2FAPB

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 37
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2fapB00
3FAPB 2NPUA 2RSEB 2GAQA 1FAPB 5GPGB 4DRJB 1AUEA 4DRHB 4DRIB 4FAPB 2FAPB 1NSGB
chains in the Genus database with same CATH superfamily
2GA0A 2G3KA 3C8GB 4LACB 4DVYP 5KYYA 3L34A 1GS9A 1WWPA 2NSGA 4K1OA 1GM5A 4H4KC 2PBEA 2ZD9A 5BQGA 5L0FA 4OIPF 1M57C 1JR8A 2YL7A 3L0IA 4CDAA 1OCOC 3ZQVA 2XLMA 3DKAA 2R25A 2HSQA 1AUEA 4KI2A 3DAGA 3DD7A 3RIPA 3ZWIA 5BQIA 3W8HA 3LUTB 2ZXRA 3OWTA 2OCCC 1HMOA 3JYYA 4NC3A 5KYNA 1MMDA 3E9VA 2J9BA 3GEIA 4I3MA 4MTFA 4YJWA 2IXPA 3ZTMA 3GORA 5AC5A 2CDQA 2EPOA 1WASA 4E0HA 5A69A 4XLPF 2YWAA 2YEVA 3K6BA 2R05A 4MQ9F 2RD9A 4WGYA 1Z63A 3LAYA 2VCBA 3H65A 3VYWA 5L0CA 2LK4A 2VH3A 1TR2A 1YZCA 1D1AA 2YLIA 1YYXA 3SXYA 5K0IA 5FCLA 4A2NB 2NG1A 1TWAA 4U5EE 1VLSA 2PX3A 2VC9A 1RMVA 4DBQA 3IQTA 3ASNC 1LM3B 4OINF 1YAUO 2NUPB 4JCHA 4PJMA 3NG1A 1VYKA 4PK4A 1B68A 2YLGA 3C63A 1VOMA 2HSBA 2VB6A 4PJJA 3RFYA 4CS7A 4XEVA 1ZHYA 2FAPB 1NU7D 1QLEC 2OQMA 3U2MA 3DJNB 1PV3A 2EPLX 2Q3TA 2WVQA 4U5BE 4CX9A 1NFOA 4E7ZA 5HV9A 3DXJF 4U5FE 2DB4A 4PACA 1T6IA 4DBRA 4O6MA 1ZHXA 1EA8A 4JIOA 4CS9C 4HE8D 3JYHA 1WTYA 3Q7GA 3U8VA 4ANJA 4MVUA 1ZHZA 2HV6A 1RJ9A 4N6CA 1YA9A 5F5FA 3S0XA 4O7GA 3L1MA 3NRHA 1ORYA 2A69F 3MLGA 2CNWA 3PMRA 1OW6A 5JLIA 3AG3C 3EGXA 1MNDA 4W8KA 2A6EF 4J30B 4ZLDA 2Y3BA 2J9UA 3BEHA 1C02A 2NSFA 1K40A 2P6VA 4J7TA 3LLIA 1APCA 5DLJA 3DWWA 3ABMC 3N2ZB 5DS5A 2R7WA 2M4EA 1VTMP 2HUJA 4A4AA 2A0UA 2EIKC 1GQAA 4U5DE 4JTCB 4K0DA 4M63A 2AWYA 1HW1A 2ZXWC 4DRHB 1QPUA 4KNWA 4U5GA 5E3CA 4BPMA 5F28E 5CI9A 2W45A 4NY3A 4AE4A 4MS2A 2YVKA 4ONSA 3H2VA 3EGXB 4BEMJ 5JS5A 5DS6A 2C03A 4CS9A 3ZDLA 4C3DA 3CSKA 1JPJA 1HE1A 3NYMA 3HNKA 3JRTA 1NFNA 3EGDB 1OW7A 4RBNA 2XM4A 4DRIB 5D91A 1LS4A 2PF4E 3H2UA 2H8AA 3EH2A 3POVA 1A7EA 3CQZA 1OXBA 3IHUA 2R7XA 2I15A 2VCCA 3EQLF 4CJGA 1KNYA 3W4YA 4BG0A 5A6JA 2J45A 3TOLA 1J8YF 1VK5A 3V5YA 3UGPA 4ULVA 2HV7A 3VRCA 3TJ6A 1T01A 4NQFA 5B1BC 1D0YA 5A6BD 2HMQA 1H7IA 1N1CA 1C17M 2D4UA 3RVZA 1IW7F 1FMVA 4J32B 1NZEA 3M4BA 2Q7RA 3W2VA 5COMA 1S05A 2H7BA 3FOOA 3NYJA 2UUIA 4PR9A 2IXOA 4I1MA 4YT8A 3C8GA 1ZW3A 1E83A 4C7OA 1I4YA 3TULA 2R7VA 4XLNF 1CPRA 2OJED 2MHRA 4WABA 3JSZA 1T6QA 3WHNA 4ZLCA 2HKVA 3JCUQ 4MW3A 2FFHA 3S28A 1MMGA 4Q7CA 1FMWA 3CZ6A 1FFTC 3LESA 4JTDB 4WGZA 2TMVP 1R5ID 1JAFA 2G62A 3QW0A 3K66A 1MQVA 3O10A 4LERA 5JUAA 4QI2A 4MW8A 3ZSUA 1AVOB 4JCZA 4UDVA 1KU2A 2ZPAA 5L0GA 3F46A 1U89A 3QZCA 4YT5A 1IZMA 1H6GA 3U2LA 1O5HA 1QKRA 1ORSC 3TJ5A 4EHPA 2A68F 3FHDA 2QE9A 1BR1A 2JPUA 4HFFB 3SXMA 1CGOA 1A0BA 1OR2A 3JZ0A 2EIJC 3FAJA 3R2PA 3U9JA 1ZU4A 5TJ5E 1TWCA 1FR0A 1PCXA 3MYIA 5T1DB 4CJOA 2CW0F 2HZ8A 4K7BA 3HLZA 4MVSA 4PFPA 4XEFA 4GQHA 4XQ1A 5BUOA 5AGFA 3LLKA 3EZIA 4FX5A 4JC7A 2NUPA 2P0NA 3AQCA 3ABKC 2E87A 3AGTA 4B6IA 2R02A 2XM0A 3TD7A 3RQEA 4H54A 3DE9A 1LI5A 4YT4A 1G8XA 3I5QA 2FGYA 5KYXB 2CYDA 3HNJA 5L3VA 5BQHA 5JSLA 2WZLA 2LIGA 5JT4A 3EZHA 5E2QA 3DE8A 5D92A 2XRHA 2ZXPA 3RF3A 1XZQA 1K05A 2PX0A 1Q0GA 1TKNA 4G78A 3S27A 4E18A 2VCAA 3FXHA 3KL4A 2LD6A 1EQ1A 3PDMP 2YLDA 2J0WA 1EI7A 1O3UA 3FOPA 3SZRA 2R7TA 4JJFA 3DI5A 1SF8A 1K04A 2RSEB 1GGQA 3ATPA 1JPNA 2OEVA 4ULWA 1E84A 2BC5A 4R32A 2EPNA 1M2VB 1OR3A 3C18A 3S9OA 2XLDA 3A11A 1BR2A 1A41A 2B0JA 3LEVA 3QMKA 4RD9A 4XEKA 1M6TA 2R7SA 1S7ZA 2R03A 3GWLA 4Z9IA 1JRAA 4G0HA 1BDJB 4YL1A 4Q5SF 3S84A 2LSEA 1FFHA 1G4US 3QVYA 4NCQA 2A0BA 2Y69C 2XXAB 3W2WA 4N06A 3AQBA 3Q6NA 5B3IA 2R9RB 2XLVA 1RCPA 2DYRC 4BJ6A 4E17A 5JVEA 1KTMA 3HTKC 4C7OB 1HY5A 2DGJA 4IJJA 2D5RB 3T6JA 4P9TA 3IEEA 3KPHA 2P1AA 5EGYA 1OKKA 2WZGA 2Y39A 2R7OA 2HS5A 2YL0A 256BA 3IQ6A 2Y3GA 4MVOA 4O6NA 3VAYA 1HE9A 3RYLA 2XL8A 4CIPA 3ZG1A 2BL2A 1C03A 1VMAA 2VASA 1TWHA 3PCVA 3FMSA 5KYUA 5FZTA 2KC3A 5B1AC 4JTAB 5T3WA 4JRZA 2LFFA 3EGDA 4CS8A 4BEJA 3NYLA 1RXQA 1U6HA 1M2OA 1OW8A 1VYIA 3GEHA 4X0RA 1OKKD 1YARO 4JW1A 3RW0A 1A7VA 1VB5A 4EBJA 4KBLA 3JT1A 2CNWD 2WL8A 1ZW2A 3M1CB 2HJMA 2J46A 1R4TA 3I5PA 5A6KA 3KYJA 1OCRC 3UGOA 3K33A 2J9VA 1LPEA 1NSGB 2MWQA 3T6BA 5KYUB 1BZ4A 3SXKA 1FTSA 2PFDA 2XS1A 3B0UX 3GEEA 2OU6A 5JRAA 1ST6A 2X51A 2QTVA 2XS8A 2V3CC 4LDKA 3MBGA 3AGUA 4XPYA 4NTFA 2IBFA 2QLAA 4LLCA 2WVNA 2IOQA 5L0DA 4JEBA 4EWCA 1TQGA 1LI7A 1SMYF 4EBKA 3LNRA 4W8PA 4G7HF 2L7AA 1RKCA 4EIYA 3GM2A 1G5ZA 1HMDA 2AU5A 2AVKA 5EHHA 3I4UA 4U5CE 4CDVA 5L0JA 3TQOA 1FAPB 1ZYRF 3G50A 2MYSA 3N0TA 3ASOC 1W2WA 4OD4A 1OXKA 3GODA 3UMIA 3OEOA 1FNTc 1ZVZA 3VM6A 1NLXA 2A1DD 4MVQA 2XLHA 4N4WA 1HW2A 1Z7Qc 3DM9B 4FAPB 5E3AA 1V54C 2W9YA 2W4MA 4E7SA 3UNGC 4QI0A 1L3PA 2HJ3A 2X0CA 1OQCA 1ZU5A 2AP3A 4NTAA 4KC9A 3K1HA 5AC4A 1JOGA 1D1CA 1V74B 2J7PA 1YLMA 1ZHWA 2XLEA 3LS1A 1T5OA 1YZAA 2Q9CA 2YQYA 4MTGA 2J8WA 2Y3HA 2GAQA 1QVXA 1Q0KA 2L9JA 3G4ZA 1QZXA 1TFOB 3C8GD 4RDAA 2ICWG 1MNEA 1XZPA 4DVZA 1QQ3A 2P7VA 5KYXA 4Q4ZF 2L6HA 3T4RA 3ZC4A 3L8IA 1WOLA 4DRJB 2LCHA 2A6HF 1M56C 3DZAA 3HNIA 3ITFA 3L8JA 4L6RA 4JZAA 3RVYA 3V5ZA 2LFDA 3CAXA 3AG2C 4O79A 4LLEA 2OJQA 2YRFA 1YJGA 2WB7A 2XL6A 2JD3A 3UMHA 3UMKA 2Q9AA 4J7YA 3IQ5A 4XPWA 4IARA 4AK9A 3FAPB 1PD1A 3NKDA 3AOUA 3QVZA 3VF0A 3HJCA 1LKXA 3NKEA 4IAOA 3NMKA 3Q7LA 1M2VA 2EPMX 3A9CA 1Z3IX 3O39A 4IWBA 4OIOF 4BJ6C 3C8ZA 1E85A 2KQ9A 3IPMO 3RQFA 5F5HA 2IXNA 1YYJA 2L6GA 2XLWA 1WATA 2YZSA 5JP7A 2LQGA 3U3FA 1SZIA 1MMAA 3PHF2 3GANA 2XXAA 1OCCC 2IM8A 2KNHA 4JURI 5HSWA 4OD5A 5EK0A 3SXZA 3EG9B 3EFOB 1LE4A 1NBBA 3DAFA 2HFIA 2YHSA 3K7DA 3O6XA 1T6UA 4JE9A 4PJLA 4EUKB 1YVIA 2KK1A 1TWGA 3US6A 1H9GA 1U0BB 2EINC 2R7UA 3B29A 3ZQYA 1VLTA 4HEAJ 3HKKA 1DOVA 1LE2A 4XPXA 4PJNA 2NUTA 4CS8C 1UFBA 4YT2A 4G7ZF 2EILC 2DI3A 1E86A 4CBEA 1PD0A 1Y4CA 4IB4A 2CCYA 3GM3A 4LDQA 4BJ1A 3WAQA 3AG1C 4FESA 4MVRA 5KYYB 3LS0A 5A6AA 2KYHA 1Q0FA 3KKBA 4C3EA 3C7JA 2KW3C 4C3BA 3S90A 3IQCA 3ECSA 1I5NA 3C62A 2YKZA 4JVSA 2EPKX 1WN0A 3MX3A 2IXMA 4XTKA 3S29A 3BRJA 1Z5ZA 3FVYA 3Q6MA 1CPQA 1V55C 1RKEA 3RH3A 2Z15A 3QW1A 2UUHA 3TOMA 4IRUA 4E0IA 2NUTB 2F22A 4BJTA 4N6HA 1LIHA 1DOWA 1ORJA 2WVOA 5DQTA 2BE5F 3G4XA 5L3QA 4CDYA 1D1BA 2C04A 5DS4A 2QY9A 2L81A 2GFHA 2QNLA 1A7DA 3DMDA 4DOZA 4ER9A 4EKWA 2Y3DA 3E70C 3SNHA 2KSFA 1ZHTA 2ETSA 4G7OF 2XL4A 2EIMC 2YL1A 3DJUB 2GWWA 3GWNA 3LJBA 2O9XA 3U8PA 5KYWA 1ZZPA 2PNOA 3HNLA 3K1IC 4YL3A 1RKEB 3B71A 5L0HA 1CGNA 4JKVA 4PFOA 1Q0MA 1MMNA 2XSEA 3B9QA 2OEXA 3DM5A 2NPUA 3SYNA 1UG7A 4QDLA 3UR3C 4MVMA 3X2QC 3B0PA 4JEAA 1CGME 4KNVA 1Z6AA 3ABLC 3LEOA 2OG2A 1EKYA 4JJGA 4OIRF 4D4XA 1I4ZA 1G4WR 4NTBA 3RQGA 3JSEO 2M64A 3LNMB 2AWCA 2V26A 4YK5A 1QSPA 2R7QA 2W4BA 3MYFA 4AL1A 1OCZC 5KYWB 3U5SA 3JTLO 4YN0B 3U9MA 4AX2A 2KJGA 3NMJA 3ZTZA 5DQZA 1H9TA 2B0HA 1L7CA 5IY5C 2JX0A 2OKUA 3ZIBA 2WZFA 3N24A 3M79A 5T3TA 2KGOA 3MFNA 3NMIA 1RJ9B 3EHMA 2L6FA 3V7OA 1JMWA 4GYTA 4IAQA 1NG1A 2HMZA 2IYLD 3KH2A 3K1IA 2YL3A 2CGEA 4MNDA 1LVKA 3M15A 4FWVA 4I1OB 4P6IC 4Z9JA 5COGA 1T9KA 2H7VC 5DVWA 5A6BA 5E33A 1BBHA 1YA7O 2XLOA 4EBBA 5COFA 1Y6DA 4YWQA 2QUPA 1E2XA 3U0CA 3O55A 2J0XA 4WJ0A 4D4NA 1F1MA 4U9EA 3CEXA 3SP1A 3B0VC 4DJ9A 3V5XA 3WODF 1V4AA 4I44A 5L0IA 3AG4C 4YL0A 4CIHA 4CSAC 3M4CA 4MVZA 4F4BA 4DXWA 3JRMO 4BJ5C 3FDQA 3SEOA 4AE4B 3W8IA 3F47A 4P9FA 3GM1A 3WG7C 5CIVA 1YDIA 3RKOF 3EH1A 2G3VA 2H7OA 3KMIA 4AL0A 2LP4A 1NU9C 4LDRA 4OIQF 2ASRA 1AEPA 4Z9HA 1BR4A 2I8BA 3EHNA 2GDCA 1Q0DA 3EJNA 2P61A 5GPGB 3AJMA 2PP4A 3T9OA 2Q9BA 3QTHA 1O87A 3U3BA 3EPVA 5CI8A 2Q4FA 2J7PD 4MTOA 5B3SC 1LS1A 1D0ZA 3ZVRA 1Z23A 2J9WA 3NDBB 2DYSC 4O6YA 4XWJA 1WGWA 3X1OA 3R7CA 3EG9A 3EFOA 1XWJA 3KYIA 4U9DA 3T6GB 3TK0A 2ZXOA 2R7RA 1D0XA 2OOCA 1TFKB 4IGGA 3J06A 4GEHA 4CSAA 4U5HA 3OA1A 4BJ5A 2Q00A 1SR2A 1J8MF 4HFKB 1SYQA
chains in the Genus database with same CATH topology
3FAPB 2NPUA 2RSEB 2GAQA 1FAPB 5GPGB 4DRJB 1AUEA 4DRHB 4DRIB 4FAPB 2FAPB 1NSGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP B;  2NPU A;  2RSE B;  2GAQ A;  1FAP B;  5GPG B;  4DRJ B;  1AUE A;  4DRH B;  4DRI B;  4FAP B;  2FAP B;  1NSG B; 
#chains in the Genus database with same CATH topology
 2GA0 A;  2G3K A;  3C8G B;  4LAC B;  4DVY P;  5KYY A;  3L34 A;  1GS9 A;  1WWP A;  2NSG A;  4K1O A;  1GM5 A;  4H4K C;  2PBE A;  2ZD9 A;  5BQG A;  5L0F A;  4OIP F;  1M57 C;  1JR8 A;  2YL7 A;  3L0I A;  4CDA A;  1OCO C;  3ZQV A;  2XLM A;  3DKA A;  2R25 A;  2HSQ A;  1AUE A;  4KI2 A;  3DAG A;  3DD7 A;  3RIP A;  3ZWI A;  5BQI A;  3W8H A;  3LUT B;  2ZXR A;  3OWT A;  2OCC C;  1HMO A;  3JYY A;  4NC3 A;  5KYN A;  1MMD A;  3E9V A;  2J9B A;  3GEI A;  4I3M A;  4MTF A;  4YJW A;  2IXP A;  3ZTM A;  3GOR A;  5AC5 A;  2CDQ A;  2EPO A;  1WAS A;  4E0H A;  5A69 A;  4XLP F;  2YWA A;  2YEV A;  3K6B A;  2R05 A;  4MQ9 F;  2RD9 A;  4WGY A;  1Z63 A;  3LAY A;  2VCB A;  3H65 A;  3VYW A;  5L0C A;  2LK4 A;  2VH3 A;  1TR2 A;  1YZC A;  1D1A A;  2YLI A;  1YYX A;  3SXY A;  5K0I A;  5FCL A;  4A2N B;  2NG1 A;  1TWA A;  4U5E E;  1VLS A;  2PX3 A;  2VC9 A;  1RMV A;  4DBQ A;  3IQT A;  3ASN C;  1LM3 B;  4OIN F;  1YAU O;  2NUP B;  4JCH A;  4PJM A;  3NG1 A;  1VYK A;  4PK4 A;  1B68 A;  2YLG A;  3C63 A;  1VOM A;  2HSB A;  2VB6 A;  4PJJ A;  3RFY A;  4CS7 A;  4XEV A;  1ZHY A;  2FAP B;  1NU7 D;  1QLE C;  2OQM A;  3U2M A;  3DJN B;  1PV3 A;  2EPL X;  2Q3T A;  2WVQ A;  4U5B E;  4CX9 A;  1NFO A;  4E7Z A;  5HV9 A;  3DXJ F;  4U5F E;  2DB4 A;  4PAC A;  1T6I A;  4DBR A;  4O6M A;  1ZHX A;  1EA8 A;  4JIO A;  4CS9 C;  4HE8 D;  3JYH A;  1WTY A;  3Q7G A;  3U8V A;  4ANJ A;  4MVU A;  1ZHZ A;  2HV6 A;  1RJ9 A;  4N6C A;  1YA9 A;  5F5F A;  3S0X A;  4O7G A;  3L1M A;  3NRH A;  1ORY A;  2A69 F;  3MLG A;  2CNW A;  3PMR A;  1OW6 A;  5JLI A;  3AG3 C;  3EGX A;  1MND A;  4W8K A;  2A6E F;  4J30 B;  4ZLD A;  2Y3B A;  2J9U A;  3BEH A;  1C02 A;  2NSF A;  1K40 A;  2P6V A;  4J7T A;  3LLI A;  1APC A;  5DLJ A;  3DWW A;  3ABM C;  3N2Z B;  5DS5 A;  2R7W A;  2M4E A;  1VTM P;  2HUJ A;  4A4A A;  2A0U A;  2EIK C;  1GQA A;  4U5D E;  4JTC B;  4K0D A;  4M63 A;  2AWY A;  1HW1 A;  2ZXW C;  4DRH B;  1QPU A;  4KNW A;  4U5G A;  5E3C A;  4BPM A;  5F28 E;  5CI9 A;  2W45 A;  4NY3 A;  4AE4 A;  4MS2 A;  2YVK A;  4ONS A;  3H2V A;  3EGX B;  4BEM J;  5JS5 A;  5DS6 A;  2C03 A;  4CS9 A;  3ZDL A;  4C3D A;  3CSK A;  1JPJ A;  1HE1 A;  3NYM A;  3HNK A;  3JRT A;  1NFN A;  3EGD B;  1OW7 A;  4RBN A;  2XM4 A;  4DRI B;  5D91 A;  1LS4 A;  2PF4 E;  3H2U A;  2H8A A;  3EH2 A;  3POV A;  1A7E A;  3CQZ A;  1OXB A;  3IHU A;  2R7X A;  2I15 A;  2VCC A;  3EQL F;  4CJG A;  1KNY A;  3W4Y A;  4BG0 A;  5A6J A;  2J45 A;  3TOL A;  1J8Y F;  1VK5 A;  3V5Y A;  3UGP A;  4ULV A;  2HV7 A;  3VRC A;  3TJ6 A;  1T01 A;  4NQF A;  5B1B C;  1D0Y A;  5A6B D;  2HMQ A;  1H7I A;  1N1C A;  1C17 M;  2D4U A;  3RVZ A;  1IW7 F;  1FMV A;  4J32 B;  1NZE A;  3M4B A;  2Q7R A;  3W2V A;  5COM A;  1S05 A;  2H7B A;  3FOO A;  3NYJ A;  2UUI A;  4PR9 A;  2IXO A;  4I1M A;  4YT8 A;  3C8G A;  1ZW3 A;  1E83 A;  4C7O A;  1I4Y A;  3TUL A;  2R7V A;  4XLN F;  1CPR A;  2OJE D;  2MHR A;  4WAB A;  3JSZ A;  1T6Q A;  3WHN A;  4ZLC A;  2HKV A;  3JCU Q;  4MW3 A;  2FFH A;  3S28 A;  1MMG A;  4Q7C A;  1FMW A;  3CZ6 A;  1FFT C;  3LES A;  4JTD B;  4WGZ A;  2TMV P;  1R5I D;  1JAF A;  2G62 A;  3QW0 A;  3K66 A;  1MQV A;  3O10 A;  4LER A;  5JUA A;  4QI2 A;  4MW8 A;  3ZSU A;  1AVO B;  4JCZ A;  4UDV A;  1KU2 A;  2ZPA A;  5L0G A;  3F46 A;  1U89 A;  3QZC A;  4YT5 A;  1IZM A;  1H6G A;  3U2L A;  1O5H A;  1QKR A;  1ORS C;  3TJ5 A;  4EHP A;  2A68 F;  3FHD A;  2QE9 A;  1BR1 A;  2JPU A;  4HFF B;  3SXM A;  1CGO A;  1A0B A;  1OR2 A;  3JZ0 A;  2EIJ C;  3FAJ A;  3R2P A;  3U9J A;  1ZU4 A;  5TJ5 E;  1TWC A;  1FR0 A;  1PCX A;  3MYI A;  5T1D B;  4CJO A;  2CW0 F;  2HZ8 A;  4K7B A;  3HLZ A;  4MVS A;  4PFP A;  4XEF A;  4GQH A;  4XQ1 A;  5BUO A;  5AGF A;  3LLK A;  3EZI A;  4FX5 A;  4JC7 A;  2NUP A;  2P0N A;  3AQC A;  3ABK C;  2E87 A;  3AGT A;  4B6I A;  2R02 A;  2XM0 A;  3TD7 A;  3RQE A;  4H54 A;  3DE9 A;  1LI5 A;  4YT4 A;  1G8X A;  3I5Q A;  2FGY A;  5KYX B;  2CYD A;  3HNJ A;  5L3V A;  5BQH A;  5JSL A;  2WZL A;  2LIG A;  5JT4 A;  3EZH A;  5E2Q A;  3DE8 A;  5D92 A;  2XRH A;  2ZXP A;  3RF3 A;  1XZQ A;  1K05 A;  2PX0 A;  1Q0G A;  1TKN A;  4G78 A;  3S27 A;  4E18 A;  2VCA A;  3FXH A;  3KL4 A;  2LD6 A;  1EQ1 A;  3PDM P;  2YLD A;  2J0W A;  1EI7 A;  1O3U A;  3FOP A;  3SZR A;  2R7T A;  4JJF A;  3DI5 A;  1SF8 A;  1K04 A;  2RSE B;  1GGQ A;  3ATP A;  1JPN A;  2OEV A;  4ULW A;  1E84 A;  2BC5 A;  4R32 A;  2EPN A;  1M2V B;  1OR3 A;  3C18 A;  3S9O A;  2XLD A;  3A11 A;  1BR2 A;  1A41 A;  2B0J A;  3LEV A;  3QMK A;  4RD9 A;  4XEK A;  1M6T A;  2R7S A;  1S7Z A;  2R03 A;  3GWL A;  4Z9I A;  1JRA A;  4G0H A;  1BDJ B;  4YL1 A;  4Q5S F;  3S84 A;  2LSE A;  1FFH A;  1G4U S;  3QVY A;  4NCQ A;  2A0B A;  2Y69 C;  2XXA B;  3W2W A;  4N06 A;  3AQB A;  3Q6N A;  5B3I A;  2R9R B;  2XLV A;  1RCP A;  2DYR C;  4BJ6 A;  4E17 A;  5JVE A;  1KTM A;  3HTK C;  4C7O B;  1HY5 A;  2DGJ A;  4IJJ A;  2D5R B;  3T6J A;  4P9T A;  3IEE A;  3KPH A;  2P1A A;  5EGY A;  1OKK A;  2WZG A;  2Y39 A;  2R7O A;  2HS5 A;  2YL0 A;  256B A;  3IQ6 A;  2Y3G A;  4MVO A;  4O6N A;  3VAY A;  1HE9 A;  3RYL A;  2XL8 A;  4CIP A;  3ZG1 A;  2BL2 A;  1C03 A;  1VMA A;  2VAS A;  1TWH A;  3PCV A;  3FMS A;  5KYU A;  5FZT A;  2KC3 A;  5B1A C;  4JTA B;  5T3W A;  4JRZ A;  2LFF A;  3EGD A;  4CS8 A;  4BEJ A;  3NYL A;  1RXQ A;  1U6H A;  1M2O A;  1OW8 A;  1VYI A;  3GEH A;  4X0R A;  1OKK D;  1YAR O;  4JW1 A;  3RW0 A;  1A7V A;  1VB5 A;  4EBJ A;  4KBL A;  3JT1 A;  2CNW D;  2WL8 A;  1ZW2 A;  3M1C B;  2HJM A;  2J46 A;  1R4T A;  3I5P A;  5A6K A;  3KYJ A;  1OCR C;  3UGO A;  3K33 A;  2J9V A;  1LPE A;  1NSG B;  2MWQ A;  3T6B A;  5KYU B;  1BZ4 A;  3SXK A;  1FTS A;  2PFD A;  2XS1 A;  3B0U X;  3GEE A;  2OU6 A;  5JRA A;  1ST6 A;  2X51 A;  2QTV A;  2XS8 A;  2V3C C;  4LDK A;  3MBG A;  3AGU A;  4XPY A;  4NTF A;  2IBF A;  2QLA A;  4LLC A;  2WVN A;  2IOQ A;  5L0D A;  4JEB A;  4EWC A;  1TQG A;  1LI7 A;  1SMY F;  4EBK A;  3LNR A;  4W8P A;  4G7H F;  2L7A A;  1RKC A;  4EIY A;  3GM2 A;  1G5Z A;  1HMD A;  2AU5 A;  2AVK A;  5EHH A;  3I4U A;  4U5C E;  4CDV A;  5L0J A;  3TQO A;  1FAP B;  1ZYR F;  3G50 A;  2MYS A;  3N0T A;  3ASO C;  1W2W A;  4OD4 A;  1OXK A;  3GOD A;  3UMI A;  3OEO A;  1FNT c;  1ZVZ A;  3VM6 A;  1NLX A;  2A1D D;  4MVQ A;  2XLH A;  4N4W A;  1HW2 A;  1Z7Q c;  3DM9 B;  4FAP B;  5E3A A;  1V54 C;  2W9Y A;  2W4M A;  4E7S A;  3UNG C;  4QI0 A;  1L3P A;  2HJ3 A;  2X0C A;  1OQC A;  1ZU5 A;  2AP3 A;  4NTA A;  4KC9 A;  3K1H A;  5AC4 A;  1JOG A;  1D1C A;  1V74 B;  2J7P A;  1YLM A;  1ZHW A;  2XLE A;  3LS1 A;  1T5O A;  1YZA A;  2Q9C A;  2YQY A;  4MTG A;  2J8W A;  2Y3H A;  2GAQ A;  1QVX A;  1Q0K A;  2L9J A;  3G4Z A;  1QZX A;  1TFO B;  3C8G D;  4RDA A;  2ICW G;  1MNE A;  1XZP A;  4DVZ A;  1QQ3 A;  2P7V A;  5KYX A;  4Q4Z F;  2L6H A;  3T4R A;  3ZC4 A;  3L8I A;  1WOL A;  4DRJ B;  2LCH A;  2A6H F;  1M56 C;  3DZA A;  3HNI A;  3ITF A;  3L8J A;  4L6R A;  4JZA A;  3RVY A;  3V5Z A;  2LFD A;  3CAX A;  3AG2 C;  4O79 A;  4LLE A;  2OJQ A;  2YRF A;  1YJG A;  2WB7 A;  2XL6 A;  2JD3 A;  3UMH A;  3UMK A;  2Q9A A;  4J7Y A;  3IQ5 A;  4XPW A;  4IAR A;  4AK9 A;  3FAP B;  1PD1 A;  3NKD A;  3AOU A;  3QVZ A;  3VF0 A;  3HJC A;  1LKX A;  3NKE A;  4IAO A;  3NMK A;  3Q7L A;  1M2V A;  2EPM X;  3A9C A;  1Z3I X;  3O39 A;  4IWB A;  4OIO F;  4BJ6 C;  3C8Z A;  1E85 A;  2KQ9 A;  3IPM O;  3RQF A;  5F5H A;  2IXN A;  1YYJ A;  2L6G A;  2XLW A;  1WAT A;  2YZS A;  5JP7 A;  2LQG A;  3U3F A;  1SZI A;  1MMA A;  3PHF 2;  3GAN A;  2XXA A;  1OCC C;  2IM8 A;  2KNH A;  4JUR I;  5HSW A;  4OD5 A;  5EK0 A;  3SXZ A;  3EG9 B;  3EFO B;  1LE4 A;  1NBB A;  3DAF A;  2HFI A;  2YHS A;  3K7D A;  3O6X A;  1T6U A;  4JE9 A;  4PJL A;  4EUK B;  1YVI A;  2KK1 A;  1TWG A;  3US6 A;  1H9G A;  1U0B B;  2EIN C;  2R7U A;  3B29 A;  3ZQY A;  1VLT A;  4HEA J;  3HKK A;  1DOV A;  1LE2 A;  4XPX A;  4PJN A;  2NUT A;  4CS8 C;  1UFB A;  4YT2 A;  4G7Z F;  2EIL C;  2DI3 A;  1E86 A;  4CBE A;  1PD0 A;  1Y4C A;  4IB4 A;  2CCY A;  3GM3 A;  4LDQ A;  4BJ1 A;  3WAQ A;  3AG1 C;  4FES A;  4MVR A;  5KYY B;  3LS0 A;  5A6A A;  2KYH A;  1Q0F A;  3KKB A;  4C3E A;  3C7J A;  2KW3 C;  4C3B A;  3S90 A;  3IQC A;  3ECS A;  1I5N A;  3C62 A;  2YKZ A;  4JVS A;  2EPK X;  1WN0 A;  3MX3 A;  2IXM A;  4XTK A;  3S29 A;  3BRJ A;  1Z5Z A;  3FVY A;  3Q6M A;  1CPQ A;  1V55 C;  1RKE A;  3RH3 A;  2Z15 A;  3QW1 A;  2UUH A;  3TOM A;  4IRU A;  4E0I A;  2NUT B;  2F22 A;  4BJT A;  4N6H A;  1LIH A;  1DOW A;  1ORJ A;  2WVO A;  5DQT A;  2BE5 F;  3G4X A;  5L3Q A;  4CDY A;  1D1B A;  2C04 A;  5DS4 A;  2QY9 A;  2L81 A;  2GFH A;  2QNL A;  1A7D A;  3DMD A;  4DOZ A;  4ER9 A;  4EKW A;  2Y3D A;  3E70 C;  3SNH A;  2KSF A;  1ZHT A;  2ETS A;  4G7O F;  2XL4 A;  2EIM C;  2YL1 A;  3DJU B;  2GWW A;  3GWN A;  3LJB A;  2O9X A;  3U8P A;  5KYW A;  1ZZP A;  2PNO A;  3HNL A;  3K1I C;  4YL3 A;  1RKE B;  3B71 A;  5L0H A;  1CGN A;  4JKV A;  4PFO A;  1Q0M A;  1MMN A;  2XSE A;  3B9Q A;  2OEX A;  3DM5 A;  2NPU A;  3SYN A;  1UG7 A;  4QDL A;  3UR3 C;  4MVM A;  3X2Q C;  3B0P A;  4JEA A;  1CGM E;  4KNV A;  1Z6A A;  3ABL C;  3LEO A;  2OG2 A;  1EKY A;  4JJG A;  4OIR F;  4D4X A;  1I4Z A;  1G4W R;  4NTB A;  3RQG A;  3JSE O;  2M64 A;  3LNM B;  2AWC A;  2V26 A;  4YK5 A;  1QSP A;  2R7Q A;  2W4B A;  3MYF A;  4AL1 A;  1OCZ C;  5KYW B;  3U5S A;  3JTL O;  4YN0 B;  3U9M A;  4AX2 A;  2KJG A;  3NMJ A;  3ZTZ A;  5DQZ A;  1H9T A;  2B0H A;  1L7C A;  5IY5 C;  2JX0 A;  2OKU A;  3ZIB A;  2WZF A;  3N24 A;  3M79 A;  5T3T A;  2KGO A;  3MFN A;  3NMI A;  1RJ9 B;  3EHM A;  2L6F A;  3V7O A;  1JMW A;  4GYT A;  4IAQ A;  1NG1 A;  2HMZ A;  2IYL D;  3KH2 A;  3K1I A;  2YL3 A;  2CGE A;  4MND A;  1LVK A;  3M15 A;  4FWV A;  4I1O B;  4P6I C;  4Z9J A;  5COG A;  1T9K A;  2H7V C;  5DVW A;  5A6B A;  5E33 A;  1BBH A;  1YA7 O;  2XLO A;  4EBB A;  5COF A;  1Y6D A;  4YWQ A;  2QUP A;  1E2X A;  3U0C A;  3O55 A;  2J0X A;  4WJ0 A;  4D4N A;  1F1M A;  4U9E A;  3CEX A;  3SP1 A;  3B0V C;  4DJ9 A;  3V5X A;  3WOD F;  1V4A A;  4I44 A;  5L0I A;  3AG4 C;  4YL0 A;  4CIH A;  4CSA C;  3M4C A;  4MVZ A;  4F4B A;  4DXW A;  3JRM O;  4BJ5 C;  3FDQ A;  3SEO A;  4AE4 B;  3W8I A;  3F47 A;  4P9F A;  3GM1 A;  3WG7 C;  5CIV A;  1YDI A;  3RKO F;  3EH1 A;  2G3V A;  2H7O A;  3KMI A;  4AL0 A;  2LP4 A;  1NU9 C;  4LDR A;  4OIQ F;  2ASR A;  1AEP A;  4Z9H A;  1BR4 A;  2I8B A;  3EHN A;  2GDC A;  1Q0D A;  3EJN A;  2P61 A;  5GPG B;  3AJM A;  2PP4 A;  3T9O A;  2Q9B A;  3QTH A;  1O87 A;  3U3B A;  3EPV A;  5CI8 A;  2Q4F A;  2J7P D;  4MTO A;  5B3S C;  1LS1 A;  1D0Z A;  3ZVR A;  1Z23 A;  2J9W A;  3NDB B;  2DYS C;  4O6Y A;  4XWJ A;  1WGW A;  3X1O A;  3R7C A;  3EG9 A;  3EFO A;  1XWJ A;  3KYI A;  4U9D A;  3T6G B;  3TK0 A;  2ZXO A;  2R7R A;  1D0X A;  2OOC A;  1TFK B;  4IGG A;  3J06 A;  4GEH A;  4CSA A;  4U5H A;  3OA1 A;  4BJ5 A;  2Q00 A;  1SR2 A;  1J8M F;  4HFK B;  1SYQ A; 
#chains in the Genus database with same CATH homology
 3FAP B;  2NPU A;  2RSE B;  2GAQ A;  1FAP B;  5GPG B;  4DRJ B;  1AUE A;  4DRH B;  4DRI B;  4FAP B;  2FAP B;  1NSG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...