2FAPB

The structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1998-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2fapB00
5GPGB 4DRIB 4FAPB 2NPUA 4DRJB 1FAPB 2GAQA 1AUEA 2FAPB 2RSEB 3FAPB 1NSGB 4DRHB
chains in the Genus database with same CATH superfamily
1H7IA 3EZIA 5JUAA 2XS8A 4FWVA 5A6JA 2ASRA 1AVOB 4QI2A 4E7SA 2XLOA 2V26A 3GM3A 5KYYB 2YL3A 1O87A 2OG2A 3S29A 1ORSC 2JD3A 4BG0A 4BJ5A 4FX5A 3OEOA 3ZG1A 4AE4A 4O7GA 4CS8C 4DJ9A 1JMWA 3EFOB 2NSFA 3S84A 3DZAA 3EHMA 1HE9A 3IQCA 2FGYA 2YRFA 2CGEA 1Q0FA 3RQFA 1TWAA 1SYQA 4JTAB 3SZRA 2QY9A 1AUEA 3LUTB 5L0GA 1XWJA 3K1IC 3FMSA 4K0DA 1WATA 3X1OA 1Q0MA 4LERA 4E7ZA 2HS5A 2EPOA 3C8GA 3EGDB 3KYIA 4ULVA 3RW0A 1OKKA 2IBFA 4EUKB 4U5FE 2KYHA 1QLEC 2LIGA 3LLKA 1JPNA 1LS4A 3DM9B 3TJ6A 3G4ZA 4BJTA 2WZGA 2LFFA 3DM5A 4IGGA 4MQ9F 4Q7CA 1E84A 3ZSUA 5AC4A 5BUOA 2CNWD 3U0CA 4KBLA 4MTFA 3O10A 4LLCA 5KYUB 3BEHA 3DWWA 2KC3A 2R7SA 3LS0A 3KL4A 1EQ1A 1MMGA 3LEOA 5KYXA 3TOLA 3ASNC 1OCOC 1JRAA 2W4MA 2BE5F 2W45A 3GANA 3NMIA 4AL1A 3X2QC 4BPMA 1WN0A 3ZTMA 3S90A 4I3MA 4C7OB 1FTSA 3U8VA 3UGPA 4D4XA 1M56C 2KSFA 2ZXOA 3GWLA 4DVZA 5A69A 3ABKC 1E2XA 1H9TA 2YLGA 1FFHA 3GEEA 4ER9A 2G3KA 2XLMA 1I5NA 3GM2A 3H65A 4PACA 3RVZA 4PJNA 1LE4A 2H7VC 1VOMA 1T5OA 3K6BA 3DXJF 4C3DA 2Y3GA 2UUHA 3GWNA 3M15A 4YT4A 1RJ9A 3H2VA 3DAFA 4MVUA 4HFFB 2J9VA 4CS7A 4L6RA 3AG4C 5DQZA 4JTCB 3QZCA 1NFOA 4W8PA 2A0BA 2WVNA 4MTOA 4PR9A 1ORYA 1YJGA 2J7PA 1ST6A 4XPXA 1GQAA 5T3WA 3M79A 2V3CC 4XPYA 5FZTA 5T3TA 4RBNA 4E17A 4U5DE 1D0YA 2HSBA 4PFPA 2J9BA 1VLSA 3O39A 5E3CA 5BQGA 3RQGA 4BJ6A 1JR8A 2R7VA 4EBBA 3DD7A 3Q7LA 5L3VA 2VH3A 1D1AA 2PP4A 1IZMA 1TKNA 1WTYA 3GODA 5L0DA 5A6BD 3B0UX 1MMNA 3OWTA 4EWCA 1CGOA 2CCYA 3MFNA 1G5ZA 2AWCA 3ZTZA 1EI7A 1APCA 1H6GA 4G7HF 1RCPA 4LLEA 4XTKA 2Y3DA 4ULWA 4NTBA 5HSWA 3L0IA 3VM6A 2P1AA 4IB4A 3JCUQ 1FFTC 1RXQA 2H8AA 2R7QA 1NLXA 2Y69C 4IJJA 1ZW3A 3U5SA 3SXMA 4GEHA 4M63A 4FAPB 1NBBA 3LLIA 3CZ6A 4U9DA 1HW1A 1L7CA 1QQ3A 4IAQA 2YZSA 1SR2A 2J45A 3B71A 2D5RB 3C18A 2LCHA 3NMJA 2KGOA 2LSEA 4G7ZF 2P7VA 1JPJA 5B1AC 1LS1A 1V54C 1TWHA 1HE1A 2R9RB 3KMIA 1YYXA 2J0XA 5JSLA 2Q3TA 1ZHWA 3HNKA 1ZU4A 3FOPA 3LS1A 4MVOA 3T9OA 1M2OA 2W4BA 3L1MA 1A7DA 3ASOC 3FVYA 3LAYA 4KNWA 4D4NA 1YARO 3QTHA 1CGNA 4C7OA 1BDJB 2Y39A 2YL7A 3Q6NA 3T6JA 4JVSA 4YK5A 4YWQA 5JRAA 5DQTA 2GWWA 3AQBA 1N1CA 5COGA 2JPUA 3VYWA 2B0HA 4EKWA 2NUTB 5DS4A 4H54A 4HEAJ 1Z63A 4KC9A 3I5PA 3PHF2 1JOGA 5A6KA 1SZIA 1VYKA 1Y4CA 1E85A 3Q7GA 1I4YA 1YVIA 1S7ZA 3SXYA 3LNMB 4BEMJ 4DOZA 3JT1A 4YT2A 2XXAB 5F5FA 1MMAA 5COFA 5AC5A 3UGOA 3ZIBA 5L0JA 1GM5A 2Q00A 4N6CA 4XLNF 3PMRA 2OEVA 3T4RA 2L9JA 4JRZA 1G4WR 1PCXA 3FDQA 4AX2A 2RD9A 3IPMO 2TMVP 2CYDA 3EHNA 2HJ3A 3EH2A 1YLMA 1W2WA 3HNJA 4JEAA 3HLZA 4OINF 5BQHA 1YA7O 2A6HF 3DKAA 1A0BA 5A6AA 4OIOF 1BR2A 1TFOB 4O6NA 2R7UA 5DVWA 1A7EA 2R05A 2BL2A 2YLDA 4O6YA 2A69F 3M4BA 3AGUA 5JVEA 1D0XA 1G4US 4O6MA 2WVQA 1RMVA 3H2UA 1RKEA 3SXZA 2VCAA 1LI5A 3U3FA 1WASA 2A1DD 1ZHYA 2CNWA 2Q9CA 4P9FA 2DYSC 3C8GB 1S05A 2YWAA 3ZDLA 1PD0A 3FXHA 3EZHA 1L3PA 1XZPA 4Z9IA 1B68A 4LDQA 4OD5A 4H4KC 3T6GB 1C17M 2HMZA 1GGQA 2IXMA 1T01A 2QLAA 2DB4A 4YT8A 5KYYA 4IRUA 4LDKA 5KYNA 1D0ZA 3PCVA 5D92A 4P6IC 1DOVA 2XLDA 3UNGC 5B3SC 4Z9HA 2XM0A 3JRMO 4BJ1A 5L0CA 3DI5A 3EFOA 4MNDA 1BBHA 1YYJA 2MHRA 3ATPA 3HTKC 1Q0KA 2L7AA 3CAXA 3LESA 4G0HA 4A4AA 2L81A 3IQTA 3U3BA 1I4ZA 3V5XA 4BJ5C 3JZ0A 4JJFA 1Q0DA 3OA1A 2PX3A 2ZD9A 1LI7A 2EPLX 2R7OA 2IXOA 2XSEA 5DS6A 2NUPB 3AG2C 1KU2A 3TJ5A 3O6XA 2XLHA 4N4WA 1V55C 4MVSA 2L6GA 4XEFA 2X0CA 4MW8A 3UMHA 4DRJB 4CBEA 4NCQA 5A6BA 4N6HA 2GAQA 1M57C 3T6BA 2AP3A 2J9UA 2OKUA 5CI9A 3V5ZA 3POVA 1CPQA 4NTAA 2A0UA 1Q0GA 1CGME 1OW6A 2KW3C 2L6FA 4I44A 2Q4FA 5E33A 2XS1A 2RSEB 3ZC4A 4CS9A 5KYWB 2DI3A 2I8BA 4RDAA 5KYUA 5EK0A 2HV7A 1Z23A 4GQHA 4Q5SF 2CDQA 3WG7C 1LM3B 4HFKB 1E83A 1FR0A 1OR2A 2R7XA 1BR1A 1YZCA 2HSQA 2EILC 3BRJA 1VMAA 4GYTA 3RIPA 3U8PA 4U5BE 4EBJA 1FMVA 3HKKA 2R7RA 3QW0A 2AU5A 3MLGA 2OCCC 2AWYA 2XRHA 1NFNA 3I4UA 5AGFA 3VF0A 4AL0A 2IYLD 5B3IA 3R2PA 4XEVA 1LPEA 2C03A 5L0HA 2YVKA 3C62A 4CDYA 4MVMA 5F28E 2XLWA 2C04A 3RH3A 4MS2A 4DVYP 3F47A 3NDBB 1TQGA 4QI0A 4R32A 2FFHA 4YN0B 4OIRF 3W2VA 4MVQA 3EH1A 4IARA 2OU6A 1M2VB 2OJED 3UR3C 5JT4A 3W8IA 2XLEA 1J8YF 1K04A 3S28A 4B6IA 3NKDA 1F1MA 2VASA 4LDRA 3SEOA 3U2MA 4QDLA 2L6HA 2LK4A 5FCLA 4XQ1A 3MBGA 1Z5ZA 2NSGA 3EGXA 4CX9A 3G50A 4G78A 3SXKA 2EIMC 4NQFA 2VCBA 1WGWA 2B0JA 4AK9A 1MQVA 5DS5A 4J7YA 1TWCA 4CDVA 2QNLA 2ETSA 4YL0A 3TULA 2HMQA 2PNOA 3ZQVA 2F22A 1D1BA 4C3BA 4CIHA 2XL4A 3QW1A 3S9OA 1RKCA 1IW7F 2M4EA 1EA8A 2J8WA 3DJNB 3R7CA 5B1BC 4BJ6C 3K7DA 3V7OA 3TK0A 4ZLDA 2XL6A 3GEIA 3L8JA 3M1CB 4K7BA 1YDIA 4JTDB 4YL3A 2D4UA 1V4AA 1HY5A 1OCCC 2Y3HA 4JEBA 4DRHB 1XZQA 3IQ6A 4FESA 3QVYA 1Z3IX 2Q9AA 1J8MF 3NYMA 2QUPA 3ITFA 3QVZA 1ZU5A 4JIOA 3RFYA 3U2LA 3ZWIA 5JS5A 5L0FA 1BR4A 4CSAA 3L34A 3Q6MA 2KK1A 3S0XA 2R25A 4PFOA 2P61A 1TR2A 3IEEA 2EPNA 3TOMA 2PF4E 5IY5C 1G8XA 3EG9B 4CDAA 4O79A 1VLTA 3EQLF 2E87A 2IXPA 3N2ZB 2YL1A 3AG1C 4OIPF 3DJUB 4JE9A 1FMWA 4KNVA 4CS8A 2VC9A 3B0PA 3IHUA 5BQIA 3ZQYA 2X51A 3LNRA 2G62A 1MNEA 4J30B 4JURI 2P0NA 1LKXA 1VB5A 5JLIA 4LACB 1VK5A 4AE4B 1GS9A 5CI8A 3ZVRA 2OOCA 2GFHA 2HUJA 1H9GA 2MWQA 1KNYA 4HE8D 4N06A 4OD4A 2R02A 5HV9A 1ZHZA 2DYRC 3I5QA 3K1IA 2QE9A 1BZ4A 3FOOA 4WJ0A 4X0RA 3TQOA 4CJGA 4DRIB 3HNIA 5L0IA 1FNTc 5TJ5E 2Q7RA 3HJCA 3FAPB 5E2QA 3K33A 5CIVA 3B0VC 2HFIA 4JZAA 4CSAC 2XXAA 1T6IA 4PJJA 3SYNA 3W4YA 4ZLCA 2PX0A 1O3UA 1R4TA 2HKVA 3GEHA 4NC3A 3E9VA 4ANJA 4XPWA 1UG7A 1U0BB 1YAUO 1LVKA 4CJOA 3PDMP 2YHSA 4EBKA 1T6QA 3MX3A 3K66A 4ONSA 1U89A 4I1MA 1D1CA 1R5ID 3RKOF 256BA 4Q4ZF 3NG1A 3NRHA 1ORJA 4NY3A 4DBRA 3EPVA 1LIHA 3C7JA 4E0HA 3KKBA 1FAPB 1ZVZA 1NZEA 1QZXA 1TWGA 2WZFA 1HW2A 3NMKA 5KYXB 1EKYA 2XM4A 4P9TA 1ZHXA 2YQYA 4W8KA 3WAQA 2LFDA 3KYJA 3O55A 3QMKA 4DBQA 2P6VA 3DE8A 2HZ8A 2OEXA 2PFDA 3EGDA 3L8IA 2A68F 4J32B 2M64A 2CW0F 4Z9JA 3J06A 1V74B 4U9EA 2R03A 3AJMA 3V5YA 1OW8A 1DOWA 3F46A 2ZPAA 4U5EE 5GPGB 2YEVA 3AGTA 3IQ5A 2IOQA 3NKEA 1NU9C 1OXKA 4JC7A 1A7VA 3C8GD 3RVYA 2J46A 2OQMA 5K0IA 1OKKD 3W2WA 1OCRC 1RJ9B 2A6EF 3ABLC 3M4CA 1ZHTA 1T6UA 4PJMA 1U6HA 1NSGB 4A2NB 2WB7A 3JSEO 1YA9A 3DAGA 1M6TA 4MTGA 2NUPA 1Z7Qc 4RD9A 1SMYF 1LE2A 1SF8A 2NG1A 4WGZA 1MMDA 1K40A 3CEXA 2I15A 3CSKA 1JAFA 3EJNA 1NU7D 4WABA 2O9XA 4WGYA 3GM1A 4C3EA 2ICWG 4K1OA 4MW3A 2H7BA 4G7OF 2VB6A 2EIJC 3JYHA 4I1OB 3VAYA 3C8ZA 2HV6A 1A41A 1TFKB 4EIYA 2LP4A 2WZLA 4EHPA 5KYWA 3B9QA 3N24A 2FAPB 3MYIA 2ZXWC 5L3QA 3MYFA 1Z6AA 1WWPA 3W8HA 2QTVA 1C02A 4IWBA 3A9CA 1MNDA 4DXWA 1E86A 1T9KA 2J9WA 2LQGA 3JSZA 4CS9C 3EGXB 4U5HA 3RQEA 4IAOA 1QPUA 3A11A 4E18A 1HMDA 4KI2A 4J7TA 4JCZA 1O5HA 2W9YA 1K05A 3U9JA 1YZAA 5F5HA 1OQCA 2EPKX 2UUIA 3ABMC 2LD6A 3US6A 1OCZC 4MVZA 2YLIA 4PJLA 3K1HA 3LJBA 1AEPA 3DMDA 4YT5A 5D91A 1NG1A 1ZZPA 5JP7A 4UDVA 2Z15A 2VCCA 4E0IA 3AG3C 2J7PD 4JKVA 2HJMA 4OIQF 2WVOA 3C63A 3E70C 1M2VA 2KJGA 1QVXA 2R7TA 4F4BA 2PBEA 5T1DB 4BEJA 2Q9BA 3NYLA 2IM8A 3JTLO 3N0TA 3RYLA 2ZXPA 2KQ9A 4XEKA 3UMIA 2DGJA 1OR3A 2YKZA 4U5CE 4YJWA 4YL1A 3JYYA 1UFBA 2OJQA 3VRCA 2EPMX 2Y3BA 3KPHA 3LEVA 2NPUA 1VTMP 3GORA 1WOLA 4NTFA 1PD1A 2GDCA 2MYSA 2H7OA 2BC5A 2YL0A 1QKRA 2IXNA 5EGYA 3SP1A 2R7WA 3AQCA 3AOUA 2JX0A 2KNHA 3FAJA 2XLVA 3JRTA 2ZXRA 4PK4A 3DE9A 4XWJA 2XL8A 4JW1A 4JJGA 1QSPA 3CQZA 1PV3A 5DLJA 3KH2A 2AVKA 1OXBA 1ZW2A 3B29A 3WODF 1HMOA 5EHHA 4U5GA 2EIKC 3G4XA 1C03A 2J0WA 3ECSA 3SNHA 4MVRA 1KTMA 3UMKA 1Y6DA 4CIPA 2WL8A 3HNLA 3NYJA 5E3AA 3S27A 1OW7A 3WHNA 3U9MA 3RF3A 1VYIA 4XLPF 2NUTA 3FHDA 2EINC 3TD7A 2GA0A 1CPRA 5COMA 4JCHA 2G3VA 1ZYRF 1RKEB 3EG9A
chains in the Genus database with same CATH topology
5GPGB 4DRIB 4FAPB 2NPUA 4DRJB 1FAPB 2GAQA 1AUEA 2FAPB 2RSEB 3FAPB 1NSGB 4DRHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPG B;  4DRI B;  4FAP B;  2NPU A;  4DRJ B;  1FAP B;  2GAQ A;  1AUE A;  2FAP B;  2RSE B;  3FAP B;  1NSG B;  4DRH B; 
#chains in the Genus database with same CATH topology
 1H7I A;  3EZI A;  5JUA A;  2XS8 A;  4FWV A;  5A6J A;  2ASR A;  1AVO B;  4QI2 A;  4E7S A;  2XLO A;  2V26 A;  3GM3 A;  5KYY B;  2YL3 A;  1O87 A;  2OG2 A;  3S29 A;  1ORS C;  2JD3 A;  4BG0 A;  4BJ5 A;  4FX5 A;  3OEO A;  3ZG1 A;  4AE4 A;  4O7G A;  4CS8 C;  4DJ9 A;  1JMW A;  3EFO B;  2NSF A;  3S84 A;  3DZA A;  3EHM A;  1HE9 A;  3IQC A;  2FGY A;  2YRF A;  2CGE A;  1Q0F A;  3RQF A;  1TWA A;  1SYQ A;  4JTA B;  3SZR A;  2QY9 A;  1AUE A;  3LUT B;  5L0G A;  1XWJ A;  3K1I C;  3FMS A;  4K0D A;  1WAT A;  3X1O A;  1Q0M A;  4LER A;  4E7Z A;  2HS5 A;  2EPO A;  3C8G A;  3EGD B;  3KYI A;  4ULV A;  3RW0 A;  1OKK A;  2IBF A;  4EUK B;  4U5F E;  2KYH A;  1QLE C;  2LIG A;  3LLK A;  1JPN A;  1LS4 A;  3DM9 B;  3TJ6 A;  3G4Z A;  4BJT A;  2WZG A;  2LFF A;  3DM5 A;  4IGG A;  4MQ9 F;  4Q7C A;  1E84 A;  3ZSU A;  5AC4 A;  5BUO A;  2CNW D;  3U0C A;  4KBL A;  4MTF A;  3O10 A;  4LLC A;  5KYU B;  3BEH A;  3DWW A;  2KC3 A;  2R7S A;  3LS0 A;  3KL4 A;  1EQ1 A;  1MMG A;  3LEO A;  5KYX A;  3TOL A;  3ASN C;  1OCO C;  1JRA A;  2W4M A;  2BE5 F;  2W45 A;  3GAN A;  3NMI A;  4AL1 A;  3X2Q C;  4BPM A;  1WN0 A;  3ZTM A;  3S90 A;  4I3M A;  4C7O B;  1FTS A;  3U8V A;  3UGP A;  4D4X A;  1M56 C;  2KSF A;  2ZXO A;  3GWL A;  4DVZ A;  5A69 A;  3ABK C;  1E2X A;  1H9T A;  2YLG A;  1FFH A;  3GEE A;  4ER9 A;  2G3K A;  2XLM A;  1I5N A;  3GM2 A;  3H65 A;  4PAC A;  3RVZ A;  4PJN A;  1LE4 A;  2H7V C;  1VOM A;  1T5O A;  3K6B A;  3DXJ F;  4C3D A;  2Y3G A;  2UUH A;  3GWN A;  3M15 A;  4YT4 A;  1RJ9 A;  3H2V A;  3DAF A;  4MVU A;  4HFF B;  2J9V A;  4CS7 A;  4L6R A;  3AG4 C;  5DQZ A;  4JTC B;  3QZC A;  1NFO A;  4W8P A;  2A0B A;  2WVN A;  4MTO A;  4PR9 A;  1ORY A;  1YJG A;  2J7P A;  1ST6 A;  4XPX A;  1GQA A;  5T3W A;  3M79 A;  2V3C C;  4XPY A;  5FZT A;  5T3T A;  4RBN A;  4E17 A;  4U5D E;  1D0Y A;  2HSB A;  4PFP A;  2J9B A;  1VLS A;  3O39 A;  5E3C A;  5BQG A;  3RQG A;  4BJ6 A;  1JR8 A;  2R7V A;  4EBB A;  3DD7 A;  3Q7L A;  5L3V A;  2VH3 A;  1D1A A;  2PP4 A;  1IZM A;  1TKN A;  1WTY A;  3GOD A;  5L0D A;  5A6B D;  3B0U X;  1MMN A;  3OWT A;  4EWC A;  1CGO A;  2CCY A;  3MFN A;  1G5Z A;  2AWC A;  3ZTZ A;  1EI7 A;  1APC A;  1H6G A;  4G7H F;  1RCP A;  4LLE A;  4XTK A;  2Y3D A;  4ULW A;  4NTB A;  5HSW A;  3L0I A;  3VM6 A;  2P1A A;  4IB4 A;  3JCU Q;  1FFT C;  1RXQ A;  2H8A A;  2R7Q A;  1NLX A;  2Y69 C;  4IJJ A;  1ZW3 A;  3U5S A;  3SXM A;  4GEH A;  4M63 A;  4FAP B;  1NBB A;  3LLI A;  3CZ6 A;  4U9D A;  1HW1 A;  1L7C A;  1QQ3 A;  4IAQ A;  2YZS A;  1SR2 A;  2J45 A;  3B71 A;  2D5R B;  3C18 A;  2LCH A;  3NMJ A;  2KGO A;  2LSE A;  4G7Z F;  2P7V A;  1JPJ A;  5B1A C;  1LS1 A;  1V54 C;  1TWH A;  1HE1 A;  2R9R B;  3KMI A;  1YYX A;  2J0X A;  5JSL A;  2Q3T A;  1ZHW A;  3HNK A;  1ZU4 A;  3FOP A;  3LS1 A;  4MVO A;  3T9O A;  1M2O A;  2W4B A;  3L1M A;  1A7D A;  3ASO C;  3FVY A;  3LAY A;  4KNW A;  4D4N A;  1YAR O;  3QTH A;  1CGN A;  4C7O A;  1BDJ B;  2Y39 A;  2YL7 A;  3Q6N A;  3T6J A;  4JVS A;  4YK5 A;  4YWQ A;  5JRA A;  5DQT A;  2GWW A;  3AQB A;  1N1C A;  5COG A;  2JPU A;  3VYW A;  2B0H A;  4EKW A;  2NUT B;  5DS4 A;  4H54 A;  4HEA J;  1Z63 A;  4KC9 A;  3I5P A;  3PHF 2;  1JOG A;  5A6K A;  1SZI A;  1VYK A;  1Y4C A;  1E85 A;  3Q7G A;  1I4Y A;  1YVI A;  1S7Z A;  3SXY A;  3LNM B;  4BEM J;  4DOZ A;  3JT1 A;  4YT2 A;  2XXA B;  5F5F A;  1MMA A;  5COF A;  5AC5 A;  3UGO A;  3ZIB A;  5L0J A;  1GM5 A;  2Q00 A;  4N6C A;  4XLN F;  3PMR A;  2OEV A;  3T4R A;  2L9J A;  4JRZ A;  1G4W R;  1PCX A;  3FDQ A;  4AX2 A;  2RD9 A;  3IPM O;  2TMV P;  2CYD A;  3EHN A;  2HJ3 A;  3EH2 A;  1YLM A;  1W2W A;  3HNJ A;  4JEA A;  3HLZ A;  4OIN F;  5BQH A;  1YA7 O;  2A6H F;  3DKA A;  1A0B A;  5A6A A;  4OIO F;  1BR2 A;  1TFO B;  4O6N A;  2R7U A;  5DVW A;  1A7E A;  2R05 A;  2BL2 A;  2YLD A;  4O6Y A;  2A69 F;  3M4B A;  3AGU A;  5JVE A;  1D0X A;  1G4U S;  4O6M A;  2WVQ A;  1RMV A;  3H2U A;  1RKE A;  3SXZ A;  2VCA A;  1LI5 A;  3U3F A;  1WAS A;  2A1D D;  1ZHY A;  2CNW A;  2Q9C A;  4P9F A;  2DYS C;  3C8G B;  1S05 A;  2YWA A;  3ZDL A;  1PD0 A;  3FXH A;  3EZH A;  1L3P A;  1XZP A;  4Z9I A;  1B68 A;  4LDQ A;  4OD5 A;  4H4K C;  3T6G B;  1C17 M;  2HMZ A;  1GGQ A;  2IXM A;  1T01 A;  2QLA A;  2DB4 A;  4YT8 A;  5KYY A;  4IRU A;  4LDK A;  5KYN A;  1D0Z A;  3PCV A;  5D92 A;  4P6I C;  1DOV A;  2XLD A;  3UNG C;  5B3S C;  4Z9H A;  2XM0 A;  3JRM O;  4BJ1 A;  5L0C A;  3DI5 A;  3EFO A;  4MND A;  1BBH A;  1YYJ A;  2MHR A;  3ATP A;  3HTK C;  1Q0K A;  2L7A A;  3CAX A;  3LES A;  4G0H A;  4A4A A;  2L81 A;  3IQT A;  3U3B A;  1I4Z A;  3V5X A;  4BJ5 C;  3JZ0 A;  4JJF A;  1Q0D A;  3OA1 A;  2PX3 A;  2ZD9 A;  1LI7 A;  2EPL X;  2R7O A;  2IXO A;  2XSE A;  5DS6 A;  2NUP B;  3AG2 C;  1KU2 A;  3TJ5 A;  3O6X A;  2XLH A;  4N4W A;  1V55 C;  4MVS A;  2L6G A;  4XEF A;  2X0C A;  4MW8 A;  3UMH A;  4DRJ B;  4CBE A;  4NCQ A;  5A6B A;  4N6H A;  2GAQ A;  1M57 C;  3T6B A;  2AP3 A;  2J9U A;  2OKU A;  5CI9 A;  3V5Z A;  3POV A;  1CPQ A;  4NTA A;  2A0U A;  1Q0G A;  1CGM E;  1OW6 A;  2KW3 C;  2L6F A;  4I44 A;  2Q4F A;  5E33 A;  2XS1 A;  2RSE B;  3ZC4 A;  4CS9 A;  5KYW B;  2DI3 A;  2I8B A;  4RDA A;  5KYU A;  5EK0 A;  2HV7 A;  1Z23 A;  4GQH A;  4Q5S F;  2CDQ A;  3WG7 C;  1LM3 B;  4HFK B;  1E83 A;  1FR0 A;  1OR2 A;  2R7X A;  1BR1 A;  1YZC A;  2HSQ A;  2EIL C;  3BRJ A;  1VMA A;  4GYT A;  3RIP A;  3U8P A;  4U5B E;  4EBJ A;  1FMV A;  3HKK A;  2R7R A;  3QW0 A;  2AU5 A;  3MLG A;  2OCC C;  2AWY A;  2XRH A;  1NFN A;  3I4U A;  5AGF A;  3VF0 A;  4AL0 A;  2IYL D;  5B3I A;  3R2P A;  4XEV A;  1LPE A;  2C03 A;  5L0H A;  2YVK A;  3C62 A;  4CDY A;  4MVM A;  5F28 E;  2XLW A;  2C04 A;  3RH3 A;  4MS2 A;  4DVY P;  3F47 A;  3NDB B;  1TQG A;  4QI0 A;  4R32 A;  2FFH A;  4YN0 B;  4OIR F;  3W2V A;  4MVQ A;  3EH1 A;  4IAR A;  2OU6 A;  1M2V B;  2OJE D;  3UR3 C;  5JT4 A;  3W8I A;  2XLE A;  1J8Y F;  1K04 A;  3S28 A;  4B6I A;  3NKD A;  1F1M A;  2VAS A;  4LDR A;  3SEO A;  3U2M A;  4QDL A;  2L6H A;  2LK4 A;  5FCL A;  4XQ1 A;  3MBG A;  1Z5Z A;  2NSG A;  3EGX A;  4CX9 A;  3G50 A;  4G78 A;  3SXK A;  2EIM C;  4NQF A;  2VCB A;  1WGW A;  2B0J A;  4AK9 A;  1MQV A;  5DS5 A;  4J7Y A;  1TWC A;  4CDV A;  2QNL A;  2ETS A;  4YL0 A;  3TUL A;  2HMQ A;  2PNO A;  3ZQV A;  2F22 A;  1D1B A;  4C3B A;  4CIH A;  2XL4 A;  3QW1 A;  3S9O A;  1RKC A;  1IW7 F;  2M4E A;  1EA8 A;  2J8W A;  3DJN B;  3R7C A;  5B1B C;  4BJ6 C;  3K7D A;  3V7O A;  3TK0 A;  4ZLD A;  2XL6 A;  3GEI A;  3L8J A;  3M1C B;  4K7B A;  1YDI A;  4JTD B;  4YL3 A;  2D4U A;  1V4A A;  1HY5 A;  1OCC C;  2Y3H A;  4JEB A;  4DRH B;  1XZQ A;  3IQ6 A;  4FES A;  3QVY A;  1Z3I X;  2Q9A A;  1J8M F;  3NYM A;  2QUP A;  3ITF A;  3QVZ A;  1ZU5 A;  4JIO A;  3RFY A;  3U2L A;  3ZWI A;  5JS5 A;  5L0F A;  1BR4 A;  4CSA A;  3L34 A;  3Q6M A;  2KK1 A;  3S0X A;  2R25 A;  4PFO A;  2P61 A;  1TR2 A;  3IEE A;  2EPN A;  3TOM A;  2PF4 E;  5IY5 C;  1G8X A;  3EG9 B;  4CDA A;  4O79 A;  1VLT A;  3EQL F;  2E87 A;  2IXP A;  3N2Z B;  2YL1 A;  3AG1 C;  4OIP F;  3DJU B;  4JE9 A;  1FMW A;  4KNV A;  4CS8 A;  2VC9 A;  3B0P A;  3IHU A;  5BQI A;  3ZQY A;  2X51 A;  3LNR A;  2G62 A;  1MNE A;  4J30 B;  4JUR I;  2P0N A;  1LKX A;  1VB5 A;  5JLI A;  4LAC B;  1VK5 A;  4AE4 B;  1GS9 A;  5CI8 A;  3ZVR A;  2OOC A;  2GFH A;  2HUJ A;  1H9G A;  2MWQ A;  1KNY A;  4HE8 D;  4N06 A;  4OD4 A;  2R02 A;  5HV9 A;  1ZHZ A;  2DYR C;  3I5Q A;  3K1I A;  2QE9 A;  1BZ4 A;  3FOO A;  4WJ0 A;  4X0R A;  3TQO A;  4CJG A;  4DRI B;  3HNI A;  5L0I A;  1FNT c;  5TJ5 E;  2Q7R A;  3HJC A;  3FAP B;  5E2Q A;  3K33 A;  5CIV A;  3B0V C;  2HFI A;  4JZA A;  4CSA C;  2XXA A;  1T6I A;  4PJJ A;  3SYN A;  3W4Y A;  4ZLC A;  2PX0 A;  1O3U A;  1R4T A;  2HKV A;  3GEH A;  4NC3 A;  3E9V A;  4ANJ A;  4XPW A;  1UG7 A;  1U0B B;  1YAU O;  1LVK A;  4CJO A;  3PDM P;  2YHS A;  4EBK A;  1T6Q A;  3MX3 A;  3K66 A;  4ONS A;  1U89 A;  4I1M A;  1D1C A;  1R5I D;  3RKO F;  256B A;  4Q4Z F;  3NG1 A;  3NRH A;  1ORJ A;  4NY3 A;  4DBR A;  3EPV A;  1LIH A;  3C7J A;  4E0H A;  3KKB A;  1FAP B;  1ZVZ A;  1NZE A;  1QZX A;  1TWG A;  2WZF A;  1HW2 A;  3NMK A;  5KYX B;  1EKY A;  2XM4 A;  4P9T A;  1ZHX A;  2YQY A;  4W8K A;  3WAQ A;  2LFD A;  3KYJ A;  3O55 A;  3QMK A;  4DBQ A;  2P6V A;  3DE8 A;  2HZ8 A;  2OEX A;  2PFD A;  3EGD A;  3L8I A;  2A68 F;  4J32 B;  2M64 A;  2CW0 F;  4Z9J A;  3J06 A;  1V74 B;  4U9E A;  2R03 A;  3AJM A;  3V5Y A;  1OW8 A;  1DOW A;  3F46 A;  2ZPA A;  4U5E E;  5GPG B;  2YEV A;  3AGT A;  3IQ5 A;  2IOQ A;  3NKE A;  1NU9 C;  1OXK A;  4JC7 A;  1A7V A;  3C8G D;  3RVY A;  2J46 A;  2OQM A;  5K0I A;  1OKK D;  3W2W A;  1OCR C;  1RJ9 B;  2A6E F;  3ABL C;  3M4C A;  1ZHT A;  1T6U A;  4PJM A;  1U6H A;  1NSG B;  4A2N B;  2WB7 A;  3JSE O;  1YA9 A;  3DAG A;  1M6T A;  4MTG A;  2NUP A;  1Z7Q c;  4RD9 A;  1SMY F;  1LE2 A;  1SF8 A;  2NG1 A;  4WGZ A;  1MMD A;  1K40 A;  3CEX A;  2I15 A;  3CSK A;  1JAF A;  3EJN A;  1NU7 D;  4WAB A;  2O9X A;  4WGY A;  3GM1 A;  4C3E A;  2ICW G;  4K1O A;  4MW3 A;  2H7B A;  4G7O F;  2VB6 A;  2EIJ C;  3JYH A;  4I1O B;  3VAY A;  3C8Z A;  2HV6 A;  1A41 A;  1TFK B;  4EIY A;  2LP4 A;  2WZL A;  4EHP A;  5KYW A;  3B9Q A;  3N24 A;  2FAP B;  3MYI A;  2ZXW C;  5L3Q A;  3MYF A;  1Z6A A;  1WWP A;  3W8H A;  2QTV A;  1C02 A;  4IWB A;  3A9C A;  1MND A;  4DXW A;  1E86 A;  1T9K A;  2J9W A;  2LQG A;  3JSZ A;  4CS9 C;  3EGX B;  4U5H A;  3RQE A;  4IAO A;  1QPU A;  3A11 A;  4E18 A;  1HMD A;  4KI2 A;  4J7T A;  4JCZ A;  1O5H A;  2W9Y A;  1K05 A;  3U9J A;  1YZA A;  5F5H A;  1OQC A;  2EPK X;  2UUI A;  3ABM C;  2LD6 A;  3US6 A;  1OCZ C;  4MVZ A;  2YLI A;  4PJL A;  3K1H A;  3LJB A;  1AEP A;  3DMD A;  4YT5 A;  5D91 A;  1NG1 A;  1ZZP A;  5JP7 A;  4UDV A;  2Z15 A;  2VCC A;  4E0I A;  3AG3 C;  2J7P D;  4JKV A;  2HJM A;  4OIQ F;  2WVO A;  3C63 A;  3E70 C;  1M2V A;  2KJG A;  1QVX A;  2R7T A;  4F4B A;  2PBE A;  5T1D B;  4BEJ A;  2Q9B A;  3NYL A;  2IM8 A;  3JTL O;  3N0T A;  3RYL A;  2ZXP A;  2KQ9 A;  4XEK A;  3UMI A;  2DGJ A;  1OR3 A;  2YKZ A;  4U5C E;  4YJW A;  4YL1 A;  3JYY A;  1UFB A;  2OJQ A;  3VRC A;  2EPM X;  2Y3B A;  3KPH A;  3LEV A;  2NPU A;  1VTM P;  3GOR A;  1WOL A;  4NTF A;  1PD1 A;  2GDC A;  2MYS A;  2H7O A;  2BC5 A;  2YL0 A;  1QKR A;  2IXN A;  5EGY A;  3SP1 A;  2R7W A;  3AQC A;  3AOU A;  2JX0 A;  2KNH A;  3FAJ A;  2XLV A;  3JRT A;  2ZXR A;  4PK4 A;  3DE9 A;  4XWJ A;  2XL8 A;  4JW1 A;  4JJG A;  1QSP A;  3CQZ A;  1PV3 A;  5DLJ A;  3KH2 A;  2AVK A;  1OXB A;  1ZW2 A;  3B29 A;  3WOD F;  1HMO A;  5EHH A;  4U5G A;  2EIK C;  3G4X A;  1C03 A;  2J0W A;  3ECS A;  3SNH A;  4MVR A;  1KTM A;  3UMK A;  1Y6D A;  4CIP A;  2WL8 A;  3HNL A;  3NYJ A;  5E3A A;  3S27 A;  1OW7 A;  3WHN A;  3U9M A;  3RF3 A;  1VYI A;  4XLP F;  2NUT A;  3FHD A;  2EIN C;  3TD7 A;  2GA0 A;  1CPR A;  5COM A;  4JCH A;  2G3V A;  1ZYR F;  1RKE B;  3EG9 A; 
#chains in the Genus database with same CATH homology
 5GPG B;  4DRI B;  4FAP B;  2NPU A;  4DRJ B;  1FAP B;  2GAQ A;  1AUE A;  2FAP B;  2RSE B;  3FAP B;  1NSG B;  4DRH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...