2FAPB

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 37
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2fapB00
2RSEB 4FAPB 4DRHB 2FAPB 1NSGB 4DRJB 5GPGB 4DRIB 1AUEA 3FAPB 1FAPB 2NPUA 2GAQA
chains in the Genus database with same CATH superfamily
3ASNC 3B71A 2HKVA 5CI9A 3PDMP 3LAYA 1G8XA 2NG1A 2OKUA 3QW1A 2QUPA 3MBGA 4C7OB 2WVNA 1GQAA 2J46A 2LQGA 2MYSA 4PK4A 5IY5C 2R7OA 3S90A 3NRHA 2LIGA 4J32B 4A2NB 2HV7A 3FOOA 1QPUA 4MVOA 2VASA 4IB4A 1MMGA 2A68F 4JW1A 4DJ9A 1FAPB 2XLWA 1MMNA 4M63A 3LLKA 4MVRA 4H4KC 1YAUO 3HLZA 1RJ9A 5D91A 1LE2A 3DXJF 4N4WA 5AC5A 1MMDA 2L9JA 2LD6A 1TR2A 2AWCA 2H7BA 2OU6A 4KI2A 4BJ5A 3K6BA 1FMVA 1PD1A 3RYLA 5L0HA 2QLAA 3ITFA 2XS8A 2YL0A 4I1MA 2C04A 4U9DA 3B9QA 3UNGC 4OINF 3EH2A 1JAFA 3M4BA 4JJGA 3ZIBA 5BQGA 1TWGA 3CZ6A 5L0CA 3ATPA 4JURI 3S29A 3WAQA 3IQ6A 4N06A 4ULVA 4XWJA 5K0IA 2Q9CA 2W45A 3IHUA 2ZXWC 4ER9A 1EA8A 4PFPA 2OQMA 4EHPA 3EG9A 5F28E 5KYYB 4LACB 1QLEC 2A0BA 1NU9C 256BA 1T01A 4YL1A 3JTLO 4O6NA 1RMVA 3U2MA 1OXKA 3Q6NA 3HJCA 1NFNA 2OOCA 3EZHA 3K1IA 4L6RA 2XLOA 4EBBA 2L81A 3EGXA 3TJ6A 1H7IA 4DRIB 2Q3TA 1V74B 3DE9A 3ABLC 4Z9JA 1SZIA 3DM5A 2YLDA 3L8IA 5AC4A 2R25A 3K66A 1U89A 3KMIA 4NTAA 2QTVA 1Y6DA 4GQHA 4YL3A 3T6JA 2V3CC 2VCCA 2YHSA 3QW0A 2BL2A 1ORYA 2X51A 3C8GA 2V26A 2XLHA 3EFOB 4YN0B 2HMZA 1ZHTA 3GEIA 3PCVA 2B0HA 1FTSA 2EINC 1SR2A 1Q0DA 1T6UA 3W8HA 3N24A 2PBEA 3NKDA 2R7WA 1YZCA 1OCRC 1QVXA 5B1AC 1CPRA 4IGGA 3FVYA 4ULWA 4CJGA 4EBJA 1RKEB 2XS1A 1XZQA 1A7EA 2R02A 4R32A 1G4US 3X2QC 3POVA 3W2WA 2R05A 2G3VA 4QDLA 1ZHYA 2XLDA 2IYLD 2EIJC 5CIVA 2XL8A 5KYUA 4CDVA 1NFOA 2EPNA 3C8ZA 1JPJA 1OR2A 2A1DD 3DE8A 3IPMO 4NC3A 4JCZA 4AE4B 4YT8A 1LI7A 1K05A 1QKRA 4DOZA 2HJ3A 4IWBA 2GWWA 3KKBA 4LDKA 4NCQA 4I44A 3S0XA 3H2VA 4BJ6A 3NYLA 3R7CA 3N2ZB 3X1OA 1A0BA 3FAJA 4DVYP 2NUPA 4GEHA 4CDAA 2KSFA 2XXAA 1YZAA 3ZQVA 3KYJA 3Q7LA 1D0XA 1TKNA 1UG7A 2GAQA 1ZHXA 3ASOC 5KYWB 2JD3A 1Z3IX 1FMWA 2TMVP 3DI5A 2WZFA 4ZLCA 3HTKC 3PMRA 1Y4CA 3OWTA 2HSQA 1TFKB 4WGZA 5T3TA 4BEJA 1HMDA 1LS4A 5JSLA 1WWPA 2LP4A 4K0DA 2KNHA 2P0NA 2VH3A 1YDIA 2YL7A 5E3AA 3V5YA 2AU5A 4CS9C 5B3SC 1TWHA 4HFFB 3SYNA 4J30B 2Y3BA 4ZLDA 3NYJA 2KJGA 1V55C 2XM0A 4OIRF 4ONSA 3U3FA 4LLCA 4E7SA 1LVKA 5L0GA 1Q0KA 1LM3B 1WOLA 5T3WA 4D4XA 1E86A 1Z6AA 3NKEA 3OA1A 4MNDA 1XZPA 3V5XA 3EJNA 4XPYA 3AG2C 3MYFA 3ZQYA 2HS5A 1JRAA 1ORSC 1OW7A 2D5RB 2J7PA 3UMHA 4E7ZA 1VB5A 3H65A 1JMWA 5A6BD 2O9XA 2R7QA 3CEXA 2ETSA 1Q0GA 3IQCA 3TK0A 3FHDA 5L0IA 1ZYRF 2IBFA 4U5EE 3VAYA 3I5PA 3QMKA 2EIMC 4YT5A 2YKZA 4YL0A 3C62A 4MW8A 3U9JA 2D4UA 2XLMA 2VCBA 3ABMC 2AVKA 2OJED 2XLEA 3T4RA 2WL8A 4OD4A 5L0FA 5DVWA 1RJ9B 1WATA 1ZU4A 2MHRA 3FAPB 1UFBA 3B29A 2QE9A 1AVOB 2ZXOA 2FAPB 1H9GA 1SF8A 2IOQA 1QZXA 4JEBA 4U5DE 5HSWA 4W8PA 2NPUA 1AEPA 3C63A 3U3BA 2P7VA 3LEOA 1L3PA 2ICWG 1HE1A 2EPOA 4I3MA 3RH3A 3IQTA 3RF3A 2NSFA 2B0JA 1YYXA 4PR9A 4U5FE 1SYQA 2JX0A 2AWYA 3AG3C 1XWJA 4N6HA 4D4NA 5DS4A 3U5SA 3JSZA 1OCZC 1ZZPA 3NMJA 1OKKD 1YLMA 3EZIA 3O39A 5FZTA 4CSAC 5L0JA 2Y69C 2A69F 1T6IA 1HY5A 1NLXA 2RSEB 4MVZA 1C02A 1OCOC 3LS0A 5CI8A 1ZHZA 3UGOA 2WVOA 2AP3A 3KPHA 1U0BB 2OEXA 4JIOA 2PFDA 3F47A 5DQTA 2LFDA 2HUJA 4WGYA 2NUTA 1GM5A 4FAPB 4K1OA 4XTKA 2LFFA 3EGXB 3NDBB 3I4UA 3JRMO 3S28A 3TD7A 4RDAA 3US6A 1QSPA 2C03A 2IXPA 5BUOA 4KNVA 3V7OA 4AK9A 1VYIA 2A0UA 3F46A 3M4CA 1OW8A 2YVKA 3C8GB 2J0WA 2YQYA 1T9KA 2P61A 1Q0FA 3DM9B 1OR3A 2WVQA 5L0DA 3FDQA 2R7RA 3UGPA 1H9TA 1D1CA 3ZTZA 3GODA 4U5GA 1CPQA 5KYXB 1NZEA 3S27A 1LIHA 1J8YF 1BZ4A 3TOLA 4O6MA 1M2VB 3L8JA 2CCYA 4WABA 2CDQA 3A9CA 3HNLA 3E9VA 1JR8A 3MLGA 3U8PA 2KQ9A 1HW1A 2OEVA 4XPXA 4YJWA 5T1DB 3JYYA 2I8BA 3C7JA 4G7HF 2MWQA 5F5FA 1MMAA 1PD0A 5KYUB 3HKKA 1YA7O 1R4TA 4G0HA 1EI7A 1VK5A 4DVZA 3GEHA 1L7CA 1DOWA 4YK5A 1DOVA 1JOGA 2R7VA 1G5ZA 1I5NA 2OJQA 3K33A 3M15A 2JPUA 4IJJA 3S84A 3DKAA 3W2VA 4OD5A 1WGWA 3HNIA 4Z9IA 5BQHA 2R7XA 4AL1A 2A6EF 2CW0F 5B1BC 4FX5A 1S7ZA 2NUPB 1D0ZA 2EILC 2YL1A 5A6KA 3AGUA 2I15A 3NMKA 2WZLA 3T6GB 4P6IC 1JPNA 3EGDB 1VLSA 3SXYA 2Q7RA 4DBQA 3LJBA 5L3QA 3CSKA 4O79A 2OCCC 4AL0A 3ZWIA 1S05A 3EFOA 4J7YA 4BJ5C 1CGME 2ZXPA 3GM2A 1RXQA 2XRHA 4DRHB 3GM3A 3RKOF 4MTOA 5E3CA 4C3DA 4YT4A 3FXHA 3ZDLA 4E18A 4U5CE 3ZVRA 2GDCA 1I4YA 2YWAA 3O10A 1RKEA 2VB6A 3EQLF 4XLNF 3RQEA 5EK0A 2E87A 1FNTc 1V4AA 1ZU5A 3DAGA 2GA0A 3RQGA 1T5OA 4JVSA 3CAXA 4CIPA 2L6HA 3IEEA 3H2UA 4NTBA 3U0CA 1RKCA 1TWAA 3OEOA 4MVUA 4WJ0A 3SXZA 2J0XA 3B0PA 4BG0A 2XSEA 3VRCA 2VCAA 1NU7D 1VLTA 2KW3C 1VYKA 2PX0A 3RW0A 1YJGA 2LCHA 4CBEA 5A6JA 2L7AA 3A11A 3RQFA 2YEVA 4E17A 4OIPF 2H8AA 2Y3HA 2HSBA 1FFHA 2EPLX 3K1IC 2G3KA 3R2PA 4KC9A 4CSAA 1VMAA 1WN0A 2J9VA 3O6XA 1A7VA 5F5HA 2HFIA 2PX3A 4Z9HA 3TQOA 2CNWD 2Y39A 4EKWA 1E83A 1CGNA 1KU2A 3DWWA 1D0YA 5GPGB 4CDYA 2EPKX 2PF4E 2FFHA 3LLIA 5A69A 4BJ1A 1CGOA 3G50A 1VTMP 4A4AA 3QVZA 3I5QA 2R03A 1OQCA 3EHNA 2LSEA 5TJ5E 4BEMJ 3LS1A 4E0HA 1EKYA 3TJ5A 3M79A 2YLGA 1MNEA 3L1MA 4PFOA 5FCLA 5A6BA 4G7ZF 1RCPA 4MTGA 4DRJB 5HV9A 5JUAA 5AGFA 5JVEA 4EUKB 4Q4ZF 4HE8D 1PV3A 3AQBA 3L34A 4X0RA 3ZSUA 4P9TA 4CS8C 3B0UX 1IZMA 2FGYA 2WB7A 2QY9A 4F4BA 1HW2A 1IW7F 3FOPA 3NG1A 5JS5A 1Z23A 1NG1A 1MQVA 3C18A 3LUTB 4O6YA 4PJMA 2J7PD 3SXMA 2Y3GA 3LESA 1U6HA 3KYIA 4BJ6C 1ZVZA 5EGYA 1LE4A 3RVZA 1FR0A 1FFTC 2J9BA 3CQZA 1Z7Qc 3JCUQ 3ECSA 5DS5A 2DYRC 2Y3DA 3AGTA 4XEFA 3GWLA 2IXOA 4LLEA 4EWCA 2CYDA 1KTMA 2NUTB 5B3IA 5A6AA 3ZC4A 3DZAA 1K40A 3EG9B 3FMSA 1OKKA 2W9YA 2YLIA 2VC9A 4GYTA 4JKVA 4NY3A 3VF0A 1ZHWA 1LPEA 4NQFA 4C7OA 3E70C 3M1CB 4JJFA 1BR1A 2YRFA 4MW3A 4QI0A 2W4BA 2XL4A 3Q6MA 1KNYA 1Z5ZA 4PJJA 4U9EA 3UMIA 4DBRA 2R7SA 2R7TA 3NMIA 1LKXA 4MVMA 2PNOA 2HV6A 3UR3C 4BPMA 3DMDA 4J7TA 1A7DA 1E84A 2P6VA 4G7OF 3SEOA 1TQGA 2IM8A 4HEAJ 4I1OB 1D1AA 3L0IA 2Q9BA 2KYHA 2LK4A 2IXMA 2J8WA 3G4XA 4PACA 5JRAA 1TWCA 3JZ0A 5DLJA 3B0VC 1HMOA 4MVSA 1ST6A 5JLIA 2EIKC 4LDRA 3DD7A 2YZSA 2DGJA 5E33A 4UDVA 2H7OA 2ASRA 3U9MA 3DJUB 2Q9AA 3LNRA 2BC5A 2F22A 3SP1A 3SNHA 4CS9A 5JT4A 1YARO 3J06A 3GEEA 4Q5SF 3W4YA 2R9RB 4XEVA 2DB4A 2Q00A 4JTDB 4MTFA 5D92A 2P1AA 3DJNB 4K7BA 3JSEO 1B68A 3MX3A 2M4EA 4N6CA 4NTFA 1LS1A 3QVYA 1WTYA 3GORA 2KK1A 1M56C 2WZGA 5E2QA 3RVYA 4DXWA 4E0IA 5KYYA 2KC3A 3QZCA 1LI5A 3JT1A 1GS9A 1D1BA 3K7DA 3NYMA 4G78A 4YT2A 1O5HA 1ZW3A 3C8GD 4XEKA 2J9UA 1C03A 4IARA 3U8VA 2XXAB 4QI2A 1M2OA 1YYJA 2W4MA 2G62A 2RD9A 3RIPA 1OCCC 1WASA 4FESA 2R7UA 3O55A 1H6GA 3HNJA 1G4WR 3WODF 3LEVA 1EQ1A 4XLPF 3K1HA 4P9FA 5KYXA 4OIQF 3TULA 3BEHA 1M2VA 1BR4A 5DQZA 2ZD9A 2X0CA 4LDQA 3T9OA 3W8IA 4C3BA 5DS6A 2Z15A 3JRTA 4JE9A 2J9WA 3Q7GA 4PJLA 1BR2A 3GM1A 3EPVA 4CS8A 4RBNA 1Z63A 3AQCA 2XLVA 2EPMX 4KNWA 3ZTMA 2J45A 2L6FA 4JTAB 2A6HF 3AJMA 4CJOA 3SXKA 3LNMB 4XQ1A 3IQ5A 3MFNA 1O3UA 4MVQA 5COGA 2ZXRA 4IAQA 1O87A 2Q4FA 4IAOA 2YL3A 3EHMA 1OW6A 3S9OA 3MYIA 4AE4A 4JTCB 4HFKB 3U2LA 3KL4A 4U5HA 4IRUA 3G4ZA 1TFOB 2L6GA 2PP4A 4LERA 4MS2A 4PJNA 5COFA 1YVIA 2OG2A 3VYWA 2DYSC 1W2WA 3UMKA 4O7GA 2UUIA 1HE9A 2CGEA 4JRZA 3EGDA 4JZAA 1R5ID 4KBLA 4CX9A 1E85A 3PHF2 1BDJB 1ZW2A 4YWQA 1NBBA 1M57C 1M6TA 4RD9A 1BBHA 1E2XA 1NSGB 3BRJA 3DAFA 1N1CA 4FWVA 2KGOA 2ZPAA 4JC7A 2XL6A 3KH2A 4W8KA 5COMA 3ZG1A 4AX2A 2NSGA 5KYWA 1QQ3A 2CNWA 4CS7A 3QTHA 2UUHA 4U5BE 4Q7CA 1PCXA 1V54C 4JEAA 5EHHA 4OIOF 1F1MA 3N0TA 3AG4C 4EBKA 5KYNA 3WHNA 3RFYA 3EH1A 2HZ8A 4H54A 2IXNA 3ABKC 1GGQA 1OXBA 3VM6A 1J8MF 1K04A 2HJMA 2HMQA 3GWNA 4EIYA 3GANA 2XM4A 5JP7A 4C3EA 3HNKA 3WG7C 2DI3A 3SZRA 1ORJA 1Q0MA 1SMYF 3JYHA 5BQIA 4MQ9F 4CIHA 2M64A 1VOMA 4JCHA 2GFHA 1MNDA 1YA9A 1C17M 2QNLA 3V5ZA 4B6IA 4ANJA 2BE5F 3T6BA 4BJTA 3AG1C 1T6QA 2H7VC 1APCA 1AUEA 3TOMA 5L3VA 1I4ZA 4XPWA 3AOUA 1A41A
chains in the Genus database with same CATH topology
2RSEB 4FAPB 4DRHB 2FAPB 1NSGB 4DRJB 5GPGB 4DRIB 1AUEA 3FAPB 1FAPB 2NPUA 2GAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSE B;  4FAP B;  4DRH B;  2FAP B;  1NSG B;  4DRJ B;  5GPG B;  4DRI B;  1AUE A;  3FAP B;  1FAP B;  2NPU A;  2GAQ A; 
#chains in the Genus database with same CATH topology
 3ASN C;  3B71 A;  2HKV A;  5CI9 A;  3PDM P;  3LAY A;  1G8X A;  2NG1 A;  2OKU A;  3QW1 A;  2QUP A;  3MBG A;  4C7O B;  2WVN A;  1GQA A;  2J46 A;  2LQG A;  2MYS A;  4PK4 A;  5IY5 C;  2R7O A;  3S90 A;  3NRH A;  2LIG A;  4J32 B;  4A2N B;  2HV7 A;  3FOO A;  1QPU A;  4MVO A;  2VAS A;  4IB4 A;  1MMG A;  2A68 F;  4JW1 A;  4DJ9 A;  1FAP B;  2XLW A;  1MMN A;  4M63 A;  3LLK A;  4MVR A;  4H4K C;  1YAU O;  3HLZ A;  1RJ9 A;  5D91 A;  1LE2 A;  3DXJ F;  4N4W A;  5AC5 A;  1MMD A;  2L9J A;  2LD6 A;  1TR2 A;  2AWC A;  2H7B A;  2OU6 A;  4KI2 A;  4BJ5 A;  3K6B A;  1FMV A;  1PD1 A;  3RYL A;  5L0H A;  2QLA A;  3ITF A;  2XS8 A;  2YL0 A;  4I1M A;  2C04 A;  4U9D A;  3B9Q A;  3UNG C;  4OIN F;  3EH2 A;  1JAF A;  3M4B A;  4JJG A;  3ZIB A;  5BQG A;  1TWG A;  3CZ6 A;  5L0C A;  3ATP A;  4JUR I;  3S29 A;  3WAQ A;  3IQ6 A;  4N06 A;  4ULV A;  4XWJ A;  5K0I A;  2Q9C A;  2W45 A;  3IHU A;  2ZXW C;  4ER9 A;  1EA8 A;  4PFP A;  2OQM A;  4EHP A;  3EG9 A;  5F28 E;  5KYY B;  4LAC B;  1QLE C;  2A0B A;  1NU9 C;  256B A;  1T01 A;  4YL1 A;  3JTL O;  4O6N A;  1RMV A;  3U2M A;  1OXK A;  3Q6N A;  3HJC A;  1NFN A;  2OOC A;  3EZH A;  3K1I A;  4L6R A;  2XLO A;  4EBB A;  2L81 A;  3EGX A;  3TJ6 A;  1H7I A;  4DRI B;  2Q3T A;  1V74 B;  3DE9 A;  3ABL C;  4Z9J A;  1SZI A;  3DM5 A;  2YLD A;  3L8I A;  5AC4 A;  2R25 A;  3K66 A;  1U89 A;  3KMI A;  4NTA A;  2QTV A;  1Y6D A;  4GQH A;  4YL3 A;  3T6J A;  2V3C C;  2VCC A;  2YHS A;  3QW0 A;  2BL2 A;  1ORY A;  2X51 A;  3C8G A;  2V26 A;  2XLH A;  3EFO B;  4YN0 B;  2HMZ A;  1ZHT A;  3GEI A;  3PCV A;  2B0H A;  1FTS A;  2EIN C;  1SR2 A;  1Q0D A;  1T6U A;  3W8H A;  3N24 A;  2PBE A;  3NKD A;  2R7W A;  1YZC A;  1OCR C;  1QVX A;  5B1A C;  1CPR A;  4IGG A;  3FVY A;  4ULW A;  4CJG A;  4EBJ A;  1RKE B;  2XS1 A;  1XZQ A;  1A7E A;  2R02 A;  4R32 A;  1G4U S;  3X2Q C;  3POV A;  3W2W A;  2R05 A;  2G3V A;  4QDL A;  1ZHY A;  2XLD A;  2IYL D;  2EIJ C;  5CIV A;  2XL8 A;  5KYU A;  4CDV A;  1NFO A;  2EPN A;  3C8Z A;  1JPJ A;  1OR2 A;  2A1D D;  3DE8 A;  3IPM O;  4NC3 A;  4JCZ A;  4AE4 B;  4YT8 A;  1LI7 A;  1K05 A;  1QKR A;  4DOZ A;  2HJ3 A;  4IWB A;  2GWW A;  3KKB A;  4LDK A;  4NCQ A;  4I44 A;  3S0X A;  3H2V A;  4BJ6 A;  3NYL A;  3R7C A;  3N2Z B;  3X1O A;  1A0B A;  3FAJ A;  4DVY P;  2NUP A;  4GEH A;  4CDA A;  2KSF A;  2XXA A;  1YZA A;  3ZQV A;  3KYJ A;  3Q7L A;  1D0X A;  1TKN A;  1UG7 A;  2GAQ A;  1ZHX A;  3ASO C;  5KYW B;  2JD3 A;  1Z3I X;  1FMW A;  2TMV P;  3DI5 A;  2WZF A;  4ZLC A;  3HTK C;  3PMR A;  1Y4C A;  3OWT A;  2HSQ A;  1TFK B;  4WGZ A;  5T3T A;  4BEJ A;  1HMD A;  1LS4 A;  5JSL A;  1WWP A;  2LP4 A;  4K0D A;  2KNH A;  2P0N A;  2VH3 A;  1YDI A;  2YL7 A;  5E3A A;  3V5Y A;  2AU5 A;  4CS9 C;  5B3S C;  1TWH A;  4HFF B;  3SYN A;  4J30 B;  2Y3B A;  4ZLD A;  3NYJ A;  2KJG A;  1V55 C;  2XM0 A;  4OIR F;  4ONS A;  3U3F A;  4LLC A;  4E7S A;  1LVK A;  5L0G A;  1Q0K A;  1LM3 B;  1WOL A;  5T3W A;  4D4X A;  1E86 A;  1Z6A A;  3NKE A;  3OA1 A;  4MND A;  1XZP A;  3V5X A;  3EJN A;  4XPY A;  3AG2 C;  3MYF A;  3ZQY A;  2HS5 A;  1JRA A;  1ORS C;  1OW7 A;  2D5R B;  2J7P A;  3UMH A;  4E7Z A;  1VB5 A;  3H65 A;  1JMW A;  5A6B D;  2O9X A;  2R7Q A;  3CEX A;  2ETS A;  1Q0G A;  3IQC A;  3TK0 A;  3FHD A;  5L0I A;  1ZYR F;  2IBF A;  4U5E E;  3VAY A;  3I5P A;  3QMK A;  2EIM C;  4YT5 A;  2YKZ A;  4YL0 A;  3C62 A;  4MW8 A;  3U9J A;  2D4U A;  2XLM A;  2VCB A;  3ABM C;  2AVK A;  2OJE D;  2XLE A;  3T4R A;  2WL8 A;  4OD4 A;  5L0F A;  5DVW A;  1RJ9 B;  1WAT A;  1ZU4 A;  2MHR A;  3FAP B;  1UFB A;  3B29 A;  2QE9 A;  1AVO B;  2ZXO A;  2FAP B;  1H9G A;  1SF8 A;  2IOQ A;  1QZX A;  4JEB A;  4U5D E;  5HSW A;  4W8P A;  2NPU A;  1AEP A;  3C63 A;  3U3B A;  2P7V A;  3LEO A;  1L3P A;  2ICW G;  1HE1 A;  2EPO A;  4I3M A;  3RH3 A;  3IQT A;  3RF3 A;  2NSF A;  2B0J A;  1YYX A;  4PR9 A;  4U5F E;  1SYQ A;  2JX0 A;  2AWY A;  3AG3 C;  1XWJ A;  4N6H A;  4D4N A;  5DS4 A;  3U5S A;  3JSZ A;  1OCZ C;  1ZZP A;  3NMJ A;  1OKK D;  1YLM A;  3EZI A;  3O39 A;  5FZT A;  4CSA C;  5L0J A;  2Y69 C;  2A69 F;  1T6I A;  1HY5 A;  1NLX A;  2RSE B;  4MVZ A;  1C02 A;  1OCO C;  3LS0 A;  5CI8 A;  1ZHZ A;  3UGO A;  2WVO A;  2AP3 A;  3KPH A;  1U0B B;  2OEX A;  4JIO A;  2PFD A;  3F47 A;  5DQT A;  2LFD A;  2HUJ A;  4WGY A;  2NUT A;  1GM5 A;  4FAP B;  4K1O A;  4XTK A;  2LFF A;  3EGX B;  3NDB B;  3I4U A;  3JRM O;  3S28 A;  3TD7 A;  4RDA A;  3US6 A;  1QSP A;  2C03 A;  2IXP A;  5BUO A;  4KNV A;  3V7O A;  4AK9 A;  1VYI A;  2A0U A;  3F46 A;  3M4C A;  1OW8 A;  2YVK A;  3C8G B;  2J0W A;  2YQY A;  1T9K A;  2P61 A;  1Q0F A;  3DM9 B;  1OR3 A;  2WVQ A;  5L0D A;  3FDQ A;  2R7R A;  3UGP A;  1H9T A;  1D1C A;  3ZTZ A;  3GOD A;  4U5G A;  1CPQ A;  5KYX B;  1NZE A;  3S27 A;  1LIH A;  1J8Y F;  1BZ4 A;  3TOL A;  4O6M A;  1M2V B;  3L8J A;  2CCY A;  4WAB A;  2CDQ A;  3A9C A;  3HNL A;  3E9V A;  1JR8 A;  3MLG A;  3U8P A;  2KQ9 A;  1HW1 A;  2OEV A;  4XPX A;  4YJW A;  5T1D B;  3JYY A;  2I8B A;  3C7J A;  4G7H F;  2MWQ A;  5F5F A;  1MMA A;  1PD0 A;  5KYU B;  3HKK A;  1YA7 O;  1R4T A;  4G0H A;  1EI7 A;  1VK5 A;  4DVZ A;  3GEH A;  1L7C A;  1DOW A;  4YK5 A;  1DOV A;  1JOG A;  2R7V A;  1G5Z A;  1I5N A;  2OJQ A;  3K33 A;  3M15 A;  2JPU A;  4IJJ A;  3S84 A;  3DKA A;  3W2V A;  4OD5 A;  1WGW A;  3HNI A;  4Z9I A;  5BQH A;  2R7X A;  4AL1 A;  2A6E F;  2CW0 F;  5B1B C;  4FX5 A;  1S7Z A;  2NUP B;  1D0Z A;  2EIL C;  2YL1 A;  5A6K A;  3AGU A;  2I15 A;  3NMK A;  2WZL A;  3T6G B;  4P6I C;  1JPN A;  3EGD B;  1VLS A;  3SXY A;  2Q7R A;  4DBQ A;  3LJB A;  5L3Q A;  3CSK A;  4O79 A;  2OCC C;  4AL0 A;  3ZWI A;  1S05 A;  3EFO A;  4J7Y A;  4BJ5 C;  1CGM E;  2ZXP A;  3GM2 A;  1RXQ A;  2XRH A;  4DRH B;  3GM3 A;  3RKO F;  4MTO A;  5E3C A;  4C3D A;  4YT4 A;  3FXH A;  3ZDL A;  4E18 A;  4U5C E;  3ZVR A;  2GDC A;  1I4Y A;  2YWA A;  3O10 A;  1RKE A;  2VB6 A;  3EQL F;  4XLN F;  3RQE A;  5EK0 A;  2E87 A;  1FNT c;  1V4A A;  1ZU5 A;  3DAG A;  2GA0 A;  3RQG A;  1T5O A;  4JVS A;  3CAX A;  4CIP A;  2L6H A;  3IEE A;  3H2U A;  4NTB A;  3U0C A;  1RKC A;  1TWA A;  3OEO A;  4MVU A;  4WJ0 A;  3SXZ A;  2J0X A;  3B0P A;  4BG0 A;  2XSE A;  3VRC A;  2VCA A;  1NU7 D;  1VLT A;  2KW3 C;  1VYK A;  2PX0 A;  3RW0 A;  1YJG A;  2LCH A;  4CBE A;  5A6J A;  2L7A A;  3A11 A;  3RQF A;  2YEV A;  4E17 A;  4OIP F;  2H8A A;  2Y3H A;  2HSB A;  1FFH A;  2EPL X;  3K1I C;  2G3K A;  3R2P A;  4KC9 A;  4CSA A;  1VMA A;  1WN0 A;  2J9V A;  3O6X A;  1A7V A;  5F5H A;  2HFI A;  2PX3 A;  4Z9H A;  3TQO A;  2CNW D;  2Y39 A;  4EKW A;  1E83 A;  1CGN A;  1KU2 A;  3DWW A;  1D0Y A;  5GPG B;  4CDY A;  2EPK X;  2PF4 E;  2FFH A;  3LLI A;  5A69 A;  4BJ1 A;  1CGO A;  3G50 A;  1VTM P;  4A4A A;  3QVZ A;  3I5Q A;  2R03 A;  1OQC A;  3EHN A;  2LSE A;  5TJ5 E;  4BEM J;  3LS1 A;  4E0H A;  1EKY A;  3TJ5 A;  3M79 A;  2YLG A;  1MNE A;  3L1M A;  4PFO A;  5FCL A;  5A6B A;  4G7Z F;  1RCP A;  4MTG A;  4DRJ B;  5HV9 A;  5JUA A;  5AGF A;  5JVE A;  4EUK B;  4Q4Z F;  4HE8 D;  1PV3 A;  3AQB A;  3L34 A;  4X0R A;  3ZSU A;  4P9T A;  4CS8 C;  3B0U X;  1IZM A;  2FGY A;  2WB7 A;  2QY9 A;  4F4B A;  1HW2 A;  1IW7 F;  3FOP A;  3NG1 A;  5JS5 A;  1Z23 A;  1NG1 A;  1MQV A;  3C18 A;  3LUT B;  4O6Y A;  4PJM A;  2J7P D;  3SXM A;  2Y3G A;  3LES A;  1U6H A;  3KYI A;  4BJ6 C;  1ZVZ A;  5EGY A;  1LE4 A;  3RVZ A;  1FR0 A;  1FFT C;  2J9B A;  3CQZ A;  1Z7Q c;  3JCU Q;  3ECS A;  5DS5 A;  2DYR C;  2Y3D A;  3AGT A;  4XEF A;  3GWL A;  2IXO A;  4LLE A;  4EWC A;  2CYD A;  1KTM A;  2NUT B;  5B3I A;  5A6A A;  3ZC4 A;  3DZA A;  1K40 A;  3EG9 B;  3FMS A;  1OKK A;  2W9Y A;  2YLI A;  2VC9 A;  4GYT A;  4JKV A;  4NY3 A;  3VF0 A;  1ZHW A;  1LPE A;  4NQF A;  4C7O A;  3E70 C;  3M1C B;  4JJF A;  1BR1 A;  2YRF A;  4MW3 A;  4QI0 A;  2W4B A;  2XL4 A;  3Q6M A;  1KNY A;  1Z5Z A;  4PJJ A;  4U9E A;  3UMI A;  4DBR A;  2R7S A;  2R7T A;  3NMI A;  1LKX A;  4MVM A;  2PNO A;  2HV6 A;  3UR3 C;  4BPM A;  3DMD A;  4J7T A;  1A7D A;  1E84 A;  2P6V A;  4G7O F;  3SEO A;  1TQG A;  2IM8 A;  4HEA J;  4I1O B;  1D1A A;  3L0I A;  2Q9B A;  2KYH A;  2LK4 A;  2IXM A;  2J8W A;  3G4X A;  4PAC A;  5JRA A;  1TWC A;  3JZ0 A;  5DLJ A;  3B0V C;  1HMO A;  4MVS A;  1ST6 A;  5JLI A;  2EIK C;  4LDR A;  3DD7 A;  2YZS A;  2DGJ A;  5E33 A;  4UDV A;  2H7O A;  2ASR A;  3U9M A;  3DJU B;  2Q9A A;  3LNR A;  2BC5 A;  2F22 A;  3SP1 A;  3SNH A;  4CS9 A;  5JT4 A;  1YAR O;  3J06 A;  3GEE A;  4Q5S F;  3W4Y A;  2R9R B;  4XEV A;  2DB4 A;  2Q00 A;  4JTD B;  4MTF A;  5D92 A;  2P1A A;  3DJN B;  4K7B A;  3JSE O;  1B68 A;  3MX3 A;  2M4E A;  4N6C A;  4NTF A;  1LS1 A;  3QVY A;  1WTY A;  3GOR A;  2KK1 A;  1M56 C;  2WZG A;  5E2Q A;  3RVY A;  4DXW A;  4E0I A;  5KYY A;  2KC3 A;  3QZC A;  1LI5 A;  3JT1 A;  1GS9 A;  1D1B A;  3K7D A;  3NYM A;  4G78 A;  4YT2 A;  1O5H A;  1ZW3 A;  3C8G D;  4XEK A;  2J9U A;  1C03 A;  4IAR A;  3U8V A;  2XXA B;  4QI2 A;  1M2O A;  1YYJ A;  2W4M A;  2G62 A;  2RD9 A;  3RIP A;  1OCC C;  1WAS A;  4FES A;  2R7U A;  3O55 A;  1H6G A;  3HNJ A;  1G4W R;  3WOD F;  3LEV A;  1EQ1 A;  4XLP F;  3K1H A;  4P9F A;  5KYX A;  4OIQ F;  3TUL A;  3BEH A;  1M2V A;  1BR4 A;  5DQZ A;  2ZD9 A;  2X0C A;  4LDQ A;  3T9O A;  3W8I A;  4C3B A;  5DS6 A;  2Z15 A;  3JRT A;  4JE9 A;  2J9W A;  3Q7G A;  4PJL A;  1BR2 A;  3GM1 A;  3EPV A;  4CS8 A;  4RBN A;  1Z63 A;  3AQC A;  2XLV A;  2EPM X;  4KNW A;  3ZTM A;  2J45 A;  2L6F A;  4JTA B;  2A6H F;  3AJM A;  4CJO A;  3SXK A;  3LNM B;  4XQ1 A;  3IQ5 A;  3MFN A;  1O3U A;  4MVQ A;  5COG A;  2ZXR A;  4IAQ A;  1O87 A;  2Q4F A;  4IAO A;  2YL3 A;  3EHM A;  1OW6 A;  3S9O A;  3MYI A;  4AE4 A;  4JTC B;  4HFK B;  3U2L A;  3KL4 A;  4U5H A;  4IRU A;  3G4Z A;  1TFO B;  2L6G A;  2PP4 A;  4LER A;  4MS2 A;  4PJN A;  5COF A;  1YVI A;  2OG2 A;  3VYW A;  2DYS C;  1W2W A;  3UMK A;  4O7G A;  2UUI A;  1HE9 A;  2CGE A;  4JRZ A;  3EGD A;  4JZA A;  1R5I D;  4KBL A;  4CX9 A;  1E85 A;  3PHF 2;  1BDJ B;  1ZW2 A;  4YWQ A;  1NBB A;  1M57 C;  1M6T A;  4RD9 A;  1BBH A;  1E2X A;  1NSG B;  3BRJ A;  3DAF A;  1N1C A;  4FWV A;  2KGO A;  2ZPA A;  4JC7 A;  2XL6 A;  3KH2 A;  4W8K A;  5COM A;  3ZG1 A;  4AX2 A;  2NSG A;  5KYW A;  1QQ3 A;  2CNW A;  4CS7 A;  3QTH A;  2UUH A;  4U5B E;  4Q7C A;  1PCX A;  1V54 C;  4JEA A;  5EHH A;  4OIO F;  1F1M A;  3N0T A;  3AG4 C;  4EBK A;  5KYN A;  3WHN A;  3RFY A;  3EH1 A;  2HZ8 A;  4H54 A;  2IXN A;  3ABK C;  1GGQ A;  1OXB A;  3VM6 A;  1J8M F;  1K04 A;  2HJM A;  2HMQ A;  3GWN A;  4EIY A;  3GAN A;  2XM4 A;  5JP7 A;  4C3E A;  3HNK A;  3WG7 C;  2DI3 A;  3SZR A;  1ORJ A;  1Q0M A;  1SMY F;  3JYH A;  5BQI A;  4MQ9 F;  4CIH A;  2M64 A;  1VOM A;  4JCH A;  2GFH A;  1MND A;  1YA9 A;  1C17 M;  2QNL A;  3V5Z A;  4B6I A;  4ANJ A;  2BE5 F;  3T6B A;  4BJT A;  3AG1 C;  1T6Q A;  2H7V C;  1APC A;  1AUE A;  3TOM A;  5L3V A;  1I4Z A;  4XPW A;  3AOU A;  1A41 A; 
#chains in the Genus database with same CATH homology
 2RSE B;  4FAP B;  4DRH B;  2FAP B;  1NSG B;  4DRJ B;  5GPG B;  4DRI B;  1AUE A;  3FAP B;  1FAP B;  2NPU A;  2GAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...