4E0HA

Crystal structure of fad binding domain of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HMDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0hA00
3LLKA 1OQCA 2HJ3A 3W4YA 1JR8A 3O55A 3U2MA 1JRAA 3TD7A 4E0HA 4LDKA 3LLIA 3TK0A 3U5SA 3R7CA 3GWLA 3U2LA 4E0IA 3MBGA 3GWNA
chains in the Genus database with same CATH superfamily
2XLVA 1NFNA 4QI2A 2HUJA 4MVUA 4NY3A 2P0NA 2VB6A 2Z15A 1V55C 4XPXA 2QY9A 2HSBA 2QE9A 3K66A 3K6BA 3ECSA 1BZ4A 1C17M 4XLNF 3MLGA 3FHDA 1RJ9A 2P1AA 3EH2A 1RJ9B 4Q4ZF 1G4US 1AVOB 1HMDA 1M6TA 2PFDA 4D4XA 4CS8C 3EJNA 3OA1A 4JEAA 4F4BA 2YLDA 3OWTA 4CS8A 3S9OA 5JVEA 3HKKA 2XSEA 4KNVA 2WZFA 3WG7C 4EBJA 5F5FA 5AGFA 2MWQA 3WODF 1VTMP 1ZW3A 5JSLA 3S27A 1ZZPA 3T9OA 4IAQA 1E83A 4CS9C 4DBQA 4CS9A 2Y3HA 3TQOA 4KBLA 5A6BD 2H8AA 5K0IA 2R05A 1D1AA 2WL8A 2IOQA 3ABKC 4U5EE 5CI8A 2QNLA 3FOOA 4MW8A 1D0XA 1M2OA 2L6FA 4YK5A 3LEOA 4CX9A 2Y69C 1Q0MA 3GORA 3NYJA 1JAFA 4FWVA 5A6BA 2R25A 4U5HA 5L0IA 4ZLCA 4I1MA 1J8MF 5D91A 1OXKA 4YN0B 3IQCA 2WB7A 1BDJB 4JE9A 1RKCA 3O55A 4NTBA 5JLIA 1Q0DA 2AWYA 1WOLA 3RQFA 2CGEA 3U2MA 1CPRA 3RFYA 3M15A 4U5BE 2E87A 3Q6MA 1E2XA 1WN0A 3U2LA 2ZXRA 4MVZA 5L3VA 4C3EA 3SP1A 1TR2A 3S28A 1XZPA 2HV7A 4U5DE 4J7TA 1VOMA 1H9GA 2M64A 2NG1A 3EGXA 3EGXB 3HNJA 5KYUB 5B1AC 2FAPB 1W2WA 2DB4A 2KSFA 3FMSA 4NTAA 3B0PA 4JJFA 2BE5F 4Z9IA 3UGOA 2XLMA 3T4RA 3JZ0A 1VLTA 4AX2A 3V7OA 4OIPF 1HY5A 2W45A 1TWCA 4NC3A 4Z9JA 1J8YF 3CQZA 3C7JA 1T6UA 3M4CA 1N1CA 1MMAA 2JD3A 4JTDB 3V5ZA 2DI3A 2H7BA 3DXJF 2P6VA 4PJNA 3B9QA 5BUOA 1Y4CA 2ZD9A 1JPJA 3DWWA 3B0UX 3MFNA 3SYNA 4E0IA 1OW6A 3CEXA 4ER9A 2A0BA 4PJJA 2PX3A 2ZXOA 4CIHA 3S90A 3KH2A 5L0FA 1KU2A 2G3VA 3JYYA 3GWNA 3KMIA 3L0IA 3QZCA 2EPKX 4HFKB 4CSAC 5FCLA 2YRFA 2J7PD 4WJ0A 1ZU4A 4CSAA 3AQBA 2J9UA 3DKAA 1V74B 3OEOA 3X1OA 3AGUA 1H7IA 3DM5A 2Q9BA 3JYHA 4I44A 4NQFA 2XL4A 1CPQA 2ETSA 1QVXA 1YYJA 2J7PA 2R7QA 4LLEA 1V54C 2L81A 2LCHA 2LD6A 3JCUQ 3U3BA 4GYTA 1NG1A 1UFBA 4JZAA 4LDQA 2LP4A 4E7ZA 2NUPA 2QUPA 1YJGA 2X51A 3N2ZB 3PHF2 3DAFA 3DI5A 1OCCC 2AVKA 4LDRA 3FOPA 2LK4A 5BQGA 4O6MA 2R7SA 4JKVA 2H7OA 4Z9HA 2AU5A 5JS5A 2OEXA 4W8PA 1I5NA 2C04A 4P9FA 4BJ6C 1A7DA 1E86A 1A41A 3E9VA 5COGA 2R7VA 1XZQA 3WAQA 4BJ6A 3S29A 4CJOA 4C3BA 2TMVP 3ZDLA 1B68A 5L0CA 2R7XA 1U6HA 2GDCA 4JIOA 1SYQA 5KYNA 1SZIA 3G4XA 5AC5A 4WABA 1XWJA 3F46A 1HW2A 3DM9B 2IXNA 2GWWA 3LESA 2RSEB 4JURI 2YKZA 3CAXA 4JRZA 1D1CA 4N4WA 5BQIA 3GM1A 3GM3A 4G78A 4YJWA 5DQTA 1YZCA 5GPGB 1RCPA 1KNYA 2J0XA 3TD7A 3LLIA 1D0YA 4MTOA 4KI2A 3C62A 4MTFA 4EWCA 4JJGA 4CIPA 3DE9A 2VASA 1WATA 3ZWIA 3ZQVA 3UGPA 1Z6AA 1ST6A 3E70C 5IY5C 1WASA 4H4KC 4DVYP 5E3CA 5T1DB 2OKUA 2XLDA 3EQLF 3G4ZA 4FESA 4U5CE 3UNGC 3U9JA 1ZU5A 2OEVA 2WVQA 4XWJA 4E18A 1AEPA 5BQHA 4GQHA 1S7ZA 2CCYA 1Q0FA 4PR9A 3PDMP 4I1OB 1Z5ZA 3RVZA 2OQMA 3ZSUA 1VYKA 2OCCC 1FFTC 2R9RB 3AG2C 4EIYA 1MNDA 4ZLDA 2VCAA 1GS9A 2A1DD 1MMGA 1YYXA 1TWHA 3EZIA 3NYMA 2G3KA 3N0TA 4NCQA 4Q7CA 1OKKD 4N6CA 4DRJB 2XS8A 3A9CA 5T3TA 3U8VA 1LE4A 1Z63A 1GGQA 1TFOB 2W4BA 4C3DA 2R7RA 4CJGA 4J32B 3U5SA 2D5RB 3WHNA 2JX0A 1H9TA 3SXMA 5DQZA 4BJ5C 1LI7A 3TOLA 1MMNA 1Z23A 1OKKA 4BJ5A 1K04A 4JTAB 1G5ZA 3IQ6A 3LAYA 3VRCA 2R7WA 4G7OF 1GQAA 4JCZA 256BA 2F22A 3K1IC 4KNWA 3B0VC 3LLKA 3K1IA 4RD9A 2HJ3A 3O10A 1D1BA 4JTCB 1RMVA 3ZC4A 2A6HF 2ZXPA 2L6HA 3ITFA 2XXAA 2R7UA 2M4EA 2XXAB 2PF4E 3ABLC 1JR8A 4M63A 4MVMA 1V4AA 1BR4A 1YA7O 1YAUO 4U9EA 3NDBB 3JTLO 5KYWA 1NLXA 4YWQA 5KYWB 2XL8A 3U0CA 2AP3A 4LERA 1VMAA 2C03A 4J7YA 1C02A 1QQ3A 2QLAA 2XLHA 2XRHA 5E3AA 1PD1A 2EPOA 3W2WA 4E0HA 4EUKB 2ASRA 1JOGA 2VCBA 2NPUA 3IPMO 1ZVZA 2Y3BA 4L6RA 4OD4A 3C18A 2HJMA 1MQVA 2KC3A 2L7AA 4XPYA 1ORJA 3FXHA 3FDQA 5E33A 4O6NA 5KYUA 1ZHXA 3W2VA 2FFHA 3FAJA 3HLZA 4IWBA 3PMRA 4MTGA 2A68F 4OINF 4CDVA 1A7VA 1K05A 2OJQA 1ZYRF 3EGDB 4I3MA 4DOZA 1NBBA 3AGTA 3QW0A 3RKOF 5L0DA 1A7EA 1HE1A 4O7GA 4ULVA 2DYSC 1ZHYA 5COMA 1OCZC 3RIPA 3L34A 1QLEC 2WZLA 4X0RA 3RVYA 2Q4FA 4GEHA 5DVWA 2V3CC 4FX5A 4NTFA 3EG9A 4G7ZF 1QSPA 3EG9B 3MBGA 3MYIA 1T01A 1ZW2A 3JSZA 4IRUA 3SEOA 4Q5SF 1Q0KA 3JSEO 2XLOA 1YDIA 2OOCA 1T6QA 2EIMC 2LFFA 2YLIA 3QVYA 1YA9A 2DYRC 4EHPA 1O5HA 2XL6A 2Q3TA 5A69A 3ZG1A 2LIGA 1L3PA 2Q9AA 4FAPB 1EI7A 1SMYF 3HTKC 4DJ9A 3KKBA 3POVA 3KYJA 2I8BA 4HE8D 2BC5A 3KPHA 4MW3A 4C7OA 1CGOA 2W9YA 2YVKA 1VB5A 4C7OB 3KL4A 1M56C 2KJGA 2ZXWC 4LDKA 3SXYA 4CDAA 2A0UA 4XPWA 2CDQA 4RDAA 1D0ZA 1EA8A 2X0CA 2EIKC 1FFHA 3QVZA 3ABMC 1JPNA 3AJMA 4BG0A 4CBEA 3I4UA 3K7DA 4JW1A 1QZXA 2J0WA 3QMKA 2VH3A 5D92A 3ATPA 2GFHA 1NSGB 2YEVA 1VLSA 1MMDA 1SR2A 2YL1A 3NMKA 3T6JA 3H2UA 2GA0A 2XM0A 1PD0A 2HMQA 3O39A 2CYDA 2R7TA 1HE9A 3GANA 3F47A 5L0JA 1G8XA 1OR2A 4OD5A 1SF8A 3HNKA 4XLPF 4CS7A 4AK9A 2Q9CA 3EZHA 4PJMA 2OG2A 2GAQA 1M57C 3NMJA 1JRAA 2J9BA 5JP7A 4W8KA 3U9MA 2P61A 3RW0A 1APCA 4BEMJ 1U89A 5L0GA 4BEJA 3ZTZA 4DXWA 5JUAA 5EK0A 1FR0A 3AG1C 3Q6NA 4AE4A 4YL3A 4JVSA 3VM6A 4AE4B 3K1HA 3LJBA 4U5GA 1G4WR 4EBBA 5A6AA 4UDVA 4BJTA 2NUTA 2PNOA 3FAPB 2NUTB 3G50A 2A69F 3US6A 1EKYA 4YT4A 2J8WA 3QTHA 3NYLA 5A6KA 1A0BA 4EBKA 4PJLA 3ZTMA 5TJ5E 2UUIA 3JRMO 4MVRA 1LE2A 3TJ6A 5B3SC 1U0BB 5JRAA 1K40A 1S05A 3DZAA 2PX0A 2RD9A 5JT4A 4YT8A 1OW8A 3I5QA 4YL0A 1WGWA 2R03A 5E2QA 4U5FE 2Y3DA 5B1BC 4JEBA 3RH3A 1MNEA 3DAGA 2CW0F 4JC7A 5HSWA 3JRTA 5AC4A 2IYLD 2QTVA 1OR3A 1LVKA 2IXMA 2KNHA 3IEEA 3HJCA 4EKWA 3X2QC 2EINC 1TQGA 3KYIA 3NG1A 3QW1A 4O6YA 1H6GA 2YLGA 1VYIA 3HNIA 1YVIA 3ZQYA 2YHSA 5T3WA 2Y39A 3LS1A 3MX3A 4PACA 2Y3GA 4G7HF 4OIOF 3RYLA 2AWCA 3ASNC 5F5HA 3H2VA 3HNLA 2MHRA 3CZ6A 1Q0GA 4RBNA 5EGYA 3UR3C 4AL0A 4D4NA 4IJJA 5EHHA 2EIJC 1I4YA 4LLCA 4E17A 3L1MA 4U9DA 1NFOA 2OJED 4PFOA 4K1OA 3EHNA 4WGZA 1NZEA 3SZRA 2V26A 4BJ1A 5L0HA 1Y6DA 5F28E 2OU6A 2JPUA 2R02A 3M1CB 1M2VA 1M2VB 4DBRA 4ULWA 1AUEA 2ZPAA 3UMHA 3GEIA 4O79A 4K7BA 1TKNA 1O87A 1NU9C 2YL0A 3B29A 2ICWG 5DLJA 3S84A 1QPUA 1OXBA 1OQCA 3SXZA 1OCOC 4IARA 2LQGA 3C63A 2YWAA 5L3QA 3V5XA 2IBFA 1OW7A 3R2PA 3GODA 3J06A 2YL3A 3EFOA 3ZVRA 3EFOB 1LI5A 2A6EF 3EGDA 4YT5A 1HW1A 2KW3C 2L6GA 2WVNA 3U8PA 4N06A 3AG3C 1FMWA 2VC9A 4HFFB 4G0HA 3C8ZA 1EQ1A 3LS0A 4J30B 4YL1A 2DGJA 3GWLA 1NU7D 1IZMA 1I4ZA 3GEHA 2PBEA 2YQYA 4MQ9F 2J9VA 2J9WA 2MYSA 5CI9A 1PCXA 4DVZA 3C8GD 3EPVA 3RF3A 1R4TA 3L8IA 3UMIA 5FZTA 4XEVA 1Z3IX 4DRIB 3TOMA 1IW7F 1DOWA 4MNDA 2HKVA 3CSKA 4MVSA 3T6GB 5CIVA 2EPMX 3LNMB 2P7VA 4IB4A 5DS6A 5KYYA 3C8GA 3SNHA 2I15A 4IGGA 3C8GB 3PCVA 1T9KA 2IM8A 3Q7LA 5DS4A 5KYYB 2W4MA 4MVQA 2IXOA 3NMIA 3LEVA 2KQ9A 2XM4A 2EPLX 2KYHA 3VYWA 2H7VC 4IAOA 4XTKA 3IQTA 1RKEA 1RKEB 2IXPA 2G62A 3TJ5A 1CGME 4ANJA 3MYFA 3TK0A 2Q7RA 3R7CA 3DE8A 3FVYA 4HEAJ 1T6IA 1QKRA 2HS5A 2VCCA 1KTMA 2HV6A 2EILC 3AQCA 3IQ5A 3JT1A 4PK4A 3Q7GA 2NSGA 3GEEA 3T6BA 1HMOA 2YL7A 3LNRA 3GM2A 1WWPA 2J46A 1VK5A 4XEKA 2HZ8A 3U3FA 1L7CA 2R7OA 2UUHA 1F1MA 1OCRC 3B71A 5DS5A 3DD7A 4XQ1A 3SXKA 3DMDA 1BR2A 3LUTB 4YT2A 1FAPB 1ORYA 2BL2A 2O9XA 4LACB 4QDLA 2B0JA 2D4UA 3AG4C 2B0HA 3NKEA 1LS4A 3L8JA 2XLEA 1ZHZA 1LM3B 1BR1A 4P6IC 1FMVA 1LKXA 1RXQA 2LFDA 1WTYA 2NUPB 3NKDA 3V5YA 2NSFA 3EHMA 4MS2A 1CGNA 3AOUA 1ZHTA 3DJNB 3I5PA 3ZIBA 4E7SA 1TWAA 2WZGA 4OIRF 3TULA 1TWGA 2J45A 2WVOA 3BRJA 4ONSA 4P9TA 3W8IA 3W8HA 1C03A 1R5ID 3H65A 2FGYA 3VAYA 2XLWA 3RQEA 3K33A 1LIHA 2HMZA 3N24A 4A2NB 1YLMA 4QI0A 5KYXA 5KYXB 4PFPA 2HSQA 1ORSC 4XEFA 5COFA 3W4YA 3DJUB 2LSEA 1DOVA 2KK1A 3EH1A 4B6IA 1BBHA 2EPNA 3UMKA 1E84A 1GM5A 4WGYA 2HFIA 4N6HA 1Z7Qc 3M4BA 3O6XA 3A11A 1YZAA 3BEHA 5HV9A 4H54A 2L9JA 2KGOA 2YZSA 1YARO 3NRHA 3VF0A 4A4AA 1FTSA 1PV3A 4CDYA 5A6JA 1TFKB 2Q00A 3M79A 1FNTc 3RQGA 4OIQF 4MVOA 2CNWD 2PP4A 4DRHB 3S0XA 1JMWA 2XS1A 4R32A 1LS1A 3IHUA 4KC9A 1E85A 4AL1A 1ZHWA 1T5OA 1UG7A 3ASOC 1O3UA 4JCHA 1LPEA 4BPMA 5B3IA 2CNWA 4K0DA
chains in the Genus database with same CATH topology
3LLKA 1OQCA 2HJ3A 3W4YA 1JR8A 3O55A 3U2MA 1JRAA 3TD7A 4E0HA 4LDKA 3LLIA 3TK0A 3U5SA 3R7CA 3GWLA 3U2LA 4E0IA 3MBGA 3GWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLK A;  1OQC A;  2HJ3 A;  3W4Y A;  1JR8 A;  3O55 A;  3U2M A;  1JRA A;  3TD7 A;  4E0H A;  4LDK A;  3LLI A;  3TK0 A;  3U5S A;  3R7C A;  3GWL A;  3U2L A;  4E0I A;  3MBG A;  3GWN A; 
#chains in the Genus database with same CATH topology
 2XLV A;  1NFN A;  4QI2 A;  2HUJ A;  4MVU A;  4NY3 A;  2P0N A;  2VB6 A;  2Z15 A;  1V55 C;  4XPX A;  2QY9 A;  2HSB A;  2QE9 A;  3K66 A;  3K6B A;  3ECS A;  1BZ4 A;  1C17 M;  4XLN F;  3MLG A;  3FHD A;  1RJ9 A;  2P1A A;  3EH2 A;  1RJ9 B;  4Q4Z F;  1G4U S;  1AVO B;  1HMD A;  1M6T A;  2PFD A;  4D4X A;  4CS8 C;  3EJN A;  3OA1 A;  4JEA A;  4F4B A;  2YLD A;  3OWT A;  4CS8 A;  3S9O A;  5JVE A;  3HKK A;  2XSE A;  4KNV A;  2WZF A;  3WG7 C;  4EBJ A;  5F5F A;  5AGF A;  2MWQ A;  3WOD F;  1VTM P;  1ZW3 A;  5JSL A;  3S27 A;  1ZZP A;  3T9O A;  4IAQ A;  1E83 A;  4CS9 C;  4DBQ A;  4CS9 A;  2Y3H A;  3TQO A;  4KBL A;  5A6B D;  2H8A A;  5K0I A;  2R05 A;  1D1A A;  2WL8 A;  2IOQ A;  3ABK C;  4U5E E;  5CI8 A;  2QNL A;  3FOO A;  4MW8 A;  1D0X A;  1M2O A;  2L6F A;  4YK5 A;  3LEO A;  4CX9 A;  2Y69 C;  1Q0M A;  3GOR A;  3NYJ A;  1JAF A;  4FWV A;  5A6B A;  2R25 A;  4U5H A;  5L0I A;  4ZLC A;  4I1M A;  1J8M F;  5D91 A;  1OXK A;  4YN0 B;  3IQC A;  2WB7 A;  1BDJ B;  4JE9 A;  1RKC A;  3O55 A;  4NTB A;  5JLI A;  1Q0D A;  2AWY A;  1WOL A;  3RQF A;  2CGE A;  3U2M A;  1CPR A;  3RFY A;  3M15 A;  4U5B E;  2E87 A;  3Q6M A;  1E2X A;  1WN0 A;  3U2L A;  2ZXR A;  4MVZ A;  5L3V A;  4C3E A;  3SP1 A;  1TR2 A;  3S28 A;  1XZP A;  2HV7 A;  4U5D E;  4J7T A;  1VOM A;  1H9G A;  2M64 A;  2NG1 A;  3EGX A;  3EGX B;  3HNJ A;  5KYU B;  5B1A C;  2FAP B;  1W2W A;  2DB4 A;  2KSF A;  3FMS A;  4NTA A;  3B0P A;  4JJF A;  2BE5 F;  4Z9I A;  3UGO A;  2XLM A;  3T4R A;  3JZ0 A;  1VLT A;  4AX2 A;  3V7O A;  4OIP F;  1HY5 A;  2W45 A;  1TWC A;  4NC3 A;  4Z9J A;  1J8Y F;  3CQZ A;  3C7J A;  1T6U A;  3M4C A;  1N1C A;  1MMA A;  2JD3 A;  4JTD B;  3V5Z A;  2DI3 A;  2H7B A;  3DXJ F;  2P6V A;  4PJN A;  3B9Q A;  5BUO A;  1Y4C A;  2ZD9 A;  1JPJ A;  3DWW A;  3B0U X;  3MFN A;  3SYN A;  4E0I A;  1OW6 A;  3CEX A;  4ER9 A;  2A0B A;  4PJJ A;  2PX3 A;  2ZXO A;  4CIH A;  3S90 A;  3KH2 A;  5L0F A;  1KU2 A;  2G3V A;  3JYY A;  3GWN A;  3KMI A;  3L0I A;  3QZC A;  2EPK X;  4HFK B;  4CSA C;  5FCL A;  2YRF A;  2J7P D;  4WJ0 A;  1ZU4 A;  4CSA A;  3AQB A;  2J9U A;  3DKA A;  1V74 B;  3OEO A;  3X1O A;  3AGU A;  1H7I A;  3DM5 A;  2Q9B A;  3JYH A;  4I44 A;  4NQF A;  2XL4 A;  1CPQ A;  2ETS A;  1QVX A;  1YYJ A;  2J7P A;  2R7Q A;  4LLE A;  1V54 C;  2L81 A;  2LCH A;  2LD6 A;  3JCU Q;  3U3B A;  4GYT A;  1NG1 A;  1UFB A;  4JZA A;  4LDQ A;  2LP4 A;  4E7Z A;  2NUP A;  2QUP A;  1YJG A;  2X51 A;  3N2Z B;  3PHF 2;  3DAF A;  3DI5 A;  1OCC C;  2AVK A;  4LDR A;  3FOP A;  2LK4 A;  5BQG A;  4O6M A;  2R7S A;  4JKV A;  2H7O A;  4Z9H A;  2AU5 A;  5JS5 A;  2OEX A;  4W8P A;  1I5N A;  2C04 A;  4P9F A;  4BJ6 C;  1A7D A;  1E86 A;  1A41 A;  3E9V A;  5COG A;  2R7V A;  1XZQ A;  3WAQ A;  4BJ6 A;  3S29 A;  4CJO A;  4C3B A;  2TMV P;  3ZDL A;  1B68 A;  5L0C A;  2R7X A;  1U6H A;  2GDC A;  4JIO A;  1SYQ A;  5KYN A;  1SZI A;  3G4X A;  5AC5 A;  4WAB A;  1XWJ A;  3F46 A;  1HW2 A;  3DM9 B;  2IXN A;  2GWW A;  3LES A;  2RSE B;  4JUR I;  2YKZ A;  3CAX A;  4JRZ A;  1D1C A;  4N4W A;  5BQI A;  3GM1 A;  3GM3 A;  4G78 A;  4YJW A;  5DQT A;  1YZC A;  5GPG B;  1RCP A;  1KNY A;  2J0X A;  3TD7 A;  3LLI A;  1D0Y A;  4MTO A;  4KI2 A;  3C62 A;  4MTF A;  4EWC A;  4JJG A;  4CIP A;  3DE9 A;  2VAS A;  1WAT A;  3ZWI A;  3ZQV A;  3UGP A;  1Z6A A;  1ST6 A;  3E70 C;  5IY5 C;  1WAS A;  4H4K C;  4DVY P;  5E3C A;  5T1D B;  2OKU A;  2XLD A;  3EQL F;  3G4Z A;  4FES A;  4U5C E;  3UNG C;  3U9J A;  1ZU5 A;  2OEV A;  2WVQ A;  4XWJ A;  4E18 A;  1AEP A;  5BQH A;  4GQH A;  1S7Z A;  2CCY A;  1Q0F A;  4PR9 A;  3PDM P;  4I1O B;  1Z5Z A;  3RVZ A;  2OQM A;  3ZSU A;  1VYK A;  2OCC C;  1FFT C;  2R9R B;  3AG2 C;  4EIY A;  1MND A;  4ZLD A;  2VCA A;  1GS9 A;  2A1D D;  1MMG A;  1YYX A;  1TWH A;  3EZI A;  3NYM A;  2G3K A;  3N0T A;  4NCQ A;  4Q7C A;  1OKK D;  4N6C A;  4DRJ B;  2XS8 A;  3A9C A;  5T3T A;  3U8V A;  1LE4 A;  1Z63 A;  1GGQ A;  1TFO B;  2W4B A;  4C3D A;  2R7R A;  4CJG A;  4J32 B;  3U5S A;  2D5R B;  3WHN A;  2JX0 A;  1H9T A;  3SXM A;  5DQZ A;  4BJ5 C;  1LI7 A;  3TOL A;  1MMN A;  1Z23 A;  1OKK A;  4BJ5 A;  1K04 A;  4JTA B;  1G5Z A;  3IQ6 A;  3LAY A;  3VRC A;  2R7W A;  4G7O F;  1GQA A;  4JCZ A;  256B A;  2F22 A;  3K1I C;  4KNW A;  3B0V C;  3LLK A;  3K1I A;  4RD9 A;  2HJ3 A;  3O10 A;  1D1B A;  4JTC B;  1RMV A;  3ZC4 A;  2A6H F;  2ZXP A;  2L6H A;  3ITF A;  2XXA A;  2R7U A;  2M4E A;  2XXA B;  2PF4 E;  3ABL C;  1JR8 A;  4M63 A;  4MVM A;  1V4A A;  1BR4 A;  1YA7 O;  1YAU O;  4U9E A;  3NDB B;  3JTL O;  5KYW A;  1NLX A;  4YWQ A;  5KYW B;  2XL8 A;  3U0C A;  2AP3 A;  4LER A;  1VMA A;  2C03 A;  4J7Y A;  1C02 A;  1QQ3 A;  2QLA A;  2XLH A;  2XRH A;  5E3A A;  1PD1 A;  2EPO A;  3W2W A;  4E0H A;  4EUK B;  2ASR A;  1JOG A;  2VCB A;  2NPU A;  3IPM O;  1ZVZ A;  2Y3B A;  4L6R A;  4OD4 A;  3C18 A;  2HJM A;  1MQV A;  2KC3 A;  2L7A A;  4XPY A;  1ORJ A;  3FXH A;  3FDQ A;  5E33 A;  4O6N A;  5KYU A;  1ZHX A;  3W2V A;  2FFH A;  3FAJ A;  3HLZ A;  4IWB A;  3PMR A;  4MTG A;  2A68 F;  4OIN F;  4CDV A;  1A7V A;  1K05 A;  2OJQ A;  1ZYR F;  3EGD B;  4I3M A;  4DOZ A;  1NBB A;  3AGT A;  3QW0 A;  3RKO F;  5L0D A;  1A7E A;  1HE1 A;  4O7G A;  4ULV A;  2DYS C;  1ZHY A;  5COM A;  1OCZ C;  3RIP A;  3L34 A;  1QLE C;  2WZL A;  4X0R A;  3RVY A;  2Q4F A;  4GEH A;  5DVW A;  2V3C C;  4FX5 A;  4NTF A;  3EG9 A;  4G7Z F;  1QSP A;  3EG9 B;  3MBG A;  3MYI A;  1T01 A;  1ZW2 A;  3JSZ A;  4IRU A;  3SEO A;  4Q5S F;  1Q0K A;  3JSE O;  2XLO A;  1YDI A;  2OOC A;  1T6Q A;  2EIM C;  2LFF A;  2YLI A;  3QVY A;  1YA9 A;  2DYR C;  4EHP A;  1O5H A;  2XL6 A;  2Q3T A;  5A69 A;  3ZG1 A;  2LIG A;  1L3P A;  2Q9A A;  4FAP B;  1EI7 A;  1SMY F;  3HTK C;  4DJ9 A;  3KKB A;  3POV A;  3KYJ A;  2I8B A;  4HE8 D;  2BC5 A;  3KPH A;  4MW3 A;  4C7O A;  1CGO A;  2W9Y A;  2YVK A;  1VB5 A;  4C7O B;  3KL4 A;  1M56 C;  2KJG A;  2ZXW C;  4LDK A;  3SXY A;  4CDA A;  2A0U A;  4XPW A;  2CDQ A;  4RDA A;  1D0Z A;  1EA8 A;  2X0C A;  2EIK C;  1FFH A;  3QVZ A;  3ABM C;  1JPN A;  3AJM A;  4BG0 A;  4CBE A;  3I4U A;  3K7D A;  4JW1 A;  1QZX A;  2J0W A;  3QMK A;  2VH3 A;  5D92 A;  3ATP A;  2GFH A;  1NSG B;  2YEV A;  1VLS A;  1MMD A;  1SR2 A;  2YL1 A;  3NMK A;  3T6J A;  3H2U A;  2GA0 A;  2XM0 A;  1PD0 A;  2HMQ A;  3O39 A;  2CYD A;  2R7T A;  1HE9 A;  3GAN A;  3F47 A;  5L0J A;  1G8X A;  1OR2 A;  4OD5 A;  1SF8 A;  3HNK A;  4XLP F;  4CS7 A;  4AK9 A;  2Q9C A;  3EZH A;  4PJM A;  2OG2 A;  2GAQ A;  1M57 C;  3NMJ A;  1JRA A;  2J9B A;  5JP7 A;  4W8K A;  3U9M A;  2P61 A;  3RW0 A;  1APC A;  4BEM J;  1U89 A;  5L0G A;  4BEJ A;  3ZTZ A;  4DXW A;  5JUA A;  5EK0 A;  1FR0 A;  3AG1 C;  3Q6N A;  4AE4 A;  4YL3 A;  4JVS A;  3VM6 A;  4AE4 B;  3K1H A;  3LJB A;  4U5G A;  1G4W R;  4EBB A;  5A6A A;  4UDV A;  4BJT A;  2NUT A;  2PNO A;  3FAP B;  2NUT B;  3G50 A;  2A69 F;  3US6 A;  1EKY A;  4YT4 A;  2J8W A;  3QTH A;  3NYL A;  5A6K A;  1A0B A;  4EBK A;  4PJL A;  3ZTM A;  5TJ5 E;  2UUI A;  3JRM O;  4MVR A;  1LE2 A;  3TJ6 A;  5B3S C;  1U0B B;  5JRA A;  1K40 A;  1S05 A;  3DZA A;  2PX0 A;  2RD9 A;  5JT4 A;  4YT8 A;  1OW8 A;  3I5Q A;  4YL0 A;  1WGW A;  2R03 A;  5E2Q A;  4U5F E;  2Y3D A;  5B1B C;  4JEB A;  3RH3 A;  1MNE A;  3DAG A;  2CW0 F;  4JC7 A;  5HSW A;  3JRT A;  5AC4 A;  2IYL D;  2QTV A;  1OR3 A;  1LVK A;  2IXM A;  2KNH A;  3IEE A;  3HJC A;  4EKW A;  3X2Q C;  2EIN C;  1TQG A;  3KYI A;  3NG1 A;  3QW1 A;  4O6Y A;  1H6G A;  2YLG A;  1VYI A;  3HNI A;  1YVI A;  3ZQY A;  2YHS A;  5T3W A;  2Y39 A;  3LS1 A;  3MX3 A;  4PAC A;  2Y3G A;  4G7H F;  4OIO F;  3RYL A;  2AWC A;  3ASN C;  5F5H A;  3H2V A;  3HNL A;  2MHR A;  3CZ6 A;  1Q0G A;  4RBN A;  5EGY A;  3UR3 C;  4AL0 A;  4D4N A;  4IJJ A;  5EHH A;  2EIJ C;  1I4Y A;  4LLC A;  4E17 A;  3L1M A;  4U9D A;  1NFO A;  2OJE D;  4PFO A;  4K1O A;  3EHN A;  4WGZ A;  1NZE A;  3SZR A;  2V26 A;  4BJ1 A;  5L0H A;  1Y6D A;  5F28 E;  2OU6 A;  2JPU A;  2R02 A;  3M1C B;  1M2V A;  1M2V B;  4DBR A;  4ULW A;  1AUE A;  2ZPA A;  3UMH A;  3GEI A;  4O79 A;  4K7B A;  1TKN A;  1O87 A;  1NU9 C;  2YL0 A;  3B29 A;  2ICW G;  5DLJ A;  3S84 A;  1QPU A;  1OXB A;  1OQC A;  3SXZ A;  1OCO C;  4IAR A;  2LQG A;  3C63 A;  2YWA A;  5L3Q A;  3V5X A;  2IBF A;  1OW7 A;  3R2P A;  3GOD A;  3J06 A;  2YL3 A;  3EFO A;  3ZVR A;  3EFO B;  1LI5 A;  2A6E F;  3EGD A;  4YT5 A;  1HW1 A;  2KW3 C;  2L6G A;  2WVN A;  3U8P A;  4N06 A;  3AG3 C;  1FMW A;  2VC9 A;  4HFF B;  4G0H A;  3C8Z A;  1EQ1 A;  3LS0 A;  4J30 B;  4YL1 A;  2DGJ A;  3GWL A;  1NU7 D;  1IZM A;  1I4Z A;  3GEH A;  2PBE A;  2YQY A;  4MQ9 F;  2J9V A;  2J9W A;  2MYS A;  5CI9 A;  1PCX A;  4DVZ A;  3C8G D;  3EPV A;  3RF3 A;  1R4T A;  3L8I A;  3UMI A;  5FZT A;  4XEV A;  1Z3I X;  4DRI B;  3TOM A;  1IW7 F;  1DOW A;  4MND A;  2HKV A;  3CSK A;  4MVS A;  3T6G B;  5CIV A;  2EPM X;  3LNM B;  2P7V A;  4IB4 A;  5DS6 A;  5KYY A;  3C8G A;  3SNH A;  2I15 A;  4IGG A;  3C8G B;  3PCV A;  1T9K A;  2IM8 A;  3Q7L A;  5DS4 A;  5KYY B;  2W4M A;  4MVQ A;  2IXO A;  3NMI A;  3LEV A;  2KQ9 A;  2XM4 A;  2EPL X;  2KYH A;  3VYW A;  2H7V C;  4IAO A;  4XTK A;  3IQT A;  1RKE A;  1RKE B;  2IXP A;  2G62 A;  3TJ5 A;  1CGM E;  4ANJ A;  3MYF A;  3TK0 A;  2Q7R A;  3R7C A;  3DE8 A;  3FVY A;  4HEA J;  1T6I A;  1QKR A;  2HS5 A;  2VCC A;  1KTM A;  2HV6 A;  2EIL C;  3AQC A;  3IQ5 A;  3JT1 A;  4PK4 A;  3Q7G A;  2NSG A;  3GEE A;  3T6B A;  1HMO A;  2YL7 A;  3LNR A;  3GM2 A;  1WWP A;  2J46 A;  1VK5 A;  4XEK A;  2HZ8 A;  3U3F A;  1L7C A;  2R7O A;  2UUH A;  1F1M A;  1OCR C;  3B71 A;  5DS5 A;  3DD7 A;  4XQ1 A;  3SXK A;  3DMD A;  1BR2 A;  3LUT B;  4YT2 A;  1FAP B;  1ORY A;  2BL2 A;  2O9X A;  4LAC B;  4QDL A;  2B0J A;  2D4U A;  3AG4 C;  2B0H A;  3NKE A;  1LS4 A;  3L8J A;  2XLE A;  1ZHZ A;  1LM3 B;  1BR1 A;  4P6I C;  1FMV A;  1LKX A;  1RXQ A;  2LFD A;  1WTY A;  2NUP B;  3NKD A;  3V5Y A;  2NSF A;  3EHM A;  4MS2 A;  1CGN A;  3AOU A;  1ZHT A;  3DJN B;  3I5P A;  3ZIB A;  4E7S A;  1TWA A;  2WZG A;  4OIR F;  3TUL A;  1TWG A;  2J45 A;  2WVO A;  3BRJ A;  4ONS A;  4P9T A;  3W8I A;  3W8H A;  1C03 A;  1R5I D;  3H65 A;  2FGY A;  3VAY A;  2XLW A;  3RQE A;  3K33 A;  1LIH A;  2HMZ A;  3N24 A;  4A2N B;  1YLM A;  4QI0 A;  5KYX A;  5KYX B;  4PFP A;  2HSQ A;  1ORS C;  4XEF A;  5COF A;  3W4Y A;  3DJU B;  2LSE A;  1DOV A;  2KK1 A;  3EH1 A;  4B6I A;  1BBH A;  2EPN A;  3UMK A;  1E84 A;  1GM5 A;  4WGY A;  2HFI A;  4N6H A;  1Z7Q c;  3M4B A;  3O6X A;  3A11 A;  1YZA A;  3BEH A;  5HV9 A;  4H54 A;  2L9J A;  2KGO A;  2YZS A;  1YAR O;  3NRH A;  3VF0 A;  4A4A A;  1FTS A;  1PV3 A;  4CDY A;  5A6J A;  1TFK B;  2Q00 A;  3M79 A;  1FNT c;  3RQG A;  4OIQ F;  4MVO A;  2CNW D;  2PP4 A;  4DRH B;  3S0X A;  1JMW A;  2XS1 A;  4R32 A;  1LS1 A;  3IHU A;  4KC9 A;  1E85 A;  4AL1 A;  1ZHW A;  1T5O A;  1UG7 A;  3ASO C;  1O3U A;  4JCH A;  1LPE A;  4BPM A;  5B3I A;  2CNW A;  4K0D A; 
#chains in the Genus database with same CATH homology
 3LLK A;  1OQC A;  2HJ3 A;  3W4Y A;  1JR8 A;  3O55 A;  3U2M A;  1JRA A;  3TD7 A;  4E0H A;  4LDK A;  3LLI A;  3TK0 A;  3U5S A;  3R7C A;  3GWL A;  3U2L A;  4E0I A;  3MBG A;  3GWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...