4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
b'SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
3K6GA 3OWTA 4BJ6C 4BJ5C 4BJTA 3CZ6A
chains in the Genus database with same CATH superfamily
1R4MB 3J80Z 5FD6A 3E5XA 5IP6A 4PZJA 3ZR8X 3TJ6A 3CJRB 2DYRH 1JRAA 1BIAA 2L4AA 3ZQGA 5GP9A 2DO7A 4C9YA 2NVQJ 2DT5A 2OU2A 2XAHA 2STTA 3RH3A 1XMAA 2W4MA 1MW7A 5EJCA 3R0JA 3TO7A 2C03A 3QTHA 5JRAA 3VRCA 2PLYA 4X0RA 2PMHA 3PIOF 2HZDA 2LLKA 1TQGA 2IA2A 1TT5B 3FXLA 2KIFA 3ZC4A 2Z99A 3HXLA 4W8KA 3C18A 3U9MA 3HRTA 3RTRA 4N4WA 4M9ZA 1JPJA 1AHDP 4EHPA 3WG9A 4YT2A 1R22A 2P6VA 1JOGA 256BA 3U21A 2L6HA 5CVIA 5DVWA 2R7SA 1TWFJ 3B0VC 3H0DA 5CVVA 2XRHA 4XPYA 2M64A 3KL4A 5KYUB 4H4KC 4XOTA 3BG9A 1MBEA 2DOAA 3PL8A 1SF8A 2BBYA 4LG0A 1XG1A 1S5LC 4N6CA 5D5VB 5ILSA 5J47A 3KYIA 3Q9SA 2KK1A 4EBBA 1YW8A 5AC4A 1VQOI 2M0CA 1MDMA 2DMTA 4CCJA 3CJNA 3KFWX 5F5HA 2O7OA 4FESA 4U5HA 1W7PD 1B4AA 2HYGD 2M8EA 3ASNH 1V5GA 4C30A 3I59A 4MLOA 1OCPA 3AG3C 2ASRA 3GW2A 2DGJA 1A04A 3L2VA 3EH2A 4RM2A 2Q0OA 3VODA 3E1SA 5LHIA 4LDKA 1D0XA 4P5OA 4RBOA 2EWNA 5LGUA 2HJ3A 3T4RA 5FLXZ 2DU9A 1X1CA 4UV9A 3DPLC 1G2HA 2N8GA 2WAQN 2R7FA 4LITA 4E7SA 5H2FC 3S93A 2HGCA 2R5YB 2J9VA 1B1BA 2YL0A 4RB0A 4LLGF 5L3EA 2Q2EB 2WA0A 2WV0A 3S16J 5GTHC 4MS2A 4HW0A 2E19A 4I1OB 2Q7RA 2DYSC 2D5VA 1QZXA 1EQ1A 2JUCA 3BJAA 1WJCA 2HV6A 4DYQA 3T9OA 4UXNA 3U9GA 4Q48A 4X0GA 3ECOA 2GWWA 1Z67A 2DA3A 3JRFA 3H3ZA 1LFPA 3WHCA 4F7ZA 1FIPA 4KFCA 1ZZPA 3BR5A 2X1DA 3RYRA 3T0YA 1ZHZA 3IAM2 4WGZA 5FLMJ 2LH9A 5E1WA 5TISC 1F5TA 2EV6A 1BOBA 1T38A 1LJ9A 4HSTA 4UVAA 4JE9A 1ZAOA 4P9FA 1RR8C 3GM1A 1FNNA 2J0WA 3T6JA 3Q9VA 5E3NA 2W45A 1QHHD 3JRMO 3CCRI 4XLCA 3U3FA 2EIKH 3CLOA 1OCCC 2XF6A 1KYZA 3AOUA 1PVEA 4O6JA 1KZHA 1LE4A 4HEA2 3FAJA 1JKQC 3BR2A 2B7EA 1IXSB 1O87A 1FYLA 5EG0B 4G78A 3MKWB 4BBSJ 2FGYA 1J7KA 5HLGA 4KIGA 2P5LC 2FD5A 3AQBA 1IRZA 1OCOC 2R02A 1ON1A 3EFOA 2KQRA 5LLQA 2JSPA 4QSHA 3IH2A 1FY7A 1D8JA 4HQEA 1SFUA 2JA8J 1K04A 3S90A 2DTZA 3KLNA 2VI6A 3J81K 1KYWA 2KQ9A 2L9NA 4U0YA 1XMKA 2DYRC 2H6BA 2B9SA 3LNRA 2DW4A 2JVGA 3KYCB 2F5VA 3N05A 1EJ9A 4EUKB 3AG1H 1L3PA 4BQAA 1U6GA 1BDJB 1MD0A 1O3SA 2R7ZJ 1GT0C 1WCMJ 1L7CA 4MNDA 4N4OB 1YJWI 3EZHA 4FASD 2M87A 3T6BA 2HXOA 2DA1A 4IO9F 4E17A 3ZCOA 1Z0XA 3RZDJ 4OINF 3C2GA 3P5JA 1OPCA 2OQGA 3I71A 2Y75A 2FQ3A 3LA3A 2V1DA 3OV8A 3V8JA 2LCHA 2EQRA 3GLXA 1FT9A 2H09A 3SYTA 1U0BB 2MYSA 4XKBA 3C2HA 2V6CA 4M3EA 2KMUA 3OOUA 3MVPA 2R0QC 1SFEA 1IGNA 5ILUA 1WJFA 4BE2A 3SEQA 1ETXA 3JW4A 2Y30A 1ZREA 2QBYB 3S2WA 3G6EI 1PD1A 1HE1A 1ZN2A 2R5ZA 4YJWA 2VQLA 1MNEA 5M3MJ 2OQRA 2LP4A 3S9OA 1A5JA 2R7XA 1S6LA 4WABA 3FOPA 2F2EA 3AKZA 4R79A 2DCEA 3GWZA 4X1EA 3RKXA 3K2AA 2XAJA 1W0UA 2VODA 3A2KA 2H7BA 3NYLA 2W57A 4I2OA 1VI0A 3NAUA 3DJNB 3GEIA 1R00A 3ASNC 3MFKA 4KN7X 1K7AA 1YLMA 2QCOA 1R5HA 2BYVE 1S7ZA 2Y9ZA 3LSKA 2YL3A 3M4OJ 2M45A 1E86A 2HS5A 4MFEA 1B9MA 1TW3A 2LC2A 2LD5A 3A0BC 3U5SA 4C3BA 3EHMA 3FVYA 4D4XA 3RF3A 2J5OA 2ZFUA 2LF8A 3HKZA 3N97A 4A0ZA 1VNDA 2W4BA 1PP7U 4Y4RA 1YVIA 3OL3A 1FBSA 2NNNA 2GLOA 3TO9A 2LOOA 2UUHA 1W5TA 2VKVA 2XPUA 5J6XA 3BY6A 3DTEA 2GZWA 3HZJA 3V42A 1SFOJ 3Q0WA 5IYDJ 1NHAA 5EDNA 3EUAA 3EUHC 1NU7D 3R61A 2PMUA 2A68F 3ABKH 1GV5A 1U0JA 1YQAA 2EFQA 1YZCA 1KU7A 2RDPA 4GQHA 2C04A 4ZJZA 4G9YA 3H5AA 2O3FA 2GIZA 3DBRB 3CDHA 2YLDA 2LDUA 2QYOA 2M2EA 3EGDB 3HB9A 2NUTA 1OXKA 1R6RA 2Y3GA 4NQWA 1MBGA 4XICA 3TJ5A 2A07F 4JCZA 1FMWA 3IH4A 2Y39A 3KP7A 4L0ZB 2ZFWA 3IQTA 3A0HC 3ZQ7A 5D6EA 3WTXC 2ZXOA 2VPLA 3CC2I 4A2UA 4ER9A 1PDNC 1W4MA 3E0JB 4KT6A 2J0XA 1QA6A 2IA1A 4J00A 1YDIA 4RGRA 2OOCA 2PN6A 1RUNA 4A3JJ 2HVSA 1BI1A 1QZEA 4LB5A 5CIVA 1DGRM 2AU5A 1KTMA 3VFZA 1R5GA 1RIOH 3I9V2 4XN3A 2FX0A 3G4SI 3S3NA 4XM3A 1MMDA 1QRYA 4P6IC 2HDDA 2COMA 2ME0A 2MLGA 2K86A 4DRHB 1J59A 2Y0MA 5JLWA 2O6GE 3DP7A 4LIUA 1ZU4A 3JTLO 4IRIA 2KDOA 3GM2A 4YG2F 5L0FA 1FYMA 1Q1HA 2ZXIA 4BQQA 1LQ1A 3VAYA 4AVZA 2J5PA 5LHGA 1QSPA 4C3IJ 3MMYB 4YEJA 2MD0A 3CUQB 2DMPA 2H1KA 2FFHA 5DTDA 3CCMI 2NUPA 1YS7A 1BJAA 2FJ1A 3LA7A 3I5PA 3I64A 1DQUA 2DXIA 3HOZJ 2V26A 1FTSA 1T6SA 3BRJA 5D5XB 3MEXA 4RGUA 3ZGKA 4HRIA 1TWHA 3AG1C 3CMAI 1FTTA 4A3CJ 5J4YA 2F4IA 2JT1A 4EJVA 4IOCF 2XSJC 1TQMA 4M74A 4YFXF 4MHGA 2V1NA 5FFZA 4EV0A 3EPVA 1O3QA 3OEOA 4WGYA 1QGPA 1JUSA 5EZGA 5CVRA 2IXMA 2FSWA 4ENNA 2GOXB 3KH2A 3K1IA 2D5RB 4G6TB 3G4XA 3ZPLA 1YIOA 2WBMA 4EQQA 2PQ8A 3BR3A 3OYBA 2EPOA 4YN0B 3P9KA 5J8CA 4N06A 1TWCA 3H1CA 3JR9A 3ISPA 3REOA 4M63A 2RC4A 4RM3A 4AU7A 5AIQA 2HV7A 2E2JJ 3RSNA 3I4UA 4U7DA 4JEAA 1ZTRA 4M3FA 1MJ9A 2R92J 3LWFA 3KE2A 4KBLA 3MZ8A 5AGFA 2HOSA 3WTVC 4KN4X 4X6AJ 2L6FA 2FE3A 1HSJA 4IJJA 3WGHA 1DUXC 1V3FA 2QEXI 4NC7A 1A6IA 3S0XA 2HWVA 4IXAA 2VE9A 1YA7O 4XRSA 1AA7A 3TP3A 1H89C 4ZYEA 3LSRA 2EB7A 2FA5A 1BC8C 2UWMA 2HYFA 3SZPA 1OW6A 3ZQCA 1O3TA 3C2BA 3ZXSA 2L9JA 3DE9A 2EPLX 1WZ2A 2H8AA 2GXAA 2JWTA 5KVRA 3GWNA 1X3ZB 2ISYA 4RAZA 4YFKF 3E5UA 3FMRA 4F91B 5ILVA 3DV8A 3HHGA 5GPGB 2BY3A 4I1MA 3LS0A 2IP2A 4N4NB 5TGTA 1HMDA 3KYJA 4W8PA 1IRXA 4XKWA 2XLHA 1XX5A 5T3TA 2P5VA 3CCJI 1R23A 3HC7A 5L3BA 4U7BA 1JPNA 2X1CA 1J2XA 1UG2A 3BR0A 2CYDA 4BEJA 2IVMA 1BI3A 5A2QK 3O8GA 2HPMA 5HDNA 3HM5A 3ABKC 3BZCA 4FHTA 5IP7J 1KU3A 3HNIA 5B3SH 1CQTA 3SQNA 3U8VA 3G73A 2J8WA 3E9VA 1U8BA 1GDTA 2XS8A 3CC4I 2Z2SB 2YL1A 5CI9A 5GAEJ 2M4KA 3OR1C 4KT5C 1ZG3A 4CDYA 3PNYA 5TRDA 3RKYA 3U8PA 2D2WA 3CP2A 4FETA 4UVBA 4R32A 3WTTC 4OOIA 4QI0A 3LA2A 1YI2I 1E0EA 3DJUB 5KAFC 2GXGA 1SZIA 1Z6TA 3LAJA 2K9QA 4BS9A 1ENHA 4OMZA 4TV7A 3LAPA 5ICGA 4FX4A 2UUZA 2HKXA 2PF4E 1OCZH 3GODA 1W36D 1IN7A 1LNWA 1IUFA 1R58A 3MZYA 5A6BA 1QZYA 2AQFA 2HYJA 2RN7A 3NRHA 3WU0A 1UMQA 2H8WA 3K70D 3UMHA 2HXIA 4BEMJ 3RVZA 1TWGJ 4FT8A 3HOXJ 3R60A 1XGOA 4XOPA 4M6VA 2XPWA 3L34A 2OJED 3ZMZA 3EYYA 1KA8A 4LLNA 3K1NA 1YW9A 3F22A 2JX0A 1ORYA 5HLTA 3EETA 2MG4A 2DAOA 5EGOB 3GZ5A 1K6OA 1I4ZA 4A2NB 3OYNA 4MTGA 1RXQA 5T3WA 4J30B 3VSKA 4A4AA 1QU3A 1B8IB 3CF2A 1B6AA 4JJFA 2CS3A 3DEEA 2KC3A 4JP0A 1ORSC 2NSFA 1BBYA 3HOSA 4AIJA 3I53A 3DKYA 2W85A 1DOVA 4J7TA 4L5IA 4O6MA 2E1OA 1JUPA 3HJCA 4O6NA 5CLSA 1M2OA 1RRJA 1VYKA 1OCRH 1IRFA 1BBHA 2IAIA 3BPXA 3J80K 5CKTA 3FDQA 2OCCH 4OIRF 4IRGA 1Z6RA 3AL0C 5E1ZB 2ZXRA 2VC1A 3J06A 5D5WB 1HSTA 3U1KA 1WI3A 1AEPA 3D0SA 4HAMA 3VB2A 2OV7A 4EM1A 1FBQA 3OL4A 4WX9A 5E33A 3RQEA 5M3FJ 4Z9HA 3E6CC 1Z05A 2W82A 3K1HA 4XRSG 2V4JC 3I55I 2FOWA 2DDAA 2IJLA 3EDPA 4WXCA 1I4YA 4D0PA 1VLSA 2Y3HA 1HKSA 3A9CA 4UHTA 5E79C 2WZGA 1XTAA 4U5EE 3J7ZI 4G0HA 5JSLA 1K4TA 1ZW3A 3C1DA 3M1EA 1D1CA 2OPTA 3M15A 3PQKA 3M07A 1NU9C 2LY9A 2Z15A 1S9HA 5L0JA 1G4WR 3S29A 4CICA 3JRBA 3B02A 3QYEA 1NLXA 1OW8A 3LSGA 3D1NI 2CNWA 4LLEA 2DMQA 2DLLA 4A12A 3EZIA 3GWLA 4IGGA 1U9OA 2H8RA 2AQEA 3OSFA 1BA5A 1H88C 2A05A 1JGSA 3K4KA 3RJPA 1UCRA 4LIVA 4DJAA 2LFBA 3RKWA 1HKTA 4ULWA 4BG0A 3GMEA 2DJNA 4U5DE 5L0HA 2EFPA 4EJWA 2QA4I 3JSOA 3HNKA 1QVXA 2JQ7A 3TP0A 2EINH 1RKTA 3BLYA 3FMQA 4YIIA 4D4NA 5M5YJ 1WKMA 2FBKA 2HFHA 2XHKA 2IA0A 1QZZA 2Q4FA 3MYIA 2W24A 3FM5A 4IEJA 5FLXK 5A6BD 1WJAA 4IRHA 1IG7A 4Y33A 4EIYA 4A3GJ 1QPIA 3T8RA 3L7WA 3LMMA 3RKOF 5E2QA 2WV1A 3GTJJ 4Y52J 2KRFA 4XLEA 3OYHA 1K40A 5B3SC 4IF4A 3QAHA 3O10A 3OIOA 4HSRA 3LSIA 4CS7A 5GPCA 1OXBA 3BTJA 2ZBKA 4PSWA 2DT6A 3MYFA 4ASNA 1PUFB 4JURI 1G3YA 3DXJF 3S8PA 3S3OA 1KGSA 4GO1A 2NVXJ 1A7VA 2CMPA 4IQ4A 4DYCA 3K33A 3OYEA 3GFIA 1U3EM 4G94A 5CQEA 2VJIA 1I6XA 2HQ5A 3HUGB 1GM5A 3MD2A 1WGXA 1OQCA 2FMLA 1YYJA 2F4MB 3DLAA 2X48A 2WZLA 1XCVA 2A61A 4U5FE 4G7OF 3F8MA 3R0AA 2AXTC 3DBHB 1WJDA 3PIPF 1OCZC 3BG6A 1ORJA 2XAQA 4FCYA 3L8IA 5COGA 1TWCJ 4CJGA 4HG2A 4B8XA 4R8HA 3ZRGA 1TT0A 3K4LA 1LIHA 4G8XA 3FXKA 2HOAA 2X0LA 2M3AA 1EA8A 1LM3B 4XQFA 2J45A 2GAQA 1GXQA 5KNLA 4QI2A 4U0WA 2CH0A 4HF0A 3DZAA 2YL7A 5ICCA 1I6HJ 2KIMA 1AU7A 1XD7A 3KIOA 3VDXA 3S1NJ 2EV5A 1ZRDA 2O0YA 4AD9A 1H9TA 1KQ8A 2LFDA 2PJRB 1PYVA 1SD4A 2QSHX 3BTIA 2L7KA 3K69A 4UDVA 5D8LB 3C8ZA 2CU7A 4Y13A 3TGNA 2CGEA 2CV2A 1VQKI 4L9TA 2D1VA 4YIRX 3COAC 1Z7Qc 3I3LA 4RBNA 3DEWA 2RSEB 5A6AA 3I5UA 3WTWC 2HNHA 3VYRB 2KL4A 4KIBA 4Y3OA 2V9KA 2WB7A 1OCRC 3ZQVA 4CDAA 3HJEA 4RAGA 4II3A 4BACA 3B6AA 4XORA 4PJNA 2OCCC 1HBXG 3GTKJ 1WWPA 4BGDA 3LLIA 1YZAA 4PGHA 2GDCA 3K7DA 3ECHA 1TP4A 4DBQA 2TRTA 3EYIA 4JCHA 4NC6A 3FXQA 3P9IA 2F22A 1UHSA 3JCUC 5KYNA 4WXHA 2WY7Q 2ZMEA 4KC9A 2JD3A 3G50A 2GBYA 2GOMA 4M6XA 1M57C 4A3DJ 2BV6A 1S8NA 2ZCWA 4KA4A 4MW3A 3DD7A 2CG4A 2JN6A 4DZPA 1Z9CA 2VH3A 3H5RA 3MWMA 1JXSA 2RAEA 1WH5A 2AO9A 3GBGA 4RDUA 5K7ZA 1W36C 3K4JA 4IJAA 3S28A 1IN6A 2IS4A 1UAAA 1AKHA 2I15A 3NWTA 4XKVA 3IL2A 2E2HJ 3QRFF 3BPVA 4BYYA 4IHTA 3TQNA 4C3EA 4ZYDA 1X58A 5IOYA 3SZRA 4A3IJ 2LTPA 1HOMA 3DPTA 4K0DA 2WC2A 3TKYA 4M3GA 2I10A 5JVEA 4U9EA 1W7PB 5FRNA 2PX9A 2MSYA 3FKJA 4HQMA 3VPRA 4S05A 4Q5SF 2IS2A 2XPVA 1DU6A 2HDWA 2LG4A 1QPUA 2HR3A 1T8IA 2E60A 2KP6A 3ZOBA 2EPFA 3HGYA 3M9AA 5J3LA 5DM6F 2IW5A 1Q0KA 4KISA 4NBQA 2KIQA 3IQ5A 4CCOA 2AWYA 4WCGA 3G71I 2R7RA 2VBZA 1V54H 2EZLA 1JTXA 2FUG2 2JTVA 3OWTA 4NTAA 1PUEE 1TTYA 4JTDB 2XKPA 4Q4ZF 3OYIA 3OYMA 5K1YA 2O61A 2EINC 2OQMA 3HPHA 3F8BA 3M1CB 5EK0A 4HNTA 2JSCA 3KX2A 4EVIA 3QP6A 1T33A 2QENA 1VQPI 3HTUA 2E87A 4GEHA 5KYXA 4NQFA 1YYVA 2H1LA 2GWRA 2XSDC 4BE1A 2OEVA 4YRVA 1U5TC 5BQTA 2XAUA 4H0EA 2CQNA 1X2MA 4NTFA 2LREA 3SYNA 4ENMA 2JA2A 3H35A 4JOMA 5LHHA 4I3MA 2JPBA 4IAOA 4RLFA 2CSOA 1MBJA 2K40A 5GTIC 4MVMA 2KKOA 3J7AY 1E3HA 1F1MA 3K6BA 3V7CA 4DIQA 4HA8A 5KYXB 1QVUA 3I58A 4FQGA 5FB2A 3S32A 2EH3A 3HKZN 2IRFG 2W48A 4CHUA 1WTYA 1IDZA 5KYWA 4LDRA 2E5NA 2X6WA 2R7WA 2MFZA 4OWRB 3KEQA 2VL8A 1SEUA 1FSEA 2QQ8A 4MEXF 1Z23A 2HJMA 1YJGA 5K0IA 2BEOA 4FE4A 5KYYB 1P92A 1FMVA 1A0BA 2R5YA 2IM8A 4HDVA 3WE3A 4O5VA 1A36A 2IXSA 1S7OA 2HMQA 2YPRA 1G4DA 2Q2EA 4I02A 1ETVA 4ETSA 1TQPA 4CZZA 1LDDA 1VLTA 1WATA 2CV1A 2M1BA 3OIQA 5M5XJ 2YSRA 1LVAA 1FNTc 3C62A 3KP5A 3GORA 2K7LA 3WTYC 3IV5A 3MAJA 4N9IA 3KZYA 1VQ7I 2VJJA 3KCCA 3LSJA 2WAEA 4ZC3A 3T8TA 4XBFA 2Q00A 5BUOA 1H8AC 1QQ3A 3F46A 3QW1A 3PNVA 5E3CA 1Y1VJ 2KZVA 3RCOA 1MZBA 4B1RA 2VQHA 4EEFG 1NK2P 2DA6A 2G0EA 1R1VA 2V1XA 3CLQA 5E3LA 1D8KA 1NG1A 4PSXA 4NDLA 4LLLA 3TDZC 2VOPA 1XC5A 3W6JB 4F92B 1ETWA 1JHHA 2RREA 3SXYA 4ESBA 5KK1A 4RB1A 2ZJRF 3LSPA 1QNTA 3I59B 1PV3A 1LI5A 2YS9A 1LS1A 3DQVC 1QHGA 2PMZA 1ZQ3P 5DEQA 2P8TA 4Z6YA 3C8GD 1A35A 3LAYA 3UGPA 4QTRA 3RVYA 1VQ8I 1ONVA 3CCQI 4PCQA 5JR3A 3VWBA 4P96A 1QKRA 2CO5A 4GGGA 2ZSIB 5IY5H 5EG0A 3TMOA 2OC6A 3ABTA 1T2KA 3O2PE 4YFNF 4F4BA 4UV8A 3K4MA 3LOCA 2VQGA 1R49A 3LUTB 1Q0MA 2IPQX 3SZTA 1YFHA 2NG1A 5DCFA 5JVGF 1E83A 1VTMP 2FXAA 3OYAA 1VOMA 2OTJI 3M79A 5F6FA 4KNVA 3V8KA 2XIGA 3GLLA 5D91A 2W84A 4XLPF 2VC9A 1QBJA 3OYJA 1N25A 3PUFA 2ADUA 5B66C 5JFRA 1U78A 3MZHA 1GGQA 2BHYA 2EZHA 4EM2A 2A5WA 4GCVA 4ON0A 3MLGA 3W6KB 1E85A 2CUFA 2HU9A 3G1LA 3DLLF 2AP3A 5COFA 4ESFA 3RQFA 3CCYA 1RCPA 1O7LA 1MIJA 3FHZA 2MD5A 4I6ZA 5BPIA 1T0FA 1ZG1A 3PJRA 4BJ1A 3FXRA 2KPMA 5JLIA 2A6TA 1JT6A 3HSRA 5EEHA 2R9RB 2M7BA 4XSXF 4EBJA 1ETOA 3W2WA 4E7IA 2XLVA 4P55A 3IQ6A 1V54C 2QQ9A 4CDVA 4M3BA 3BOQA 4IHSA 4JJGA 1Z3IX 5JUAA 2IGNA 3BC8A 3S15J 3DFGA 3AGUA 2VUMJ 4BQOA 1FYKA 1KNYA 2V79A 2QWWA 1NK3P 2QBYA 2XSEA 4BL0B 2X0CA 2RKHA 5T1DB 3BP8A 3ZMTA 1CPQA 2HFIA 2XRNA 5AC5A 3A1YA 3WHBA 4BJ5C 4DVYP 2KRCA 2Y3BA 5E3AA 4FX0A 3NMIA 2VXZA 1AUEA 4AX2A 3BR1A 3HKKA 4CXFA 3AL0B 2GA0A 1SR2A 5BQGA 3LEVA 4W97A 3F9KA 5KHDA 5DS5A 3G1OA 1BM9A 2OU6A 5HDGA 1TWGA 2UUIA 5JP7A 3L2UA 2LR8A 2XLOA 2YX7A 2BL2A 5FGMA 4CCMA 2EA4A 1ZGAA 1EI7A 4CZCA 1YO5C 3MFNA 1KQ0A 1C03A 3S27A 3SXZA 2W4SA 1Z7UA 2UZKA 1LE8B 1AWCA 1Y0NA 3BDDA 1SVMA 3SHFA 2I8BA 3HDDA 2BXYA 5HLHA 2ZC2A 3DWLE 2NOJB 2E7XA 2TDXA 5J1RA 2OTLI 1GVDA 2A1DD 1MMGA 5LBQA 3LNQA 1YA9A 4HPQA 3G1MA 1SVLA 5DS9A 2R03A 2DA2A 1XZPA 3ASOH 4S04A 2J7PA 3JSEO 4R1HA 2JA7J 1YHQI 2L54A 1R7JA 2LNBA 1W5SA 1X4OA 2EZIA 2ELHA 1SMTA 1ZLKA 4K1OA 4AIHA 1OR7A 1D3YA 3H0GJ 4HV6A 2JRMA 1DPRA 3I5QA 4RD9A 2DOEA 2L9VA 1RMVA 3DEUA 5HS9A 4EMSA 4XTKA 3J7AO 1MNMC 1YIJI 5FKOA 2PEXA 2JZYA 3RDIA 1DP3A 3ITFA 4LMYA 1TNSA 3EGDA 3Q5FA 3QW0A 5B1AH 2WVQA 1DGWY 4GRIA 4OIOF 3SEZA 4M72A 2DFFA 2IS1A 4E0IA 3PNTA 2LK2A 1Z3YA 4U88A 1WPKA 4BJ6C 3W8IA 3NMKA 2QTVA 3ERMA 5LRSA 3JRAA 2XS1A 4NUBA 3PHF2 2HQRA 1I5ZA 2NAZA 1YX5A 2V7FA 2Y69H 3CJTB 1GHCA 1XN7A 4L9NA 4LB6B 1CPRA 2XUBA 2VN2A 3BQYA 5F64A 3U3BA 3LFUA 2DPDA 2Z1DA 4EGZA 2UXNA 2FBIA 5E8GA 3S2HJ 4ZLDA 2O5RA 2A6HF 2YLGA 4DZJA 2M7AA 2P0WA 3SZGA 2P6TA 1G59A 5IY5C 5DD8A 2CW7A 2I8DA 2DB4A 3ZQYA 4DOZA 1UB9A 3AG4H 4RB2C 4E7KA 3L2RA 4BDYA 2MABA 3FK7A 4PFPA 5CYVA 5ICFA 3RQ4A 4PJ0C 4J01A 1RJ9A 2EIKC 4JKVA 3PSFA 1ZKGA 3DE8A 2H27A 4WK8F 3B29A 4V19K 2ZMEC 3JREA 3SDBA 3CUOA 1H0MA 1TFKB 2L7AA 3B0PA 1JGGA 4E7HA 1LUJB 4U87A 3F0CA 3TOBA 1N75A 2VBWA 1P6RA 4HX8A 2F5DA 1HKQA 3ZMDA 1GV2A 4FWVA 3KP3A 1W2WA 3ZMVA 1FIAA 3VYWA 3FMSA 2GAUA 1D0ZA 2CQ7A 4GYGA 1X1PA 2RNJA 2QM3A 1UFMA 2YU3A 4OD5A 1MGTA 1NTCA 4AVPA 5F27A 3GTPJ 1EH7A 3KEOA 4E18A 2Y48A 2BC5A 2EPMX 2O03A 2XASA 3F21A 5JLXA 3F6VA 1FTZA 2KSFA 3A11A 3K1MA 4EBKA 1MMSA 3VYUB 2IBDA 3ZQQA 3VEPA 3V7OA 2YKZA 2B0LA 2ZPAA 4RB3C 1Y39A 4CGZA 1W1WE 1VQ4I 4EJTA 5C4XJ 3HL2A 1PD0A 3NQOA 5CVJA 5L0DA 3K66A 2QUFA 2HKVA 4EJOA 3SFZA 3H3UA 3ZN0A 5K7HA 5E3MA 4J7YA 3U1DA 3BZ6A 4E7LA 3GTGJ 5DQZA 1CGNA 4L5EA 3CD6I 1S7EA 5EZHA 3IWFA 1X3UA 4A3FJ 1Y8RB 3FIWA 2ZD9A 4XPWA 5HNFA 3OS2A 4GDFA 1EA3A 1UHMA 3S14J 2GA1A 4E7ZA 4LLCA 1Y0UA 5BQHA 3ABMH 3WODF 5TJ5E 4F55A 1CF7A 2NS7A 3S3MA 2XM0A 3Q3SA 4WXDA 4CUGA 4IRUA 1LFUP 1USTA 1EV7A 3IKTA 3QQAA 4E70A 3RQGA 2M5WA 1EKEA 2QKMB 1V74B 4HFFB 3PMRA 1OJLA 1KU2A 2LK4A 2BZTA 1IN4A 3MBGA 3ASOC 3VF0A 3CP8A 2G3KA 2E36A 4CS8A 4A3BJ 2VB6A 2H94A 3BG3A 3LFKA 2MA3A 4I0AA 2QSFX 5C4JJ 4XLAA 2JA6J 4DVZA 2LFFA 4XQ1A 3CCSI 2QLZA 4G12A 5IYCJ 3PSIA 3WTUC 3HRUA 5B5EC 1IN8A 2K27A 4XSZF 1U9NA 3F72A 4KMUX 2X4HA 4HEAJ 1I1SA 2QZ8A 2BHZA 2R7TA 2Q9BA 2YR2A 2HMZA 3NKDA 1JMWA 5DCMB 1BR1A 2OBPA 4PR9A 2AHQA 2BGCA 3FF5A 4B44A 5B1AC 3VSLA 3OYLA 3BJOA 2VLAA 3Q0UA 3OYCA 3AGTA 4ZDPA 2YEVA 1HQCA 3V5XA 2E7WA 2V9PA 4I44A 1I27A 2EFNA 1SVOA 2NVUB 4JIOA 2Y69C 1ETQA 4ZH4F 1HLVA 3RIRA 1NZEA 4ABZA 3HOYJ 4ZYGA 1SD6A 2KRHA 1U89A 1U5TB 4AWXB 2JPCA 2CQKA 2KZGA 5JVTA 2IXPA 2PBEA 1JJ6C 1ITYA 4NNJA 3QODA 4E4HA 4C2TA 1QQIA 2R4GA 4G6QA 1E3PA 4DGWB 2VXDA 2HSBA 4HF1A 1MJBA 3ABLH 2A5YB 5AONA 4BXFA 3IKVA 4A0XA 5L0GA 3L00A 3AG4C 4IHVA 1N77A 1Q0GA 4CIPA 5F08A 3GF2A 2P1AA 2XLMA 1B8IA 3DU6A 2HQNA 3TO6A 2G7UA 4BJTA 2HTSA 4IHYA 1ZHWA 2PX3A 2IOQA 4IKFA 4AE4B 1KONA 1B72B 3KYDB 2NRAC 3GTOJ 2XL8A 4JK1X 4M3DA 1Z21A 1RKEB 1T39A 2XXAB 3TBIA 2OKUA 4CYDA 4MVZA 2DJIA 2CGPA 3POVA 5LGTA 4DRJB 4DRIB 1HF0A 3KLOA 4LJZF 2AVKA 3FHNA 2Q3TA 3BT9A 1FOKA 1MBKA 4F93B 2NPUA 1OW7A 3F6OA 5CVUA 3U9JA 3OR2C 2P7VB 4U5BE 2L02A 4A3KJ 4L0YB 3KMIA 4WJ0A 4PFOA 3H9GA 3LL7A 1NG7A 2W1OA 3WTZA 2LSOA 2V3CC 3O3KA 1GUUA 4LD5A 3CQZJ 1Z6AA 5LFAA 5HS8A 3QPSA 2E1NA 3DU5A 1O4XA 3CZ6A 5E17F 2VOOA 2ICWG 1FR0A 1SD5A 3A4CA 1T0FC 1K83J 2LKXA 1F4KA 3QOPA 5E3OA 2YU9J 1NSGB 1HCRA 1PP8F 2X6XA 1FJLA 5EGYA 4CDGA 2ZXWH 4E6KG 4EJUA 4YIFA 1LDKB 4IAQA 3UGOA 4XL9A 3Q6MA 2L01A 3SFIA 4BHBA 5L3FA 1DOWA 2E2IJ 2FNAA 1FOWA 4M6YA 3HBLA 1MH4A 1FLIA 1NFOA 2LQGA 3DM5A 2IT0A 1R36A 4U5CE 2DBBA 2DPUA 4UUSB 3BG5A 4DXWA 4O7GA 2ESHA 4YWQA 4L9VA 1C0WA 2YQYA 1ZW2A 2M30A 1Q0DA 3ABMC 4FTHA 3BTLA 2ACJA 2RNGA 4WF2A 1ZYRF 1QLEC 2W25A 3PQJA 5FD5A 1VQLI 2OAZA 5IOZA 2LVSA 2GFHA 4C7OB 2CUEA 2EFWA 3CCUI 2IXOA 1S7AA 2JPUA 4UB6C 4OIPF 2MHRA 2YLIA 3H2VA 4MFDA 2R25A 3HTKC 3ML6A 1RZ4A 3F47A 2F6CA 2KGOA 3NEUA 4UY8I 4HE8D 2A6EF 3CCLI 1HA8A 2RVCA 2JUGA 3HSEA 3PM1A 3BCBA 3RYPA 3T6GB 1OMIA 4JZAA 1PUFA 4S0HB 3ZIBA 2BVLA 1OR2A 3BEHA 2B0JA 1VQ6I 4BEHB 4A5NA 3GEZA 1LDJA 3P7NA 4BU2A 2ZJPF 2MBFA 1F43A 1FFTC 3I0TA 4RMNA 2M8GX 3GYHX 3GVAA 3HUGA 3A02A 3T1BA 1MKMA 3LSHA 1JR8A 4CS9A 5TJJA 4ZTFA 3SP1A 3X1OA 2ID6A 2NYXA 2XL6A 4JX5A 3C3WA 3UMKA 5AIPA 3HLZA 3L1MA 3R6SA 1WQ2A 2O9XA 3LS1A 5HOOA 3GTQJ 1ZG5A 2CJJA 5J1UA 3E6BA 1BN5A 2DOFA 4YL0A 4IZZA 1K78A 2J9WA 3EG9A 3RKQA 3RYLA 4XIDA 2L7FP 3TOLA 1XDSA 3IP4B 4ZZLA 4JW1A 3B9QA 4KI2A 2CDQA 2XC7A 1XB4A 3GFLA 3Q7LA 1B68A 1B9NA 4HLXA 5K5OA 2OUMA 2CFOA 3A01B 4B3AA 2EIMH 3QPHA 4ZDLA 5J4VA 3ABLC 4I0BA 5LRRA 1MMAA 5LGNA 4A3EJ 2G3VA 5DS4A 3E3VA 3S1QJ 3V8LA 2BW3A 3FXJA 1OYYA 4AC0A 5JHUA 4EGYA 1ZGWA 3LESA 3BG7A 1OR3A 1STZA 3BTCA 3E5QA 4RLQA 2BY1A 2OZ6A 3JTHA 3OS1A 2CUJA 3NRVA 4G7HF 1JKPC 2R93J 2PFDA 4AYBA 2QLAA 4HV5A 4LOCA 4B3XA 2QUPA 1TNTA 2EV0A 1E17A 2KYHA 1R4NB 3M8FA 2XV4S 3OY9A 3OYFA 2QNLA 4M9SA 1LB2A 2PMZN 3H2UA 2NS8A 3SDGA 5F28E 2EIJH 2VJ4A 4EM0B 4ONSA 4IB4A 3HG9A 1NG6A 2VKEA 5HNHA 2AS5F 1UFBA 2Y0SA 2FAPB 2MLKA 4YT5A 1FP2A 4ZYHA 2EBIA 1Y1WJ 3N2ZB 3EUHA 3HNLA 4UVCA 3R2PA 2STWA 2FBHA 3N0TA 2XAFA 4DW6A 1YRNB 1J75A 2M0MA 1OYWA 3BR6A 1P4AA 5FROA 1VQNI 5FKLA 1YARO 2XM4A 2H7OA 1LFBA 2GM4A 3JZ0A 3K4NA 2K3PA 2QQAA 4CYCB 2CNWD 2CYYA 3AG2H 3EGXB 3W3CA 2BVMA 3QOEA 4MTOA 2AXLA 4XWJA 3PUBA 2YHSA 1SAXA 3R7CA 4XRMA 3CAXA 4IHXA 4B6IA 1O3RA 1O3UA 2GIVA 3O6BB 1L3LA 1IJWC 4BPMA 2DA7A 2KDZA 3I54A 4JX4A 2CQQA 2FNPA 2ZXWC 4PK4A 2R7UA 3ZMSA 1LPEA 1H6GA 3TEDA 3V5YA 2Y2ZA 4U0VA 1N1CA 1BJZA 2WADA 2R7QA 2VCBA 5FZTA 2XB0X 4MNUA 4BQNA 1YS6A 3W6VA 4CSWA 3CCEI 2YRFA 1UHWA 4I76A 2NVYJ 3H65A 3SEOA 4Q47A 1O57A 3VM6A 1S72I 2ZJ2A 1K61A 4PUSA 2EFOA 2F5FA 3K70C 1CGOA 4J32B 1MBFA 4JC7A 4W1UA 3W2AA 3K1IC 2CQXA 2LBFB 4Y7NJ 1BW5A 1ZLJA 3IEEA 2DA4A 3NYMA 2MH2A 1J9IA 1GXPA 3FXHA 1DPUA 1I39A 2K9NA 3GO5A 3O55A 1X4PA 3ZN1A 2VONA 3KZZA 2DTRA 2A0UA 1Z63A 3F8CA 1XGMA 5H6QA 1OCCH 2ETHA 5L3CA 4JVSA 5E18F 5HVQC 1M2VB 4BKXA 1ERDA 2LKPA 2OD5A 3QYBA 3J7YJ 2H7VC 1UJ8A 1M1EB 3G2BA 1Y6IA 3GM3A 4HNVA 2OJQA 1RR7A 4OMYA 4MEYF 3H3VK 2RQQA 3IRQA 1X19A 3S1RJ 2E1CA 4G7ZF 1IN5A 1IRGA 1E3OC 4IARA 3UKGA 2TMVP 4BH9A 5HSWA 5DS6A 3Q7GA 1AKHB 3WU2C 4RAYA 1O5HA 1P9QC 5FKKA 5KYUA 1JJ8C 3U2MA 3IQCA 2LP0A 1J09A 1K4SA 2IGKA 4CS8C 4CJOA 4CX9A 3NDBB 1SD7A 4BAYA 1Z3XA 3RPUA 2HPIA 4KUMA 2QY9A 1XSXA 1J8YF 2VCAA 1Z91A 2ZXJA 1E2XA 1FP1D 1SFXA 2HEOA 4QWQA 4RAFA 2YX4A 1D5YA 1VTNC 1T6UA 5A6JA 2ETSA 4CCKA 3FX3A 3JRIA 3KYLA 3UMIA 4PACA 3PFYA 3LEOA 3DTKA 3C8GB 5KYYA 1WVRA 3GANA 5BNGA 1GLNA 3H36A 3JRHA 1REPC 3E7LA 4L5JA 2DT7B 2VKHA 1VFCA 3PO2J 2G62A 1SFKA 3HOVJ 3MQ0A 2K4JA 2ELKA 2VE8A 3NARA 4HNUA 2HVRA 5L3DA 1UG7A 2F48A 3GX4X 2EIMC 4RDAA 5J1YA 3NKEA 1HXDA 4BDZA 2EZKA 2VASA 3NWSA 1QO0D 2KFDA 2L3DA 2DODA 4DJ9A 3CMEI 1ZHFA 2WZFA 5IT9K 2BY0A 2BXZA 2ZXHA 1T08B 2WB1A 1BC7C 1IV8A 3K1PA 3WTSC 3NMJA 3TK0A 1RESA 4HBLA 1VMAA 2W00A 2XGEA 1KQ9A 2YZSA 3US6A 5FCLA 3PO3J 4BHCA 3OS0A 3M4CA 1I1GA 4BY7J 4MTDA 1LS4A 2X85A 5JT4A 1A31A 3B73A 4MW8A 1IXCA 2VT2A 2FF4A 1FWZA 1J5YA 2DMUA 2K4BA 3HOWJ 2KNHA 4BUPA 1T6QA 2KJGA 2XRLA 2O8XA 4XLFA 2JJ7A 2EIJC 4EKWA 1OLTA 4GYTA 4ENJA 3S2DJ 4IHWA 5CJ9A 2Z5UA 4HFKB 1VYIA 2E34A 5LEKA 4RGSA 3TW7A 2QF7A 1BI0A 2XB5A 1IW7F 2E71A 4LG0B 3OA1A 3WHNA 2IS6A 5KYWB 4NHJA 2ECBA 1T01A 1ST6A 4BNCA 1MDMB 3U2LA 4MO7A 1T5OA 2LSEA 2PBIA 1PJRA 3AG2C 3A03A 1I5NA 1TWAA 4AK9A 1QPMA 1IV6A 4OD4A 2LMDA 4YT8A 2G9WA 6PAXA 1HMOA 4HX7A 3C7JA 5C3EJ 5D5UB 1R1UA 3K0LA 3JAMZ 3X2QH 3F23A 1X2NA 3KETA 3WGIA 1T6IA 4ZYAA 1ZK8A 1OISA 4HZFA 4A5MA 4XN0A 4QLCU 1YITI 1P4WA 2A69F 2M4GA 4G6DA 4JYKA 3CDIA 3N24A 3DAFA 2WY8Q 3GUDA 1ZGJA 1F36A 3OYDA 2YWAA 2EILH 4YT4A 1TQIA 2KLOA 5BS6A 4MVUA 3S1MJ 2E35A 2CCYA 1RKCA 4QPQA 2HI3A 3DPUA 3HIFA 5DV5A 1IDYA 2F5CA 2H6CA 3EPZA 3N4MA 5BMZA 1RC9A 5HDKA 3DCFA 3BZKA 4KNWA 4XR6A 2RV8A 3RPUD 2W7NA 2V6EA 4OAZA 3ELKA 3E70C 2Z3YA 4JRZA 3CEXA 2HQAA 2JRTA 3RW0A 3QPLA 3TOAA 5HS7A 4WWCA 2L2OA 2WVOA 4IPAA 5DUKA 4BHPA 2GQQA 2F4OB 5FFXA 1D0YA 2FOKA 3H9JA 3QWLA 1P7IA 2FEZA 1M6TA 3M4BA 5D4SA 2K9SA 2DFHA 3LQRA 1AOYA 2HKOA 1JUMA 3ZG1A 3MCZA 3L0IA 3NYJA 2XDVA 2A0BA 1W5CC 4Y15A 3I56I 3SXKA 2PP4A 3K4CA 3I4MJ 1OFCX 1UG0A 2QE9A 1WGWA 2XLWA 3CSKA 1F1ZA 4F52A 5F5FA 2XAGA 1G5ZA 1IF1A 2CRGA 3B71A 3F3XA 3U0CA 3ZQIA 3FBIB 2L9RA 4C2MJ 2L7ZA 3JRDA 1LE8A 4A69C 3CF5F 4HLYA 1JTYA 5FLVA 1U6HA 3RZOJ 5B3IA 2ZO4A 1Q1VA 3EFOB 2FU4A 1WHUA 2KHMA 3TULA 3M3YJ 1LEAA 4LFUA 4A3LJ 4MVQA 2Y31A 4F3QA 2M34A 1ZHXA 2BY2A 3I4NJ 2LKSA 4A0YA 2X6OA 1K79A 1BR4A 2XF7A 5F0HA 1J8MF 4UNOA 2PX0A 1LI7A 4CS9C 4JTAB 1YTYA 1D1AA 3K2ZA 4P1WA 2YVKA 3PCVA 2NOGA 4ANJA 2CFXA 3HYIA 4ZZDA 1TW2A 1OKRA 5E20A 1QVTA 1VZ0A 1MSEC 2HZTA 2DFEA 4KNYA 4NB5A 1BI2A 5BOXA 1DP7P 1BR2A 1Q0FA 1R71A 1H9GA 2R7OA 2VIXA 4BXUA 1LPQA 1BL0A 1UELB 3ZQHA 1X1DA 4GYIA 4RGXA 1MSFC 3CQZA 1A41A 1XMXA 2OF7A 3IPMO 4JEBA 3FOOA 3M8EA 4OU0A 2HSQA 1ZHTA 1WJEA 2X6YA 2XVCA 1HW2A 1FEXA 2IXNA 1FOYA 3FM3A 4L18B 5EEAA 2Y9YA 2L0KA 4XRFA 5KCMA 3CO7C 1T9KA 4LGWA 3QMKA 2R5ZB 2EK5A 1MMNA 5DQTA 2DA5A 2HVQA 2VQCA 2K5CA 4ZDOA 4NCQA 2JA5J 2RGVA 4A6DA 4GXOA 1RKWA 3FAPB 5A6KA 1JHFA 3D5SC 1G3SA 4Z9JA 3L2WA 4FAPB 1YOVB 4CBEA 4ZLCA 3WG7H 2L7MP 3RIPA 1USSA 2YUSA 1ACIA 2DN0A 3JRTA 1ETKA 4UUVA 2D1HA 5F1RA 3X2QC 1OQYA 2HTJA 2E1MC 5GAGJ 1C17M 2LYCA 1VB5A 3OSGA 2P61A 2XLEA 2A3SA 4BY1J 2FQ4A 5IT9Z 3L1PA 2Z16A 1XSVA 1IXRC 5F04A 4NTBA 2DI3A 4ITVA 2J9BA 3GFMA 5IT3A 4DQ2A 1XZQA 4D7MA 2XLDA 2EILC 1X1BA 2CW0F 5JI6A 2WAQA 5LD2C 1I3QJ 3DMDA 1WASA 1Z7LA 2KT0A 3CUQA 4IWBA 1WI9A 2K9LA 4CSAA 2L9SA 1A7DA 1O7FA 1Z77A 4HYEA 1WSUA 1G4US 1XWJA 2MWQA 3GEHA 1RNLA 3UNGC 4CH7A 2MGQA 3B6CA 3DM9B 1P2FA 3ERED 4P9UA 4BE0A 2Q9CA 1HW5A 1ON2A 2Q8KA 3GTLJ 1FPQA 5COMA 3TW6A 1HDPA 3UR3C 5FJ8J 1NH3A 1HW1A 3KEYA 2Q9AA 4EWCA 2NUTB 2EPKX 3CDLA 1FSHA 2V9VA 4NQWB 2XF5A 1WJ5A 2BE5F 3K7AJ 4YL3A 5EF6A 3SJMA 2XKOA 3LLKA 2P6SA 3OOPA 4DNCA 1LKXA 4IOAF 3W8HA 1KU9A 3FXMA 4LG3A 3H92A 1YW7A 4A93J 2LRDA 1BZ4A 3K6GA 2ZKZA 1RJ9B 1ORKA 1J0RA 1K05A 3ATPA 1U8RA 2CV0A 2J7PD 2LD6A 1G8XA 5BQIA 3IUOA 1YAUO 1YE9A 2CWEA 3GFJA 1Y56A 3FDYA 4UUTA 3HRSA 4C3HJ 1FFHA 3GCMA 2I5UA 2VPRA 2K02A 4I01A 5D92A 5DLJA 5E8IA 2DMNA 2LY1A 3KP6A 3DI5A 5F0FA 4BBRJ 1YJNI 3G4ZA 4LDQA 4XK4A 2R3SA 1I50J 4KYWA 1TL8A 4O79A 4MTEA 3RPQA 1TWAJ 4AM3A 1XGNA 1YX3A 3WU1B 3LSMA 5D6FA 4CO8A 4O3MA 2HUJA 2NUPB 4K7BA 4MIMA 3ZMUA 3W4YA 3DKWA 2R7DA 1JAFA 3FHDA 3IAS2 1FBUA 2OZUA 4Q7CA 3HSFA 3GTMJ 9ANTA 4M73A 2COBA 4ULVA 1E84A 4D9JA 4YELA 3OYKA 4IL6C 5DCMA 3K9TA 4B43A 5J8FA 1N78A 2KJCA 1FC3A 2L6GA 1G3TA 1JT0A 4MVOA 1EH6A 2NSGA 2PNOA 3BROA 2X9DA 3LSTA 2ZJQF 3IH3A 1SYQA 1V4RA 3V7RA 4V2FA 1ZR2A 4D7NA 3SXMA 2ME6A 2HOTA 1S3JA 1T98A 3J81Z 3HOUJ 2D4UA 3H5NA 3G3ZA 3CMYA 3GEEA 3ULQB 5C44J 4JBAA 3O8HA 1YYXA 3BJ6A 2J9UA 4LERA 3GZNB 4OIQF 1WJBA 4LACB 5HLIA 2EJRA 1RETA 3OMYA 5IP9J 1U5TA 1IC8A 4B4CA 1TFOB 1I3AA 2EA2A 1Z5ZA 2K9MA 1UZCA 2MH9A 2ZSHB 3GXOA 1K6YA 4LK1F 1IAWA 1CF7B 1U2WA 2ID3A 2JVHA 3QVYA 3ONQA 4NC8A 2IEKA 4V2GA 5F1JA 3WG7C 4FISA 2ECCA 4PDKA 3ABUA 3ESWB 5EHHA 3MKZA 4CCLA 5EYRA 1T95A 3JCUQ 1P7JA 2K3FA 4HDUA 1OCTC 4AYBN 1BOAA 3Q6NA 1FZPB 2E5ZA 4DBRA 2WWYA 4AE4A 5GAHJ 4C2UA 5JS5A 3CTAA 1B72A 1JKRC 5DM7F 3CCVI 4KITB 2IBFA 4H54A 4P9TA 3FK6A 1R5ID 3ZWIA 3H9QA 3Q0VA 5EGOA 1RKEA 2Y0SN 1G6NA 4IVNA 3AAFA 1VK5A 2XXAA 2L81A 3E6DA 1ZHYA 1V55H 3KP4A 3W2VA 4B09A 4C3DA 1AVOB 1OYIA 3L8JA 4I99C 2ZNZA 1P4XA 4PJMA 4ZTJA 2B63J 1EKYA 1R1TA 1RPWA 4J19A 2ZNYA 5BPDA 3DTIA 4DYRA 2W9YA 3SNHA 2P7VA 3CESA 4E0HA 3ZTMA 5F0CA 3I4PA 1WWXA 3IC7A 4B48A 3RI4A 1JE8A 1XS9A 4QDLA 4AIDA 3BCAA 1TZLA 2VC0A 5GADJ 4NC3A 4QPOA 3C63A 2GXBA 4I98B 2FRHA 3IWZA 1TR2A 3D5RC 3MKLA 3BQZA 4PGGA 2Z9OA 4CA0A 1ODDA 3BWGA 4MQVA 5D8KB 4NY3A 5DYMA 5DDGA 1RUOA 5CPRB 4N9HA 1IZ1A 4XKCA 2PJPA 1VQMI 1WN0A 2XL4A 3QZCA 2IGMA 2V1UA 2O8KA 1FAPB 4KJZA 1JKOC 2CUZA 5ICEA 1DU0A 2KW3C 3ZQLA 1R4TA 2WVNA 2M4EA 3MX3A 4MVRA 3U2RA 2ISZA 4UUSA 2ESNA 1F9NA 3KKBA 4MTFA 3F8NA 1NBBA 3FBNB 1T56A 1SC7A 5D4RA 2M9HA 3EUKL 3TOMA 2F5EA 4Z2YA 2DK5A 2K85A 3QVZA 4U9DA 1B59A 1S05A 4K2EA 1S29A 3FXUA 3PDMP 5IYBJ 1IO2A 1YLFA 3T5XA 4C7OA 2P5KA 5KAIC 5ED4A 3EHNA 2XGXA 1FX7A 2XROA 4AL0A 1G3WA 3O39A 3E97A 2OCEA 5DD4A 3JT1A 1YG2A 5LEJA 5L3GA 4D5CA 3QU6A 2X51A 1BIBA 1NFNA 2D45A 2O9LA 4KICA 3EQLF 5E1XA 1HDDC 3L2QA 1JI8A 1CGME 4A6EA 3P9CA 4M9XA 4BEHA 4ESJA 4FE7A 2ZXPA 1VQ9I 4PJLA 1XPXA 1VQ5I 4MGRA 3NG1A 1Y6DA 5HODA 4AL1A 1WFXA 3JSZA 3LNMB 5GPAA 1Y4CA 2VBYA 5B1BH 1C02A 3EH1A 1EH8A 4XNFA 2VCCA 3CMMA 1XCBA 2JK3A 1HE9A 2VKDA 1OKKA 5L3VA 2R05A 4BJ5A 5HV9A 2PFBA 2HOEA 1V4AA 3CC7I 3QP5A 3CJQB 1GS9A 2NNYA 1MQVA 2DQRA 3FWEA 1OR7C 4XMYA 3V7SA 1ZU5A 4D1QA 3A01A 1MJAA 4XEFA 3JRCA 3TQOA 2WB1N 4AUXA 4LK0F 4D5FA 4II2A 2OG2A 1X1AA 1TKNA 3QYFA 1GVJA 2OA4A 1TBXA 1SAUA 3HOTA 3AQCA 1MBHA 3L09A 1IZMA 2WAFA 3F8FA 2BOLA 3ZQFA 1ZRCA 4BXXJ 3O6XA 3L9FA 3D5LA 1WRJA 3FXOA 3WAQA 3B0UX 3VYSB 3K4BA 3CO6C 4JTCB 1XDUA 2FMYA 3L2CA 5H6RA 4E7JA 2AWCA 3KPHA 1L0OC 2HDCA 1APCA 3AFHA 3DAGA 3ZDLA 1LVKA 3OYGA 4IQJA 3K10A 3JAMK 2PJRA 2MC3A 2R7VA 1R9TJ 2WL8A 2Y3DA 3JYYA 2LF7A 3DBLB 4XLHA 3ZSUA 3JYHA 1BW6A 2UV1A 1LE2A 2QSGX 4I7HA 1V55C 3DWWA 1TWHJ 2WTEA 5L0CA 4QIWN 1VF9A 3IRRA 4CCNA 2DFIA 1APLC 1PCXA 4RS8A 3HNJA 2GA2A 4FX5A 3V5ZA 1DDNA 1Z1DA 5H20A 1YRNA 3S17J 2ELJA 1SMYF 1D5VA 1A6QA 4HX4A 1V5FA 5K5RA 2NVTJ 5K7FA 1W0TA 4CYCA 3EGXA 4M71A 4O6YA 2J46A 4HF2A 2Z33A 3AG3H 3FISA 3LJBA 2CW8A 2VBXA 2L5QA 3FZVA 3HEFA 3HPGA 4KIFA 1K78B 2RD9A 3EG9B 5L0IA 2RQPA 2ZB9A 3GZ6A 1ZRFA 5DUIA 3CUQC 4L9JA 4MQ9F 3JRGA 1GQAA 4XPXA 4HOBA 4RA2A 4YK5A 4CSAC 2PI0A 2EPNA 1YJ9I 4BJ6A 1LEBA 2IYLD 3TD7A 1CGPA 2JMWA 1A7EA 3S84A 1RI7A 4EATA 3LQQA 1WOLA 3PFIA 1TLHB 1ZR4A 4AIKA 5IPAA 3HTSB 3AJMA 3JSPA 1D1BA 1MNDA 5A2QZ 4JQFA 2DQLA 2NXNB 3EJNA 4IX7A 2BW3B 2P81A 1ZELA 2P4WA 5EEGA 1X3WB 3DKXA 3MKYB 4U5GA 5J40A 3KP2A 3OIPA 2P7CB 2QVOA 5FO5A 4Y17A 1XSDA 1ULYA 2Q1ZB 1MH3A 1V5EA 5K5QA 2DDBA 1H7IA 4CIHA 2DYSH 4I09A 2LBFA 2QKLB 2C6YA 2DK8A 1W7PA 2XGCA 1HC8A 2OEXA 3RFYA 3HGGA 1POGA 5A69A 2QQBA 5M5WJ 4GFBA 2LY2A 5JHFA 1ZARA 3E6MA 4XLNF 4XEKA 4YL1A 3ZVRA 3QU3A 1IUYA 2E1MB 2UXXA 2NS0A 4L6RA 2VJ5A 3RQIA 3HHHA 2LIGA 1OKKD 1ETYA 4UB8C 4C3JJ 2G7HA 1M2VA 5FRMA 3ZP5A 5ERIA 5CI8A 5FKMA 2B0HA 2TCTA 3IHUA 1HY5A 1FOXA 2KISA 5L3QA 3M1CA 2KIUA 3R4KA 2X1EA 3DF8A 3VOEA 1WH7A 2IGOA 2XGDA 3M8JA 3MN2A 4N0BA 4PJJA 1ZH5A 4A3MJ 3KZIC 2P0NA 3TL4X 2VT3A 4ENKA 2ZMEB 1SANA 4JX6A 3M7GA 4XONA 2L4MA 2MC4A 3QPTA 2HZ8A 1M56C 3FKIJ 3ZTZA 1Y8QB 2KJBA 2QGUA 4OAYA 3WE2A 3DKAA 5CQGA 3ROUA 4KMFA 1EF4A 3JTGA 3HRMA 5B1BC 1OCOH 3ECSA 3TDUC 3WGGA 4B47A 1TC3C 2PG4A 4KDPA 3V4GA 1ZVZA 2MW8A 4XEVA 4Z9IA 1XGSA 3VYTB 4N6HA 5FKNA 3C8GA 4MVSA
chains in the Genus database with same CATH topology
2CNWA 3LSGA 5HNFA 3OS2A 3EZIA 3EFOB 1EA3A 2KHMA 3ZR8X 2AQEA 3CJRB 4E7ZA 4LLCA 3K4KA 4C9YA 4F3QA 1ZHXA 5B1AC 4LIVA 4DJAA 3WODF 4F55A 3S3MA 1BR4A 4ULWA 4CUGA 2XF7A 4IRUA 4LLEA 3RH3A 1J8MF 4U5DE 4BG0A 2W4MA 2PX0A 1MW7A 2C03A 2QKMB 4HFFB 4CS9C 3PMRA 1KU2A 3BLYA 4X0RA 3ASOC 3CP8A 2HZDA 2G3KA 1D1AA 4CS8A 4P1WA 3ZC4A 2VB6A 4ANJA 3HXLA 4W8KA 4XLAA 4DVZA 3RTRA 1VZ0A 3PSIA 1JPJA 1WJAA 4YT2A 4Y33A 2P6VA 1BR2A 4HEAJ 2R7OA 2VIXA 3LMMA 3U21A 5E2QA 1UELB 2R7SA 5DVWA 3RKOF 1X1DA 4XLEA 2R7TA 3OYHA 2Q9BA 3CQZA 3NKDA 5B3SC 1BR1A 4HSRA 3LSIA 4CS7A 3B0VC 3H0DA 1ZHTA 1WJEA 2X6YA 2XRHA 4B44A 3KL4A 5KYUB 4H4KC 4PSWA 4XOTA 2DT6A 2IXNA 3VSLA 3OYLA 2DOAA 3PL8A 2VLAA 3OYCA 1SF8A 5KCMA 3DXJF 3S8PA 4ZDPA 3S3OA 3QMKA 2CMPA 4IQ4A 2YEVA 3K33A 4EBBA 1MMNA 3OYEA 5DQTA 4CCJA 5CQEA 5F5HA 2HVQA 2VQCA 2K5CA 2VJIA 4ZDOA 4I44A 4FESA 4U5HA 3HUGB 2Y69C 1V5GA 3MD2A 4C30A 4MLOA 1NZEA 3AG3C 3DLAA 2KRHA 2WZLA 3D5SC 2DGJA 4U5FE 3L2VA 2IXPA 4G7OF 3L2WA 3EH2A 4RM2A 1OCZC 1WJDA 3POVA 3BG6A 3E1SA 4CBEA 4NNJA 1D0XA 3QODA 4P5OA 4E4HA 2R4GA 4HG2A 4C2TA 3ZRGA 1TT0A 3K4LA 4DGWB 2VXDA 3JRTA 3RIPA 1X1CA 2M3AA 3T4RA 3DPLC 4XQFA 2J45A 3X2QC 5KNLA 4QI2A 4BXFA 2E1MC 2CH0A 3DZAA 2LYCA 4LITA 4E7SA 3AG4C 1N77A 2Z16A 3S93A 3VDXA 2J9VA 4ITVA 2PX3A 3DU6A 4BJTA 2Q2EB 1PYVA 2WA0A 2PJRB 2L7KA 1ZHWA 2EILC 1X1BA 2IOQA 4IKFA 4AE4B 2CW0F 1KONA 2CGEA 4I1OB 2CV2A 2WAQA 2DYSC 5LD2C 1QZXA 3DMDA 1Z7LA 3I3LA 1WJCA 2HV6A 1Z21A 2K9LA 4IWBA 4RBNA 4CSAA 2L9SA 3TBIA 2XXAB 4X0GA 2HNHA 3VYRB 2KL4A 2MWQA 3UNGC 2DJIA 4CH7A 4Y3OA 3DM9B 2V9KA 2WB7A 1LFPA 1OCRC 4BE0A 2Q9CA 3FHNA 4II3A 4BACA 2Q3TA 4XORA 4PJNA 2OCCC 3UR3C 3LLIA 2X1DA 4BGDA 4F93B 1ZHZA 3IAM2 3K7DA 3OR2C 3KEYA 2Q9AA 4U5BE 4DBQA 2NUTB 4JCHA 4EWCA 3KMIA 2LH9A 4WJ0A 4PFOA 3H9GA 1BOBA 5KYNA 3LL7A 1NG7A 2W1OA 2WY7Q 4HSTA 4NQWB 2XF5A 4KC9A 1WJ5A 2BE5F 2JD3A 1M57C 2GOMA 2J0WA 2V3CC 1Z6AA 5LFAA 3T6JA 3LLKA 3DU5A 3CZ6A 1QHHD 2W45A 1LKXA 3DD7A 4XLCA 1OCCC 2VH3A 3W8HA 2XF6A 1T0FC 3A4CA 3H5RA 4LG3A 3GBGA 4HEA2 2X6XA 3FAJA 5EGYA 1W36C 3K4JA 2LRDA 3S28A 3K6GA 1RJ9B 4E6KG 2IS4A 1UAAA 1O87A 1LDKB 3UGOA 3MKWB 4XL9A 2FGYA 3Q6MA 3NWTA 4XKVA 3AQBA 2CV0A 2J7PD 1OCOC 1G8XA 3IUOA 1YE9A 3EFOA 2KQRA 1Y56A 3FDYA 2JSPA 1FFHA 4C3EA 3DM5A 3SZRA 4K0DA 3DPTA 5D92A 5DLJA 4U5CE 2LY1A 5FRNA 3FKJA 2KQ9A 4Q5SF 2IS2A 2L9NA 4O7GA 2HDWA 2LG4A 4YWQA 2DYRC 2E60A 2KP6A 3LNRA 4O79A 3ABMC 2JVGA 2F5VA 3N05A 1YX3A 2RNGA 4K7BA 3LSMA 2NUPB 1QLEC 4KISA 1ZYRF 4CCOA 2R7RA 4N4OB 4MNDA 3EZHA 2FUG2 4FASD 3OWTA 3T6BA 3FHDA 2EINC 4Q4ZF 3OYIA 3OYMA 2GFHA 3ZCOA 4C7OB 3HPHA 4OINF 2IXOA 3M1CB 3IAS2 3C2GA 4Q7CA 4OIPF 4HNTA 3KX2A 2E87A 4GEHA 3HTKC 4D9JA 4YELA 3OYKA 3F47A 3SYTA 4B43A 2F6CA 2MYSA 3C2HA 4XKBA 1N78A 2KGOA 2KMUA 3OOUA 4HE8D 2A6EF 4BE1A 1HA8A 2JUGA 4YRVA 1WJFA 3BCBA 2XAUA 4BE2A 3SEQA 4JZAA 2LREA 3SYNA 2JA2A 2BVLA 3H35A 4JOMA 1PD1A 4I3MA 3ZIBA 4IAOA 4YJWA 4RLFA 2B0JA 2VQLA 4BEHB 1MNEA 3H5NA 2R7XA 4BU2A 1FFTC 3J7AY 4RMNA 3K6BA 3AKZA 4R79A 2DCEA 3LSHA 4CS9A 4DIQA 4ZTFA 3SP1A 2J9UA 4LERA 3X1OA 5KYXB 3A2KA 1WJBA 2H7BA 4LACB 3NYLA 4OIQF 3UMKA 3OMYA 3HLZA 3S32A 3DJNB 3ASNC 5KYWA 2E5NA 3LS1A 2O9XA 2X6WA 5HOOA 2K9MA 1Z5ZA 1S7ZA 2R7WA 2MFZA 2ZSHB 1K6YA 3LSKA 4OWRB 4IZZA 2VL8A 2J9WA 3EG9A 2JVHA 1Z23A 3RYLA 3ONQA 4NC8A 4KI2A 3IP4B 4JW1A 3B9QA 4C3BA 2LC2A 2XC7A 2CDQA 3WG7C 3EHMA 3FVYA 3Q7LA 5KYYB 1FMVA 2ZFUA 5EHHA 2OUMA 2CFOA 3HKZA 4CCLA 3MKZA 1T95A 3JCUQ 2W4BA 2IXSA 4ZDLA 3ABLC 4Y4RA 1MMAA 2G3VA 5DS4A 3OL3A 3Q6NA 2E5ZA 4DBRA 2CV1A 2BW3A 3OIQA 4AE4A 2LOOA 4C2UA 3LESA 3BG7A 4KITB 3DTEA 3V42A 3H9QA 4RLQA 3OS1A 3EUAA 1VK5A 3EUHC 2XXAA 2CUJA 1NU7D 2L81A 2A68F 1ZHYA 4G7HF 2VJJA 4AYBA 3W2VA 2PFDA 4C3DA 1U0JA 4B3XA 2WAEA 4ZC3A 5BUOA 4PJMA 4ZTJA 3F46A 3OY9A 3OYFA 3PNVA 5E3CA 2KZVA 4ZJZA 3RCOA 2C04A 3H5AA 2VJ4A 2VQHA 3DTIA 3HG9A 1NG6A 2W9YA 5HNHA 2P7VA 3SNHA 2Y0SA 3CESA 3EGDB 4YT5A 2NUTA 1NG1A 4PSXA 4B48A 1R6RA 2Y3GA 3N2ZB 4F92B 4QDLA 2RREA 1TZLA 3BCAA 4QPOA 1FMWA 3N0TA 2Y39A 2M0MA 1LS1A 5FROA 3DQVC 1QHGA 3D5RC 2PMZA 2VPLA 1TR2A 2H7OA 2ZXOA 3K4NA 2K3PA 2CNWD 3EGXB 3LAYA 4XWJA 3E0JB 3W3CA 2BVMA 3QOEA 4KT6A 4CA0A 2J0XA 3PUBA 2YHSA 4J00A 3VWBA 4NY3A 4B6IA 5CPRB 2HVSA 2ZSIB 4XKCA 3TMOA 2OC6A 2XL4A 1DGRM 3QZCA 2IGMA 3I9V2 4XN3A 4F4BA 3S3NA 4KJZA 1MMDA 4XM3A 2CUZA 4P6IC 3K4MA 2ZXWC 4PK4A 2VQGA 2KW3C 2R7UA 2NG1A 1N1CA 2WADA 2WVNA 2R7QA 1ZU4A 4LIUA 2M4EA 3MX3A 4BQNA 2KDOA 3OYAA 1VOMA 4CSWA 4KNVA 3H65A 5D91A 3KKBA 3SEOA 4XLPF 2ZXIA 4BQQA 3VAYA 3OYJA 4AVZA 3FBNB 3MMYB 4YEJA 2MD0A 4PUSA 2A5WA 3EUKL 3K70C 2FFHA 3MLGA 4J32B 3W2AA 2NUPA 3K1IC 2HU9A 3I5PA 1DQUA 2DXIA 4BJ1A 2V26A 3PJRA 2LBFB 1FTSA 1TWHA 3ZGKA 4HRIA 3IEEA 3NYMA 2KPMA 3AG1C 2A6TA 4C7OA 3EHNA 2M7BA 2F4IA 3W2WA 4E7IA 1X4PA 1V54C 2XSJC 3O39A 2V1NA 1Z63A 3EPVA 3OEOA 3JT1A 3KH2A 2IXMA 4JJGA 1Z3IX 2GOXB 2IGNA 4JVSA 3BC8A 5HVQC 2D5RB 4G6TB 1M2VB 2X51A 1ERDA 4BQOA 3QYBA 2WBMA 2XSEA 3OYBA 4BL0B 2H7VC 4YN0B 4N06A 3G2BA 1JI8A 1TWCA 3L2QA 3EQLF 5T1DB 1Y6IA 4BEHA 4M63A 4RM3A 3A1YA 4AU7A 2RQQA 4BJ5C 1X19A 2KRCA 2Y3BA 2HV7A 2ZXPA 4PJLA 5E3AA 4DVYP 3RSNA 2VXZA 3I4UA 3NG1A 4G7ZF 4AX2A 1WFXA 3JSZA 5DS6A 3Q7GA 5HSWA 1O5HA 1P9QC 5KYUA 3EH1A 4KBLA 3AL0B 5DS5A 3LEVA 4XNFA 1J09A 3F9KA 2IGKA 5KHDA 4CS8C 3NDBB 3CMMA 1TWGA 1Z3XA 2HPIA 2QY9A 4IJJA 1J8YF 3L2UA 2VKDA 4NC7A 1OKKA 3S0XA 4CCMA 5L3VA 4BJ5A 1AA7A 4CZCA 3S27A 2W4SA 4CCKA 3KYLA 3UMIA 3PFYA 3CJQB 3DTKA 2UWMA 5KYYA 1OR7C 4XMYA 1ZU5A 3ZXSA 2I8BA 4D1QA 2L9JA 3GANA 1GLNA 3DWLE 2NOJB 2OG2A 4II2A 2DT7B 1X1AA 1MMGA 2VKHA 1TKNA 1SFKA 2A1DD 3QYFA 4HPQA 2G62A 3AQCA 1SAUA 3HOTA 4HNUA 2HVRA 1IZMA 2WAFA 4F91B 2BOLA 2EIMC 3O6XA 4RDAA 2J7PA 3D5LA 3B0UX 3NKEA 4BDZA 3VYSB 2VASA 3K4BA 1X4OA 3NWSA 4I1MA 3LS0A 5TGTA 4N4NB 4E7JA 2WZFA 1IRXA 4XKWA 5T3TA 3AFHA 2ZXHA 3DAGA 1LVKA 2WB1A 3OYGA 3K10A 4IQJA 3HC7A 4U7BA 3I5QA 1JPNA 2X1CA 4RD9A 2PJRA 2R7VA 2W00A 1VMAA 2WL8A 2Y3DA 2YZSA 4BEJA 5FCLA 4XLHA 3OS0A 4XTKA 3JYHA 3ZSUA 2HPMA 2UV1A 2X85A 3ABKC 1V55C 3ITFA 1DP3A 3E9VA 3EGDA 1PCXA 4CCNA 2KNHA 4BUPA 4ZLCA 2KJGA 2Z2SB 2WVQA 1DGWY 4GRIA 4XLFA 5CI9A 2M4KA 2EIJC 3OR1C 4FX5A 3SEZA 4OIOF 1OLTA 2IS1A 3PNYA 4GYTA 3PNTA 3CP2A 1Z3YA 4BJ6C 2ELJA 4FETA 1SMYF 3W8IA 2QTVA 1V5FA 4HFKB 4NUBA 1VYIA 4QI0A 3PHF2 3EGXA 3UGPA 3DJUB 1E0EA 1IW7F 1YX5A 2V7FA 3OA1A 4O6YA 2IS6A 5KYWB 2J46A 1ST6A 3LJBA 1SZIA 2CW8A 2L5QA 3LFUA 4BS9A 2LSEA 3HPGA 3EG9B 2PF4E 2Z1DA 1PJRA 2UUZA 3AG2C 1TWAA 4AK9A 4MQ9F 3GODA 1W36D 4OD4A 4ZLDA 4YT8A 4CSAC 2O5RA 2A6HF 4BJ6A 2IYLD 3TD7A 2M7AA 2P0WA 3SZGA 1G59A 2AQFA 4EATA 3NRHA 5IY5C 3UMHA 2CW7A 2I8DA 4ZYAA 3K70D 1D1BA 1MNDA 4XN0A 4DOZA 4JQFA 4E7KA 3EJNA 3L2RA 4BDYA 4IX7A 2MABA 4PFPA 2BW3B 4XOPA 3RQ4A 1ZELA 4J01A 1RJ9A 2A69F 3L34A 4JURI 2M4GA 2EIKC 5HLTA 3PSFA 3DAFA 2WY8Q 3DKXA 3MKYB 3OYDA 4U5GA 4A2NB 3OYNA 3OIPA 4YT4A 5T3WA 3SDBA 2Q1ZB 1V5EA 4J30B 4CIHA 2KLOA 3VSKA 1QU3A 3B0PA 2LBFA 4QPQA 2QKLB 4E7HA 3CF2A 3DPUA 4JJFA 4U87A 2CS3A 3DEEA 3RFYA 3EPZA 3HOSA 1N75A 3DKYA 4O6MA 4KNWA 2LY2A 5JHFA 3HJCA 4XR6A 4XLNF 3ZVRA 4O6NA 3RPUD 4FWVA 1M2OA 2W7NA 2V6EA 2E1MB 4OAZA 1VYKA 1W2WA 3E70C 3VYWA 2VJ5A 2HQAA 1OKKD 1D0ZA 5CKTA 3FDQA 4OIRF 1M2VA 5FRMA 3AL0C 5CI8A 2L2OA 2ZXRA 2WVOA 4OD5A 5L3QA 1D0YA 3M1CA 3N24A 2OV7A 3H9JA 2X1EA 2IGOA 3OL4A 5E33A 3M8JA 3VYUB 4PJJA 3ZQQA 3TL4X 2W82A 3K1HA 3V7OA 2V4JC 2ZPAA 3ZG1A 3L0IA 4XONA 2Y3HA 2MC4A 3HL2A 3NYJA 2XDVA 1PD0A 1M56C 2PP4A 3K4CA 4OAYA 2WZGA 4U5EE 1UG0A 5CQGA 1WGWA 3CSKA 3K66A 4F52A 4G0HA 5F5FA 5B1BC 3ECSA 1D1CA 4B47A 1NU9C 4E7LA 5DQZA 3FBIB 2Z15A 1S9HA 3S29A 3VYTB 5KYXA 3QYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  3OWT A;  4BJ6 C;  4BJ5 C;  4BJT A;  3CZ6 A; 
#chains in the Genus database with same CATH topology
 1R4M B;  3J80 Z;  5FD6 A;  3E5X A;  5IP6 A;  4PZJ A;  3ZR8 X;  3TJ6 A;  3CJR B;  2DYR H;  1JRA A;  1BIA A;  2L4A A;  3ZQG A;  5GP9 A;  2DO7 A;  4C9Y A;  2NVQ J;  2DT5 A;  2OU2 A;  2XAH A;  2STT A;  3RH3 A;  1XMA A;  2W4M A;  1MW7 A;  5EJC A;  3R0J A;  3TO7 A;  2C03 A;  3QTH A;  5JRA A;  3VRC A;  2PLY A;  4X0R A;  2PMH A;  3PIO F;  2HZD A;  2LLK A;  1TQG A;  2IA2 A;  1TT5 B;  3FXL A;  2KIF A;  3ZC4 A;  2Z99 A;  3HXL A;  4W8K A;  3C18 A;  3U9M A;  3HRT A;  3RTR A;  4N4W A;  4M9Z A;  1JPJ A;  1AHD P;  4EHP A;  3WG9 A;  4YT2 A;  1R22 A;  2P6V A;  1JOG A;  256B A;  3U21 A;  2L6H A;  5CVI A;  5DVW A;  2R7S A;  1TWF J;  3B0V C;  3H0D A;  5CVV A;  2XRH A;  4XPY A;  2M64 A;  3KL4 A;  5KYU B;  4H4K C;  4XOT A;  3BG9 A;  1MBE A;  2DOA A;  3PL8 A;  1SF8 A;  2BBY A;  4LG0 A;  1XG1 A;  1S5L C;  4N6C A;  5D5V B;  5ILS A;  5J47 A;  3KYI A;  3Q9S A;  2KK1 A;  4EBB A;  1YW8 A;  5AC4 A;  1VQO I;  2M0C A;  1MDM A;  2DMT A;  4CCJ A;  3CJN A;  3KFW X;  5F5H A;  2O7O A;  4FES A;  4U5H A;  1W7P D;  1B4A A;  2HYG D;  2M8E A;  3ASN H;  1V5G A;  4C30 A;  3I59 A;  4MLO A;  1OCP A;  3AG3 C;  2ASR A;  3GW2 A;  2DGJ A;  1A04 A;  3L2V A;  3EH2 A;  4RM2 A;  2Q0O A;  3VOD A;  3E1S A;  5LHI A;  4LDK A;  1D0X A;  4P5O A;  4RBO A;  2EWN A;  5LGU A;  2HJ3 A;  3T4R A;  5FLX Z;  2DU9 A;  1X1C A;  4UV9 A;  3DPL C;  1G2H A;  2N8G A;  2WAQ N;  2R7F A;  4LIT A;  4E7S A;  5H2F C;  3S93 A;  2HGC A;  2R5Y B;  2J9V A;  1B1B A;  2YL0 A;  4RB0 A;  4LLG F;  5L3E A;  2Q2E B;  2WA0 A;  2WV0 A;  3S16 J;  5GTH C;  4MS2 A;  4HW0 A;  2E19 A;  4I1O B;  2Q7R A;  2DYS C;  2D5V A;  1QZX A;  1EQ1 A;  2JUC A;  3BJA A;  1WJC A;  2HV6 A;  4DYQ A;  3T9O A;  4UXN A;  3U9G A;  4Q48 A;  4X0G A;  3ECO A;  2GWW A;  1Z67 A;  2DA3 A;  3JRF A;  3H3Z A;  1LFP A;  3WHC A;  4F7Z A;  1FIP A;  4KFC A;  1ZZP A;  3BR5 A;  2X1D A;  3RYR A;  3T0Y A;  1ZHZ A;  3IAM 2;  4WGZ A;  5FLM J;  2LH9 A;  5E1W A;  5TIS C;  1F5T A;  2EV6 A;  1BOB A;  1T38 A;  1LJ9 A;  4HST A;  4UVA A;  4JE9 A;  1ZAO A;  4P9F A;  1RR8 C;  3GM1 A;  1FNN A;  2J0W A;  3T6J A;  3Q9V A;  5E3N A;  2W45 A;  1QHH D;  3JRM O;  3CCR I;  4XLC A;  3U3F A;  2EIK H;  3CLO A;  1OCC C;  2XF6 A;  1KYZ A;  3AOU A;  1PVE A;  4O6J A;  1KZH A;  1LE4 A;  4HEA 2;  3FAJ A;  1JKQ C;  3BR2 A;  2B7E A;  1IXS B;  1O87 A;  1FYL A;  5EG0 B;  4G78 A;  3MKW B;  4BBS J;  2FGY A;  1J7K A;  5HLG A;  4KIG A;  2P5L C;  2FD5 A;  3AQB A;  1IRZ A;  1OCO C;  2R02 A;  1ON1 A;  3EFO A;  2KQR A;  5LLQ A;  2JSP A;  4QSH A;  3IH2 A;  1FY7 A;  1D8J A;  4HQE A;  1SFU A;  2JA8 J;  1K04 A;  3S90 A;  2DTZ A;  3KLN A;  2VI6 A;  3J81 K;  1KYW A;  2KQ9 A;  2L9N A;  4U0Y A;  1XMK A;  2DYR C;  2H6B A;  2B9S A;  3LNR A;  2DW4 A;  2JVG A;  3KYC B;  2F5V A;  3N05 A;  1EJ9 A;  4EUK B;  3AG1 H;  1L3P A;  4BQA A;  1U6G A;  1BDJ B;  1MD0 A;  1O3S A;  2R7Z J;  1GT0 C;  1WCM J;  1L7C A;  4MND A;  4N4O B;  1YJW I;  3EZH A;  4FAS D;  2M87 A;  3T6B A;  2HXO A;  2DA1 A;  4IO9 F;  4E17 A;  3ZCO A;  1Z0X A;  3RZD J;  4OIN F;  3C2G A;  3P5J A;  1OPC A;  2OQG A;  3I71 A;  2Y75 A;  2FQ3 A;  3LA3 A;  2V1D A;  3OV8 A;  3V8J A;  2LCH A;  2EQR A;  3GLX A;  1FT9 A;  2H09 A;  3SYT A;  1U0B B;  2MYS A;  4XKB A;  3C2H A;  2V6C A;  4M3E A;  2KMU A;  3OOU A;  3MVP A;  2R0Q C;  1SFE A;  1IGN A;  5ILU A;  1WJF A;  4BE2 A;  3SEQ A;  1ETX A;  3JW4 A;  2Y30 A;  1ZRE A;  2QBY B;  3S2W A;  3G6E I;  1PD1 A;  1HE1 A;  1ZN2 A;  2R5Z A;  4YJW A;  2VQL A;  1MNE A;  5M3M J;  2OQR A;  2LP4 A;  3S9O A;  1A5J A;  2R7X A;  1S6L A;  4WAB A;  3FOP A;  2F2E A;  3AKZ A;  4R79 A;  2DCE A;  3GWZ A;  4X1E A;  3RKX A;  3K2A A;  2XAJ A;  1W0U A;  2VOD A;  3A2K A;  2H7B A;  3NYL A;  2W57 A;  4I2O A;  1VI0 A;  3NAU A;  3DJN B;  3GEI A;  1R00 A;  3ASN C;  3MFK A;  4KN7 X;  1K7A A;  1YLM A;  2QCO A;  1R5H A;  2BYV E;  1S7Z A;  2Y9Z A;  3LSK A;  2YL3 A;  3M4O J;  2M45 A;  1E86 A;  2HS5 A;  4MFE A;  1B9M A;  1TW3 A;  2LC2 A;  2LD5 A;  3A0B C;  3U5S A;  4C3B A;  3EHM A;  3FVY A;  4D4X A;  3RF3 A;  2J5O A;  2ZFU A;  2LF8 A;  3HKZ A;  3N97 A;  4A0Z A;  1VND A;  2W4B A;  1PP7 U;  4Y4R A;  1YVI A;  3OL3 A;  1FBS A;  2NNN A;  2GLO A;  3TO9 A;  2LOO A;  2UUH A;  1W5T A;  2VKV A;  2XPU A;  5J6X A;  3BY6 A;  3DTE A;  2GZW A;  3HZJ A;  3V42 A;  1SFO J;  3Q0W A;  5IYD J;  1NHA A;  5EDN A;  3EUA A;  3EUH C;  1NU7 D;  3R61 A;  2PMU A;  2A68 F;  3ABK H;  1GV5 A;  1U0J A;  1YQA A;  2EFQ A;  1YZC A;  1KU7 A;  2RDP A;  4GQH A;  2C04 A;  4ZJZ A;  4G9Y A;  3H5A A;  2O3F A;  2GIZ A;  3DBR B;  3CDH A;  2YLD A;  2LDU A;  2QYO A;  2M2E A;  3EGD B;  3HB9 A;  2NUT A;  1OXK A;  1R6R A;  2Y3G A;  4NQW A;  1MBG A;  4XIC A;  3TJ5 A;  2A07 F;  4JCZ A;  1FMW A;  3IH4 A;  2Y39 A;  3KP7 A;  4L0Z B;  2ZFW A;  3IQT A;  3A0H C;  3ZQ7 A;  5D6E A;  3WTX C;  2ZXO A;  2VPL A;  3CC2 I;  4A2U A;  4ER9 A;  1PDN C;  1W4M A;  3E0J B;  4KT6 A;  2J0X A;  1QA6 A;  2IA1 A;  4J00 A;  1YDI A;  4RGR A;  2OOC A;  2PN6 A;  1RUN A;  4A3J J;  2HVS A;  1BI1 A;  1QZE A;  4LB5 A;  5CIV A;  1DGR M;  2AU5 A;  1KTM A;  3VFZ A;  1R5G A;  1RIO H;  3I9V 2;  4XN3 A;  2FX0 A;  3G4S I;  3S3N A;  4XM3 A;  1MMD A;  1QRY A;  4P6I C;  2HDD A;  2COM A;  2ME0 A;  2MLG A;  2K86 A;  4DRH B;  1J59 A;  2Y0M A;  5JLW A;  2O6G E;  3DP7 A;  4LIU A;  1ZU4 A;  3JTL O;  4IRI A;  2KDO A;  3GM2 A;  4YG2 F;  5L0F A;  1FYM A;  1Q1H A;  2ZXI A;  4BQQ A;  1LQ1 A;  3VAY A;  4AVZ A;  2J5P A;  5LHG A;  1QSP A;  4C3I J;  3MMY B;  4YEJ A;  2MD0 A;  3CUQ B;  2DMP A;  2H1K A;  2FFH A;  5DTD A;  3CCM I;  2NUP A;  1YS7 A;  1BJA A;  2FJ1 A;  3LA7 A;  3I5P A;  3I64 A;  1DQU A;  2DXI A;  3HOZ J;  2V26 A;  1FTS A;  1T6S A;  3BRJ A;  5D5X B;  3MEX A;  4RGU A;  3ZGK A;  4HRI A;  1TWH A;  3AG1 C;  3CMA I;  1FTT A;  4A3C J;  5J4Y A;  2F4I A;  2JT1 A;  4EJV A;  4IOC F;  2XSJ C;  1TQM A;  4M74 A;  4YFX F;  4MHG A;  2V1N A;  5FFZ A;  4EV0 A;  3EPV A;  1O3Q A;  3OEO A;  4WGY A;  1QGP A;  1JUS A;  5EZG A;  5CVR A;  2IXM A;  2FSW A;  4ENN A;  2GOX B;  3KH2 A;  3K1I A;  2D5R B;  4G6T B;  3G4X A;  3ZPL A;  1YIO A;  2WBM A;  4EQQ A;  2PQ8 A;  3BR3 A;  3OYB A;  2EPO A;  4YN0 B;  3P9K A;  5J8C A;  4N06 A;  1TWC A;  3H1C A;  3JR9 A;  3ISP A;  3REO A;  4M63 A;  2RC4 A;  4RM3 A;  4AU7 A;  5AIQ A;  2HV7 A;  2E2J J;  3RSN A;  3I4U A;  4U7D A;  4JEA A;  1ZTR A;  4M3F A;  1MJ9 A;  2R92 J;  3LWF A;  3KE2 A;  4KBL A;  3MZ8 A;  5AGF A;  2HOS A;  3WTV C;  4KN4 X;  4X6A J;  2L6F A;  2FE3 A;  1HSJ A;  4IJJ A;  3WGH A;  1DUX C;  1V3F A;  2QEX I;  4NC7 A;  1A6I A;  3S0X A;  2HWV A;  4IXA A;  2VE9 A;  1YA7 O;  4XRS A;  1AA7 A;  3TP3 A;  1H89 C;  4ZYE A;  3LSR A;  2EB7 A;  2FA5 A;  1BC8 C;  2UWM A;  2HYF A;  3SZP A;  1OW6 A;  3ZQC A;  1O3T A;  3C2B A;  3ZXS A;  2L9J A;  3DE9 A;  2EPL X;  1WZ2 A;  2H8A A;  2GXA A;  2JWT A;  5KVR A;  3GWN A;  1X3Z B;  2ISY A;  4RAZ A;  4YFK F;  3E5U A;  3FMR A;  4F91 B;  5ILV A;  3DV8 A;  3HHG A;  5GPG B;  2BY3 A;  4I1M A;  3LS0 A;  2IP2 A;  4N4N B;  5TGT A;  1HMD A;  3KYJ A;  4W8P A;  1IRX A;  4XKW A;  2XLH A;  1XX5 A;  5T3T A;  2P5V A;  3CCJ I;  1R23 A;  3HC7 A;  5L3B A;  4U7B A;  1JPN A;  2X1C A;  1J2X A;  1UG2 A;  3BR0 A;  2CYD A;  4BEJ A;  2IVM A;  1BI3 A;  5A2Q K;  3O8G A;  2HPM A;  5HDN A;  3HM5 A;  3ABK C;  3BZC A;  4FHT A;  5IP7 J;  1KU3 A;  3HNI A;  5B3S H;  1CQT A;  3SQN A;  3U8V A;  3G73 A;  2J8W A;  3E9V A;  1U8B A;  1GDT A;  2XS8 A;  3CC4 I;  2Z2S B;  2YL1 A;  5CI9 A;  5GAE J;  2M4K A;  3OR1 C;  4KT5 C;  1ZG3 A;  4CDY A;  3PNY A;  5TRD A;  3RKY A;  3U8P A;  2D2W A;  3CP2 A;  4FET A;  4UVB A;  4R32 A;  3WTT C;  4OOI A;  4QI0 A;  3LA2 A;  1YI2 I;  1E0E A;  3DJU B;  5KAF C;  2GXG A;  1SZI A;  1Z6T A;  3LAJ A;  2K9Q A;  4BS9 A;  1ENH A;  4OMZ A;  4TV7 A;  3LAP A;  5ICG A;  4FX4 A;  2UUZ A;  2HKX A;  2PF4 E;  1OCZ H;  3GOD A;  1W36 D;  1IN7 A;  1LNW A;  1IUF A;  1R58 A;  3MZY A;  5A6B A;  1QZY A;  2AQF A;  2HYJ A;  2RN7 A;  3NRH A;  3WU0 A;  1UMQ A;  2H8W A;  3K70 D;  3UMH A;  2HXI A;  4BEM J;  3RVZ A;  1TWG J;  4FT8 A;  3HOX J;  3R60 A;  1XGO A;  4XOP A;  4M6V A;  2XPW A;  3L34 A;  2OJE D;  3ZMZ A;  3EYY A;  1KA8 A;  4LLN A;  3K1N A;  1YW9 A;  3F22 A;  2JX0 A;  1ORY A;  5HLT A;  3EET A;  2MG4 A;  2DAO A;  5EGO B;  3GZ5 A;  1K6O A;  1I4Z A;  4A2N B;  3OYN A;  4MTG A;  1RXQ A;  5T3W A;  4J30 B;  3VSK A;  4A4A A;  1QU3 A;  1B8I B;  3CF2 A;  1B6A A;  4JJF A;  2CS3 A;  3DEE A;  2KC3 A;  4JP0 A;  1ORS C;  2NSF A;  1BBY A;  3HOS A;  4AIJ A;  3I53 A;  3DKY A;  2W85 A;  1DOV A;  4J7T A;  4L5I A;  4O6M A;  2E1O A;  1JUP A;  3HJC A;  4O6N A;  5CLS A;  1M2O A;  1RRJ A;  1VYK A;  1OCR H;  1IRF A;  1BBH A;  2IAI A;  3BPX A;  3J80 K;  5CKT A;  3FDQ A;  2OCC H;  4OIR F;  4IRG A;  1Z6R A;  3AL0 C;  5E1Z B;  2ZXR A;  2VC1 A;  3J06 A;  5D5W B;  1HST A;  3U1K A;  1WI3 A;  1AEP A;  3D0S A;  4HAM A;  3VB2 A;  2OV7 A;  4EM1 A;  1FBQ A;  3OL4 A;  4WX9 A;  5E33 A;  3RQE A;  5M3F J;  4Z9H A;  3E6C C;  1Z05 A;  2W82 A;  3K1H A;  4XRS G;  2V4J C;  3I55 I;  2FOW A;  2DDA A;  2IJL A;  3EDP A;  4WXC A;  1I4Y A;  4D0P A;  1VLS A;  2Y3H A;  1HKS A;  3A9C A;  4UHT A;  5E79 C;  2WZG A;  1XTA A;  4U5E E;  3J7Z I;  4G0H A;  5JSL A;  1K4T A;  1ZW3 A;  3C1D A;  3M1E A;  1D1C A;  2OPT A;  3M15 A;  3PQK A;  3M07 A;  1NU9 C;  2LY9 A;  2Z15 A;  1S9H A;  5L0J A;  1G4W R;  3S29 A;  4CIC A;  3JRB A;  3B02 A;  3QYE A;  1NLX A;  1OW8 A;  3LSG A;  3D1N I;  2CNW A;  4LLE A;  2DMQ A;  2DLL A;  4A12 A;  3EZI A;  3GWL A;  4IGG A;  1U9O A;  2H8R A;  2AQE A;  3OSF A;  1BA5 A;  1H88 C;  2A05 A;  1JGS A;  3K4K A;  3RJP A;  1UCR A;  4LIV A;  4DJA A;  2LFB A;  3RKW A;  1HKT A;  4ULW A;  4BG0 A;  3GME A;  2DJN A;  4U5D E;  5L0H A;  2EFP A;  4EJW A;  2QA4 I;  3JSO A;  3HNK A;  1QVX A;  2JQ7 A;  3TP0 A;  2EIN H;  1RKT A;  3BLY A;  3FMQ A;  4YII A;  4D4N A;  5M5Y J;  1WKM A;  2FBK A;  2HFH A;  2XHK A;  2IA0 A;  1QZZ A;  2Q4F A;  3MYI A;  2W24 A;  3FM5 A;  4IEJ A;  5FLX K;  5A6B D;  1WJA A;  4IRH A;  1IG7 A;  4Y33 A;  4EIY A;  4A3G J;  1QPI A;  3T8R A;  3L7W A;  3LMM A;  3RKO F;  5E2Q A;  2WV1 A;  3GTJ J;  4Y52 J;  2KRF A;  4XLE A;  3OYH A;  1K40 A;  5B3S C;  4IF4 A;  3QAH A;  3O10 A;  3OIO A;  4HSR A;  3LSI A;  4CS7 A;  5GPC A;  1OXB A;  3BTJ A;  2ZBK A;  4PSW A;  2DT6 A;  3MYF A;  4ASN A;  1PUF B;  4JUR I;  1G3Y A;  3DXJ F;  3S8P A;  3S3O A;  1KGS A;  4GO1 A;  2NVX J;  1A7V A;  2CMP A;  4IQ4 A;  4DYC A;  3K33 A;  3OYE A;  3GFI A;  1U3E M;  4G94 A;  5CQE A;  2VJI A;  1I6X A;  2HQ5 A;  3HUG B;  1GM5 A;  3MD2 A;  1WGX A;  1OQC A;  2FML A;  1YYJ A;  2F4M B;  3DLA A;  2X48 A;  2WZL A;  1XCV A;  2A61 A;  4U5F E;  4G7O F;  3F8M A;  3R0A A;  2AXT C;  3DBH B;  1WJD A;  3PIP F;  1OCZ C;  3BG6 A;  1ORJ A;  2XAQ A;  4FCY A;  3L8I A;  5COG A;  1TWC J;  4CJG A;  4HG2 A;  4B8X A;  4R8H A;  3ZRG A;  1TT0 A;  3K4L A;  1LIH A;  4G8X A;  3FXK A;  2HOA A;  2X0L A;  2M3A A;  1EA8 A;  1LM3 B;  4XQF A;  2J45 A;  2GAQ A;  1GXQ A;  5KNL A;  4QI2 A;  4U0W A;  2CH0 A;  4HF0 A;  3DZA A;  2YL7 A;  5ICC A;  1I6H J;  2KIM A;  1AU7 A;  1XD7 A;  3KIO A;  3VDX A;  3S1N J;  2EV5 A;  1ZRD A;  2O0Y A;  4AD9 A;  1H9T A;  1KQ8 A;  2LFD A;  2PJR B;  1PYV A;  1SD4 A;  2QSH X;  3BTI A;  2L7K A;  3K69 A;  4UDV A;  5D8L B;  3C8Z A;  2CU7 A;  4Y13 A;  3TGN A;  2CGE A;  2CV2 A;  1VQK I;  4L9T A;  2D1V A;  4YIR X;  3COA C;  1Z7Q c;  3I3L A;  4RBN A;  3DEW A;  2RSE B;  5A6A A;  3I5U A;  3WTW C;  2HNH A;  3VYR B;  2KL4 A;  4KIB A;  4Y3O A;  2V9K A;  2WB7 A;  1OCR C;  3ZQV A;  4CDA A;  3HJE A;  4RAG A;  4II3 A;  4BAC A;  3B6A A;  4XOR A;  4PJN A;  2OCC C;  1HBX G;  3GTK J;  1WWP A;  4BGD A;  3LLI A;  1YZA A;  4PGH A;  2GDC A;  3K7D A;  3ECH A;  1TP4 A;  4DBQ A;  2TRT A;  3EYI A;  4JCH A;  4NC6 A;  3FXQ A;  3P9I A;  2F22 A;  1UHS A;  3JCU C;  5KYN A;  4WXH A;  2WY7 Q;  2ZME A;  4KC9 A;  2JD3 A;  3G50 A;  2GBY A;  2GOM A;  4M6X A;  1M57 C;  4A3D J;  2BV6 A;  1S8N A;  2ZCW A;  4KA4 A;  4MW3 A;  3DD7 A;  2CG4 A;  2JN6 A;  4DZP A;  1Z9C A;  2VH3 A;  3H5R A;  3MWM A;  1JXS A;  2RAE A;  1WH5 A;  2AO9 A;  3GBG A;  4RDU A;  5K7Z A;  1W36 C;  3K4J A;  4IJA A;  3S28 A;  1IN6 A;  2IS4 A;  1UAA A;  1AKH A;  2I15 A;  3NWT A;  4XKV A;  3IL2 A;  2E2H J;  3QRF F;  3BPV A;  4BYY A;  4IHT A;  3TQN A;  4C3E A;  4ZYD A;  1X58 A;  5IOY A;  3SZR A;  4A3I J;  2LTP A;  1HOM A;  3DPT A;  4K0D A;  2WC2 A;  3TKY A;  4M3G A;  2I10 A;  5JVE A;  4U9E A;  1W7P B;  5FRN A;  2PX9 A;  2MSY A;  3FKJ A;  4HQM A;  3VPR A;  4S05 A;  4Q5S F;  2IS2 A;  2XPV A;  1DU6 A;  2HDW A;  2LG4 A;  1QPU A;  2HR3 A;  1T8I A;  2E60 A;  2KP6 A;  3ZOB A;  2EPF A;  3HGY A;  3M9A A;  5J3L A;  5DM6 F;  2IW5 A;  1Q0K A;  4KIS A;  4NBQ A;  2KIQ A;  3IQ5 A;  4CCO A;  2AWY A;  4WCG A;  3G71 I;  2R7R A;  2VBZ A;  1V54 H;  2EZL A;  1JTX A;  2FUG 2;  2JTV A;  3OWT A;  4NTA A;  1PUE E;  1TTY A;  4JTD B;  2XKP A;  4Q4Z F;  3OYI A;  3OYM A;  5K1Y A;  2O61 A;  2EIN C;  2OQM A;  3HPH A;  3F8B A;  3M1C B;  5EK0 A;  4HNT A;  2JSC A;  3KX2 A;  4EVI A;  3QP6 A;  1T33 A;  2QEN A;  1VQP I;  3HTU A;  2E87 A;  4GEH A;  5KYX A;  4NQF A;  1YYV A;  2H1L A;  2GWR A;  2XSD C;  4BE1 A;  2OEV A;  4YRV A;  1U5T C;  5BQT A;  2XAU A;  4H0E A;  2CQN A;  1X2M A;  4NTF A;  2LRE A;  3SYN A;  4ENM A;  2JA2 A;  3H35 A;  4JOM A;  5LHH A;  4I3M A;  2JPB A;  4IAO A;  4RLF A;  2CSO A;  1MBJ A;  2K40 A;  5GTI C;  4MVM A;  2KKO A;  3J7A Y;  1E3H A;  1F1M A;  3K6B A;  3V7C A;  4DIQ A;  4HA8 A;  5KYX B;  1QVU A;  3I58 A;  4FQG A;  5FB2 A;  3S32 A;  2EH3 A;  3HKZ N;  2IRF G;  2W48 A;  4CHU A;  1WTY A;  1IDZ A;  5KYW A;  4LDR A;  2E5N A;  2X6W A;  2R7W A;  2MFZ A;  4OWR B;  3KEQ A;  2VL8 A;  1SEU A;  1FSE A;  2QQ8 A;  4MEX F;  1Z23 A;  2HJM A;  1YJG A;  5K0I A;  2BEO A;  4FE4 A;  5KYY B;  1P92 A;  1FMV A;  1A0B A;  2R5Y A;  2IM8 A;  4HDV A;  3WE3 A;  4O5V A;  1A36 A;  2IXS A;  1S7O A;  2HMQ A;  2YPR A;  1G4D A;  2Q2E A;  4I02 A;  1ETV A;  4ETS A;  1TQP A;  4CZZ A;  1LDD A;  1VLT A;  1WAT A;  2CV1 A;  2M1B A;  3OIQ A;  5M5X J;  2YSR A;  1LVA A;  1FNT c;  3C62 A;  3KP5 A;  3GOR A;  2K7L A;  3WTY C;  3IV5 A;  3MAJ A;  4N9I A;  3KZY A;  1VQ7 I;  2VJJ A;  3KCC A;  3LSJ A;  2WAE A;  4ZC3 A;  3T8T A;  4XBF A;  2Q00 A;  5BUO A;  1H8A C;  1QQ3 A;  3F46 A;  3QW1 A;  3PNV A;  5E3C A;  1Y1V J;  2KZV A;  3RCO A;  1MZB A;  4B1R A;  2VQH A;  4EEF G;  1NK2 P;  2DA6 A;  2G0E A;  1R1V A;  2V1X A;  3CLQ A;  5E3L A;  1D8K A;  1NG1 A;  4PSX A;  4NDL A;  4LLL A;  3TDZ C;  2VOP A;  1XC5 A;  3W6J B;  4F92 B;  1ETW A;  1JHH A;  2RRE A;  3SXY A;  4ESB A;  5KK1 A;  4RB1 A;  2ZJR F;  3LSP A;  1QNT A;  3I59 B;  1PV3 A;  1LI5 A;  2YS9 A;  1LS1 A;  3DQV C;  1QHG A;  2PMZ A;  1ZQ3 P;  5DEQ A;  2P8T A;  4Z6Y A;  3C8G D;  1A35 A;  3LAY A;  3UGP A;  4QTR A;  3RVY A;  1VQ8 I;  1ONV A;  3CCQ I;  4PCQ A;  5JR3 A;  3VWB A;  4P96 A;  1QKR A;  2CO5 A;  4GGG A;  2ZSI B;  5IY5 H;  5EG0 A;  3TMO A;  2OC6 A;  3ABT A;  1T2K A;  3O2P E;  4YFN F;  4F4B A;  4UV8 A;  3K4M A;  3LOC A;  2VQG A;  1R49 A;  3LUT B;  1Q0M A;  2IPQ X;  3SZT A;  1YFH A;  2NG1 A;  5DCF A;  5JVG F;  1E83 A;  1VTM P;  2FXA A;  3OYA A;  1VOM A;  2OTJ I;  3M79 A;  5F6F A;  4KNV A;  3V8K A;  2XIG A;  3GLL A;  5D91 A;  2W84 A;  4XLP F;  2VC9 A;  1QBJ A;  3OYJ A;  1N25 A;  3PUF A;  2ADU A;  5B66 C;  5JFR A;  1U78 A;  3MZH A;  1GGQ A;  2BHY A;  2EZH A;  4EM2 A;  2A5W A;  4GCV A;  4ON0 A;  3MLG A;  3W6K B;  1E85 A;  2CUF A;  2HU9 A;  3G1L A;  3DLL F;  2AP3 A;  5COF A;  4ESF A;  3RQF A;  3CCY A;  1RCP A;  1O7L A;  1MIJ A;  3FHZ A;  2MD5 A;  4I6Z A;  5BPI A;  1T0F A;  1ZG1 A;  3PJR A;  4BJ1 A;  3FXR A;  2KPM A;  5JLI A;  2A6T A;  1JT6 A;  3HSR A;  5EEH A;  2R9R B;  2M7B A;  4XSX F;  4EBJ A;  1ETO A;  3W2W A;  4E7I A;  2XLV A;  4P55 A;  3IQ6 A;  1V54 C;  2QQ9 A;  4CDV A;  4M3B A;  3BOQ A;  4IHS A;  4JJG A;  1Z3I X;  5JUA A;  2IGN A;  3BC8 A;  3S15 J;  3DFG A;  3AGU A;  2VUM J;  4BQO A;  1FYK A;  1KNY A;  2V79 A;  2QWW A;  1NK3 P;  2QBY A;  2XSE A;  4BL0 B;  2X0C A;  2RKH A;  5T1D B;  3BP8 A;  3ZMT A;  1CPQ A;  2HFI A;  2XRN A;  5AC5 A;  3A1Y A;  3WHB A;  4BJ5 C;  4DVY P;  2KRC A;  2Y3B A;  5E3A A;  4FX0 A;  3NMI A;  2VXZ A;  1AUE A;  4AX2 A;  3BR1 A;  3HKK A;  4CXF A;  3AL0 B;  2GA0 A;  1SR2 A;  5BQG A;  3LEV A;  4W97 A;  3F9K A;  5KHD A;  5DS5 A;  3G1O A;  1BM9 A;  2OU6 A;  5HDG A;  1TWG A;  2UUI A;  5JP7 A;  3L2U A;  2LR8 A;  2XLO A;  2YX7 A;  2BL2 A;  5FGM A;  4CCM A;  2EA4 A;  1ZGA A;  1EI7 A;  4CZC A;  1YO5 C;  3MFN A;  1KQ0 A;  1C03 A;  3S27 A;  3SXZ A;  2W4S A;  1Z7U A;  2UZK A;  1LE8 B;  1AWC A;  1Y0N A;  3BDD A;  1SVM A;  3SHF A;  2I8B A;  3HDD A;  2BXY A;  5HLH A;  2ZC2 A;  3DWL E;  2NOJ B;  2E7X A;  2TDX A;  5J1R A;  2OTL I;  1GVD A;  2A1D D;  1MMG A;  5LBQ A;  3LNQ A;  1YA9 A;  4HPQ A;  3G1M A;  1SVL A;  5DS9 A;  2R03 A;  2DA2 A;  1XZP A;  3ASO H;  4S04 A;  2J7P A;  3JSE O;  4R1H A;  2JA7 J;  1YHQ I;  2L54 A;  1R7J A;  2LNB A;  1W5S A;  1X4O A;  2EZI A;  2ELH A;  1SMT A;  1ZLK A;  4K1O A;  4AIH A;  1OR7 A;  1D3Y A;  3H0G J;  4HV6 A;  2JRM A;  1DPR A;  3I5Q A;  4RD9 A;  2DOE A;  2L9V A;  1RMV A;  3DEU A;  5HS9 A;  4EMS A;  4XTK A;  3J7A O;  1MNM C;  1YIJ I;  5FKO A;  2PEX A;  2JZY A;  3RDI A;  1DP3 A;  3ITF A;  4LMY A;  1TNS A;  3EGD A;  3Q5F A;  3QW0 A;  5B1A H;  2WVQ A;  1DGW Y;  4GRI A;  4OIO F;  3SEZ A;  4M72 A;  2DFF A;  2IS1 A;  4E0I A;  3PNT A;  2LK2 A;  1Z3Y A;  4U88 A;  1WPK A;  4BJ6 C;  3W8I A;  3NMK A;  2QTV A;  3ERM A;  5LRS A;  3JRA A;  2XS1 A;  4NUB A;  3PHF 2;  2HQR A;  1I5Z A;  2NAZ A;  1YX5 A;  2V7F A;  2Y69 H;  3CJT B;  1GHC A;  1XN7 A;  4L9N A;  4LB6 B;  1CPR A;  2XUB A;  2VN2 A;  3BQY A;  5F64 A;  3U3B A;  3LFU A;  2DPD A;  2Z1D A;  4EGZ A;  2UXN A;  2FBI A;  5E8G A;  3S2H J;  4ZLD A;  2O5R A;  2A6H F;  2YLG A;  4DZJ A;  2M7A A;  2P0W A;  3SZG A;  2P6T A;  1G59 A;  5IY5 C;  5DD8 A;  2CW7 A;  2I8D A;  2DB4 A;  3ZQY A;  4DOZ A;  1UB9 A;  3AG4 H;  4RB2 C;  4E7K A;  3L2R A;  4BDY A;  2MAB A;  3FK7 A;  4PFP A;  5CYV A;  5ICF A;  3RQ4 A;  4PJ0 C;  4J01 A;  1RJ9 A;  2EIK C;  4JKV A;  3PSF A;  1ZKG A;  3DE8 A;  2H27 A;  4WK8 F;  3B29 A;  4V19 K;  2ZME C;  3JRE A;  3SDB A;  3CUO A;  1H0M A;  1TFK B;  2L7A A;  3B0P A;  1JGG A;  4E7H A;  1LUJ B;  4U87 A;  3F0C A;  3TOB A;  1N75 A;  2VBW A;  1P6R A;  4HX8 A;  2F5D A;  1HKQ A;  3ZMD A;  1GV2 A;  4FWV A;  3KP3 A;  1W2W A;  3ZMV A;  1FIA A;  3VYW A;  3FMS A;  2GAU A;  1D0Z A;  2CQ7 A;  4GYG A;  1X1P A;  2RNJ A;  2QM3 A;  1UFM A;  2YU3 A;  4OD5 A;  1MGT A;  1NTC A;  4AVP A;  5F27 A;  3GTP J;  1EH7 A;  3KEO A;  4E18 A;  2Y48 A;  2BC5 A;  2EPM X;  2O03 A;  2XAS A;  3F21 A;  5JLX A;  3F6V A;  1FTZ A;  2KSF A;  3A11 A;  3K1M A;  4EBK A;  1MMS A;  3VYU B;  2IBD A;  3ZQQ A;  3VEP A;  3V7O A;  2YKZ A;  2B0L A;  2ZPA A;  4RB3 C;  1Y39 A;  4CGZ A;  1W1W E;  1VQ4 I;  4EJT A;  5C4X J;  3HL2 A;  1PD0 A;  3NQO A;  5CVJ A;  5L0D A;  3K66 A;  2QUF A;  2HKV A;  4EJO A;  3SFZ A;  3H3U A;  3ZN0 A;  5K7H A;  5E3M A;  4J7Y A;  3U1D A;  3BZ6 A;  4E7L A;  3GTG J;  5DQZ A;  1CGN A;  4L5E A;  3CD6 I;  1S7E A;  5EZH A;  3IWF A;  1X3U A;  4A3F J;  1Y8R B;  3FIW A;  2ZD9 A;  4XPW A;  5HNF A;  3OS2 A;  4GDF A;  1EA3 A;  1UHM A;  3S14 J;  2GA1 A;  4E7Z A;  4LLC A;  1Y0U A;  5BQH A;  3ABM H;  3WOD F;  5TJ5 E;  4F55 A;  1CF7 A;  2NS7 A;  3S3M A;  2XM0 A;  3Q3S A;  4WXD A;  4CUG A;  4IRU A;  1LFU P;  1UST A;  1EV7 A;  3IKT A;  3QQA A;  4E70 A;  3RQG A;  2M5W A;  1EKE A;  2QKM B;  1V74 B;  4HFF B;  3PMR A;  1OJL A;  1KU2 A;  2LK4 A;  2BZT A;  1IN4 A;  3MBG A;  3ASO C;  3VF0 A;  3CP8 A;  2G3K A;  2E36 A;  4CS8 A;  4A3B J;  2VB6 A;  2H94 A;  3BG3 A;  3LFK A;  2MA3 A;  4I0A A;  2QSF X;  5C4J J;  4XLA A;  2JA6 J;  4DVZ A;  2LFF A;  4XQ1 A;  3CCS I;  2QLZ A;  4G12 A;  5IYC J;  3PSI A;  3WTU C;  3HRU A;  5B5E C;  1IN8 A;  2K27 A;  4XSZ F;  1U9N A;  3F72 A;  4KMU X;  2X4H A;  4HEA J;  1I1S A;  2QZ8 A;  2BHZ A;  2R7T A;  2Q9B A;  2YR2 A;  2HMZ A;  3NKD A;  1JMW A;  5DCM B;  1BR1 A;  2OBP A;  4PR9 A;  2AHQ A;  2BGC A;  3FF5 A;  4B44 A;  5B1A C;  3VSL A;  3OYL A;  3BJO A;  2VLA A;  3Q0U A;  3OYC A;  3AGT A;  4ZDP A;  2YEV A;  1HQC A;  3V5X A;  2E7W A;  2V9P A;  4I44 A;  1I27 A;  2EFN A;  1SVO A;  2NVU B;  4JIO A;  2Y69 C;  1ETQ A;  4ZH4 F;  1HLV A;  3RIR A;  1NZE A;  4ABZ A;  3HOY J;  4ZYG A;  1SD6 A;  2KRH A;  1U89 A;  1U5T B;  4AWX B;  2JPC A;  2CQK A;  2KZG A;  5JVT A;  2IXP A;  2PBE A;  1JJ6 C;  1ITY A;  4NNJ A;  3QOD A;  4E4H A;  4C2T A;  1QQI A;  2R4G A;  4G6Q A;  1E3P A;  4DGW B;  2VXD A;  2HSB A;  4HF1 A;  1MJB A;  3ABL H;  2A5Y B;  5AON A;  4BXF A;  3IKV A;  4A0X A;  5L0G A;  3L00 A;  3AG4 C;  4IHV A;  1N77 A;  1Q0G A;  4CIP A;  5F08 A;  3GF2 A;  2P1A A;  2XLM A;  1B8I A;  3DU6 A;  2HQN A;  3TO6 A;  2G7U A;  4BJT A;  2HTS A;  4IHY A;  1ZHW A;  2PX3 A;  2IOQ A;  4IKF A;  4AE4 B;  1KON A;  1B72 B;  3KYD B;  2NRA C;  3GTO J;  2XL8 A;  4JK1 X;  4M3D A;  1Z21 A;  1RKE B;  1T39 A;  2XXA B;  3TBI A;  2OKU A;  4CYD A;  4MVZ A;  2DJI A;  2CGP A;  3POV A;  5LGT A;  4DRJ B;  4DRI B;  1HF0 A;  3KLO A;  4LJZ F;  2AVK A;  3FHN A;  2Q3T A;  3BT9 A;  1FOK A;  1MBK A;  4F93 B;  2NPU A;  1OW7 A;  3F6O A;  5CVU A;  3U9J A;  3OR2 C;  2P7V B;  4U5B E;  2L02 A;  4A3K J;  4L0Y B;  3KMI A;  4WJ0 A;  4PFO A;  3H9G A;  3LL7 A;  1NG7 A;  2W1O A;  3WTZ A;  2LSO A;  2V3C C;  3O3K A;  1GUU A;  4LD5 A;  3CQZ J;  1Z6A A;  5LFA A;  5HS8 A;  3QPS A;  2E1N A;  3DU5 A;  1O4X A;  3CZ6 A;  5E17 F;  2VOO A;  2ICW G;  1FR0 A;  1SD5 A;  3A4C A;  1T0F C;  1K83 J;  2LKX A;  1F4K A;  3QOP A;  5E3O A;  2YU9 J;  1NSG B;  1HCR A;  1PP8 F;  2X6X A;  1FJL A;  5EGY A;  4CDG A;  2ZXW H;  4E6K G;  4EJU A;  4YIF A;  1LDK B;  4IAQ A;  3UGO A;  4XL9 A;  3Q6M A;  2L01 A;  3SFI A;  4BHB A;  5L3F A;  1DOW A;  2E2I J;  2FNA A;  1FOW A;  4M6Y A;  3HBL A;  1MH4 A;  1FLI A;  1NFO A;  2LQG A;  3DM5 A;  2IT0 A;  1R36 A;  4U5C E;  2DBB A;  2DPU A;  4UUS B;  3BG5 A;  4DXW A;  4O7G A;  2ESH A;  4YWQ A;  4L9V A;  1C0W A;  2YQY A;  1ZW2 A;  2M30 A;  1Q0D A;  3ABM C;  4FTH A;  3BTL A;  2ACJ A;  2RNG A;  4WF2 A;  1ZYR F;  1QLE C;  2W25 A;  3PQJ A;  5FD5 A;  1VQL I;  2OAZ A;  5IOZ A;  2LVS A;  2GFH A;  4C7O B;  2CUE A;  2EFW A;  3CCU I;  2IXO A;  1S7A A;  2JPU A;  4UB6 C;  4OIP F;  2MHR A;  2YLI A;  3H2V A;  4MFD A;  2R25 A;  3HTK C;  3ML6 A;  1RZ4 A;  3F47 A;  2F6C A;  2KGO A;  3NEU A;  4UY8 I;  4HE8 D;  2A6E F;  3CCL I;  1HA8 A;  2RVC A;  2JUG A;  3HSE A;  3PM1 A;  3BCB A;  3RYP A;  3T6G B;  1OMI A;  4JZA A;  1PUF A;  4S0H B;  3ZIB A;  2BVL A;  1OR2 A;  3BEH A;  2B0J A;  1VQ6 I;  4BEH B;  4A5N A;  3GEZ A;  1LDJ A;  3P7N A;  4BU2 A;  2ZJP F;  2MBF A;  1F43 A;  1FFT C;  3I0T A;  4RMN A;  2M8G X;  3GYH X;  3GVA A;  3HUG A;  3A02 A;  3T1B A;  1MKM A;  3LSH A;  1JR8 A;  4CS9 A;  5TJJ A;  4ZTF A;  3SP1 A;  3X1O A;  2ID6 A;  2NYX A;  2XL6 A;  4JX5 A;  3C3W A;  3UMK A;  5AIP A;  3HLZ A;  3L1M A;  3R6S A;  1WQ2 A;  2O9X A;  3LS1 A;  5HOO A;  3GTQ J;  1ZG5 A;  2CJJ A;  5J1U A;  3E6B A;  1BN5 A;  2DOF A;  4YL0 A;  4IZZ A;  1K78 A;  2J9W A;  3EG9 A;  3RKQ A;  3RYL A;  4XID A;  2L7F P;  3TOL A;  1XDS A;  3IP4 B;  4ZZL A;  4JW1 A;  3B9Q A;  4KI2 A;  2CDQ A;  2XC7 A;  1XB4 A;  3GFL A;  3Q7L A;  1B68 A;  1B9N A;  4HLX A;  5K5O A;  2OUM A;  2CFO A;  3A01 B;  4B3A A;  2EIM H;  3QPH A;  4ZDL A;  5J4V A;  3ABL C;  4I0B A;  5LRR A;  1MMA A;  5LGN A;  4A3E J;  2G3V A;  5DS4 A;  3E3V A;  3S1Q J;  3V8L A;  2BW3 A;  3FXJ A;  1OYY A;  4AC0 A;  5JHU A;  4EGY A;  1ZGW A;  3LES A;  3BG7 A;  1OR3 A;  1STZ A;  3BTC A;  3E5Q A;  4RLQ A;  2BY1 A;  2OZ6 A;  3JTH A;  3OS1 A;  2CUJ A;  3NRV A;  4G7H F;  1JKP C;  2R93 J;  2PFD A;  4AYB A;  2QLA A;  4HV5 A;  4LOC A;  4B3X A;  2QUP A;  1TNT A;  2EV0 A;  1E17 A;  2KYH A;  1R4N B;  3M8F A;  2XV4 S;  3OY9 A;  3OYF A;  2QNL A;  4M9S A;  1LB2 A;  2PMZ N;  3H2U A;  2NS8 A;  3SDG A;  5F28 E;  2EIJ H;  2VJ4 A;  4EM0 B;  4ONS A;  4IB4 A;  3HG9 A;  1NG6 A;  2VKE A;  5HNH A;  2AS5 F;  1UFB A;  2Y0S A;  2FAP B;  2MLK A;  4YT5 A;  1FP2 A;  4ZYH A;  2EBI A;  1Y1W J;  3N2Z B;  3EUH A;  3HNL A;  4UVC A;  3R2P A;  2STW A;  2FBH A;  3N0T A;  2XAF A;  4DW6 A;  1YRN B;  1J75 A;  2M0M A;  1OYW A;  3BR6 A;  1P4A A;  5FRO A;  1VQN I;  5FKL A;  1YAR O;  2XM4 A;  2H7O A;  1LFB A;  2GM4 A;  3JZ0 A;  3K4N A;  2K3P A;  2QQA A;  4CYC B;  2CNW D;  2CYY A;  3AG2 H;  3EGX B;  3W3C A;  2BVM A;  3QOE A;  4MTO A;  2AXL A;  4XWJ A;  3PUB A;  2YHS A;  1SAX A;  3R7C A;  4XRM A;  3CAX A;  4IHX A;  4B6I A;  1O3R A;  1O3U A;  2GIV A;  3O6B B;  1L3L A;  1IJW C;  4BPM A;  2DA7 A;  2KDZ A;  3I54 A;  4JX4 A;  2CQQ A;  2FNP A;  2ZXW C;  4PK4 A;  2R7U A;  3ZMS A;  1LPE A;  1H6G A;  3TED A;  3V5Y A;  2Y2Z A;  4U0V A;  1N1C A;  1BJZ A;  2WAD A;  2R7Q A;  2VCB A;  5FZT A;  2XB0 X;  4MNU A;  4BQN A;  1YS6 A;  3W6V A;  4CSW A;  3CCE I;  2YRF A;  1UHW A;  4I76 A;  2NVY J;  3H65 A;  3SEO A;  4Q47 A;  1O57 A;  3VM6 A;  1S72 I;  2ZJ2 A;  1K61 A;  4PUS A;  2EFO A;  2F5F A;  3K70 C;  1CGO A;  4J32 B;  1MBF A;  4JC7 A;  4W1U A;  3W2A A;  3K1I C;  2CQX A;  2LBF B;  4Y7N J;  1BW5 A;  1ZLJ A;  3IEE A;  2DA4 A;  3NYM A;  2MH2 A;  1J9I A;  1GXP A;  3FXH A;  1DPU A;  1I39 A;  2K9N A;  3GO5 A;  3O55 A;  1X4P A;  3ZN1 A;  2VON A;  3KZZ A;  2DTR A;  2A0U A;  1Z63 A;  3F8C A;  1XGM A;  5H6Q A;  1OCC H;  2ETH A;  5L3C A;  4JVS A;  5E18 F;  5HVQ C;  1M2V B;  4BKX A;  1ERD A;  2LKP A;  2OD5 A;  3QYB A;  3J7Y J;  2H7V C;  1UJ8 A;  1M1E B;  3G2B A;  1Y6I A;  3GM3 A;  4HNV A;  2OJQ A;  1RR7 A;  4OMY A;  4MEY F;  3H3V K;  2RQQ A;  3IRQ A;  1X19 A;  3S1R J;  2E1C A;  4G7Z F;  1IN5 A;  1IRG A;  1E3O C;  4IAR A;  3UKG A;  2TMV P;  4BH9 A;  5HSW A;  5DS6 A;  3Q7G A;  1AKH B;  3WU2 C;  4RAY A;  1O5H A;  1P9Q C;  5FKK A;  5KYU A;  1JJ8 C;  3U2M A;  3IQC A;  2LP0 A;  1J09 A;  1K4S A;  2IGK A;  4CS8 C;  4CJO A;  4CX9 A;  3NDB B;  1SD7 A;  4BAY A;  1Z3X A;  3RPU A;  2HPI A;  4KUM A;  2QY9 A;  1XSX A;  1J8Y F;  2VCA A;  1Z91 A;  2ZXJ A;  1E2X A;  1FP1 D;  1SFX A;  2HEO A;  4QWQ A;  4RAF A;  2YX4 A;  1D5Y A;  1VTN C;  1T6U A;  5A6J A;  2ETS A;  4CCK A;  3FX3 A;  3JRI A;  3KYL A;  3UMI A;  4PAC A;  3PFY A;  3LEO A;  3DTK A;  3C8G B;  5KYY A;  1WVR A;  3GAN A;  5BNG A;  1GLN A;  3H36 A;  3JRH A;  1REP C;  3E7L A;  4L5J A;  2DT7 B;  2VKH A;  1VFC A;  3PO2 J;  2G62 A;  1SFK A;  3HOV J;  3MQ0 A;  2K4J A;  2ELK A;  2VE8 A;  3NAR A;  4HNU A;  2HVR A;  5L3D A;  1UG7 A;  2F48 A;  3GX4 X;  2EIM C;  4RDA A;  5J1Y A;  3NKE A;  1HXD A;  4BDZ A;  2EZK A;  2VAS A;  3NWS A;  1QO0 D;  2KFD A;  2L3D A;  2DOD A;  4DJ9 A;  3CME I;  1ZHF A;  2WZF A;  5IT9 K;  2BY0 A;  2BXZ A;  2ZXH A;  1T08 B;  2WB1 A;  1BC7 C;  1IV8 A;  3K1P A;  3WTS C;  3NMJ A;  3TK0 A;  1RES A;  4HBL A;  1VMA A;  2W00 A;  2XGE A;  1KQ9 A;  2YZS A;  3US6 A;  5FCL A;  3PO3 J;  4BHC A;  3OS0 A;  3M4C A;  1I1G A;  4BY7 J;  4MTD A;  1LS4 A;  2X85 A;  5JT4 A;  1A31 A;  3B73 A;  4MW8 A;  1IXC A;  2VT2 A;  2FF4 A;  1FWZ A;  1J5Y A;  2DMU A;  2K4B A;  3HOW J;  2KNH A;  4BUP A;  1T6Q A;  2KJG A;  2XRL A;  2O8X A;  4XLF A;  2JJ7 A;  2EIJ C;  4EKW A;  1OLT A;  4GYT A;  4ENJ A;  3S2D J;  4IHW A;  5CJ9 A;  2Z5U A;  4HFK B;  1VYI A;  2E34 A;  5LEK A;  4RGS A;  3TW7 A;  2QF7 A;  1BI0 A;  2XB5 A;  1IW7 F;  2E71 A;  4LG0 B;  3OA1 A;  3WHN A;  2IS6 A;  5KYW B;  4NHJ A;  2ECB A;  1T01 A;  1ST6 A;  4BNC A;  1MDM B;  3U2L A;  4MO7 A;  1T5O A;  2LSE A;  2PBI A;  1PJR A;  3AG2 C;  3A03 A;  1I5N A;  1TWA A;  4AK9 A;  1QPM A;  1IV6 A;  4OD4 A;  2LMD A;  4YT8 A;  2G9W A;  6PAX A;  1HMO A;  4HX7 A;  3C7J A;  5C3E J;  5D5U B;  1R1U A;  3K0L A;  3JAM Z;  3X2Q H;  3F23 A;  1X2N A;  3KET A;  3WGI A;  1T6I A;  4ZYA A;  1ZK8 A;  1OIS A;  4HZF A;  4A5M A;  4XN0 A;  4QLC U;  1YIT I;  1P4W A;  2A69 F;  2M4G A;  4G6D A;  4JYK A;  3CDI A;  3N24 A;  3DAF A;  2WY8 Q;  3GUD A;  1ZGJ A;  1F36 A;  3OYD A;  2YWA A;  2EIL H;  4YT4 A;  1TQI A;  2KLO A;  5BS6 A;  4MVU A;  3S1M J;  2E35 A;  2CCY A;  1RKC A;  4QPQ A;  2HI3 A;  3DPU A;  3HIF A;  5DV5 A;  1IDY A;  2F5C A;  2H6C A;  3EPZ A;  3N4M A;  5BMZ A;  1RC9 A;  5HDK A;  3DCF A;  3BZK A;  4KNW A;  4XR6 A;  2RV8 A;  3RPU D;  2W7N A;  2V6E A;  4OAZ A;  3ELK A;  3E70 C;  2Z3Y A;  4JRZ A;  3CEX A;  2HQA A;  2JRT A;  3RW0 A;  3QPL A;  3TOA A;  5HS7 A;  4WWC A;  2L2O A;  2WVO A;  4IPA A;  5DUK A;  4BHP A;  2GQQ A;  2F4O B;  5FFX A;  1D0Y A;  2FOK A;  3H9J A;  3QWL A;  1P7I A;  2FEZ A;  1M6T A;  3M4B A;  5D4S A;  2K9S A;  2DFH A;  3LQR A;  1AOY A;  2HKO A;  1JUM A;  3ZG1 A;  3MCZ A;  3L0I A;  3NYJ A;  2XDV A;  2A0B A;  1W5C C;  4Y15 A;  3I56 I;  3SXK A;  2PP4 A;  3K4C A;  3I4M J;  1OFC X;  1UG0 A;  2QE9 A;  1WGW A;  2XLW A;  3CSK A;  1F1Z A;  4F52 A;  5F5F A;  2XAG A;  1G5Z A;  1IF1 A;  2CRG A;  3B71 A;  3F3X A;  3U0C A;  3ZQI A;  3FBI B;  2L9R A;  4C2M J;  2L7Z A;  3JRD A;  1LE8 A;  4A69 C;  3CF5 F;  4HLY A;  1JTY A;  5FLV A;  1U6H A;  3RZO J;  5B3I A;  2ZO4 A;  1Q1V A;  3EFO B;  2FU4 A;  1WHU A;  2KHM A;  3TUL A;  3M3Y J;  1LEA A;  4LFU A;  4A3L J;  4MVQ A;  2Y31 A;  4F3Q A;  2M34 A;  1ZHX A;  2BY2 A;  3I4N J;  2LKS A;  4A0Y A;  2X6O A;  1K79 A;  1BR4 A;  2XF7 A;  5F0H A;  1J8M F;  4UNO A;  2PX0 A;  1LI7 A;  4CS9 C;  4JTA B;  1YTY A;  1D1A A;  3K2Z A;  4P1W A;  2YVK A;  3PCV A;  2NOG A;  4ANJ A;  2CFX A;  3HYI A;  4ZZD A;  1TW2 A;  1OKR A;  5E20 A;  1QVT A;  1VZ0 A;  1MSE C;  2HZT A;  2DFE A;  4KNY A;  4NB5 A;  1BI2 A;  5BOX A;  1DP7 P;  1BR2 A;  1Q0F A;  1R71 A;  1H9G A;  2R7O A;  2VIX A;  4BXU A;  1LPQ A;  1BL0 A;  1UEL B;  3ZQH A;  1X1D A;  4GYI A;  4RGX A;  1MSF C;  3CQZ A;  1A41 A;  1XMX A;  2OF7 A;  3IPM O;  4JEB A;  3FOO A;  3M8E A;  4OU0 A;  2HSQ A;  1ZHT A;  1WJE A;  2X6Y A;  2XVC A;  1HW2 A;  1FEX A;  2IXN A;  1FOY A;  3FM3 A;  4L18 B;  5EEA A;  2Y9Y A;  2L0K A;  4XRF A;  5KCM A;  3CO7 C;  1T9K A;  4LGW A;  3QMK A;  2R5Z B;  2EK5 A;  1MMN A;  5DQT A;  2DA5 A;  2HVQ A;  2VQC A;  2K5C A;  4ZDO A;  4NCQ A;  2JA5 J;  2RGV A;  4A6D A;  4GXO A;  1RKW A;  3FAP B;  5A6K A;  1JHF A;  3D5S C;  1G3S A;  4Z9J A;  3L2W A;  4FAP B;  1YOV B;  4CBE A;  4ZLC A;  3WG7 H;  2L7M P;  3RIP A;  1USS A;  2YUS A;  1ACI A;  2DN0 A;  3JRT A;  1ETK A;  4UUV A;  2D1H A;  5F1R A;  3X2Q C;  1OQY A;  2HTJ A;  2E1M C;  5GAG J;  1C17 M;  2LYC A;  1VB5 A;  3OSG A;  2P61 A;  2XLE A;  2A3S A;  4BY1 J;  2FQ4 A;  5IT9 Z;  3L1P A;  2Z16 A;  1XSV A;  1IXR C;  5F04 A;  4NTB A;  2DI3 A;  4ITV A;  2J9B A;  3GFM A;  5IT3 A;  4DQ2 A;  1XZQ A;  4D7M A;  2XLD A;  2EIL C;  1X1B A;  2CW0 F;  5JI6 A;  2WAQ A;  5LD2 C;  1I3Q J;  3DMD A;  1WAS A;  1Z7L A;  2KT0 A;  3CUQ A;  4IWB A;  1WI9 A;  2K9L A;  4CSA A;  2L9S A;  1A7D A;  1O7F A;  1Z77 A;  4HYE A;  1WSU A;  1G4U S;  1XWJ A;  2MWQ A;  3GEH A;  1RNL A;  3UNG C;  4CH7 A;  2MGQ A;  3B6C A;  3DM9 B;  1P2F A;  3ERE D;  4P9U A;  4BE0 A;  2Q9C A;  1HW5 A;  1ON2 A;  2Q8K A;  3GTL J;  1FPQ A;  5COM A;  3TW6 A;  1HDP A;  3UR3 C;  5FJ8 J;  1NH3 A;  1HW1 A;  3KEY A;  2Q9A A;  4EWC A;  2NUT B;  2EPK X;  3CDL A;  1FSH A;  2V9V A;  4NQW B;  2XF5 A;  1WJ5 A;  2BE5 F;  3K7A J;  4YL3 A;  5EF6 A;  3SJM A;  2XKO A;  3LLK A;  2P6S A;  3OOP A;  4DNC A;  1LKX A;  4IOA F;  3W8H A;  1KU9 A;  3FXM A;  4LG3 A;  3H92 A;  1YW7 A;  4A93 J;  2LRD A;  1BZ4 A;  3K6G A;  2ZKZ A;  1RJ9 B;  1ORK A;  1J0R A;  1K05 A;  3ATP A;  1U8R A;  2CV0 A;  2J7P D;  2LD6 A;  1G8X A;  5BQI A;  3IUO A;  1YAU O;  1YE9 A;  2CWE A;  3GFJ A;  1Y56 A;  3FDY A;  4UUT A;  3HRS A;  4C3H J;  1FFH A;  3GCM A;  2I5U A;  2VPR A;  2K02 A;  4I01 A;  5D92 A;  5DLJ A;  5E8I A;  2DMN A;  2LY1 A;  3KP6 A;  3DI5 A;  5F0F A;  4BBR J;  1YJN I;  3G4Z A;  4LDQ A;  4XK4 A;  2R3S A;  1I50 J;  4KYW A;  1TL8 A;  4O79 A;  4MTE A;  3RPQ A;  1TWA J;  4AM3 A;  1XGN A;  1YX3 A;  3WU1 B;  3LSM A;  5D6F A;  4CO8 A;  4O3M A;  2HUJ A;  2NUP B;  4K7B A;  4MIM A;  3ZMU A;  3W4Y A;  3DKW A;  2R7D A;  1JAF A;  3FHD A;  3IAS 2;  1FBU A;  2OZU A;  4Q7C A;  3HSF A;  3GTM J;  9ANT A;  4M73 A;  2COB A;  4ULV A;  1E84 A;  4D9J A;  4YEL A;  3OYK A;  4IL6 C;  5DCM A;  3K9T A;  4B43 A;  5J8F A;  1N78 A;  2KJC A;  1FC3 A;  2L6G A;  1G3T A;  1JT0 A;  4MVO A;  1EH6 A;  2NSG A;  2PNO A;  3BRO A;  2X9D A;  3LST A;  2ZJQ F;  3IH3 A;  1SYQ A;  1V4R A;  3V7R A;  4V2F A;  1ZR2 A;  4D7N A;  3SXM A;  2ME6 A;  2HOT A;  1S3J A;  1T98 A;  3J81 Z;  3HOU J;  2D4U A;  3H5N A;  3G3Z A;  3CMY A;  3GEE A;  3ULQ B;  5C44 J;  4JBA A;  3O8H A;  1YYX A;  3BJ6 A;  2J9U A;  4LER A;  3GZN B;  4OIQ F;  1WJB A;  4LAC B;  5HLI A;  2EJR A;  1RET A;  3OMY A;  5IP9 J;  1U5T A;  1IC8 A;  4B4C A;  1TFO B;  1I3A A;  2EA2 A;  1Z5Z A;  2K9M A;  1UZC A;  2MH9 A;  2ZSH B;  3GXO A;  1K6Y A;  4LK1 F;  1IAW A;  1CF7 B;  1U2W A;  2ID3 A;  2JVH A;  3QVY A;  3ONQ A;  4NC8 A;  2IEK A;  4V2G A;  5F1J A;  3WG7 C;  4FIS A;  2ECC A;  4PDK A;  3ABU A;  3ESW B;  5EHH A;  3MKZ A;  4CCL A;  5EYR A;  1T95 A;  3JCU Q;  1P7J A;  2K3F A;  4HDU A;  1OCT C;  4AYB N;  1BOA A;  3Q6N A;  1FZP B;  2E5Z A;  4DBR A;  2WWY A;  4AE4 A;  5GAH J;  4C2U A;  5JS5 A;  3CTA A;  1B72 A;  1JKR C;  5DM7 F;  3CCV I;  4KIT B;  2IBF A;  4H54 A;  4P9T A;  3FK6 A;  1R5I D;  3ZWI A;  3H9Q A;  3Q0V A;  5EGO A;  1RKE A;  2Y0S N;  1G6N A;  4IVN A;  3AAF A;  1VK5 A;  2XXA A;  2L81 A;  3E6D A;  1ZHY A;  1V55 H;  3KP4 A;  3W2V A;  4B09 A;  4C3D A;  1AVO B;  1OYI A;  3L8J A;  4I99 C;  2ZNZ A;  1P4X A;  4PJM A;  4ZTJ A;  2B63 J;  1EKY A;  1R1T A;  1RPW A;  4J19 A;  2ZNY A;  5BPD A;  3DTI A;  4DYR A;  2W9Y A;  3SNH A;  2P7V A;  3CES A;  4E0H A;  3ZTM A;  5F0C A;  3I4P A;  1WWX A;  3IC7 A;  4B48 A;  3RI4 A;  1JE8 A;  1XS9 A;  4QDL A;  4AID A;  3BCA A;  1TZL A;  2VC0 A;  5GAD J;  4NC3 A;  4QPO A;  3C63 A;  2GXB A;  4I98 B;  2FRH A;  3IWZ A;  1TR2 A;  3D5R C;  3MKL A;  3BQZ A;  4PGG A;  2Z9O A;  4CA0 A;  1ODD A;  3BWG A;  4MQV A;  5D8K B;  4NY3 A;  5DYM A;  5DDG A;  1RUO A;  5CPR B;  4N9H A;  1IZ1 A;  4XKC A;  2PJP A;  1VQM I;  1WN0 A;  2XL4 A;  3QZC A;  2IGM A;  2V1U A;  2O8K A;  1FAP B;  4KJZ A;  1JKO C;  2CUZ A;  5ICE A;  1DU0 A;  2KW3 C;  3ZQL A;  1R4T A;  2WVN A;  2M4E A;  3MX3 A;  4MVR A;  3U2R A;  2ISZ A;  4UUS A;  2ESN A;  1F9N A;  3KKB A;  4MTF A;  3F8N A;  1NBB A;  3FBN B;  1T56 A;  1SC7 A;  5D4R A;  2M9H A;  3EUK L;  3TOM A;  2F5E A;  4Z2Y A;  2DK5 A;  2K85 A;  3QVZ A;  4U9D A;  1B59 A;  1S05 A;  4K2E A;  1S29 A;  3FXU A;  3PDM P;  5IYB J;  1IO2 A;  1YLF A;  3T5X A;  4C7O A;  2P5K A;  5KAI C;  5ED4 A;  3EHN A;  2XGX A;  1FX7 A;  2XRO A;  4AL0 A;  1G3W A;  3O39 A;  3E97 A;  2OCE A;  5DD4 A;  3JT1 A;  1YG2 A;  5LEJ A;  5L3G A;  4D5C A;  3QU6 A;  2X51 A;  1BIB A;  1NFN A;  2D45 A;  2O9L A;  4KIC A;  3EQL F;  5E1X A;  1HDD C;  3L2Q A;  1JI8 A;  1CGM E;  4A6E A;  3P9C A;  4M9X A;  4BEH A;  4ESJ A;  4FE7 A;  2ZXP A;  1VQ9 I;  4PJL A;  1XPX A;  1VQ5 I;  4MGR A;  3NG1 A;  1Y6D A;  5HOD A;  4AL1 A;  1WFX A;  3JSZ A;  3LNM B;  5GPA A;  1Y4C A;  2VBY A;  5B1B H;  1C02 A;  3EH1 A;  1EH8 A;  4XNF A;  2VCC A;  3CMM A;  1XCB A;  2JK3 A;  1HE9 A;  2VKD A;  1OKK A;  5L3V A;  2R05 A;  4BJ5 A;  5HV9 A;  2PFB A;  2HOE A;  1V4A A;  3CC7 I;  3QP5 A;  3CJQ B;  1GS9 A;  2NNY A;  1MQV A;  2DQR A;  3FWE A;  1OR7 C;  4XMY A;  3V7S A;  1ZU5 A;  4D1Q A;  3A01 A;  1MJA A;  4XEF A;  3JRC A;  3TQO A;  2WB1 N;  4AUX A;  4LK0 F;  4D5F A;  4II2 A;  2OG2 A;  1X1A A;  1TKN A;  3QYF A;  1GVJ A;  2OA4 A;  1TBX A;  1SAU A;  3HOT A;  3AQC A;  1MBH A;  3L09 A;  1IZM A;  2WAF A;  3F8F A;  2BOL A;  3ZQF A;  1ZRC A;  4BXX J;  3O6X A;  3L9F A;  3D5L A;  1WRJ A;  3FXO A;  3WAQ A;  3B0U X;  3VYS B;  3K4B A;  3CO6 C;  4JTC B;  1XDU A;  2FMY A;  3L2C A;  5H6R A;  4E7J A;  2AWC A;  3KPH A;  1L0O C;  2HDC A;  1APC A;  3AFH A;  3DAG A;  3ZDL A;  1LVK A;  3OYG A;  4IQJ A;  3K10 A;  3JAM K;  2PJR A;  2MC3 A;  2R7V A;  1R9T J;  2WL8 A;  2Y3D A;  3JYY A;  2LF7 A;  3DBL B;  4XLH A;  3ZSU A;  3JYH A;  1BW6 A;  2UV1 A;  1LE2 A;  2QSG X;  4I7H A;  1V55 C;  3DWW A;  1TWH J;  2WTE A;  5L0C A;  4QIW N;  1VF9 A;  3IRR A;  4CCN A;  2DFI A;  1APL C;  1PCX A;  4RS8 A;  3HNJ A;  2GA2 A;  4FX5 A;  3V5Z A;  1DDN A;  1Z1D A;  5H20 A;  1YRN A;  3S17 J;  2ELJ A;  1SMY F;  1D5V A;  1A6Q A;  4HX4 A;  1V5F A;  5K5R A;  2NVT J;  5K7F A;  1W0T A;  4CYC A;  3EGX A;  4M71 A;  4O6Y A;  2J46 A;  4HF2 A;  2Z33 A;  3AG3 H;  3FIS A;  3LJB A;  2CW8 A;  2VBX A;  2L5Q A;  3FZV A;  3HEF A;  3HPG A;  4KIF A;  1K78 B;  2RD9 A;  3EG9 B;  5L0I A;  2RQP A;  2ZB9 A;  3GZ6 A;  1ZRF A;  5DUI A;  3CUQ C;  4L9J A;  4MQ9 F;  3JRG A;  1GQA A;  4XPX A;  4HOB A;  4RA2 A;  4YK5 A;  4CSA C;  2PI0 A;  2EPN A;  1YJ9 I;  4BJ6 A;  1LEB A;  2IYL D;  3TD7 A;  1CGP A;  2JMW A;  1A7E A;  3S84 A;  1RI7 A;  4EAT A;  3LQQ A;  1WOL A;  3PFI A;  1TLH B;  1ZR4 A;  4AIK A;  5IPA A;  3HTS B;  3AJM A;  3JSP A;  1D1B A;  1MND A;  5A2Q Z;  4JQF A;  2DQL A;  2NXN B;  3EJN A;  4IX7 A;  2BW3 B;  2P81 A;  1ZEL A;  2P4W A;  5EEG A;  1X3W B;  3DKX A;  3MKY B;  4U5G A;  5J40 A;  3KP2 A;  3OIP A;  2P7C B;  2QVO A;  5FO5 A;  4Y17 A;  1XSD A;  1ULY A;  2Q1Z B;  1MH3 A;  1V5E A;  5K5Q A;  2DDB A;  1H7I A;  4CIH A;  2DYS H;  4I09 A;  2LBF A;  2QKL B;  2C6Y A;  2DK8 A;  1W7P A;  2XGC A;  1HC8 A;  2OEX A;  3RFY A;  3HGG A;  1POG A;  5A69 A;  2QQB A;  5M5W J;  4GFB A;  2LY2 A;  5JHF A;  1ZAR A;  3E6M A;  4XLN F;  4XEK A;  4YL1 A;  3ZVR A;  3QU3 A;  1IUY A;  2E1M B;  2UXX A;  2NS0 A;  4L6R A;  2VJ5 A;  3RQI A;  3HHH A;  2LIG A;  1OKK D;  1ETY A;  4UB8 C;  4C3J J;  2G7H A;  1M2V A;  5FRM A;  3ZP5 A;  5ERI A;  5CI8 A;  5FKM A;  2B0H A;  2TCT A;  3IHU A;  1HY5 A;  1FOX A;  2KIS A;  5L3Q A;  3M1C A;  2KIU A;  3R4K A;  2X1E A;  3DF8 A;  3VOE A;  1WH7 A;  2IGO A;  2XGD A;  3M8J A;  3MN2 A;  4N0B A;  4PJJ A;  1ZH5 A;  4A3M J;  3KZI C;  2P0N A;  3TL4 X;  2VT3 A;  4ENK A;  2ZME B;  1SAN A;  4JX6 A;  3M7G A;  4XON A;  2L4M A;  2MC4 A;  3QPT A;  2HZ8 A;  1M56 C;  3FKI J;  3ZTZ A;  1Y8Q B;  2KJB A;  2QGU A;  4OAY A;  3WE2 A;  3DKA A;  5CQG A;  3ROU A;  4KMF A;  1EF4 A;  3JTG A;  3HRM A;  5B1B C;  1OCO H;  3ECS A;  3TDU C;  3WGG A;  4B47 A;  1TC3 C;  2PG4 A;  4KDP A;  3V4G A;  1ZVZ A;  2MW8 A;  4XEV A;  4Z9I A;  1XGS A;  3VYT B;  4N6H A;  5FKN A;  3C8G A;  4MVS A; 
#chains in the Genus database with same CATH homology
 2CNW A;  3LSG A;  5HNF A;  3OS2 A;  3EZI A;  3EFO B;  1EA3 A;  2KHM A;  3ZR8 X;  2AQE A;  3CJR B;  4E7Z A;  4LLC A;  3K4K A;  4C9Y A;  4F3Q A;  1ZHX A;  5B1A C;  4LIV A;  4DJA A;  3WOD F;  4F55 A;  3S3M A;  1BR4 A;  4ULW A;  4CUG A;  2XF7 A;  4IRU A;  4LLE A;  3RH3 A;  1J8M F;  4U5D E;  4BG0 A;  2W4M A;  2PX0 A;  1MW7 A;  2C03 A;  2QKM B;  4HFF B;  4CS9 C;  3PMR A;  1KU2 A;  3BLY A;  4X0R A;  3ASO C;  3CP8 A;  2HZD A;  2G3K A;  1D1A A;  4CS8 A;  4P1W A;  3ZC4 A;  2VB6 A;  4ANJ A;  3HXL A;  4W8K A;  4XLA A;  4DVZ A;  3RTR A;  1VZ0 A;  3PSI A;  1JPJ A;  1WJA A;  4YT2 A;  4Y33 A;  2P6V A;  1BR2 A;  4HEA J;  2R7O A;  2VIX A;  3LMM A;  3U21 A;  5E2Q A;  1UEL B;  2R7S A;  5DVW A;  3RKO F;  1X1D A;  4XLE A;  2R7T A;  3OYH A;  2Q9B A;  3CQZ A;  3NKD A;  5B3S C;  1BR1 A;  4HSR A;  3LSI A;  4CS7 A;  3B0V C;  3H0D A;  1ZHT A;  1WJE A;  2X6Y A;  2XRH A;  4B44 A;  3KL4 A;  5KYU B;  4H4K C;  4PSW A;  4XOT A;  2DT6 A;  2IXN A;  3VSL A;  3OYL A;  2DOA A;  3PL8 A;  2VLA A;  3OYC A;  1SF8 A;  5KCM A;  3DXJ F;  3S8P A;  4ZDP A;  3S3O A;  3QMK A;  2CMP A;  4IQ4 A;  2YEV A;  3K33 A;  4EBB A;  1MMN A;  3OYE A;  5DQT A;  4CCJ A;  5CQE A;  5F5H A;  2HVQ A;  2VQC A;  2K5C A;  2VJI A;  4ZDO A;  4I44 A;  4FES A;  4U5H A;  3HUG B;  2Y69 C;  1V5G A;  3MD2 A;  4C30 A;  4MLO A;  1NZE A;  3AG3 C;  3DLA A;  2KRH A;  2WZL A;  3D5S C;  2DGJ A;  4U5F E;  3L2V A;  2IXP A;  4G7O F;  3L2W A;  3EH2 A;  4RM2 A;  1OCZ C;  1WJD A;  3POV A;  3BG6 A;  3E1S A;  4CBE A;  4NNJ A;  1D0X A;  3QOD A;  4P5O A;  4E4H A;  2R4G A;  4HG2 A;  4C2T A;  3ZRG A;  1TT0 A;  3K4L A;  4DGW B;  2VXD A;  3JRT A;  3RIP A;  1X1C A;  2M3A A;  3T4R A;  3DPL C;  4XQF A;  2J45 A;  3X2Q C;  5KNL A;  4QI2 A;  4BXF A;  2E1M C;  2CH0 A;  3DZA A;  2LYC A;  4LIT A;  4E7S A;  3AG4 C;  1N77 A;  2Z16 A;  3S93 A;  3VDX A;  2J9V A;  4ITV A;  2PX3 A;  3DU6 A;  4BJT A;  2Q2E B;  1PYV A;  2WA0 A;  2PJR B;  2L7K A;  1ZHW A;  2EIL C;  1X1B A;  2IOQ A;  4IKF A;  4AE4 B;  2CW0 F;  1KON A;  2CGE A;  4I1O B;  2CV2 A;  2WAQ A;  2DYS C;  5LD2 C;  1QZX A;  3DMD A;  1Z7L A;  3I3L A;  1WJC A;  2HV6 A;  1Z21 A;  2K9L A;  4IWB A;  4RBN A;  4CSA A;  2L9S A;  3TBI A;  2XXA B;  4X0G A;  2HNH A;  3VYR B;  2KL4 A;  2MWQ A;  3UNG C;  2DJI A;  4CH7 A;  4Y3O A;  3DM9 B;  2V9K A;  2WB7 A;  1LFP A;  1OCR C;  4BE0 A;  2Q9C A;  3FHN A;  4II3 A;  4BAC A;  2Q3T A;  4XOR A;  4PJN A;  2OCC C;  3UR3 C;  3LLI A;  2X1D A;  4BGD A;  4F93 B;  1ZHZ A;  3IAM 2;  3K7D A;  3OR2 C;  3KEY A;  2Q9A A;  4U5B E;  4DBQ A;  2NUT B;  4JCH A;  4EWC A;  3KMI A;  2LH9 A;  4WJ0 A;  4PFO A;  3H9G A;  1BOB A;  5KYN A;  3LL7 A;  1NG7 A;  2W1O A;  2WY7 Q;  4HST A;  4NQW B;  2XF5 A;  4KC9 A;  1WJ5 A;  2BE5 F;  2JD3 A;  1M57 C;  2GOM A;  2J0W A;  2V3C C;  1Z6A A;  5LFA A;  3T6J A;  3LLK A;  3DU5 A;  3CZ6 A;  1QHH D;  2W45 A;  1LKX A;  3DD7 A;  4XLC A;  1OCC C;  2VH3 A;  3W8H A;  2XF6 A;  1T0F C;  3A4C A;  3H5R A;  4LG3 A;  3GBG A;  4HEA 2;  2X6X A;  3FAJ A;  5EGY A;  1W36 C;  3K4J A;  2LRD A;  3S28 A;  3K6G A;  1RJ9 B;  4E6K G;  2IS4 A;  1UAA A;  1O87 A;  1LDK B;  3UGO A;  3MKW B;  4XL9 A;  2FGY A;  3Q6M A;  3NWT A;  4XKV A;  3AQB A;  2CV0 A;  2J7P D;  1OCO C;  1G8X A;  3IUO A;  1YE9 A;  3EFO A;  2KQR A;  1Y56 A;  3FDY A;  2JSP A;  1FFH A;  4C3E A;  3DM5 A;  3SZR A;  4K0D A;  3DPT A;  5D92 A;  5DLJ A;  4U5C E;  2LY1 A;  5FRN A;  3FKJ A;  2KQ9 A;  4Q5S F;  2IS2 A;  2L9N A;  4O7G A;  2HDW A;  2LG4 A;  4YWQ A;  2DYR C;  2E60 A;  2KP6 A;  3LNR A;  4O79 A;  3ABM C;  2JVG A;  2F5V A;  3N05 A;  1YX3 A;  2RNG A;  4K7B A;  3LSM A;  2NUP B;  1QLE C;  4KIS A;  1ZYR F;  4CCO A;  2R7R A;  4N4O B;  4MND A;  3EZH A;  2FUG 2;  4FAS D;  3OWT A;  3T6B A;  3FHD A;  2EIN C;  4Q4Z F;  3OYI A;  3OYM A;  2GFH A;  3ZCO A;  4C7O B;  3HPH A;  4OIN F;  2IXO A;  3M1C B;  3IAS 2;  3C2G A;  4Q7C A;  4OIP F;  4HNT A;  3KX2 A;  2E87 A;  4GEH A;  3HTK C;  4D9J A;  4YEL A;  3OYK A;  3F47 A;  3SYT A;  4B43 A;  2F6C A;  2MYS A;  3C2H A;  4XKB A;  1N78 A;  2KGO A;  2KMU A;  3OOU A;  4HE8 D;  2A6E F;  4BE1 A;  1HA8 A;  2JUG A;  4YRV A;  1WJF A;  3BCB A;  2XAU A;  4BE2 A;  3SEQ A;  4JZA A;  2LRE A;  3SYN A;  2JA2 A;  2BVL A;  3H35 A;  4JOM A;  1PD1 A;  4I3M A;  3ZIB A;  4IAO A;  4YJW A;  4RLF A;  2B0J A;  2VQL A;  4BEH B;  1MNE A;  3H5N A;  2R7X A;  4BU2 A;  1FFT C;  3J7A Y;  4RMN A;  3K6B A;  3AKZ A;  4R79 A;  2DCE A;  3LSH A;  4CS9 A;  4DIQ A;  4ZTF A;  3SP1 A;  2J9U A;  4LER A;  3X1O A;  5KYX B;  3A2K A;  1WJB A;  2H7B A;  4LAC B;  3NYL A;  4OIQ F;  3UMK A;  3OMY A;  3HLZ A;  3S32 A;  3DJN B;  3ASN C;  5KYW A;  2E5N A;  3LS1 A;  2O9X A;  2X6W A;  5HOO A;  2K9M A;  1Z5Z A;  1S7Z A;  2R7W A;  2MFZ A;  2ZSH B;  1K6Y A;  3LSK A;  4OWR B;  4IZZ A;  2VL8 A;  2J9W A;  3EG9 A;  2JVH A;  1Z23 A;  3RYL A;  3ONQ A;  4NC8 A;  4KI2 A;  3IP4 B;  4JW1 A;  3B9Q A;  4C3B A;  2LC2 A;  2XC7 A;  2CDQ A;  3WG7 C;  3EHM A;  3FVY A;  3Q7L A;  5KYY B;  1FMV A;  2ZFU A;  5EHH A;  2OUM A;  2CFO A;  3HKZ A;  4CCL A;  3MKZ A;  1T95 A;  3JCU Q;  2W4B A;  2IXS A;  4ZDL A;  3ABL C;  4Y4R A;  1MMA A;  2G3V A;  5DS4 A;  3OL3 A;  3Q6N A;  2E5Z A;  4DBR A;  2CV1 A;  2BW3 A;  3OIQ A;  4AE4 A;  2LOO A;  4C2U A;  3LES A;  3BG7 A;  4KIT B;  3DTE A;  3V42 A;  3H9Q A;  4RLQ A;  3OS1 A;  3EUA A;  1VK5 A;  3EUH C;  2XXA A;  2CUJ A;  1NU7 D;  2L81 A;  2A68 F;  1ZHY A;  4G7H F;  2VJJ A;  4AYB A;  3W2V A;  2PFD A;  4C3D A;  1U0J A;  4B3X A;  2WAE A;  4ZC3 A;  5BUO A;  4PJM A;  4ZTJ A;  3F46 A;  3OY9 A;  3OYF A;  3PNV A;  5E3C A;  2KZV A;  4ZJZ A;  3RCO A;  2C04 A;  3H5A A;  2VJ4 A;  2VQH A;  3DTI A;  3HG9 A;  1NG6 A;  2W9Y A;  5HNH A;  2P7V A;  3SNH A;  2Y0S A;  3CES A;  3EGD B;  4YT5 A;  2NUT A;  1NG1 A;  4PSX A;  4B48 A;  1R6R A;  2Y3G A;  3N2Z B;  4F92 B;  4QDL A;  2RRE A;  1TZL A;  3BCA A;  4QPO A;  1FMW A;  3N0T A;  2Y39 A;  2M0M A;  1LS1 A;  5FRO A;  3DQV C;  1QHG A;  3D5R C;  2PMZ A;  2VPL A;  1TR2 A;  2H7O A;  2ZXO A;  3K4N A;  2K3P A;  2CNW D;  3EGX B;  3LAY A;  4XWJ A;  3E0J B;  3W3C A;  2BVM A;  3QOE A;  4KT6 A;  4CA0 A;  2J0X A;  3PUB A;  2YHS A;  4J00 A;  3VWB A;  4NY3 A;  4B6I A;  5CPR B;  2HVS A;  2ZSI B;  4XKC A;  3TMO A;  2OC6 A;  2XL4 A;  1DGR M;  3QZC A;  2IGM A;  3I9V 2;  4XN3 A;  4F4B A;  3S3N A;  4KJZ A;  1MMD A;  4XM3 A;  2CUZ A;  4P6I C;  3K4M A;  2ZXW C;  4PK4 A;  2VQG A;  2KW3 C;  2R7U A;  2NG1 A;  1N1C A;  2WAD A;  2WVN A;  2R7Q A;  1ZU4 A;  4LIU A;  2M4E A;  3MX3 A;  4BQN A;  2KDO A;  3OYA A;  1VOM A;  4CSW A;  4KNV A;  3H65 A;  5D91 A;  3KKB A;  3SEO A;  4XLP F;  2ZXI A;  4BQQ A;  3VAY A;  3OYJ A;  4AVZ A;  3FBN B;  3MMY B;  4YEJ A;  2MD0 A;  4PUS A;  2A5W A;  3EUK L;  3K70 C;  2FFH A;  3MLG A;  4J32 B;  3W2A A;  2NUP A;  3K1I C;  2HU9 A;  3I5P A;  1DQU A;  2DXI A;  4BJ1 A;  2V26 A;  3PJR A;  2LBF B;  1FTS A;  1TWH A;  3ZGK A;  4HRI A;  3IEE A;  3NYM A;  2KPM A;  3AG1 C;  2A6T A;  4C7O A;  3EHN A;  2M7B A;  2F4I A;  3W2W A;  4E7I A;  1X4P A;  1V54 C;  2XSJ C;  3O39 A;  2V1N A;  1Z63 A;  3EPV A;  3OEO A;  3JT1 A;  3KH2 A;  2IXM A;  4JJG A;  1Z3I X;  2GOX B;  2IGN A;  4JVS A;  3BC8 A;  5HVQ C;  2D5R B;  4G6T B;  1M2V B;  2X51 A;  1ERD A;  4BQO A;  3QYB A;  2WBM A;  2XSE A;  3OYB A;  4BL0 B;  2H7V C;  4YN0 B;  4N06 A;  3G2B A;  1JI8 A;  1TWC A;  3L2Q A;  3EQL F;  5T1D B;  1Y6I A;  4BEH A;  4M63 A;  4RM3 A;  3A1Y A;  4AU7 A;  2RQQ A;  4BJ5 C;  1X19 A;  2KRC A;  2Y3B A;  2HV7 A;  2ZXP A;  4PJL A;  5E3A A;  4DVY P;  3RSN A;  2VXZ A;  3I4U A;  3NG1 A;  4G7Z F;  4AX2 A;  1WFX A;  3JSZ A;  5DS6 A;  3Q7G A;  5HSW A;  1O5H A;  1P9Q C;  5KYU A;  3EH1 A;  4KBL A;  3AL0 B;  5DS5 A;  3LEV A;  4XNF A;  1J09 A;  3F9K A;  2IGK A;  5KHD A;  4CS8 C;  3NDB B;  3CMM A;  1TWG A;  1Z3X A;  2HPI A;  2QY9 A;  4IJJ A;  1J8Y F;  3L2U A;  2VKD A;  4NC7 A;  1OKK A;  3S0X A;  4CCM A;  5L3V A;  4BJ5 A;  1AA7 A;  4CZC A;  3S27 A;  2W4S A;  4CCK A;  3KYL A;  3UMI A;  3PFY A;  3CJQ B;  3DTK A;  2UWM A;  5KYY A;  1OR7 C;  4XMY A;  1ZU5 A;  3ZXS A;  2I8B A;  4D1Q A;  2L9J A;  3GAN A;  1GLN A;  3DWL E;  2NOJ B;  2OG2 A;  4II2 A;  2DT7 B;  1X1A A;  1MMG A;  2VKH A;  1TKN A;  1SFK A;  2A1D D;  3QYF A;  4HPQ A;  2G62 A;  3AQC A;  1SAU A;  3HOT A;  4HNU A;  2HVR A;  1IZM A;  2WAF A;  4F91 B;  2BOL A;  2EIM C;  3O6X A;  4RDA A;  2J7P A;  3D5L A;  3B0U X;  3NKE A;  4BDZ A;  3VYS B;  2VAS A;  3K4B A;  1X4O A;  3NWS A;  4I1M A;  3LS0 A;  5TGT A;  4N4N B;  4E7J A;  2WZF A;  1IRX A;  4XKW A;  5T3T A;  3AFH A;  2ZXH A;  3DAG A;  1LVK A;  2WB1 A;  3OYG A;  3K10 A;  4IQJ A;  3HC7 A;  4U7B A;  3I5Q A;  1JPN A;  2X1C A;  4RD9 A;  2PJR A;  2R7V A;  2W00 A;  1VMA A;  2WL8 A;  2Y3D A;  2YZS A;  4BEJ A;  5FCL A;  4XLH A;  3OS0 A;  4XTK A;  3JYH A;  3ZSU A;  2HPM A;  2UV1 A;  2X85 A;  3ABK C;  1V55 C;  3ITF A;  1DP3 A;  3E9V A;  3EGD A;  1PCX A;  4CCN A;  2KNH A;  4BUP A;  4ZLC A;  2KJG A;  2Z2S B;  2WVQ A;  1DGW Y;  4GRI A;  4XLF A;  5CI9 A;  2M4K A;  2EIJ C;  3OR1 C;  4FX5 A;  3SEZ A;  4OIO F;  1OLT A;  2IS1 A;  3PNY A;  4GYT A;  3PNT A;  3CP2 A;  1Z3Y A;  4BJ6 C;  2ELJ A;  4FET A;  1SMY F;  3W8I A;  2QTV A;  1V5F A;  4HFK B;  4NUB A;  1VYI A;  4QI0 A;  3PHF 2;  3EGX A;  3UGP A;  3DJU B;  1E0E A;  1IW7 F;  1YX5 A;  2V7F A;  3OA1 A;  4O6Y A;  2IS6 A;  5KYW B;  2J46 A;  1ST6 A;  3LJB A;  1SZI A;  2CW8 A;  2L5Q A;  3LFU A;  4BS9 A;  2LSE A;  3HPG A;  3EG9 B;  2PF4 E;  2Z1D A;  1PJR A;  2UUZ A;  3AG2 C;  1TWA A;  4AK9 A;  4MQ9 F;  3GOD A;  1W36 D;  4OD4 A;  4ZLD A;  4YT8 A;  4CSA C;  2O5R A;  2A6H F;  4BJ6 A;  2IYL D;  3TD7 A;  2M7A A;  2P0W A;  3SZG A;  1G59 A;  2AQF A;  4EAT A;  3NRH A;  5IY5 C;  3UMH A;  2CW7 A;  2I8D A;  4ZYA A;  3K70 D;  1D1B A;  1MND A;  4XN0 A;  4DOZ A;  4JQF A;  4E7K A;  3EJN A;  3L2R A;  4BDY A;  4IX7 A;  2MAB A;  4PFP A;  2BW3 B;  4XOP A;  3RQ4 A;  1ZEL A;  4J01 A;  1RJ9 A;  2A69 F;  3L34 A;  4JUR I;  2M4G A;  2EIK C;  5HLT A;  3PSF A;  3DAF A;  2WY8 Q;  3DKX A;  3MKY B;  3OYD A;  4U5G A;  4A2N B;  3OYN A;  3OIP A;  4YT4 A;  5T3W A;  3SDB A;  2Q1Z B;  1V5E A;  4J30 B;  4CIH A;  2KLO A;  3VSK A;  1QU3 A;  3B0P A;  2LBF A;  4QPQ A;  2QKL B;  4E7H A;  3CF2 A;  3DPU A;  4JJF A;  4U87 A;  2CS3 A;  3DEE A;  3RFY A;  3EPZ A;  3HOS A;  1N75 A;  3DKY A;  4O6M A;  4KNW A;  2LY2 A;  5JHF A;  3HJC A;  4XR6 A;  4XLN F;  3ZVR A;  4O6N A;  3RPU D;  4FWV A;  1M2O A;  2W7N A;  2V6E A;  2E1M B;  4OAZ A;  1VYK A;  1W2W A;  3E70 C;  3VYW A;  2VJ5 A;  2HQA A;  1OKK D;  1D0Z A;  5CKT A;  3FDQ A;  4OIR F;  1M2V A;  5FRM A;  3AL0 C;  5CI8 A;  2L2O A;  2ZXR A;  2WVO A;  4OD5 A;  5L3Q A;  1D0Y A;  3M1C A;  3N24 A;  2OV7 A;  3H9J A;  2X1E A;  2IGO A;  3OL4 A;  5E33 A;  3M8J A;  3VYU B;  4PJJ A;  3ZQQ A;  3TL4 X;  2W82 A;  3K1H A;  3V7O A;  2V4J C;  2ZPA A;  3ZG1 A;  3L0I A;  4XON A;  2Y3H A;  2MC4 A;  3HL2 A;  3NYJ A;  2XDV A;  1PD0 A;  1M56 C;  2PP4 A;  3K4C A;  4OAY A;  2WZG A;  4U5E E;  1UG0 A;  5CQG A;  1WGW A;  3CSK A;  3K66 A;  4F52 A;  4G0H A;  5F5F A;  5B1B C;  3ECS A;  1D1C A;  4B47 A;  1NU9 C;  4E7L A;  5DQZ A;  3FBI B;  2Z15 A;  1S9H A;  3S29 A;  3VYT B;  5KYX A;  3QYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...