4E0HA

Crystal structure of fad binding domain of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HMDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0hA00
3W4YA 2HJ3A 3LLKA 1OQCA 4E0HA 1JR8A 3U2MA 3R7CA 4E0IA 4LDKA 3U2LA 3TK0A 1JRAA 3GWNA 3U5SA 3GWLA 3MBGA 3O55A 3LLIA 3TD7A
chains in the Genus database with same CATH superfamily
4JJGA 1Z5ZA 3L0IA 4JTDB 2HMQA 4MVQA 4EKWA 2NSFA 3C8GB 4FX5A 1CGOA 2PP4A 3MFNA 4L6RA 3VF0A 2J9UA 2M64A 2P0NA 3W8IA 3K1HA 1YJGA 2HSBA 3TJ6A 1VOMA 2QNLA 1JR8A 3RH3A 4YL0A 2KW3C 2R03A 1IW7F 3C63A 4D4XA 1H6GA 1VLTA 2R9RB 1CGME 2VCCA 1WOLA 2LP4A 1HW1A 5A6BD 4PR9A 2XLWA 5COFA 1OW8A 3AQBA 3T6BA 2Q00A 4DVZA 4JRZA 1GM5A 1H9TA 2J7PD 2XLOA 2FAPB 1YYXA 1OKKD 3LUTB 3RYLA 3DE9A 1I4ZA 1WATA 2AWYA 2YVKA 2EPNA 3GEIA 4XEVA 3ZDLA 3JSZA 4EIYA 5KYXB 2GFHA 2H7VC 3I5PA 2AU5A 4K7BA 1RJ9B 2W4MA 5CI9A 4J32B 4WGZA 2X51A 5DS5A 4P6IC 1AVOB 4O7GA 1OR3A 4U5HA 2Q3TA 4IARA 3V5ZA 2D5RB 2OJQA 3GEHA 3MX3A 3S29A 2YL1A 5BQHA 3E9VA 1UFBA 3KYIA 3U8PA 3ABMC 4E0HA 3NKDA 4PJJA 2YL7A 3SXYA 4BJ6C 1BZ4A 1H7IA 1TWHA 3T9OA 2ICWG 3Q7GA 4LDRA 2IOQA 4GEHA 3HNJA 4CSAC 2JX0A 1T6QA 2IBFA 2AVKA 2RD9A 3VM6A 1TR2A 4AK9A 1NFNA 4EWCA 4IAQA 3U0CA 4R32A 2P7VA 5KYYB 1CPQA 3WODF 1ZU5A 2G3KA 5KYNA 3HLZA 3A11A 4JW1A 4QDLA 4YT4A 1E85A 2CGEA 2NUPB 2PNOA 1MMDA 1T01A 1DOWA 3KL4A 2M4EA 3LNRA 3MBGA 4PACA 3FDQA 3T4RA 4LACB 2R7XA 2HSQA 4MVMA 3C8GA 4MVZA 2WVOA 4FAPB 3EZHA 4XTKA 1Z3IX 1NBBA 1VK5A 4NTFA 1FAPB 2XS8A 1H9GA 4MNDA 3S9OA 4I3MA 2EPMX 2KGOA 3RFYA 2ZD9A 2CW0F 3AJMA 3DZAA 5DVWA 4H54A 4DBQA 3WHNA 3NMIA 2IXOA 4HEAJ 5B1BC 5DS6A 2Q9BA 3ZIBA 3QTHA 3RIPA 1V55C 4AE4A 4Q5SF 5L0FA 1BBHA 2QTVA 2YWAA 2XLEA 2BL2A 2L6GA 2W9YA 2J0XA 2A1DD 3JT1A 4CS9C 1LKXA 1MMGA 2LK4A 3DM9B 1PCXA 2PF4E 4N6HA 4H4KC 4F4BA 5KYXA 2J8WA 2QLAA 1L7CA 2J9VA 2EIKC 1WWPA 2LIGA 4WJ0A 3RKOF 3AG1C 2EIJC 1RJ9A 3HNLA 4DOZA 1FTSA 1Q0DA 3B29A 1R5ID 1C17M 1WGWA 2Q9AA 1D0YA 1RKCA 3IQCA 2D4UA 3F47A 5CIVA 5JVEA 2AWCA 2OCCC 3A9CA 3BEHA 3ABKC 3GM1A 1XZPA 3HJCA 3JRTA 4NTAA 3U8VA 1Z23A 1Y6DA 2VC9A 3SXKA 4EHPA 5BQIA 4CS7A 3FOOA 1MNDA 1WN0A 3JRMO 1SMYF 3MLGA 4YT8A 5AC4A 2YEVA 3LJBA 3JSEO 1U0BB 1K40A 2R02A 3N0TA 1JOGA 1YA9A 3C7JA 1MQVA 3QW1A 4EBKA 1A0BA 4E7ZA 2XRHA 3LESA 4IGGA 3VAYA 2BC5A 2VH3A 3ZWIA 1FFHA 3EH2A 1OW7A 3C8ZA 4LDQA 3JZ0A 3ZTMA 5A6BA 2H7OA 1U89A 2R05A 3X1OA 4XEFA 2R7RA 1ZW2A 3VYWA 3ABLC 5IY5C 2J7PA 4DRIB 3L8JA 1AUEA 3NDBB 1OKKA 1F1MA 3AGUA 2MWQA 2EPKX 2A6HF 3JYYA 3FMSA 1EA8A 2V26A 1OW6A 1T6UA 2VCBA 1ORYA 2DYSC 1ZW3A 2XLDA 3GM2A 4AX2A 1VTMP 4PJNA 2YQYA 2FFHA 4D4NA 3LS0A 3HKKA 2XXAB 3ZQVA 2L6FA 3LNMB 3B0VC 4N6CA 5JT4A 4OIOF 1ZHXA 4O6NA 1QLEC 2HJMA 3UR3C 1OCZC 1SYQA 2G62A 4EBBA 2ZPAA 3B71A 3DJUB 1TFKB 1O3UA 3UGOA 2J9WA 3SP1A 3DKAA 3EG9B 256BA 2Y3GA 1VYKA 4RBNA 1QZXA 4EBJA 5KYYA 4ZLDA 3Q6NA 3UMHA 5A6AA 2YL0A 1FNTc 2L81A 3OWTA 3EFOB 2Q9CA 3PHF2 3JYHA 1L3PA 1XZQA 3SXZA 2WB7A 4MW8A 3EZIA 2KNHA 2VB6A 3LEVA 3ZC4A 2C03A 3SYNA 5T3TA 3EPVA 1LS4A 2YL3A 3TULA 3V5YA 4PFOA 1YVIA 2QY9A 4O6YA 2L7AA 2IXNA 2L6HA 5T1DB 4JKVA 1HY5A 1HE1A 3NYJA 1YZAA 5FZTA 3M4CA 1PD0A 1GGQA 2LFDA 2DGJA 2W45A 2XL6A 3X2QC 1LE4A 1RXQA 3IPMO 2L9JA 1NFOA 4DBRA 3O39A 3DAFA 1M57C 4XPXA 4AE4B 2IYLD 5F5FA 1BR1A 3EQLF 3GORA 2C04A 5GPGB 4BJTA 5B3IA 2YHSA 4U9EA 4JEBA 4IWBA 3KPHA 3VRCA 1EKYA 3K6BA 1D0ZA 3QMKA 1LI5A 2B0JA 2YLGA 4W8PA 1TWGA 4CDYA 4CS8C 2R7QA 3TOLA 2OEVA 3LEOA 4IJJA 5KYUB 3K1IA 3QVZA 3PDMP 3ZQYA 4CIPA 2XXAA 4U5FE 4BJ6A 1KTMA 4NC3A 1S05A 2HJ3A 2ZXWC 4YK5A 1WTYA 5DLJA 3RVYA 4E17A 3U2MA 4HFKB 4Q7CA 5DS4A 2Y3DA 4CSAA 4BEMJ 2V3CC 1LM3B 3SEOA 3ZG1A 3G50A 2WZGA 1KNYA 4ULWA 3B9QA 3CQZA 3EG9A 4MVSA 3B0PA 4LERA 1RCPA 3C62A 2R7OA 4MW3A 3RF3A 5JLIA 1FMVA 2XM4A 2HS5A 2WVQA 1PV3A 1ZHWA 1VLSA 4QI0A 3V5XA 3GANA 3U3FA 2TMVP 3EFOA 4E18A 3UGPA 1IZMA 1JPJA 2OKUA 4XEKA 2PFDA 1U6HA 1DOVA 1VYIA 4ANJA 5F28E 2GA0A 5JP7A 1QKRA 4YL1A 5AC5A 1ZHZA 2KYHA 1B68A 3JTLO 4C7OB 4OINF 5DQZA 1OCOC 2LFFA 3T6GB 4LLCA 3R7CA 5K0IA 3IEEA 5HSWA 1M56C 1O5HA 3S0XA 2OJED 1SZIA 1D1AA 3BRJA 4CS9A 1HMDA 3FVYA 2XL4A 4RDAA 2HUJA 5COGA 5BQGA 4CDVA 2BE5F 1A7VA 2KC3A 2Q4FA 2A69F 3K7DA 3KYJA 4O6MA 2X0CA 2XLVA 3RVZA 3AGTA 3K66A 2EIMC 3RQGA 4AL0A 3GODA 2GWWA 2XL8A 4JURI 4WABA 4C3BA 3FHDA 2XS1A 4J7YA 2YLDA 2VASA 2I15A 3RW0A 1K05A 2CCYA 1ORSC 2J45A 4XWJA 5KYUA 1SR2A 1G8XA 4IRUA 4U5CE 3IQ6A 3W2VA 3ZTZA 2AP3A 1HMOA 1QVXA 3JCUQ 4PFPA 5E3CA 4BG0A 4ZLCA 1A7EA 1OR2A 3IHUA 4YT2A 4KNVA 1W2WA 2J46A 3US6A 1MMNA 1HW2A 4Z9HA 4PJMA 3WAQA 1TFOB 4BJ5A 2W4BA 3PMRA 3AG4C 1I5NA 4IB4A 2R25A 1Q0KA 3TJ5A 4MVOA 3S90A 1QSPA 3EJNA 4PJLA 1HE9A 4JTCB 5E3AA 2OG2A 5T3WA 2DB4A 1T9KA 2KSFA 3U5SA 2OEXA 3PCVA 4M63A 2HV6A 4PK4A 4CJGA 4QI2A 2MHRA 1LVKA 2PBEA 3CEXA 1BR2A 1A41A 1OCRC 3DAGA 2OU6A 4N06A 5COMA 4ULVA 3GEEA 3Q7LA 1QQ3A 3S84A 4C3EA 1EI7A 2IXPA 2Y69C 4DXWA 2XSEA 4C7OA 2H7BA 3AQCA 2WZFA 3U3BA 4OIPF 2HFIA 1JAFA 3FAPB 1TWAA 2Q7RA 4FESA 4LDKA 3SXMA 4U5GA 2QUPA 1UG7A 2WZLA 3W8HA 1CPRA 3M15A 4U9DA 3POVA 4CBEA 2HV7A 5E2QA 3GM3A 3KMIA 3NYMA 1G4WR 3ITFA 1ZYRF 1FR0A 5FCLA 2NUTB 2P61A 2XLMA 2JD3A 1E83A 3NMKA 3TD7A 3N2ZB 5AGFA 3ASOC 3QW0A 2A0BA 3OA1A 4U5DE 2HKVA 4FWVA 1LPEA 4XPWA 4NY3A 3FAJA 4EUKB 4G7ZF 3G4ZA 3G4XA 4JCZA 1ORJA 3EGXB 3Q6MA 2XLHA 5DQTA 3NYLA 5JS5A 3FXHA 5EHHA 4YL3A 1SF8A 1ZVZA 2EILC 2XM0A 1OXBA 1O87A 1BR4A 2YKZA 2OQMA 5JRAA 4N4WA 2ETSA 1JRAA 3IQ5A 4CS8A 4AL1A 4MTFA 2ASRA 1TKNA 3FOPA 3NMJA 1LS1A 3K33A 2CNWD 5BUOA 1V4AA 3HNKA 1ST6A 3DWWA 4G78A 2P6VA 5L0DA 1D0XA 1RKEB 2KQ9A 4GQHA 2FGYA 2H8AA 4A2NB 3H2UA 3CZ6A 1Q0MA 5L0CA 3S28A 5KYWB 2R7SA 4KC9A 1ZHYA 4I44A 2ZXPA 3H2VA 5B3SC 1EQ1A 2G3VA 1M2VB 4O79A 2Y3HA 3O6XA 3AOUA 5L3QA 1ZHTA 2CDQA 1NU9C 1OXKA 1YDIA 2LSEA 2Y3BA 3TOMA 5L0GA 1G4US 2I8BA 5L3VA 4NTBA 4WGYA 1LE2A 4JEAA 4JJFA 3GWNA 4YT5A 2NUTA 4MTGA 2O9XA 3U9JA 3WG7C 1I4YA 4CX9A 3GWLA 3EHMA 4BPMA 3O10A 4G7OF 4I1MA 3LLIA 4U5BE 5A6KA 5HV9A 2R7VA 1NZEA 2EINC 2KJGA 4J7TA 4MQ9F 3RQEA 4DJ9A 2ZXRA 1BDJB 3EH1A 4OIQF 1Z63A 3ECSA 3OEOA 1RMVA 3QZCA 5JUAA 1CGNA 1OQCA 3K1IC 3CAXA 4Z9JA 1WASA 1V54C 5E33A 3KKBA 2MYSA 3EGXA 1NLXA 3H65A 5L0JA 1KU2A 2P1AA 4MVRA 2LCHA 4X0RA 4A4AA 4K1OA 1PD1A 2NSGA 3NKEA 2A68F 4DRHB 3IQTA 4OD5A 3LS1A 1G5ZA 1S7ZA 3EGDB 4MS2A 1JMWA 2EPLX 5D91A 2WL8A 3U9MA 4CDAA 2R7TA 1YA7O 4JZAA 5CI8A 3SNHA 1XWJA 4U5EE 4ER9A 3NRHA 2NUPA 4G0HA 1Y4CA 4MTOA 4YJWA 2E87A 1LIHA 1APCA 1TQGA 1M2OA 3L1MA 3NG1A 4LLEA 2DI3A 4P9FA 3ZVRA 3R2PA 1YARO 3C18A 3UMIA 4JC7A 5EK0A 4Z9IA 1RKEA 5TJ5E 3AG2C 1R4TA 5KYWA 1Q0FA 1N1CA 4NQFA 5F5HA 4JE9A 4OIRF 3EHNA 3B0UX 1M2VA 1C02A 3E70C 1A7DA 1T5OA 2J9BA 2PX0A 3DXJF 3M4BA 1VMAA 4NCQA 2B0HA 3DJNB 5JSLA 1D1BA 2NPUA 2UUHA 2RSEB 1J8YF 4MVUA 1Z6AA 4KI2A 3DI5A 3M1CB 5EGYA 4UDVA 3RQFA 4XPYA 3T6JA 4HE8D 3TK0A 3L8IA 3ZSUA 2A0UA 3ATPA 2QE9A 4JVSA 2YRFA 2OOCA 2CYDA 4JIOA 4P9TA 1NU7D 3DE8A 3W4YA 3MYFA 4E7SA 1MNEA 2F22A 1NG1A 4ONSA 1GS9A 4Q4ZF 1V74B 2PX3A 4KNWA 3J06A 2ZXOA 4C3DA 2JPUA 4XLNF 2IM8A 2A6EF 3UMKA 4BJ1A 1Z7Qc 1M6TA 2HZ8A 2HMZA 2CNWA 2VCAA 4OD4A 4E0IA 3QVYA 4HFFB 1JPNA 1C03A 2GDCA 3AG3C 4RD9A 4BJ5C 1OCCC 2WVNA 4J30B 1E2XA 1VB5A 3EGDA 1J8MF 4K0DA 4BEJA 2IXMA 2R7WA 1YZCA 3MYIA 3S27A 4G7HF 1T6IA 3C8GD 4XLPF 2YZSA 3UNGC 2DYRC 3ASNC 3KH2A 3LAYA 4DRJB 1QPUA 3HTKC 5L0HA 3O55A 4B6IA 2YLIA 3F46A 2Z15A 5D92A 1YYJA 2LD6A 1FFTC 1LI7A 4IAOA 1E86A 4XQ1A 1FMWA 3LLKA 1MMAA 3L34A 3DD7A 4KBLA 4W8KA 5A6JA 4YN0B 4DVYP 3U2LA 3N24A 5A69A 1GQAA 2NG1A 5B1AC 3DM5A 3DMDA 4JCHA 3TQOA 3V7OA 1Q0GA 3I4UA 3SZRA 2KK1A 2LQGA 4YWQA 3I5QA 1K04A 4GYTA 4CJOA 2Y39A 2UUIA 2GAQA 1D1CA 1NSGB 4CIHA 1E84A 2R7UA 4I1OB 5L0IA 1YLMA 3CSKA 3M79A 1ZU4A 2J0WA 3W2WA 3HNIA 2EPOA 1YAUO 1AEPA 1TWCA 1ZZPA 4JTAB
chains in the Genus database with same CATH topology
3W4YA 2HJ3A 3LLKA 1OQCA 4E0HA 1JR8A 3U2MA 3R7CA 4E0IA 4LDKA 3U2LA 3TK0A 1JRAA 3GWNA 3U5SA 3GWLA 3MBGA 3O55A 3LLIA 3TD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4Y A;  2HJ3 A;  3LLK A;  1OQC A;  4E0H A;  1JR8 A;  3U2M A;  3R7C A;  4E0I A;  4LDK A;  3U2L A;  3TK0 A;  1JRA A;  3GWN A;  3U5S A;  3GWL A;  3MBG A;  3O55 A;  3LLI A;  3TD7 A; 
#chains in the Genus database with same CATH topology
 4JJG A;  1Z5Z A;  3L0I A;  4JTD B;  2HMQ A;  4MVQ A;  4EKW A;  2NSF A;  3C8G B;  4FX5 A;  1CGO A;  2PP4 A;  3MFN A;  4L6R A;  3VF0 A;  2J9U A;  2M64 A;  2P0N A;  3W8I A;  3K1H A;  1YJG A;  2HSB A;  3TJ6 A;  1VOM A;  2QNL A;  1JR8 A;  3RH3 A;  4YL0 A;  2KW3 C;  2R03 A;  1IW7 F;  3C63 A;  4D4X A;  1H6G A;  1VLT A;  2R9R B;  1CGM E;  2VCC A;  1WOL A;  2LP4 A;  1HW1 A;  5A6B D;  4PR9 A;  2XLW A;  5COF A;  1OW8 A;  3AQB A;  3T6B A;  2Q00 A;  4DVZ A;  4JRZ A;  1GM5 A;  1H9T A;  2J7P D;  2XLO A;  2FAP B;  1YYX A;  1OKK D;  3LUT B;  3RYL A;  3DE9 A;  1I4Z A;  1WAT A;  2AWY A;  2YVK A;  2EPN A;  3GEI A;  4XEV A;  3ZDL A;  3JSZ A;  4EIY A;  5KYX B;  2GFH A;  2H7V C;  3I5P A;  2AU5 A;  4K7B A;  1RJ9 B;  2W4M A;  5CI9 A;  4J32 B;  4WGZ A;  2X51 A;  5DS5 A;  4P6I C;  1AVO B;  4O7G A;  1OR3 A;  4U5H A;  2Q3T A;  4IAR A;  3V5Z A;  2D5R B;  2OJQ A;  3GEH A;  3MX3 A;  3S29 A;  2YL1 A;  5BQH A;  3E9V A;  1UFB A;  3KYI A;  3U8P A;  3ABM C;  4E0H A;  3NKD A;  4PJJ A;  2YL7 A;  3SXY A;  4BJ6 C;  1BZ4 A;  1H7I A;  1TWH A;  3T9O A;  2ICW G;  3Q7G A;  4LDR A;  2IOQ A;  4GEH A;  3HNJ A;  4CSA C;  2JX0 A;  1T6Q A;  2IBF A;  2AVK A;  2RD9 A;  3VM6 A;  1TR2 A;  4AK9 A;  1NFN A;  4EWC A;  4IAQ A;  3U0C A;  4R32 A;  2P7V A;  5KYY B;  1CPQ A;  3WOD F;  1ZU5 A;  2G3K A;  5KYN A;  3HLZ A;  3A11 A;  4JW1 A;  4QDL A;  4YT4 A;  1E85 A;  2CGE A;  2NUP B;  2PNO A;  1MMD A;  1T01 A;  1DOW A;  3KL4 A;  2M4E A;  3LNR A;  3MBG A;  4PAC A;  3FDQ A;  3T4R A;  4LAC B;  2R7X A;  2HSQ A;  4MVM A;  3C8G A;  4MVZ A;  2WVO A;  4FAP B;  3EZH A;  4XTK A;  1Z3I X;  1NBB A;  1VK5 A;  4NTF A;  1FAP B;  2XS8 A;  1H9G A;  4MND A;  3S9O A;  4I3M A;  2EPM X;  2KGO A;  3RFY A;  2ZD9 A;  2CW0 F;  3AJM A;  3DZA A;  5DVW A;  4H54 A;  4DBQ A;  3WHN A;  3NMI A;  2IXO A;  4HEA J;  5B1B C;  5DS6 A;  2Q9B A;  3ZIB A;  3QTH A;  3RIP A;  1V55 C;  4AE4 A;  4Q5S F;  5L0F A;  1BBH A;  2QTV A;  2YWA A;  2XLE A;  2BL2 A;  2L6G A;  2W9Y A;  2J0X A;  2A1D D;  3JT1 A;  4CS9 C;  1LKX A;  1MMG A;  2LK4 A;  3DM9 B;  1PCX A;  2PF4 E;  4N6H A;  4H4K C;  4F4B A;  5KYX A;  2J8W A;  2QLA A;  1L7C A;  2J9V A;  2EIK C;  1WWP A;  2LIG A;  4WJ0 A;  3RKO F;  3AG1 C;  2EIJ C;  1RJ9 A;  3HNL A;  4DOZ A;  1FTS A;  1Q0D A;  3B29 A;  1R5I D;  1C17 M;  1WGW A;  2Q9A A;  1D0Y A;  1RKC A;  3IQC A;  2D4U A;  3F47 A;  5CIV A;  5JVE A;  2AWC A;  2OCC C;  3A9C A;  3BEH A;  3ABK C;  3GM1 A;  1XZP A;  3HJC A;  3JRT A;  4NTA A;  3U8V A;  1Z23 A;  1Y6D A;  2VC9 A;  3SXK A;  4EHP A;  5BQI A;  4CS7 A;  3FOO A;  1MND A;  1WN0 A;  3JRM O;  1SMY F;  3MLG A;  4YT8 A;  5AC4 A;  2YEV A;  3LJB A;  3JSE O;  1U0B B;  1K40 A;  2R02 A;  3N0T A;  1JOG A;  1YA9 A;  3C7J A;  1MQV A;  3QW1 A;  4EBK A;  1A0B A;  4E7Z A;  2XRH A;  3LES A;  4IGG A;  3VAY A;  2BC5 A;  2VH3 A;  3ZWI A;  1FFH A;  3EH2 A;  1OW7 A;  3C8Z A;  4LDQ A;  3JZ0 A;  3ZTM A;  5A6B A;  2H7O A;  1U89 A;  2R05 A;  3X1O A;  4XEF A;  2R7R A;  1ZW2 A;  3VYW A;  3ABL C;  5IY5 C;  2J7P A;  4DRI B;  3L8J A;  1AUE A;  3NDB B;  1OKK A;  1F1M A;  3AGU A;  2MWQ A;  2EPK X;  2A6H F;  3JYY A;  3FMS A;  1EA8 A;  2V26 A;  1OW6 A;  1T6U A;  2VCB A;  1ORY A;  2DYS C;  1ZW3 A;  2XLD A;  3GM2 A;  4AX2 A;  1VTM P;  4PJN A;  2YQY A;  2FFH A;  4D4N A;  3LS0 A;  3HKK A;  2XXA B;  3ZQV A;  2L6F A;  3LNM B;  3B0V C;  4N6C A;  5JT4 A;  4OIO F;  1ZHX A;  4O6N A;  1QLE C;  2HJM A;  3UR3 C;  1OCZ C;  1SYQ A;  2G62 A;  4EBB A;  2ZPA A;  3B71 A;  3DJU B;  1TFK B;  1O3U A;  3UGO A;  2J9W A;  3SP1 A;  3DKA A;  3EG9 B;  256B A;  2Y3G A;  1VYK A;  4RBN A;  1QZX A;  4EBJ A;  5KYY A;  4ZLD A;  3Q6N A;  3UMH A;  5A6A A;  2YL0 A;  1FNT c;  2L81 A;  3OWT A;  3EFO B;  2Q9C A;  3PHF 2;  3JYH A;  1L3P A;  1XZQ A;  3SXZ A;  2WB7 A;  4MW8 A;  3EZI A;  2KNH A;  2VB6 A;  3LEV A;  3ZC4 A;  2C03 A;  3SYN A;  5T3T A;  3EPV A;  1LS4 A;  2YL3 A;  3TUL A;  3V5Y A;  4PFO A;  1YVI A;  2QY9 A;  4O6Y A;  2L7A A;  2IXN A;  2L6H A;  5T1D B;  4JKV A;  1HY5 A;  1HE1 A;  3NYJ A;  1YZA A;  5FZT A;  3M4C A;  1PD0 A;  1GGQ A;  2LFD A;  2DGJ A;  2W45 A;  2XL6 A;  3X2Q C;  1LE4 A;  1RXQ A;  3IPM O;  2L9J A;  1NFO A;  4DBR A;  3O39 A;  3DAF A;  1M57 C;  4XPX A;  4AE4 B;  2IYL D;  5F5F A;  1BR1 A;  3EQL F;  3GOR A;  2C04 A;  5GPG B;  4BJT A;  5B3I A;  2YHS A;  4U9E A;  4JEB A;  4IWB A;  3KPH A;  3VRC A;  1EKY A;  3K6B A;  1D0Z A;  3QMK A;  1LI5 A;  2B0J A;  2YLG A;  4W8P A;  1TWG A;  4CDY A;  4CS8 C;  2R7Q A;  3TOL A;  2OEV A;  3LEO A;  4IJJ A;  5KYU B;  3K1I A;  3QVZ A;  3PDM P;  3ZQY A;  4CIP A;  2XXA A;  4U5F E;  4BJ6 A;  1KTM A;  4NC3 A;  1S05 A;  2HJ3 A;  2ZXW C;  4YK5 A;  1WTY A;  5DLJ A;  3RVY A;  4E17 A;  3U2M A;  4HFK B;  4Q7C A;  5DS4 A;  2Y3D A;  4CSA A;  4BEM J;  2V3C C;  1LM3 B;  3SEO A;  3ZG1 A;  3G50 A;  2WZG A;  1KNY A;  4ULW A;  3B9Q A;  3CQZ A;  3EG9 A;  4MVS A;  3B0P A;  4LER A;  1RCP A;  3C62 A;  2R7O A;  4MW3 A;  3RF3 A;  5JLI A;  1FMV A;  2XM4 A;  2HS5 A;  2WVQ A;  1PV3 A;  1ZHW A;  1VLS A;  4QI0 A;  3V5X A;  3GAN A;  3U3F A;  2TMV P;  3EFO A;  4E18 A;  3UGP A;  1IZM A;  1JPJ A;  2OKU A;  4XEK A;  2PFD A;  1U6H A;  1DOV A;  1VYI A;  4ANJ A;  5F28 E;  2GA0 A;  5JP7 A;  1QKR A;  4YL1 A;  5AC5 A;  1ZHZ A;  2KYH A;  1B68 A;  3JTL O;  4C7O B;  4OIN F;  5DQZ A;  1OCO C;  2LFF A;  3T6G B;  4LLC A;  3R7C A;  5K0I A;  3IEE A;  5HSW A;  1M56 C;  1O5H A;  3S0X A;  2OJE D;  1SZI A;  1D1A A;  3BRJ A;  4CS9 A;  1HMD A;  3FVY A;  2XL4 A;  4RDA A;  2HUJ A;  5COG A;  5BQG A;  4CDV A;  2BE5 F;  1A7V A;  2KC3 A;  2Q4F A;  2A69 F;  3K7D A;  3KYJ A;  4O6M A;  2X0C A;  2XLV A;  3RVZ A;  3AGT A;  3K66 A;  2EIM C;  3RQG A;  4AL0 A;  3GOD A;  2GWW A;  2XL8 A;  4JUR I;  4WAB A;  4C3B A;  3FHD A;  2XS1 A;  4J7Y A;  2YLD A;  2VAS A;  2I15 A;  3RW0 A;  1K05 A;  2CCY A;  1ORS C;  2J45 A;  4XWJ A;  5KYU A;  1SR2 A;  1G8X A;  4IRU A;  4U5C E;  3IQ6 A;  3W2V A;  3ZTZ A;  2AP3 A;  1HMO A;  1QVX A;  3JCU Q;  4PFP A;  5E3C A;  4BG0 A;  4ZLC A;  1A7E A;  1OR2 A;  3IHU A;  4YT2 A;  4KNV A;  1W2W A;  2J46 A;  3US6 A;  1MMN A;  1HW2 A;  4Z9H A;  4PJM A;  3WAQ A;  1TFO B;  4BJ5 A;  2W4B A;  3PMR A;  3AG4 C;  1I5N A;  4IB4 A;  2R25 A;  1Q0K A;  3TJ5 A;  4MVO A;  3S90 A;  1QSP A;  3EJN A;  4PJL A;  1HE9 A;  4JTC B;  5E3A A;  2OG2 A;  5T3W A;  2DB4 A;  1T9K A;  2KSF A;  3U5S A;  2OEX A;  3PCV A;  4M63 A;  2HV6 A;  4PK4 A;  4CJG A;  4QI2 A;  2MHR A;  1LVK A;  2PBE A;  3CEX A;  1BR2 A;  1A41 A;  1OCR C;  3DAG A;  2OU6 A;  4N06 A;  5COM A;  4ULV A;  3GEE A;  3Q7L A;  1QQ3 A;  3S84 A;  4C3E A;  1EI7 A;  2IXP A;  2Y69 C;  4DXW A;  2XSE A;  4C7O A;  2H7B A;  3AQC A;  2WZF A;  3U3B A;  4OIP F;  2HFI A;  1JAF A;  3FAP B;  1TWA A;  2Q7R A;  4FES A;  4LDK A;  3SXM A;  4U5G A;  2QUP A;  1UG7 A;  2WZL A;  3W8H A;  1CPR A;  3M15 A;  4U9D A;  3POV A;  4CBE A;  2HV7 A;  5E2Q A;  3GM3 A;  3KMI A;  3NYM A;  1G4W R;  3ITF A;  1ZYR F;  1FR0 A;  5FCL A;  2NUT B;  2P61 A;  2XLM A;  2JD3 A;  1E83 A;  3NMK A;  3TD7 A;  3N2Z B;  5AGF A;  3ASO C;  3QW0 A;  2A0B A;  3OA1 A;  4U5D E;  2HKV A;  4FWV A;  1LPE A;  4XPW A;  4NY3 A;  3FAJ A;  4EUK B;  4G7Z F;  3G4Z A;  3G4X A;  4JCZ A;  1ORJ A;  3EGX B;  3Q6M A;  2XLH A;  5DQT A;  3NYL A;  5JS5 A;  3FXH A;  5EHH A;  4YL3 A;  1SF8 A;  1ZVZ A;  2EIL C;  2XM0 A;  1OXB A;  1O87 A;  1BR4 A;  2YKZ A;  2OQM A;  5JRA A;  4N4W A;  2ETS A;  1JRA A;  3IQ5 A;  4CS8 A;  4AL1 A;  4MTF A;  2ASR A;  1TKN A;  3FOP A;  3NMJ A;  1LS1 A;  3K33 A;  2CNW D;  5BUO A;  1V4A A;  3HNK A;  1ST6 A;  3DWW A;  4G78 A;  2P6V A;  5L0D A;  1D0X A;  1RKE B;  2KQ9 A;  4GQH A;  2FGY A;  2H8A A;  4A2N B;  3H2U A;  3CZ6 A;  1Q0M A;  5L0C A;  3S28 A;  5KYW B;  2R7S A;  4KC9 A;  1ZHY A;  4I44 A;  2ZXP A;  3H2V A;  5B3S C;  1EQ1 A;  2G3V A;  1M2V B;  4O79 A;  2Y3H A;  3O6X A;  3AOU A;  5L3Q A;  1ZHT A;  2CDQ A;  1NU9 C;  1OXK A;  1YDI A;  2LSE A;  2Y3B A;  3TOM A;  5L0G A;  1G4U S;  2I8B A;  5L3V A;  4NTB A;  4WGY A;  1LE2 A;  4JEA A;  4JJF A;  3GWN A;  4YT5 A;  2NUT A;  4MTG A;  2O9X A;  3U9J A;  3WG7 C;  1I4Y A;  4CX9 A;  3GWL A;  3EHM A;  4BPM A;  3O10 A;  4G7O F;  4I1M A;  3LLI A;  4U5B E;  5A6K A;  5HV9 A;  2R7V A;  1NZE A;  2EIN C;  2KJG A;  4J7T A;  4MQ9 F;  3RQE A;  4DJ9 A;  2ZXR A;  1BDJ B;  3EH1 A;  4OIQ F;  1Z63 A;  3ECS A;  3OEO A;  1RMV A;  3QZC A;  5JUA A;  1CGN A;  1OQC A;  3K1I C;  3CAX A;  4Z9J A;  1WAS A;  1V54 C;  5E33 A;  3KKB A;  2MYS A;  3EGX A;  1NLX A;  3H65 A;  5L0J A;  1KU2 A;  2P1A A;  4MVR A;  2LCH A;  4X0R A;  4A4A A;  4K1O A;  1PD1 A;  2NSG A;  3NKE A;  2A68 F;  4DRH B;  3IQT A;  4OD5 A;  3LS1 A;  1G5Z A;  1S7Z A;  3EGD B;  4MS2 A;  1JMW A;  2EPL X;  5D91 A;  2WL8 A;  3U9M A;  4CDA A;  2R7T A;  1YA7 O;  4JZA A;  5CI8 A;  3SNH A;  1XWJ A;  4U5E E;  4ER9 A;  3NRH A;  2NUP A;  4G0H A;  1Y4C A;  4MTO A;  4YJW A;  2E87 A;  1LIH A;  1APC A;  1TQG A;  1M2O A;  3L1M A;  3NG1 A;  4LLE A;  2DI3 A;  4P9F A;  3ZVR A;  3R2P A;  1YAR O;  3C18 A;  3UMI A;  4JC7 A;  5EK0 A;  4Z9I A;  1RKE A;  5TJ5 E;  3AG2 C;  1R4T A;  5KYW A;  1Q0F A;  1N1C A;  4NQF A;  5F5H A;  4JE9 A;  4OIR F;  3EHN A;  3B0U X;  1M2V A;  1C02 A;  3E70 C;  1A7D A;  1T5O A;  2J9B A;  2PX0 A;  3DXJ F;  3M4B A;  1VMA A;  4NCQ A;  2B0H A;  3DJN B;  5JSL A;  1D1B A;  2NPU A;  2UUH A;  2RSE B;  1J8Y F;  4MVU A;  1Z6A A;  4KI2 A;  3DI5 A;  3M1C B;  5EGY A;  4UDV A;  3RQF A;  4XPY A;  3T6J A;  4HE8 D;  3TK0 A;  3L8I A;  3ZSU A;  2A0U A;  3ATP A;  2QE9 A;  4JVS A;  2YRF A;  2OOC A;  2CYD A;  4JIO A;  4P9T A;  1NU7 D;  3DE8 A;  3W4Y A;  3MYF A;  4E7S A;  1MNE A;  2F22 A;  1NG1 A;  4ONS A;  1GS9 A;  4Q4Z F;  1V74 B;  2PX3 A;  4KNW A;  3J06 A;  2ZXO A;  4C3D A;  2JPU A;  4XLN F;  2IM8 A;  2A6E F;  3UMK A;  4BJ1 A;  1Z7Q c;  1M6T A;  2HZ8 A;  2HMZ A;  2CNW A;  2VCA A;  4OD4 A;  4E0I A;  3QVY A;  4HFF B;  1JPN A;  1C03 A;  2GDC A;  3AG3 C;  4RD9 A;  4BJ5 C;  1OCC C;  2WVN A;  4J30 B;  1E2X A;  1VB5 A;  3EGD A;  1J8M F;  4K0D A;  4BEJ A;  2IXM A;  2R7W A;  1YZC A;  3MYI A;  3S27 A;  4G7H F;  1T6I A;  3C8G D;  4XLP F;  2YZS A;  3UNG C;  2DYR C;  3ASN C;  3KH2 A;  3LAY A;  4DRJ B;  1QPU A;  3HTK C;  5L0H A;  3O55 A;  4B6I A;  2YLI A;  3F46 A;  2Z15 A;  5D92 A;  1YYJ A;  2LD6 A;  1FFT C;  1LI7 A;  4IAO A;  1E86 A;  4XQ1 A;  1FMW A;  3LLK A;  1MMA A;  3L34 A;  3DD7 A;  4KBL A;  4W8K A;  5A6J A;  4YN0 B;  4DVY P;  3U2L A;  3N24 A;  5A69 A;  1GQA A;  2NG1 A;  5B1A C;  3DM5 A;  3DMD A;  4JCH A;  3TQO A;  3V7O A;  1Q0G A;  3I4U A;  3SZR A;  2KK1 A;  2LQG A;  4YWQ A;  3I5Q A;  1K04 A;  4GYT A;  4CJO A;  2Y39 A;  2UUI A;  2GAQ A;  1D1C A;  1NSG B;  4CIH A;  1E84 A;  2R7U A;  4I1O B;  5L0I A;  1YLM A;  3CSK A;  3M79 A;  1ZU4 A;  2J0W A;  3W2W A;  3HNI A;  2EPO A;  1YAU O;  1AEP A;  1TWC A;  1ZZP A;  4JTA B; 
#chains in the Genus database with same CATH homology
 3W4Y A;  2HJ3 A;  3LLK A;  1OQC A;  4E0H A;  1JR8 A;  3U2M A;  3R7C A;  4E0I A;  4LDK A;  3U2L A;  3TK0 A;  1JRA A;  3GWN A;  3U5S A;  3GWL A;  3MBG A;  3O55 A;  3LLI A;  3TD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...