFA 2XXAB 1K04A 2R7QA 1TWCA 1ZHZA 3K1IA 3VYWA 1ZZPA 1VLSA 3TOMA 1YJGA 2XLVA 3L8IA 2FFHA 2HV6A 2WB7A 4JTDB 2H7BA 1NSGB 4L6RA 3ZC4A 4I3MA 1Z23A 4IAQA 4LACB 2VCCA 2C03A 4MVUA 5TJ5E 3W8IA 4I1OB 1YYJA 1YA9A 1ST6A 2E87A 3GWLA 2YLDA 1B68A 2NSGA 1YZAA 2QTVA 3IQCA 1BBHA 2UUIA 4P6IC 4YWQA 3S27A 4ZLDA 3GEEA 4NCQA 3K33A 3NKDA 1RJ9B 3NYMA 4U5DE 2XLOA 2PNOA 3NYLA 1MMDA 3VM6A 2XM0A 2KYHA 3KYIA 4JCHA 1G4US 4MVRA 5KYUB 4PR9A 3X1OA 4E0HA 5B1AC 1OCZC 4O7GA 3JSZA 4BPMA 5KYYB 3ATPA 3DAFA 5A6KA 5DQTA 1OKKD 3EGDB 2GA0A 4KI2A 3JTLO 2P61A 2XLMA 2A6EF 3JCUQ 4G7ZF 3MLGA 4XEFA 2P7VA 2Q7RA 3J06A 2IM8A 3UNGC 4DXWA 3KKBA 3CAXA 4AE4B 5L0IA 2LFFA 2O9XA 4PFOA 3W4YA 2OEXA 2YEVA 5JRAA 2OQMA 1LKXA 1JPJA 2H7VC 2YL0A 4XEKA 4BEJA 5BQIA 3B0UX 4MVOA 1BZ4A 1M2VA 3OEOA 3ABKC 5EK0A 3ZQYA 4Z9HA 1EA8A 3FOOA 4BG0A 2WZFA 3AJMA 5IY5C 2A0UA 2R02A 5KYUA 3DKAA 4XWJA 4H54A 1ZHTA 3FXHA 2KSFA 1Z63A 2DYRC 2ZXOA 5DVWA 1YA7O 4E7ZA 2AWCA 4DBQA 5COGA 3EGXA 1Q0KA 1GGQA 2Z15A 2CDQA 3TJ5A 5KYXB 5T1DB 4XLPF 2GAQA 3DWWA 2XL4A 3ECSA 3HNKA 1V54C 4X0RA 1ZW3A 1U6HA 1LPEA 3V7OA 3JT1A 2HMQA 3VF0A 1TFOB 5AC5A 2J0WA 1UG7A 2IXNA 1XZQA 4EWCA 1WOLA 3R7CA 4ER9A 3U0CA 2LK4A 3EH2A 3O55A 3RKOF 3EG9A 2XL6A 3M79A 3M4BA 4ULWA 3RQEA 3G4XA 2VCAA 4DBRA 2Q3TA 2L81A 3LLKA 1LIHA 2L6GA 1MNEA 2P0NA 3SEOA 4ANJA 3HNLA 2MYSA 2Y3GA 1EI7A 4U5HA 2XLHA 2YQYA 3U8VA 1VTMP 3JSEO 3NMJA 4C3EA 2AP3A 2R7XA 5E2QA 2TMVP 2X51A 2YRFA 3O6XA 2W4MA 2VH3A 4BJ6A 3KPHA 2ASRA 3T6GB 3QVYA 4CDYA 4QI2A 2M64A 4JTAB 4CIPA 3GORA 4EBJA 1M2VB 4FX5A 5KYYA 4JEAA 1U89A 2OG2A 3WAQA 3IPMO 3AGUA 1CPRA 1SYQA 3QMKA 1OR2A 3GM2A 4JIOA 1V4AA 3AG3C 5FZTA 1G5ZA 1BDJB 1VB5A 2GFHA 2KQ9A 4R32A 1NU7D 3TD7A 2CNWA 1RKEA 4CSAA 3SP1A 2NPUA 3JRTA 3T6BA 2KC3A 1ORSC 3I5QA 5L0DA 2HJMA 4PJNA 3ZWIA 3CQZA 1TFKB 3B0PA 3U2MA 1OCOC 4JEBA 1IZMA 2A68F 1V74B 4CX9A 1I4ZA 1LVKA 2A69F 2G3KA 1DOVA 1E84A 2VB6A 1E2XA 1LE2A 4G7HF 4MW8A 2EIJC 4UDVA 3GM1A 4MNDA 4IGGA 1Y6DA 1JRAA 1Q0MA 1JAFA 2EPMX 256BA 2EPLX 2MWQA 1SF8A 2XLDA 3MFNA 1VK5A 4P9FA 2Q9CA 3AG4C 4CS8A 4OIRF 2LFDA 2R05A 1HE9A 2B0JA 3U3BA 3FOPA 2ZPAA 2QE9A 2J0XA 2NUTA 1LM3B 4E7SA 4AX2A 5L0GA 3U3FA 3EGXB 4MVSA 4YT5A 3DAGA 2J9VA 4MVMA 2EPKX 1YVIA 2XSEA 4BEMJ 3DJNB 2KJGA 1OR3A 1QVXA 3C8GD 5A69A 5L0CA 3S84A 3GEHA 4XQ1A 3TJ6A 3ZTZA 1T6QA 1ZHWA 2A6HF 5JVEA 2OU6A 2RSEB 3U2LA 2J9BA 4JJGA 2CYDA 1R4TA 2BL2A 2IOQA 2V26A 3QTHA 2R03A 3NG1A 5JSLA 4ZLCA 3UMIA 4OIPF 1TR2A 3SXMA 2G62A 1Z5ZA 3S28A 5EHHA 1A7VA 2ZXWC 5A6AA 4MVQA 2HJ3A 3N0TA 1I4YA 3L8JA 1AVOB 4FESA 3UMHA 4NTBA 3S0XA 4IAOA 3IEEA 2Q9BA 4G0HA 2R7RA 1FTSA 1KU2A 1H9GA 4FWVA 5JUAA 3UGOA 4K1OA 2FAPB 2D4UA 1D0YA 3HTKC 5CI8A 4E17A 2CGEA 2LIGA 2Q4FA 5A6BD 4CJGA 2V3CC 4JE9A 1O87A 1LS4A 2QY9A 1J8MF 1O3UA 3B71A 3AG2C 4CBEA 1NFNA 2CCYA 3LEVA 3FDQA 1C02A 1S7ZA 3K1IC 4M63A 2W45A 3X2QC 1H9TA 4YT2A 3K7DA 3RYLA 2R7UA 2X0CA 1C03A 4D4XA 2XLEA 1S05A 1EKYA 4MTGA 3NRHA 5DS6A 2L9JA 3GWNA 4Z9JA 1FAPB 3AQBA 2EPNA 3ASNC 4CDAA 5KYNA 4CSAC 1JMWA 3ZQVA 2H7OA 4OIOF 2CW0F 1RCPA 4FAPB 1OKKA 3WG7C 1QPUA
chains in the Genus database with same CATH topology
1AUEA 4DRHB 2RSEB 4DRJB 2GAQA 4DRIB 4FAPB 3FAPB 5GPGB 2FAPB 2NPUA 1NSGB 1FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUE A;  4DRH B;  2RSE B;  4DRJ B;  2GAQ A;  4DRI B;  4FAP B;  3FAP B;  5GPG B;  2FAP B;  2NPU A;  1NSG B;  1FAP B; 
#chains in the Genus database with same CATH topology
 3SXZ A;  3EHM A;  3QW1 A;  3PDM P;  2AU5 A;  3A9C A;  2PX0 A;  1D0X A;  3FVY A;  3DE8 A;  3LS1 A;  5AGF A;  2OJQ A;  1E85 A;  1QZX A;  2R9R B;  1T6U A;  1ZW2 A;  4DJ9 A;  1Z7Q c;  1L7C A;  2XM4 A;  3SNH A;  1Q0G A;  1MMG A;  2R7V A;  4QDL A;  2M4E A;  1DOW A;  2Y3B A;  1YDI A;  4YN0 B;  1ORJ A;  1WAT A;  2Q00 A;  5JS5 A;  2W4B A;  4BJ1 A;  2A0B A;  3IQT A;  3C8G B;  4RDA A;  4YT4 A;  2NG1 A;  3E70 C;  3H65 A;  4IWB A;  4CS9 A;  4OIQ F;  2R7T A;  4N06 A;  3C7J A;  5D91 A;  5DQZ A;  4IB4 A;  4HFF B;  2DI3 A;  3LLI A;  3RVZ A;  3EPV A;  2YL1 A;  2J46 A;  2WZG A;  3US6 A;  2CNW D;  4RBN A;  3WHN A;  1TKN A;  3IHU A;  4EBK A;  2ICW G;  3EFO B;  3EJN A;  3UMK A;  4DRH B;  4JZA A;  3PMR A;  2ZXR A;  4DRI B;  4O6M A;  2YL3 A;  1QQ3 A;  3FAP B;  3LAY A;  1LE4 A;  3ITF A;  3POV A;  1NFO A;  1ZHY A;  2L6F A;  2YVK A;  3W2W A;  4A4A A;  4DVZ A;  5HV9 A;  1QSP A;  2IXP A;  4JCZ A;  5L3Q A;  4JTC B;  3R2P A;  4MTF A;  2YZS A;  4JUR I;  4LDQ A;  4J7T A;  2WVO A;  3DI5 A;  3FMS A;  2PF4 E;  4LER A;  4PJM A;  4C3D A;  3EQL F;  1A0B A;  1JPN A;  1OCC C;  1JOG A;  2WL8 A;  2XS8 A;  1CGM E;  3JYH A;  5COM A;  4C7O A;  1M56 C;  3I4U A;  2EIN C;  4JRZ A;  5GPG B;  1YAR O;  1Z3I X;  4U5E E;  3RFY A;  1LI5 A;  5BQH A;  1OW7 A;  2W9Y A;  5E3C A;  4I44 A;  1W2W A;  1ZU4 A;  3BEH A;  3H2U A;  3LNM B;  5BUO A;  1OQC A;  4YL1 A;  1AUE A;  1T9K A;  3RIP A;  4C7O B;  2NUT B;  3V5Z A;  1MMA A;  1WGW A;  4WJ0 A;  4MW3 A;  4MTO A;  3RF3 A;  2YLI A;  1CGO A;  3JRM O;  1TWA A;  3Q6M A;  4O6Y A;  1L3P A;  3K6B A;  1LI7 A;  3L0I A;  4DRJ B;  3AGT A;  1G4W R;  3F46 A;  2XXA A;  5T3T A;  1LS1 A;  2WVN A;  3FHD A;  3A11 A;  4C3B A;  1M2O A;  1OW8 A;  1R5I D;  3OA1 A;  2EPO A;  4QI0 A;  3T6J A;  2JD3 A;  3Q7L A;  4BJT A;  3HKK A;  3AG1 C;  3OWT A;  1H6G A;  3HNJ A;  1WTY A;  3O10 A;  1NZE A;  1VOM A;  3N2Z B;  1WWP A;  3RH3 A;  4CS7 A;  3ASO C;  2ZXP A;  4W8P A;  5F28 E;  2J7P D;  3C18 A;  3ZG1 A;  4WGY A;  5L0J A;  2ZD9 A;  2C04 A;  2IYL D;  4JW1 A;  4NQF A;  4E18 A;  2HSQ A;  3C62 A;  4NC3 A;  5FCL A;  1BR2 A;  3PHF 2;  2UUH A;  1PCX A;  2XLW A;  2HSB A;  1YZC A;  3DMD A;  3SXK A;  4PFP A;  3DM9 B;  4KC9 A;  4CDV A;  4JKV A;  1Q0D A;  1NG1 A;  2WZL A;  3ABM C;  2VC9 A;  3LUT B;  5L3V A;  4CS8 C;  3B9Q A;  3DJU B;  4RD9 A;  3UGP A;  4IAR A;  1EQ1 A;  1JR8 A;  4XPX A;  4BJ5 C;  5E3A A;  5JT4 A;  3JZ0 A;  1IW7 F;  3DXJ F;  3F47 A;  1QLE C;  2YHS A;  1TWH A;  1YAU O;  1ZVZ A;  2LP4 A;  3TUL A;  1D1C A;  4OD4 A;  3E9V A;  2OKU A;  3FAJ A;  3GAN A;  5E33 A;  1M57 C;  4CS9 C;  3U8P A;  1TQG A;  5KYW A;  3B29 A;  3GM3 A;  1APC A;  3CZ6 A;  3L34 A;  1CGN A;  2HFI A;  1O5H A;  4HE8 D;  3K66 A;  1NU9 C;  1HE1 A;  3ZDL A;  3W8H A;  1ZU5 A;  2DYS C;  3HJC A;  3ZSU A;  5HSW A;  3V5X A;  3ZIB A;  5JP7 A;  2Y3H A;  3MYI A;  3LJB A;  4ULV A;  3DD7 A;  3Q6N A;  2H8A A;  3CEX A;  4J30 B;  1Y4C A;  3LES A;  4EKW A;  1QKR A;  5CIV A;  4J7Y A;  4LLE A;  2ETS A;  5AC4 A;  3HNI A;  2VAS A;  4IJJ A;  5COF A;  1NLX A;  2HUJ A;  1F1M A;  1G8X A;  2BE5 F;  3C8Z A;  3DZA A;  5F5H A;  4BJ6 C;  4G7O F;  1SR2 A;  3DM5 A;  4F4B A;  1YYX A;  1OXK A;  4XPW A;  1HW1 A;  3N24 A;  4XPY A;  2KNH A;  3C63 A;  4E0I A;  1K40 A;  4LDK A;  3TOL A;  3G4Z A;  1E83 A;  3LEO A;  3KH2 A;  2J9U A;  2J8W A;  1AEP A;  1A7E A;  4O6N A;  4N6C A;  4BJ5 A;  3SZR A;  2B0H A;  3NYJ A;  4WAB A;  3C8G A;  3EFO A;  3QVZ A;  2WVQ A;  3VRC A;  1WN0 A;  4AL1 A;  1PD1 A;  3QZC A;  4Z9I A;  2LD6 A;  4LDR A;  3RW0 A;  1N1C A;  1XZP A;  3S29 A;  1FR0 A;  4GQH A;  2FGY A;  4XTK A;  4EBB A;  3S9O A;  3B0V C;  2MHR A;  4YJW A;  3U9J A;  1NBB A;  3QW0 A;  2A1D D;  1FNT c;  3EG9 B;  3SYN A;  2KW3 C;  1RKC A;  1SMY F;  4K7B A;  1D0Z A;  4U9E A;  4Q4Z F;  1HMO A;  5JLI A;  1K05 A;  2R7O A;  3RVY A;  4XEV A;  2KK1 A;  1Z6A A;  2XL8 A;  5T3W A;  2IXM A;  4JVS A;  4B6I A;  4ONS A;  3TK0 A;  3GEI A;  5F5F A;  3CSK A;  3ABL C;  3MYF A;  1VMA A;  2DGJ A;  2HV7 A;  2NUP A;  3AQC A;  3IQ6 A;  2NSF A;  4YK5 A;  3T9O A;  4CIH A;  2PFD A;  2QLA A;  1GS9 A;  3NKE A;  3NMK A;  3W2V A;  1BR4 A;  5KYX A;  3WOD F;  1HY5 A;  1T5O A;  4YL3 A;  2HZ8 A;  4CJO A;  2J45 A;  4U9D A;  4AL0 A;  4G78 A;  5BQG A;  2JPU A;  3SXY A;  4PK4 A;  1PV3 A;  4KNV A;  1C17 M;  3V5Y A;  2JX0 A;  3KL4 A;  1J8Y F;  1RKE B;  5DS4 A;  4NTF A;  4Q5S F;  4GEH A;  4PJJ A;  5DS5 A;  2IXO A;  1OCR C;  2R25 A;  1MND A;  4W8K A;  1FFH A;  1ZHX A;  2J9W A;  2OCC C;  1T6I A;  2Q9A A;  1MQV A;  1A7D A;  4O79 A;  1GQA A;  3U9M A;  2HS5 A;  2Y69 C;  1WAS A;  1ZYR F;  1FMV A;  4H4K C;  2PP4 A;  5D92 A;  1V55 C;  1KNY A;  2GWW A;  2RD9 A;  3EZH A;  3LNR A;  3Q7G A;  4I1M A;  2EIL C;  4U5F E;  3VAY A;  2EIK C;  3ZVR A;  4AK9 A;  4HFK B;  1T01 A;  2R7S A;  4YT8 A;  2LSE A;  3GOD A;  2G3V A;  1VYI A;  4JJF A;  3EHN A;  1TWG A;  1E86 A;  5B3I A;  2OOC A;  1D1B A;  4AE4 A;  1M6T A;  1YLM A;  3LS0 A;  2YWA A;  4IRU A;  2D5R B;  4D4N A;  3ZTM A;  3KYJ A;  5A6B A;  3NDB B;  1VYK A;  3MBG A;  2HKV A;  2R7W A;  4N4W A;  3M15 A;  2QUP A;  2L6H A;  4GYT A;  4EUK B;  3EZI A;  2NUP B;  1HW2 A;  2J7P A;  2PX3 A;  2F22 A;  5B1B C;  3AOU A;  3T4R A;  3M1C B;  1CPQ A;  1I5N A;  1OW6 A;  1UFB A;  2PBE A;  3KMI A;  4KBL A;  4U5G A;  5L0H A;  3NMI A;  5CI9 A;  4DVY P;  4JC7 A;  1D1A A;  2AVK A;  1RJ9 A;  2EIM C;  2OEV A;  1RXQ A;  2LQG A;  2Y3D A;  3EH1 A;  3M4C A;  3MX3 A;  4LLC A;  4NY3 A;  3G50 A;  2XS1 A;  3PCV A;  1ORY A;  2KGO A;  3BRJ A;  4KNW A;  4MQ9 F;  4P9T A;  2YKZ A;  2I8B A;  4MVZ A;  4OIN F;  2P1A A;  4MS2 A;  2OJE D;  3IQ5 A;  1FFT C;  4EIY A;  3U5S A;  1BR1 A;  5KYW B;  3I5P A;  3JYY A;  5EGY A;  4YL0 A;  3HLZ A;  2QNL A;  3UR3 C;  1SZI A;  2YL7 A;  4HEA J;  2GDC A;  1VLT A;  3H2V A;  4DOZ A;  1A41 A;  1OXB A;  4K0D A;  1MMN A;  3S90 A;  5L0F A;  2XRH A;  3O39 A;  2DB4 A;  2LCH A;  4WGZ A;  2HMZ A;  4OD5 A;  1GM5 A;  2Y39 A;  2L7A A;  4PJL A;  2IBF A;  3TQO A;  4A2N B;  5DLJ A;  4EHP A;  3K1H A;  4U5C E;  1RMV A;  1XWJ A;  4PAC A;  2YLG A;  4XLN F;  4J32 B;  5K0I A;  1HMD A;  2VCB A;  3DE9 A;  4N6H A;  3EGD A;  3L1M A;  5B3S C;  4NTA A;  5A6J A;  1PD0 A;  1Q0F A;  4Q7C A;  2AWY A;  4U5B E;  1U0B B;  3RQG A;  2BC5 A;  2P6V A;  1FMW A;  1KTM A;  2I15 A;  1H7I A;  3RQF A;  2XXA B;  1K04 A;  2R7Q A;  1TWC A;  1ZHZ A;  3K1I A;  3VYW A;  1ZZP A;  1VLS A;  3TOM A;  1YJG A;  2XLV A;  3L8I A;  2FFH A;  2HV6 A;  2WB7 A;  4JTD B;  2H7B A;  1NSG B;  4L6R A;  3ZC4 A;  4I3M A;  1Z23 A;  4IAQ A;  4LAC B;  2VCC A;  2C03 A;  4MVU A;  5TJ5 E;  3W8I A;  4I1O B;  1YYJ A;  1YA9 A;  1ST6 A;  2E87 A;  3GWL A;  2YLD A;  1B68 A;  2NSG A;  1YZA A;  2QTV A;  3IQC A;  1BBH A;  2UUI A;  4P6I C;  4YWQ A;  3S27 A;  4ZLD A;  3GEE A;  4NCQ A;  3K33 A;  3NKD A;  1RJ9 B;  3NYM A;  4U5D E;  2XLO A;  2PNO A;  3NYL A;  1MMD A;  3VM6 A;  2XM0 A;  2KYH A;  3KYI A;  4JCH A;  1G4U S;  4MVR A;  5KYU B;  4PR9 A;  3X1O A;  4E0H A;  5B1A C;  1OCZ C;  4O7G A;  3JSZ A;  4BPM A;  5KYY B;  3ATP A;  3DAF A;  5A6K A;  5DQT A;  1OKK D;  3EGD B;  2GA0 A;  4KI2 A;  3JTL O;  2P61 A;  2XLM A;  2A6E F;  3JCU Q;  4G7Z F;  3MLG A;  4XEF A;  2P7V A;  2Q7R A;  3J06 A;  2IM8 A;  3UNG C;  4DXW A;  3KKB A;  3CAX A;  4AE4 B;  5L0I A;  2LFF A;  2O9X A;  4PFO A;  3W4Y A;  2OEX A;  2YEV A;  5JRA A;  2OQM A;  1LKX A;  1JPJ A;  2H7V C;  2YL0 A;  4XEK A;  4BEJ A;  5BQI A;  3B0U X;  4MVO A;  1BZ4 A;  1M2V A;  3OEO A;  3ABK C;  5EK0 A;  3ZQY A;  4Z9H A;  1EA8 A;  3FOO A;  4BG0 A;  2WZF A;  3AJM A;  5IY5 C;  2A0U A;  2R02 A;  5KYU A;  3DKA A;  4XWJ A;  4H54 A;  1ZHT A;  3FXH A;  2KSF A;  1Z63 A;  2DYR C;  2ZXO A;  5DVW A;  1YA7 O;  4E7Z A;  2AWC A;  4DBQ A;  5COG A;  3EGX A;  1Q0K A;  1GGQ A;  2Z15 A;  2CDQ A;  3TJ5 A;  5KYX B;  5T1D B;  4XLP F;  2GAQ A;  3DWW A;  2XL4 A;  3ECS A;  3HNK A;  1V54 C;  4X0R A;  1ZW3 A;  1U6H A;  1LPE A;  3V7O A;  3JT1 A;  2HMQ A;  3VF0 A;  1TFO B;  5AC5 A;  2J0W A;  1UG7 A;  2IXN A;  1XZQ A;  4EWC A;  1WOL A;  3R7C A;  4ER9 A;  3U0C A;  2LK4 A;  3EH2 A;  3O55 A;  3RKO F;  3EG9 A;  2XL6 A;  3M79 A;  3M4B A;  4ULW A;  3RQE A;  3G4X A;  2VCA A;  4DBR A;  2Q3T A;  2L81 A;  3LLK A;  1LIH A;  2L6G A;  1MNE A;  2P0N A;  3SEO A;  4ANJ A;  3HNL A;  2MYS A;  2Y3G A;  1EI7 A;  4U5H A;  2XLH A;  2YQY A;  3U8V A;  1VTM P;  3JSE O;  3NMJ A;  4C3E A;  2AP3 A;  2R7X A;  5E2Q A;  2TMV P;  2X51 A;  2YRF A;  3O6X A;  2W4M A;  2VH3 A;  4BJ6 A;  3KPH A;  2ASR A;  3T6G B;  3QVY A;  4CDY A;  4QI2 A;  2M64 A;  4JTA B;  4CIP A;  3GOR A;  4EBJ A;  1M2V B;  4FX5 A;  5KYY A;  4JEA A;  1U89 A;  2OG2 A;  3WAQ A;  3IPM O;  3AGU A;  1CPR A;  1SYQ A;  3QMK A;  1OR2 A;  3GM2 A;  4JIO A;  1V4A A;  3AG3 C;  5FZT A;  1G5Z A;  1BDJ B;  1VB5 A;  2GFH A;  2KQ9 A;  4R32 A;  1NU7 D;  3TD7 A;  2CNW A;  1RKE A;  4CSA A;  3SP1 A;  2NPU A;  3JRT A;  3T6B A;  2KC3 A;  1ORS C;  3I5Q A;  5L0D A;  2HJM A;  4PJN A;  3ZWI A;  3CQZ A;  1TFK B;  3B0P A;  3U2M A;  1OCO C;  4JEB A;  1IZM A;  2A68 F;  1V74 B;  4CX9 A;  1I4Z A;  1LVK A;  2A69 F;  2G3K A;  1DOV A;  1E84 A;  2VB6 A;  1E2X A;  1LE2 A;  4G7H F;  4MW8 A;  2EIJ C;  4UDV A;  3GM1 A;  4MND A;  4IGG A;  1Y6D A;  1JRA A;  1Q0M A;  1JAF A;  2EPM X;  256B A;  2EPL X;  2MWQ A;  1SF8 A;  2XLD A;  3MFN A;  1VK5 A;  4P9F A;  2Q9C A;  3AG4 C;  4CS8 A;  4OIR F;  2LFD A;  2R05 A;  1HE9 A;  2B0J A;  3U3B A;  3FOP A;  2ZPA A;  2QE9 A;  2J0X A;  2NUT A;  1LM3 B;  4E7S A;  4AX2 A;  5L0G A;  3U3F A;  3EGX B;  4MVS A;  4YT5 A;  3DAG A;  2J9V A;  4MVM A;  2EPK X;  1YVI A;  2XSE A;  4BEM J;  3DJN B;  2KJG A;  1OR3 A;  1QVX A;  3C8G D;  5A69 A;  5L0C A;  3S84 A;  3GEH A;  4XQ1 A;  3TJ6 A;  3ZTZ A;  1T6Q A;  1ZHW A;  2A6H F;  5JVE A;  2OU6 A;  2RSE B;  3U2L A;  2J9B A;  4JJG A;  2CYD A;  1R4T A;  2BL2 A;  2IOQ A;  2V26 A;  3QTH A;  2R03 A;  3NG1 A;  5JSL A;  4ZLC A;  3UMI A;  4OIP F;  1TR2 A;  3SXM A;  2G62 A;  1Z5Z A;  3S28 A;  5EHH A;  1A7V A;  2ZXW C;  5A6A A;  4MVQ A;  2HJ3 A;  3N0T A;  1I4Y A;  3L8J A;  1AVO B;  4FES A;  3UMH A;  4NTB A;  3S0X A;  4IAO A;  3IEE A;  2Q9B A;  4G0H A;  2R7R A;  1FTS A;  1KU2 A;  1H9G A;  4FWV A;  5JUA A;  3UGO A;  4K1O A;  2FAP B;  2D4U A;  1D0Y A;  3HTK C;  5CI8 A;  4E17 A;  2CGE A;  2LIG A;  2Q4F A;  5A6B D;  4CJG A;  2V3C C;  4JE9 A;  1O87 A;  1LS4 A;  2QY9 A;  1J8M F;  1O3U A;  3B71 A;  3AG2 C;  4CBE A;  1NFN A;  2CCY A;  3LEV A;  3FDQ A;  1C02 A;  1S7Z A;  3K1I C;  4M63 A;  2W45 A;  3X2Q C;  1H9T A;  4YT2 A;  3K7D A;  3RYL A;  2R7U A;  2X0C A;  1C03 A;  4D4X A;  2XLE A;  1S05 A;  1EKY A;  4MTG A;  3NRH A;  5DS6 A;  2L9J A;  3GWN A;  4Z9J A;  1FAP B;  3AQB A;  2EPN A;  3ASN C;  4CDA A;  5KYN A;  4CSA C;  1JMW A;  3ZQV A;  2H7O A;  4OIO F;  2CW0 F;  1RCP A;  4FAP B;  1OKK A;  3WG7 C;  1QPU A; 
#chains in the Genus database with same CATH homology
 1AUE A;  4DRH B;  2RSE B;  4DRJ B;  2GAQ A;  4DRI B;  4FAP B;  3FAP B;  5GPG B;  2FAP B;  2NPU A;  1NSG B;  1FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...