4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
3K6GA 3OWTA 4BJ5C 3CZ6A 4BJTA 4BJ6C
chains in the Genus database with same CATH superfamily
1XTAA 2M0CA 4IJAA 3FDQA 4GDFA 1G3WA 3NMKA 3RPUD 4A3LJ 4IQJA 4JX5A 2Y2ZA 4PSXA 4RS8A 3TW6A 4JTCB 4B4CA 2AVKA 3NMIA 2IPQX 1FIPA 2R7FA 2JX0A 4IRHA 1W1WE 3QU6A 4YIRX 1JPJA 2J46A 2M0MA 2RKHA 3BR0A 2HYJA 3M1CB 2NXNB 1ZW3A 3CC7I 1YA9A 4A3JJ 3M15A 2L2OA 3HPHA 2F4OB 3LAJA 1OR7A 3T6GB 4E6KG 5EHHA 2F2EA 2LLKA 2B9SA 3R2PA 4MO7A 4Y7NJ 3L2QA 1R71A 1SFOJ 4C3EA 2WZLA 3ROUA 1RKWA 4HOBA 4UB8C 5IY5H 1QZXA 3K6BA 1QPUA 4U0VA 1YJNI 1OCOC 4BJ6C 3MZHA 2OF7A 2Z16A 3FK6A 1TC3C 3G1LA 2A0BA 4RD9A 2FJ1A 3VYRB 3JAMK 1SFEA 4A3GJ 3U9GA 2PJRB 4GYIA 1G3SA 2DN0A 2PX0A 1VYIA 1RR8C 2I8BA 1MJBA 4EBKA 4J32B 1WJBA 3ZGKA 1D1CA 1OFCX 5EDNA 5JFRA 4L5JA 2XLHA 2STWA 2A1DD 2KIFA 3M4BA 5F0HA 4GO1A 1FT9A 2JPBA 4I99C 1OQCA 5TRDA 1V55C 2DQLA 2G3VA 5EGYA 2NUTB 4MQ9F 2BZTA 3E3VA 3C62A 2J0WA 4AIJA 3BQZA 5EGOB 1RPWA 2W45A 3RPUA 2IM8A 3SYTA 3SEOA 2P0WA 3GFLA 2GAQA 1NU9C 3F47A 4BYYA 2JUGA 3F6VA 2WC2A 1I50J 4D7MA 2BYVE 2IS6A 1XMXA 2XAGA 2YPRA 3ONQA 5E3NA 5JHUA 3JRHA 3G3ZA 4L5EA 3B71A 4NUBA 2J9VA 1QKRA 3ABLC 3VB2A 5FKOA 1SFXA 5L0IA 3GCMA 3WTTC 3JCUQ 1FR0A 4MFDA 3R61A 1U0JA 2Y0MA 4I2OA 3FOOA 1MMDA 1P2FA 3HHGA 1HF0A 1SR2A 5J1RA 1Y8RB 256BA 2OJQA 4L0YB 4OD4A 5A6KA 2DO7A 3JRDA 2E2IJ 2J45A 4XPYA 1WOLA 1FOXA 2L6HA 4H4KC 5HOOA 3QOPA 4EJWA 1HMOA 3U0CA 3HB9A 3I56I 2ISZA 1FNNA 1X2NA 3H3UA 1ZU4A 3RVYA 2MHRA 4XN0A 2PBEA 3GEHA 2Q7RA 5DYMA 4OMYA 3ECHA 2BXZA 3Q7LA 2X1CA 4G6TB 2GQQA 1Q0GA 2ZO4A 3M8JA 1BDJB 5A69A 2O03A 3G1MA 4CGZA 2WVNA 3LEVA 2LFDA 3K4BA 3RI4A 4PFOA 4B47A 4C3DA 2HKVA 2IVMA 3C2GA 3EUHC 3HUGA 4D0PA 1E3HA 4E7SA 1XSVA 3NKEA 3IP4B 1V3FA 5LGUA 3DFGA 1IN8A 4U0YA 1ST6A 4DJAA 3U5SA 3BWGA 5D8KB 2IRFG 4HAMA 2WVQA 1EH7A 1GV5A 1TWAJ 2FF4A 2VKEA 4FISA 5K7ZA 3G73A 1MIJA 2W24A 3LMMA 4HEA2 5HLIA 3PO3J 1YOVB 1XZPA 4AYBN 2Q8KA 1X1AA 3I4NJ 2FUG2 4FCYA 1R4NB 2MWQA 2WAEA 4P9FA 2OG2A 2KL4A 4G7HF 2E19A 1IRFA 3SJMA 3DZAA 1ZHWA 3KMIA 5A2QK 1XGOA 3E5QA 3FK7A 4NC8A 1Z91A 3CCYA 4Y13A 1FTZA 2JA8J 4MTEA 4M9SA 1OCTC 2IT0A 4Q4ZF 4U9EA 2OTJI 2XAUA 2ZJ2A 5J8CA 2Q2EB 1ZARA 1F36A 3PUFA 4RAYA 5J6XA 2A61A 5COGA 1Z6RA 5BPDA 2OJED 2ZBKA 4LERA 2IAIA 4XPWA 2EPFA 4P9TA 4NDLA 3AOUA 3FISA 1LM3B 3L1MA 1ZTRA 1HA8A 4ZYHA 4KIGA 2ETSA 4MLOA 2FU4A 2KRCA 2JVHA 3KP5A 3C18A 3S93A 1S72I 4PDKA 4QLCU 2W9YA 3LSTA 1XPXA 1EV7A 2IA0A 3K1PA 2P8TA 3MMYB 1P4XA 4LLLA 4JJFA 4ZC3A 1QPIA 4LG0B 1YA7O 1ON2A 3OEOA 3KYLA 5JI6A 3LSPA 3GBGA 3HOXJ 4IJJA 3N4MA 3QQAA 1GVJA 1Z7LA 1LEBA 3NKDA 4Z9JA 3H3VK 1OCRC 4FAPB 1P4WA 3KZYA 3ABUA 1SVLA 2IW5A 5E3LA 2Z1DA 3C2HA 4K0DA 1LPEA 2VKDA 3RKOF 1G3YA 2L5QA 3MVPA 3LA2A 1XWJA 3W8IA 3Q0UA 1TKNA 4N4NB 1FBUA 4KA4A 1X1DA 1OW8A 3GZNB 2NRAC 3AL0C 4LLEA 4UVBA 1EKEA 5E18F 5JVEA 2TMVP 3WGGA 1NTCA 5LRSA 1U3EM 1U78A 2GWRA 5H6RA 3E9VA 1VQKI 2MG4A 2LKPA 1GS9A 3V7CA 4ZYAA 4N9IA 2JMWA 3D5RC 2XF7A 2NVYJ 2XVCA 1FC3A 3N24A 5FB2A 2XRLA 3V7SA 1W0UA 1ZHZA 1YARO 2CO5A 4XPXA 1RNLA 3OYAA 4V2FA 1MH3A 3AFHA 4U5DE 1NG7A 1EA3A 3CAXA 2R0QC 5J1UA 1SFKA 1N25A 1MBEA 2X0CA 3LA7A 1TWCJ 2AQEA 2E7XA 4AYBA 2GWWA 2DT7B 2J5OA 3FF5A 2DMNA 4BUPA 2IS4A 2P6TA 4UV8A 2YU3A 3C7JA 2XB5A 3UMHA 1DGRM 3RYPA 3CCMI 4BE1A 4JZAA 5M5YJ 3S28A 3VDXA 1ZGAA 1T08B 5JHFA 2PEXA 3LFKA 2ZFWA 4KNYA 4ZDOA 2HWVA 5EJCA 2GLOA 2QE9A 2ZXOA 4CHUA 3HNIA 3JYYA 1MSFC 1ETKA 2VT3A 4ANJA 2A5WA 2NS0A 3DJUB 3V7RA 1DU0A 3DKXA 4LG3A 2XLOA 5CQEA 1FX7A 3TDZC 3K70C 1BIBA 3BG3A 2KQ9A 2IGKA 3NARA 3M1EA 3C63A 3FXMA 5DCFA 2IS1A 4KITB 3W3CA 3A01B 4M9XA 4DYRA 2CS3A 2CGPA 1SAUA 4XM3A 3CMYA 2EPNA 2XAFA 4LITA 1H89C 2EIKC 1K7AA 1GQAA 3OY9A 3POVA 5M3MJ 2QQ8A 2Y3BA 2HDCA 5DCMA 1LE2A 3CMEI 2NVTJ 4IOAF 1R22A 4OD5A 4C3BA 2GDCA 4U9DA 2I5UA 4NTAA 4R8HA 2ELKA 1P9QC 3E6BA 4ON0A 3SXYA 2W00A 3HOSA 2KP6A 1KQ9A 5KYWB 1IG7A 3W8HA 3CJTB 1ZQ3P 4C2TA 1J8MF 3NRVA 5F1RA 1LUJB 3M9AA 1T8IA 4CYCB 2KDZA 3VAYA 1TT0A 2EFOA 1RETA 3Q5FA 4HW0A 2LFFA 4HX4A 4R1HA 3C8GB 3OSFA 4AIDA 3ITFA 2IGMA 3J7YJ 4ZJZA 4YT8A 5F6FA 3GM3A 2WV1A 4C3JJ 2VKHA 4AD9A 2LSEA 1X58A 2EILH 5CI9A 1W7PD 2OCEA 3LESA 4KI2A 5TISC 4BGDA 3GTOJ 4OIPF 4RLFA 4LLGF 4ETSA 4XRFA 5KK1A 3WTYC 1QQIA 2M1BA 4PSWA 4WXDA 1BC8C 4YL0A 4IRIA 4WXHA 3RQ4A 2ACJA 2KRHA 4CJGA 1YZCA 2V1DA 3G4ZA 2XM4A 3M07A 4A3MJ 1SFUA 1VLTA 4LIUA 4OMZA 3F23A 2DA4A 3RDIA 3JR9A 2YS9A 3CZ6A 1DPUA 1ONVA 1UJ8A 3U8PA 1S7ZA 3BTCA 3EQLF 4DIQA 3I5QA 2RV8A 4IGGA 4UV9A 2XHKA 4NQWB 3CESA 1WI3A 2HKXA 3MN2A 3KP2A 3WG7C 4YRVA 4GCVA 1S7OA 4XR6A 3R4KA 1GXQA 3LSHA 1T9KA 1MQVA 1I1GA 4E4HA 2IXNA 1OCZC 3TOBA 2OCCH 1I1SA 3RKQA 2M4EA 3HC7A 1SZIA 4O3MA 4MS2A 4XQFA 4LB5A 2J7PD 4ZLCA 5BUOA 5B66C 3KE2A 2YLIA 2ME6A 3RSNA 1IC8A 2D1HA 3TD7A 1DU6A 2BY3A 2ID6A 1W7PA 2XB0X 5KVRA 5CPRB 4ZH4F 5CVUA 3S84A 4XKWA 2ZXRA 4DVYP 3HZJA 3B0UX 2H94A 3HRMA 3ERMA 2QKLB 2YLDA 1O57A 5AC4A 2MA3A 1PJRA 1T56A 5HODA 3OWTA 4IRUA 1QRYA 2D5RB 2FAPB 2YL0A 1FYKA 4BBSJ 4XOPA 3HJCA 5B3IA 1MW7A 1YX5A 2V9KA 3MD2A 3J80Z 3QWLA 4RLQA 4RAZA 4DVZA 2E71A 1NG1A 2XGEA 3F8MA 5M5XJ 3F8CA 4PK4A 5DUIA 3KP6A 3OYGA 1V5FA 4KN4X 2FBKA 4BJ5C 3CCQI 2YUSA 5GP9A 3FKIJ 1OJLA 1YQAA 3HG9A 1DOWA 2P81A 4XLAA 4BJTA 1QVUA 4D5FA 2AHQA 2E2HJ 3K1IA 2R5YB 3RKYA 4XMYA 1H0MA 1BI1A 1S5LC 4BQOA 1APCA 2W4MA 4QSHA 1IAWA 2JVGA 3CP2A 3ESWB 5HVQC 1RUNA 1M1EB 2R7SA 2CUEA 2LF7A 3AG2H 4P6IC 1Z3YA 2P6VA 2KFDA 4F55A 3LS0A 1EI7A 2J7PA 4ENMA 1H9GA 1HKSA 2NUPA 3MKZA 2VJ5A 4UB6C 1E83A 1LFUP 4IKFA 3A2KA 4PJ0C 4H0EA 1I4ZA 3OR1C 1LIHA 5TGTA 5LLQA 5E3CA 3F8BA 1WI9A 3I71A 4AL0A 3DKWA 1V5EA 1YIOA 3OYBA 2DB4A 4E0HA 2YQYA 2VQHA 4K2EA 5B1BH 1XDUA 4MFEA 3H0DA 1KYZA 3HGGA 2R03A 4IHVA 4EIYA 3SQNA 2V4JC 3OYFA 3GXOA 2JTVA 3DJNB 3F9KA 2DQRA 5LHGA 4YFXF 3J81Z 2HZDA 2O9LA 1YYVA 3FIWA 3T6JA 3EETA 1VQ9I 4NNJA 1XG1A 2PQ8A 2Y69H 4FE7A 4BAYA 2WA0A 2DK5A 3IPMO 1ZGJA 4ZDPA 2XAJA 4C3IJ 1PP7U 1YRNA 3ATPA 3LS1A 3U9JA 4QDLA 5FROA 1ZG5A 3U2MA 1YJ9I 3TO6A 3EFOA 2OA4A 3LOCA 5FKNA 2VPLA 4YK5A 3ZQYA 1HMDA 2CUFA 1B6AA 2KHMA 3BTJA 3GMEA 3K4MA 1QZEA 4EGYA 2XM0A 2XDVA 2L4AA 2R7ZJ 2OC6A 1WVRA 3QAHA 3CJRB 4DOZA 1N77A 1MNDA 5L0GA 2K86A 5IT9K 2KJGA 4R32A 3TGNA 2R9RB 5FKKA 3T4RA 3DU6A 1NFOA 4XLEA 2L7KA 4AM3A 1PV3A 4HNTA 1K78A 1TW2A 3J7ZI 2R7QA 2FNAA 3D5SC 2O5RA 1WJ5A 2OQRA 4B3AA 2OKUA 3NYJA 4ESFA 1L3LA 1I3AA 3LNQA 3BOQA 1IO2A 4MHGA 4XLNF 3W2WA 4PGHA 4A12A 4YFNF 4DQ2A 5CKTA 5ICEA 2Y3HA 1SEUA 2XLDA 3CDHA 3SZTA 1W5TA 2P5KA 1CGOA 1RR7A 3HYIA 2X85A 4XNFA 1TZLA 4DGWB 3G2BA 5K7HA 3CLQA 2JA5J 3A11A 1FLIA 4MNUA 3PUBA 1A35A 4KT6A 3FWEA 3Q7GA 1IRGA 2BY1A 2CQNA 5FRMA 4I7HA 5FLXZ 1T6QA 2K3FA 1JUMA 3KEYA 1FYLA 1O3SA 2BY0A 1XCVA 2AXLA 5AIQA 5E20A 3S1QJ 2WTEA 2EILC 1RKCA 2XL8A 1F9NA 3KPHA 1BR2A 1LQ1A 4NC7A 1VFCA 1QBJA 3PNYA 2Q4FA 3AG1C 3NQOA 4NC6A 3EGXA 4M3BA 4QI0A 3I3LA 4BJ6A 3ZQ7A 3KP3A 3EUAA 2C6YA 3TP0A 3EGDB 2KZGA 3S2DJ 1LE4A 2DYSC 3DEUA 4PJJA 2M45A 3VYSB 4JP0A 5L3CA 2EPLX 2MH9A 1D0ZA 4NTFA 5E2QA 5TJ5E 5L3QA 4JX6A 1GM5A 5HS7A 2HOAA 1IN4A 3CUQB 4G6DA 2ICWG 4BJ1A 4Y33A 4J7YA 2P7CB 1IN5A 3MZ8A 1YAUO 1F1ZA 1OXKA 2IBFA 4I6ZA 3FDYA 2M64A 1T39A 2OQGA 2LBFA 2XGXA 3A0HC 3DQVC 4MGRA 3RYRA 4AE4A 2WY7Q 1GT0C 4IOCF 3S0XA 4CS8C 4PFPA 5ILVA 3S16J 3GORA 3RJPA 5EG0A 1U6GA 1KU3A 2X6XA 4CIPA 1T2KA 3MFKA 1Z5ZA 3ABTA 1PUFB 1ZREA 4LDRA 4W1UA 4KDPA 3GLLA 2LFBA 1ZHTA 2EIMH 3W2AA 4N4WA 1OW7A 2OEXA 1WQ2A 2L7AA 4KIBA 1C02A 2EWNA 1XCBA 1FYMA 1IUYA 1VOMA 5GTIC 1OYYA 3KYJA 3LWFA 2IOQA 4QPOA 5FKMA 4OOIA 4IVNA 3I4MJ 1JI8A 4HQMA 2R05A 3ZG1A 4GXOA 2VIXA 4BH9A 5T3WA 2XXAA 2BHZA 3CF2A 1MDMA 3S14J 1A7EA 1R23A 3JRFA 3V8JA 3VRCA 2FQ4A 3ZMZA 3DV8A 1P4AA 2JD3A 3H2UA 3FXQA 3AGTA 4U5HA 4F4BA 3GWZA 1T6UA 1HSJA 1BI0A 1U5TB 5KAFC 2RD9A 2EINH 4KIFA 2QF7A 5KAIC 4ENJA 1VQPI 5C4XJ 4NCQA 2R92J 2E1MC 4RBOA 5EZGA 1VTNC 1FBSA 4DRHB 3HOYJ 3EUHA 2BEOA 1S7AA 3CP8A 4IXAA 4IQ4A 1MBJA 1W0TA 3CD6I 3WGHA 2KSFA 4KJZA 2HPIA 5T1DB 2UV1A 2XROA 4N0BA 2H1LA 1D3YA 5M5WJ 3IAS2 4CCJA 1K6OA 4ULVA 1LNWA 3DCFA 5CVVA 4JCZA 1ZK8A 1XGSA 2DA1A 2LK2A 2RGVA 3WG9A 1R4MB 1Y6IA 4DYCA 1TFKB 2Q9BA 2KW3C 2E2JJ 3OS0A 1QGPA 2VI6A 2XGDA 5ILUA 2E35A 5HLHA 4LOCA 3TQNA 4HDVA 4BXUA 4FX4A 4IHSA 1RJ9A 2QTVA 2Y30A 1H7IA 1ZVZA 4G0HA 2ZKZA 3H9GA 4UNOA 1FBQA 2KIQA 1JUSA 4IPAA 2AP3A 1ZLJA 2HMZA 5B1BC 1I5NA 2WB1A 2IYLD 2DOAA 2V9VA 5K0IA 1OMIA 3OYKA 2KPMA 4AC0A 2XPWA 1DP3A 1LDKB 1MMAA 3QPLA 1C17M 2L3DA 1IXSB 3R0JA 4EATA 1RKEA 3K69A 5AGFA 2VN2A 1V54H 3VFZA 1OCCC 1P6RA 3EYIA 2BY2A 3KYIA 2DDAA 3KLOA 1TWHA 3MLGA 4E7KA 2JPUA 5JUAA 1UB9A 4DZJA 3L2RA 1CF7A 1I5ZA 4UUSA 2CDQA 4YT2A 4EBJA 1IV8A 4ZZDA 2KT0A 4OIOF 4XRSG 3GODA 2L81A 4KFCA 2R5ZA 1O87A 5K5OA 3FXRA 2K4BA 2IGOA 4CO8A 1JKQC 3OYMA 2V26A 4BE0A 2XLVA 3I5PA 3L2CA 1ETQA 4RDUA 3GTJJ 4HF2A 1TR2A 4DNCA 3IKTA 3U3FA 3SXZA 1B72B 3MX3A 3I55I 2VLAA 3HKKA 1POGA 2IGNA 4X6AJ 3OYHA 3ZWIA 2XIGA 1FY7A 3L09A 1FMWA 3OYLA 3K70D 4EMSA 2B63J 4U87A 2DODA 1USTA 1UZCA 3CO7C 2WAQN 3GTKJ 2ZXHA 5BQTA 1RESA 5JVGF 2RC4A 1LE8A 2PFBA 2RREA 2QVOA 2RSEB 1D1AA 1P7IA 2CSOA 2R7TA 3ZTMA 1BW6A 4JURI 2DMQA 1RRJA 2M30A 1WJFA 2B0LA 3RPQA 3U8VA 4ZDLA 2O8KA 3FMSA 2HVRA 2I15A 3ASNH 5J4YA 4KYWA 4XRSA 3DAGA 3S29A 4L9TA 4ER9A 3HTUA 4X0RA 2FRHA 1WPKA 3PQJA 2WB7A 1JOGA 1W4MA 3D5LA 2NS7A 1UG7A 2KDOA 4YEJA 1PCXA 1HW2A 3I5UA 2VL8A 1JMWA 2EH3A 3BJ6A 3ZQHA 3KKBA 2VPRA 3KIOA 2VC1A 2MD5A 5FFZA 1M56C 5GPGB 2DA2A 3PSIA 1VB5A 3HNKA 4HBLA 1JKPC 2EPMX 3JSZA 3LEOA 4YT5A 1WWXA 3DPTA 5DD4A 1G4WR 4PUSA 2ZXPA 2UWMA 2V1XA 1NG6A 2VT2A 1ZYRF 4HSRA 4FETA 1YI2I 4LD5A 2W7NA 1XSDA 1YVIA 2XSJC 3JAMZ 5BQGA 2W57A 1ZHFA 3OYJA 2HDDA 3ZSUA 1K61A 2ISYA 2CGEA 2E34A 2HYGD 4HZFA 2MC4A 2O0YA 2FSWA 5FLVA 5F08A 1KNYA 4U7DA 1NZEA 2C04A 5DM7F 2JN6A 1FPQA 3MBGA 5DUKA 4XICA 1Y0NA 1BI2A 1DP7P 3C8ZA 2JJ7A 2M8GX 3DWWA 2LR8A 1Z3XA 3Q0WA 3RZOJ 3X1OA 1SD6A 2VJJA 5EEGA 4BACA 5FD5A 2LIGA 3HOVJ 4YL1A 3F72A 3FM3A 3WU2C 1HW5A 5K5RA 3PIPF 4KUMA 3SZGA 3H65A 1R5ID 5JSLA 3HKZN 4CH7A 1A31A 2JA6J 3HRSA 1VQLI 3DP7A 4UUTA 2J5PA 3NRHA 1ETWA 3QP5A 2PX9A 5E33A 2WWYA 4G78A 4BG0A 3BY6A 1B8IA 1G59A 2GIZA 4CCKA 4A3EJ 4BU2A 2DGJA 1HE1A 2V6EA 2MH2A 3JRMO 2EK5A 4G12A 3SHFA 5COMA 2BE5F 3L7WA 2X1DA 3S8PA 3CO6C 2XRNA 1QPMA 4B09A 2WAQA 4KMFA 3A02A 1QHGA 1XB4A 1R4TA 5LD2C 4CCOA 4EM2A 2OOCA 3ZIBA 3T6BA 4CCNA 2QA4I 4PJMA 2VBXA 2L7ZA 1IDYA 4XK4A 2STTA 5CI8A 3CDLA 3QMKA 2XLEA 2ZXJA 2PN6A 2X4HA 4CXFA 2XKPA 4CS9C 1ZZPA 2P1AA 1ITYA 1HKTA 1R5GA 3TOAA 1BOAA 3GZ5A 3P7NA 3TQOA 3VOEA 1XD7A 3GTQJ 1HQCA 1YW7A 2P4WA 1HC8A 1ZHXA 1ZHYA 5EEHA 4JEBA 2IA1A 2R3SA 2EZIA 5HLGA 5CIVA 2KMUA 2CG4A 4NHJA 2XPUA 3GEZA 2DLLA 4BHCA 2R7XA 2GXBA 3JTLO 4FESA 5D5XB 1JXSA 2W4SA 4M9ZA 4HLXA 4MNDA 4BEJA 2A6TA 2BW3A 3OOUA 1JKRC 2X51A 4O6YA 2UUIA 4J19A 3VSKA 3OS1A 2Y48A 3H5AA 3JRGA 4BXXJ 4A93J 1AVOB 4LK1F 1VNDA 2CW8A 3RW0A 3K66A 4WGZA 4PGGA 4LB6B 1A7VA 1KTMA 1HY5A 3BQYA 2QZ8A 3K4LA 4JEAA 1ZH5A 5LBQA 3M3YJ 2XUBA 3PCVA 2L02A 2RNJA 2Y75A 3OMYA 4CX9A 3FVYA 4QIWN 5A2QZ 3IWZA 3FMQA 2A3SA 3TOLA 4ZYGA 1VLSA 2CH0A 4LGWA 2JUCA 3IQ5A 3HKZA 5EF6A 2KGOA 4EV0A 5BMZA 1XX5A 3QTHA 3K1HA 1X1PA 5FCLA 1YW8A 2UUHA 4XLHA 1ZGWA 1PD1A 5KNLA 3EJNA 5L0CA 4WX9A 2OU2A 1EKYA 4D9JA 3DEWA 3HUGB 5J40A 1MH4A 3MWMA 2D45A 2E1CA 1SMYF 3WHNA 1VK5A 4HFFB 2ZCWA 1R1UA 1Y1VJ 3S3OA 2FOKA 1WFXA 2WAFA 4E7HA 3KH2A 3BR6A 2ELJA 3WHBA 4YJWA 2RNGA 1L3PA 1WN0A 4RB3C 2ME0A 3BZKA 3D1NI 3TMOA 1JE8A 4JW1A 1WTYA 3LJBA 2IS2A 2L6FA 4I0BA 3IQTA 4HSTA 2VUMJ 4LDKA 4MVSA 3S1RJ 4U5FE 4BQNA 3ZVRA 5GPAA 2LK4A 2Q00A 4BJ5A 3FXUA 1BZ4A 2XLWA 2XC7A 1M2VA 4JE9A 1E84A 2MGQA 2XL6A 3L0IA 4HFKB 5D5WB 4A4AA 4RMNA 3OIQA 4UXNA 1Z9CA 4JK1X 2VQLA 4B43A 1R49A 3FKJA 4G7OF 2B0HA 2FBIA 1OYWA 5GAHJ 1QSPA 2QM3A 3N0TA 1S8NA 1TP4A 2F5CA 5EK0A 2MYSA 2QKMB 4A3FJ 2JK3A 4D7NA 2BL2A 1JPNA 3AKZA 2XS8A 4HEAJ 4ZYEA 5L3GA 4XQ1A 3N2ZB 1IN7A 3JTHA 2X1EA 4QPQA 2F6CA 3CCRI 1Q1VA 3O8GA 4J7TA 1EH8A 3E1SA 3HSRA 4Z6YA 2XPVA 5BOXA 4V19K 3K6GA 2AO9A 1ZR4A 1GUUA 3CQZA 3S1NJ 1E17A 2R02A 2KJBA 2IXPA 3BR2A 1RXQA 5IY5C 3MFNA 3CUOA 2CQXA 4A2UA 2OU6A 3GUDA 4CZZA 2QLAA 5FKLA 3FXJA 5IP9J 3PFYA 1OXBA 4GYGA 3JRIA 2V9PA 4IB4A 2NS8A 3V5ZA 1U2WA 3HRTA 3O3KA 3H36A 2A6EF 1S3JA 1DUXC 2XASA 1GHCA 1WKMA 3HEFA 3S15J 1N1CA 2DFEA 3K10A 1USSA 3QPHA 4BL0B 4HF0A 5AIPA 1LB2A 2M9HA 5ED4A 1ZLKA 4FE4A 4LLNA 2YKZA 1R5HA 4DBRA 1UCRA 1RMVA 4IAQA 4A3IJ 5KCMA 5DQZA 4E18A 3MYIA 2L4MA 4M3DA 5K5QA 1PUEE 5JLIA 4RM3A 1R58A 3REOA 2K9QA 3HPGA 3DE8A 3L34A 4IWBA 1BOBA 3GWNA 3BROA 5HNHA 2FQ3A 1QA6A 3I59A 3RQEA 2QSHX 1Z77A 1HBXG 4DJ9A 3WGIA 5E1XA 4M3GA 3I4UA 1MBKA 4A3KJ 1JJ8C 3MEXA 4EJUA 5JP7A 5BS6A 3CF5F 3TOMA 1RZ4A 2Q0OA 2NOJB 2EJRA 2RAEA 3ASOH 3CCLI 4ZZLA 2AWYA 2LMDA 2CFOA 1T6SA 1ETVA 3AG3H 2QSGX 1XMAA 1LDJA 4XONA 3FAPB 5H6QA 1Y0UA 4XL9A 2MLGA 5E8IA 2PI0A 1OCPA 3DU5A 5LGNA 4AVZA 3K0LA 3ABMH 1YO5C 2F48A 4JX4A 4XLFA 2LC2A 1D1BA 3H92A 2NSGA 3V8KA 2PP4A 2HKOA 4CUGA 5DCMB 3SDGA 5HLTA 3WU0A 3CC4I 3PDMP 3NDBB 1TWGJ 2V79A 2Y39A 5BPIA 4RDAA 2AQFA 3ZMUA 4Q5SF 1SD4A 1J8YF 2Y9ZA 3PJRA 1AHDP 1SD5A 3DM5A 2OPTA 3L8IA 4QI2A 2JSCA 2DU9A 1ULYA 4C9YA 4XIDA 4YN0B 2QYOA 2CCYA 1U8BA 1ZW2A 3G71I 3W6JB 4UY8I 2J9BA 2MFZA 1D5VA 1Y56A 4NBQA 1R00A 3T0YA 2NVUB 3QU3A 1LEAA 3Q9VA 5DTDA 4E0IA 1Y39A 4EHPA 1YTYA 5KYUA 1JAFA 3ZMTA 2FXAA 5CYVA 2DA3A 2K9LA 3A4CA 5EEAA 3DKYA 2W25A 5KYYA 1B1BA 3CCJI 2VB6A 2L9JA 2Y0SN 2FX0A 4X1EA 4O5VA 5GADJ 4CS8A 1Q1HA 5F27A 3RF3A 3ISPA 2EV5A 4HNVA 1HLVA 3T8TA 2IEKA 4A3BJ 2DOEA 3QOEA 1HOMA 3WAQA 2KRFA 1NSGB 1VYKA 5BQIA 4XLPF 1TWAA 2VE8A 3RKWA 4CDAA 5KYXA 3H1CA 3EG9A 4B6IA 4CDYA 4CIHA 2F5FA 3BG7A 2A69F 5A6BD 5L0JA 1JGSA 1D5YA 1NU7D 3CJQB 4DRIB 2Z15A 1O3QA 2W82A 2HU9A 1YLMA 4C7OA 4QTRA 5HS9A 4XSXF 2WZFA 4WK8F 4II3A 3IRQA 3RH3A 3FXOA 2LY2A 3COAC 1B9NA 5D6FA 1K4SA 1NHAA 2DFFA 2NNNA 1K79A 1WHUA 3A03A 3L8JA 3IQ6A 3KEOA 2BHYA 1H6GA 1TQMA 5J4VA 1U9NA 2LP4A 2PMHA 5D92A 2CQKA 5DEQA 4IHWA 1ORJA 3WU1B 2ZPAA 1TNTA 4UUVA 3VM6A 5E3AA 5D8LB 2HTSA 4IF4A 4JYKA 3CCUI 3GEEA 2Q1ZB 5DD8A 3AG4H 4RB0A 3GTPJ 4NTBA 2NG1A 2YSRA 1PYVA 1OQYA 2H6CA 3T8RA 4OAYA 3H0GJ 3Q6MA 4K7BA 4E7ZA 1LI5A 1SYQA 2DTRA 2W1OA 1KZHA 1IV6A 2P0NA 1W7PB 2CQQA 2NOGA 3K4KA 2ZMEB 3IH4A 4XLCA 5FGMA 2O61A 1D8JA 2HJ3A 3ZDLA 1WGWA 1STZA 4I44A 1HDPA 4BEMJ 1X3WB 3H3ZA 1APLC 3JCUC 2HXOA 5A6AA 2V7FA 1XN7A 3EYYA 2CRGA 4PCQA 2MD0A 5A6BA 3JW4A 2NNYA 4CDGA 4LK0F 5B3SH 3LAPA 4JJGA 1Z63A 2TDXA 3BT9A 3OIOA 1XGNA 2BVMA 5EYRA 5HDGA 2K9SA 1RIOH 3BJAA 4I01A 2JWTA 2P7VA 2Y0SA 4PR9A 2IXOA 1ETYA 1S9HA 3IH2A 1CQTA 2KNHA 4OAZA 3DPLC 1Z21A 1MD0A 3E97A 3IAM2 4EVIA 4AUXA 1HE9A 1I27A 1MMSA 2WBMA 1GGQA 3E5XA 4E7JA 4JC7A 4JRZA 1K83J 1IN6A 2CMPA 3BPVA 3TW7A 2L9NA 4RGUA 1LDDA 1A6QA 4GFBA 4CSAC 4D5CA 2MBFA 1MNMC 2VCCA 2NUPB 1GLNA 2UUZA 2DOFA 2G7UA 1TQIA 4BNCA 1VQ6I 3JZ0A 3QW0A 2HR3A 4I76A 2HFHA 4ULWA 1MZBA 3DLLF 3GFMA 3M79A 4BKXA 3EZIA 2COBA 2L0KA 1HSTA 2KYHA 2GXGA 3NWSA 3KEQA 5FLMJ 1NH3A 4D4NA 1FMVA 2DCEA 1X3UA 3BC8A 4HNUA 3E6DA 1T5OA 2W4BA 4LDQA 4EKWA 1VTMP 4X0GA 4G7ZF 1NLXA 4IX7A 5IT9Z 3H5RA 2C03A 3QZCA 4JBAA 2K4JA 2OV7A 4YL3A 2VODA 1FFHA 4XORA 4A2NB 5J8FA 2EV6A 3ZPLA 1WH5A 2DT5A 1DQUA 3TKYA 3UGOA 4U5GA 3ZQGA 3SZRA 2EIJH 1V4RA 1SMTA 3JTGA 4C30A 1TBXA 1WH7A 3DE9A 3B73A 1OW6A 1VQ8I 4RA2A 1YZAA 2QENA 4RB1A 5AONA 2E87A 2YHSA 1YRNB 3G4XA 4RGSA 4OIQF 4WWCA 3HOTA 1VQ4I 3DTIA 1P92A 1A41A 2M4KA 4HLYA 3FHZA 4IRGA 3GTLJ 5IT3A 3SFZA 2D1VA 1ORSC 3EFOB 3M8FA 2DT6A 2PF4E 2G0EA 1X1BA 3TJ6A 3E7LA 4HX8A 1AUEA 1Y8QB 4EM1A 1H88C 4I1OB 3HTSB 3FXHA 4EEFG 1E0EA 3EUKL 1Z6AA 2JT1A 2HJMA 2M4GA 3RIPA 3WTZA 2LKXA 3GM1A 1IZMA 2LCHA 1BR1A 2L9RA 2P61A 3ZP5A 2CQ7A 4I0AA 3TBIA 1K78B 2B7EA 1UG2A 2LTPA 2KIUA 2X6YA 3RYLA 3GVAA 2WV0A 1PP8F 1WJAA 2HOSA 1FJLA 3OYEA 3SNHA 3KP7A 4MTDA 3B02A 5DS4A 1BBHA 1FP1D 1ZRDA 3BTLA 1K04A 3U2RA 1WATA 4B1RA 1Z05A 2F5VA 1YG2A 4YFKF 3BEHA 2WB1N 2M7BA 4BEHA 3OL4A 2OCCC 2DPUA 4FX5A 1CPQA 3R6SA 2TRTA 3LSRA 3BR5A 3Q9SA 2QBYA 4CZCA 3NYLA 3NWTA 1VMAA 2YL7A 2MLKA 1IZ1A 2RDPA 3WTWC 3ZN0A 3QW1A 5GAEJ 2OAZA 5E79C 2EFWA 3GTGJ 1LS1A 3I9V2 3EGXB 2VQCA 3QYEA 2YLGA 1U0BB 3DTKA 3VF0A 5ERIA 4RM2A 1GV2A 1TL8A 2LNBA 2KIMA 5K7FA 2AS5F 1X4PA 1AKHA 2EB7A 3QP6A 3ZN1A 1YJWI 2HEOA 2QCOA 3S2WA 4A3CJ 4HQEA 5IOYA 4CS7A 3GYHX 5ICFA 1BIAA 4XKVA 3LQRA 1SVOA 2ID3A 4S05A 3M4OJ 1BM9A 1V74B 4CS9A 1YYJA 3IKVA 4LACB 2E1OA 2ZXIA 3BRJA 4II2A 2OEVA 2RQQA 2KZVA 5IYDJ 2DFHA 2LBFB 3RZDJ 4AE4B 3MZYA 2EFNA 3GF2A 1OLTA 1T01A 3L1PA 2HZTA 2EPOA 2J8WA 1O3RA 4L6RA 3RKXA 1DGWY 3TO9A 1K6YA 4ABZA 1WGXA 2PMUA 4QWQA 2LD6A 4A5MA 2W48A 2KISA 4AU7A 5IPAA 5EG0B 3ZMDA 3RCOA 1WCMJ 4EJVA 1BC7C 2QQBA 3L2WA 1QU3A 2FBHA 1OR2A 3AG2C 3OL3A 1BL0A 2DMTA 3K4CA 2GA0A 3I64A 2CWEA 1QLEC 4MVQA 2DXIA 2NVXJ 4P9UA 1O4XA 1Q0DA 1YIJI 3Q0VA 3R7CA 2EFPA 3PO2J 4BHPA 2VOOA 2ZNZA 2OTLI 3K2AA 3CC2I 2WADA 1LS4A 1AWCA 1FTTA 3MKWB 5DDGA 5L3VA 1S29A 5IYCJ 5D5UB 3OYIA 2XXAB 1MDMB 2K3PA 3D0SA 1M57C 5B3SC 3GWLA 2IXMA 3ABKH 1ORYA 1MKMA 4OU0A 2XF6A 3OV8A 3V42A 5AC5A 3R60A 2LRDA 2L7MP 3FBNB 4RGXA 4A69C 2JZYA 2OD5A 4RAGA 3IL2A 4G8XA 3G4SI 4P1WA 2MC3A 1XZQA 1XMKA 2ETHA 3P9KA 3I0TA 3JREA 2Y69C 3DKAA 4MVZA 3FMRA 1JGGA 4NY3A 4YWQA 1YE9A 3G50A 2DA6A 3UMKA 1LVKA 2X6WA 1AEPA 3DXJF 4FASD 2IJLA 2ECCA 3N97A 5JLWA 1U6HA 2P5LC 1BW5A 4M72A 2PFDA 4A6DA 1RJ9B 4R79A 3C3WA 4W8PA 3V5XA 4F93B 1SF8A 5L3BA 1Y1WJ 4Y17A 1FZPB 1J5YA 2FD5A 2EPKX 2M2EA 4EUKB 2FE3A 3M1CA 5CJ9A 2L9VA 4YT4A 1RKEB 4HA8A 5E1ZB 4N4OB 4AX2A 4HDUA 2OUMA 2LYCA 3H9JA 4DYQA 1A5JA 2EIJC 2KLOA 4BDYA 2VCAA 3WTXC 3LNMB 3EHMA 5DS9A 2HDWA 2FA5A 3L9FA 1I6XA 1VQNI 1MJ9A 2EA4A 4WGYA 4M6YA 1CGME 4YELA 2PX3A 1AU7A 2XV4S 1CF7B 2O3FA 4MW8A 3CCVI 5E3OA 4UUSB 4ITVA 4U7BA 3NG1A 2PJRA 6PAXA 1KGSA 4Q48A 3V8LA 3PSFA 3RFYA 2DI3A 1S7EA 2R5ZB 3KFWX 2HQAA 3C1DA 1JRAA 4O6MA 4S04A 1BR4A 2F5EA 1WZ2A 2F22A 3CUQC 1KU7A 1N75A 3IV5A 5L0HA 1LFBA 4B48A 1U8RA 4F7ZA 1Z3IX 2NUTA 4L18B 1UHMA 4KC9A 4XEVA 5EGOA 3PM1A 2COMA 1LI7A 1MSEC 3AL0B 2V1NA 1ZG3A 2RVCA 3E6CC 5LHHA 2FGYA 1LE8B 1LKXA 4FWVA 3EH1A 3HLZA 4M63A 1HKQA 4XRMA 2VOPA 1DDNA 4BXFA 2W84A 5B1AH 1O3TA 2NVQJ 2HNHA 4G94A 3O2PE 4P96A 2DW4A 3HRUA 2BOLA 5LHIA 4U5BE 3VYWA 4DXWA 2PNOA 2GXAA 5KYNA 2LDUA 3BDDA 2E7WA 2HVQA 4BBRJ 3S9OA 1K40A 1VF9A 4IL6C 1FIAA 3O6BB 2JSPA 4XOTA 5HV9A 3AQCA 4YIFA 4DBQA 2R7OA 5LEKA 3US6A 3UKGA 4MIMA 4E7IA 4K1OA 3KCCA 3G1OA 3JRTA 1WJDA 3I54A 4LFUA 3OSGA 3LSJA 5M3FJ 1JUPA 1ZG1A 1XDSA 2H8WA 2M34A 1AOYA 1JHFA 5JS5A 1U5TC 5LEJA 2EIMC 5E1WA 2FEZA 1FP2A 1R1VA 2EIKH 2K9MA 3K9TA 1J7KA 4HF1A 4UDVA 3BLYA 4CDVA 1ZU5A 4AIKA 2JRMA 3VPRA 2MSYA 2M7AA 4Q7CA 1KU2A 2TCTA 2FOWA 4LIVA 4A5NA 3IWFA 2QQ9A 3ZXSA 2ZNYA 1VQOI 1T6IA 1CGNA 3E5UA 3FBIB 4M3EA 1E3PA 2H09A 3VYUB 2G7HA 3PL8A 2BGCA 2JPCA 2CV0A 4F3QA 3HSEA 3WTVC 2ZJPF 5HSWA 2FFHA 2KK1A 4BQAA 5C44J 4AK9A 2EINC 1Z1DA 4CSWA 2XSEA 5B1AC 3FAJA 1F5TA 3LUTB 2HUJA 4ENNA 1SANA 4J30B 4JIOA 1JTXA 1A36A 2J9WA 4L5IA 1QNTA 2CU7A 1QO0D 2ELHA 4L9JA 1VQ7I 4ASNA 1B8IB 1QZZA 3EPZA 4KNWA 3K4NA 3FM5A 1U89A 2NAZA 2CW0F 1G5ZA 2E5ZA 2LREA 3L2UA 3LSKA 2HMQA 2H6BA 2OZUA 4N9HA 5L0FA 2Q2EA 2VASA 3ZOBA 3BG5A 3DWLE 2ADUA 4Y15A 1KYWA 3TEDA 2YU9J 4M71A 4CA0A 3ELKA 4YG2F 4ESJA 1KU9A 2HZ8A 1OISA 4FX0A 3BR3A 2JA7J 2CYYA 1MMGA 4AVPA 1Z7UA 1EA8A 2WL8A 4ESBA 2QNLA 3ZMSA 5IOZA 2R25A 4N6CA 1LJ9A 2QSFX 4P5OA 4TV7A 3ABKC 5F28E 2P6SA 5F5FA 4LG0A 3ZRGA 4MVOA 1V54C 3SYNA 3OYNA 3BTIA 1BI3A 3BCBA 3SZPA 3LL7A 2PMZN 3ML6A 3WG7H 4CCMA 3FHDA 1EQ1A 1MBFA 3HXLA 4CYDA 2CNWD 1DPRA 1H9TA 4XKCA 3QVYA 1OCZH 2WZGA 5CQGA 1HDDC 4WJ0A 4KMUX 4MEYF 2BC5A 1TQPA 1JJ6C 2BW3B 3I4PA 3U3BA 3H35A 5DS5A 1MBHA 2VONA 2B0JA 4HYEA 2VQGA 3ZQVA 2HQ5A 3K1NA 2L9SA 3S32A 3NMJA 2K02A 1XC5A 1UHSA 2VJ4A 5J3LA 1I6HJ 3ZQCA 1J0RA 1X4OA 1TWFJ 1ZRFA 1S05A 3A9CA 3O6XA 1I3QJ 3O39A 4MW3A 2HVSA 2HSBA 2VKVA 2R93J 2R7VA 1MGTA 3ZMVA 2GOMA 3CSKA 2A68F 2I8DA 1SD7A 5F5HA 2ECBA 2CV1A 2A6HF 3RVZA 2VJIA 1G4DA 4E17A 3H9QA 3CEXA 3P9IA 3CMAI 2AWCA 4S0HB 1Z7Qc 4Y52J 4O79A 3ERED 1WJEA 3LLIA 1BJAA 3QRFF 1I39A 5FJ8J 2M3AA 4IAOA 1WJCA 3GW2A 5L3DA 2H8AA 4XEFA 2QBYB 3AGUA 3ASNC 1Y6DA 5FRNA 3VEPA 2LG4A 2D2WA 1A0BA 2CYDA 3C8GD 1O3UA 2CNWA 2EBIA 3B9QA 4WXCA 1JT0A 4O7GA 1EH6A 4I02A 1T0FC 4PJNA 3VSLA 3BZ6A 2BV6A 3H5NA 3I58A 1B4AA 5GPCA 1YW9A 3B6AA 1Y4CA 3AJMA 1MMNA 5F0CA 2HTJA 3A01A 4BPMA 2HQNA 3EHNA 4F52A 3S3MA 1YYXA 3IEEA 5ILSA 3SXMA 3VYTB 1M2VB 2PBIA 4YIIA 2K5CA 3HBLA 3DBLB 1VQMI 3J7AO 4D4XA 1OPCA 3OYDA 3MQ0A 3LSGA 1LVAA 1Q0MA 5L3EA 3DMDA 3V5YA 5ICGA 2PMZA 2LD5A 1OR7C 2FNPA 2G62A 4M6XA 4MTFA 1FOKA 2YVKA 4KNVA 5COFA 4CSAA 1YJGA 2J9UA 4IHYA 5KYWA 1R1TA 5JLXA 9ANTA 2F5DA 2YL1A 1SVMA 2QLZA 5DS6A 3PNTA 1GVDA 5BQHA 1FWZA 2QGUA 1J2XA 3EDPA 1FOWA 5F1JA 3K1MA 1M2OA 3ZCOA 3F8FA 3MAJA 3QYFA 4EBBA 2LOOA 4OINF 1IUFA 2K7LA 4B3XA 4CYCA 3BZCA 2CUJA 3WTSC 3F21A 2YL3A 3B0PA 1T98A 1CPRA 1BA5A 3IC7A 3C8GA 5F04A 1B68A 3E0JB 3LA3A 2K85A 1X2MA 1O7LA 1A6IA 2GA1A 2H1KA 5IYBJ 2BBYA 5IP6A 1ORKA 2WVOA 4PACA 3UMIA 4MTGA 3K7AJ 4I3MA 4KISA 1ZKGA 2FMYA 1JR8A 2MW8A 1J09A 2GBYA 4AWXB 2R7UA 4M3FA 2EQRA 3M8EA 2CFXA 3B29A 4C2MJ 1RCPA 2Q3TA 4BDZA 4Z2YA 4DRJB 1L7CA 1OKKD 5D4SA 4DZPA 1KQ8A 1IRXA 1JKOC 3CTAA 1PDNC 3DLAA 1YHQI 2DMPA 4A3DJ 1R7JA 2GFHA 3WHCA 2ZFUA 1UFMA 3EH2A 4V2GA 4ONSA 4CCLA 3GFIA 2DAOA 5CVIA 3JRBA 4A6EA 3LSMA 3M7GA 2VE9A 4NQWA 3HHHA 2F4IA 3LQQA 3HDDA 2XRHA 1QVTA 3TK0A 2O9XA 2EZHA 5CVJA 2M87A 2K9NA 3I59B 2XLMA 3PIOF 4GYTA 3SXKA 2PLYA 3T9OA 3M4CA 5F64A 1D0XA 3CJNA 2DMUA 1F43A 3S27A 2DFIA 5IP7J 1TLHB 1WRJA 4W97A 2Z3YA 4C3HJ 4AL1A 2HQRA 3IUOA 2F4MB 4UVCA 4BQQA 2V6CA 5DV5A 1BN5A 3Q3SA 3CCSI 1YLFA 2IA2A 3GO5A 1J9IA 1T33A 3MYFA 3AG1H 4Q47A 2G3KA 2LSOA 4M6VA 1K4TA 3NYMA 3PHF2 1FEXA 2E36A 2X6OA 1ZRCA 1Z67A 2GA2A 2PG4A 1BJZA 2ZJQF 3B0VC 1AA7A 2O6GE 2Z5UA 1NBBA 2DYSH 4JCHA 2R7RA 4EWCA 1IGNA 2Q9CA 5D5VB 1J75A 3JRAA 3HM5A 4U5EE 1G6NA 3UNGC 1ENHA 3F6OA 3DM9B 3BG6A 1OKKA 3BJOA 2L54A 2VBZA 2R7DA 3CDIA 2ZB9A 4U5CE 3DBRB 3CLOA 5JR3A 3DF8A 1ON1A 4IHXA 4I1MA 4NC3A 1M6TA 3BR1A 1IXRC 2VBWA 5T3TA 1IJWC 4GEHA 2YX7A 1C0WA 3IHUA 3KETA 3HNLA 5TJJA 1UG0A 1VQ5I 3HJEA 3NEUA 2ZSHB 2R5YA 1RUOA 2EZKA 5KHDA 5HS8A 1LFPA 5B5EC 1JHHA 3ZQIA 2EV0A 4IZZA 4L9NA 2DBBA 1OR3A 3SEZA 4H54A 5LRRA 5KYUB 2ZMEA 2VH3A 1OKRA 3BG9A 4KN7X 1TQGA 3KZIC 3HOZJ 3F8NA 4PJLA 4B8XA 4N06A 1L0OC 5HDNA 1Z6TA 3U9MA 5KYYB 2DTZA 4E70A 1LPQA 3JSOA 2D4UA 2VCBA 4RBNA 1YITI 4DW6A 3JYHA 1RKTA 5LFAA 3C2BA 1TTYA 5JVTA 2JA2A 1JT6A 2P5VA 3J80K 4LMYA 2L6GA 4ZTFA 1NK3P 1MBGA 2A05A 5F0FA 2A07F 2V1UA 4MVMA 3S17J 2KC3A 2M5WA 3GM2A 3U2LA 5HDKA 4ENKA 3WTUC 3IQCA 2VBYA 4IARA 2ZJRF 1REPC 1YFHA 3F22A 3U1DA 2M8EA 3QYBA 2QUFA 5KYXB 3EG9B 4KBLA 3HIFA 2VC0A 3TL4X 4BY1J 4HE8D 4W8KA 2IXSA 5D4RA 2XAHA 2A5YB 3JRCA 4KICA 3VWBA 3S3NA 4MTOA 4JQFA 2H27A 2YZSA 1E85A 1HXDA 3PQKA 4C7OB 4JKVA 1QQ3A 5DLJA 3RQIA 3ZQLA 5A6JA 3GX4X 3TDUC 2ESHA 3FZVA 1FNTc 4E7LA 4M74A 1TNSA 1TWHJ 4Y3OA 4BE2A 1FSEA 1ETXA 2DYRH 1SAXA 1N78A 3LAYA 3X2QH 1W5SA 4MVUA 3TJ5A 2LY9A 3EZHA 2KQRA 4G9YA 1Z0XA 4GGGA 4U88A 2E1MB 3PNVA 1RI7A 3GTMJ 4IO9F 4BY7J 1A04A 1H8AC 3GEIA 4F91B 1UFBA 3RTRA 1W36D 1NK2P 4I98B 2LH9A 3NAUA 3GLXA 5HNFA 3QVZA 3EPVA 4P55A 4G6QA 2A0UA 1TWCA 5LGTA 2LF8A 1ODDA 2ZXWH 2LQGA 4FQGA 3J81K 4WCGA 1B59A 4JTAB 2IP2A 3QPSA 4I09A 3W2VA 1OCCH 2YR2A 5J47A 2ZD9A 1W5CC 2UZKA 2JQ7A 1ACIA 3TULA 2OZ6A 1ZAOA 1TW3A 2EA2A 3DI5A 2XL4A 2ZC2A 4GRIA 1Q0FA 1X19A 4CBEA 1FTSA 3S2HJ 4Z9IA 2ASRA 2UXNA 3K2ZA 4HG2A 2E5NA 4L9VA 4ZLDA 5FFXA 1YS7A 2H7VC 2QWWA 3KX2A 4XTKA 5K1YA 1TT5B 4U0WA 4O6NA 1JTYA 2HS5A 2P7VB 5E8GA 3SEQA 5DM6F 2QEXI 4EQQA 2GOXB 3JT1A 2O7OA 1HCRA 1KA8A 1XS9A 1IXCA 4CICA 3ASOC 1E86A 1Q0KA 4A0XA 2Y3DA 1E3OC 3AG3C 3L2VA 3B6CA 2GZWA 2XKOA 1E2XA 4ZYDA 3EGDA 2HI3A 1A7DA 2HFIA 2R4GA 2DDBA 3A0BC 3O8HA 2X0LA 1I4YA 3DPUA 4XKBA 4RGRA 3ZQFA 3OOPA 3WE3A 3ABMC 3CMMA 2LKSA 1P7JA 3VODA 1GXPA 2XGCA 5GTHC 2DPDA 3H2VA 4Z9HA 3P5JA 3W6VA 1RC9A 3CUQA 5J1YA 2AXTC 3MKYB 2BXYA 2PJPA 4Y4RA 2DJIA 1O5HA 3SFIA 1PD0A 5C3EJ 4ZTJA 4XBFA 1IW7F 5FLXK 4BS9A 1Z23A 1ETOA 1T38A 5FZTA 4IEJA 1V4AA 3AAFA 1YX3A 2W85A 2GIVA 4UHTA 3MCZA 2NYXA 5D6EA 4XEKA 2IBDA 3CCEI 3HOUJ 1R6RA 4KT5C 3ZQQA 1WASA 2HV6A 3KZZA 3HOWJ 3KL4A 3F0CA 4MEXF 2G9WA 1PUFA 1OCOH 2YRFA 5EZHA 2R7WA 2YEVA 3N05A 4WABA 2Y31A 4L0ZB 4A0ZA 3HNJA 3QODA 4OWRB 4J00A 3UGPA 1U9OA 1FFTC 2EZLA 3DAFA 1TWGA 4O6JA 1O7FA 3R0AA 1D8KA 1X3ZB 3RQFA 3WODF 2HPMA 4FT8A 4EGZA 5JRAA 2J0XA 1V55H 3BPXA 4RB2C 2DA5A 1W2WA 3J7AY 2KJCA 2AU5A 4N6HA 3WE2A 1U5TA 4B44A 5CLSA 3HSFA 3E70C 2Z33A 2OBPA 1T95A 4XWJA 1UMQA 2YWAA 1XGMA 3BP8A 2LVSA 1WSUA 4HRIA 1YDIA 1IF1A 3IRRA 1FAPB 2X9DA 3KP4A 2Q9AA 3OA1A 4C2UA 2HV7A 2H8RA 5CVRA 2LY1A 3MKLA 4CJOA 1XSXA 1MJAA 2BVLA 2ZMEC 1C03A 3ABLH 3DEEA 1G8XA 4HV5A 1CGPA 1ZR2A 2H7OA 4BEHB 3OS2A 4JVSA 3QPTA 2X48A 2Y3GA 3E6MA 5GAGJ 3Q6NA 4XN3A 1R36A 2GAUA 2E1NA 3PFIA 2CW7A 4HPQA 3UR3C 3L00A 2GM4A 1UAAA 3ECSA 1FSHA 2HGCA 3K33A 3KLNA 3AG4C 1GDTA 3U1KA 3FXLA 5C4JJ 4JOMA 2YX4A 4EM0B 1EF4A 2NPUA 1SC7A 3P9CA 3LFUA 2HSQA 3GANA 4PZJA 2UXXA 4FTHA 1NFNA 3KYDB 1K05A 1OYIA 2VXDA 3K1IC 3FXKA 4UVAA 5DVWA 1BBYA 3GFJA 1WWPA 3W6KB 5FO5A 1AKHB 2V3CC 1HW1A 3F3XA 2RN7A 4EJTA 1QVXA 5FD6A 2XSDC 2L01A 5H2FC 2D5VA 3HTKC 1UHWA 3S1MJ 4A0YA 3RIRA 3A1YA 3OIPA 4RAFA 2VXZA 2LP0A 4HX7A 3OYCA 1QHHD 4J01A 3S90A 4XSZF 2ESNA 5BNGA 2Y9YA 2XF5A 3W4YA 2DYRC 3T5XA 4BHBA 4LLCA 5D91A 3V7OA 3X2QC 1KONA 1S6LA 2I10A 3OR2C 3BCAA 2QY9A 3F46A 1PVEA 1X1CA 2DJNA 2DA7A 2Z99A 1D0YA 2VC9A 5L0DA 3FHNA 1B72A 3JSPA 2EFQA 1QZYA 3KYCB 3LSIA 2HYFA 1IRZA 2K40A 3J06A 2Z2SB 4FHTA 3HGYA 1TFOB 1EJ9A 4MQVA 4IHTA 1FOYA 2K27A 3I53A 1ZELA 2HOEA 1MNEA 5H20A 3TO7A 3ECOA 3GZ6A 2ZXWC 4GQHA 3RQGA 3SP1A 2E60A 2QQAA 1B9MA 1G4US 4JTDB 3AQBA 1ZN2A 3U21A 1YS6A 3DD7A 2L7FP 3K7DA 1R9TJ 2XS1A 2QUPA 2XAQA 3ZTZA 2N8GA 3T1BA 4F92B 2DK8A 3FOPA 3O55A 2HOTA 1F1MA 1VI0A 2RQPA 4WF2A 5E3MA 3G6EI 2CV2A 3ZR8X 5L3FA 1V5GA 3DTEA 1J59A 4MVRA 4EJOA 2CJJA 3JSEO 3V4GA 1ERDA 4OIRF 3TP3A 1IDZA 3ULQB 1OCRH 4HV6A 2HXIA 2H7BA 4M73A 5JT4A 2WY8Q 4D1QA 2O8XA 2NSFA 3K4JA 1UELB 2FMLA 3DBHB 2JRTA 5ICCA 3O10A 1VZ0A 4AIHA 1G3TA 3FX3A 5E17F 4LJZF 1KQ0A 3CQZJ 2Z9OA 3PMRA 2MABA 1W36C 2KKOA 1F4KA 4NQFA 2CUZA 3SDBA 1DOVA 3LLKA 3IH3A 4NB5A 3LNRA 2ZSIB 1G2HA 3HL2A 2OQMA 3ZC4A 5DQTA 1T0FA
chains in the Genus database with same CATH topology
3CSKA 3EUAA 2I8DA 2A68F 5F5HA 3EGDB 2DYSC 2CV1A 2A6HF 2VJIA 3QOEA 4PJJA 3VYSB 3RPUD 3H9QA 1VYKA 4XLPF 1TWAA 1D0ZA 4IQJA 5E2QA 3EG9A 4O79A 4B6IA 5KYXA 1WJEA 4PSXA 3BG7A 4CIHA 5L3QA 2A69F 3LLIA 2M3AA 4IAOA 1WJCA 1NU7D 3CJQB 1JPJA 2M0MA 2J46A 3M1CB 4BJ1A 2Z15A 4Y33A 2W82A 2L2OA 3HPHA 2HU9A 3FDYA 4C7OA 3ASNC 2LBFA 5FRNA 3DQVC 4E6KG 2WZFA 4AE4A 2LG4A 4II3A 5EHHA 3RH3A 3L2QA 2WY7Q 3FDQA 2LY2A 4C3EA 2WZLA 2CNWA 1QZXA 3B9QA 3S0XA 3K6BA 4PFPA 4CS8C 4O7GA 1OCOC 1T0FC 4BJ6C 2Z16A 4PJNA 4RD9A 3VSLA 3H5NA 3VYRB 2X6XA 5D92A 2PJRB 1Z5ZA 1MMNA 2PX0A 2ZPAA 1VYIA 2I8BA 5E3AA 3EHNA 4F52A 3S3MA 1ZHTA 3IEEA 3W2AA 2Q1ZB 4J32B 1WJBA 3ZGKA 1D1CA 3VYTB 1M2VB 2NG1A 2K5CA 1PYVA 2A1DD 3Q6MA 4OAYA 4K7BA 3OYDA 4E7ZA 3LSGA 4Q7CA 2W1OA 1VOMA 3DMDA 2G3VA 3K4KA 1V55C 4XLCA 2IOQA 4QPOA 1JI8A 2PMZA 2NUTB 5EGYA 3ZG1A 1WGWA 4MQ9F 2VIXA 1OR7C 2G62A 5T3WA 3CF2A 4I44A 2XXAA 2J0WA 2W45A 3SEOA 2JD3A 4KNVA 4CSAA 3SYTA 2P0WA 2J9UA 2V7FA 1NU9C 3F47A 5KYWA 4U5HA 2JUGA 4F4BA 2MD0A 2IS6A 3PNTA 5DS6A 3ONQA 4JJGA 1Z63A 1M2OA 3ZCOA 4NUBA 2BVMA 3QYFA 2J9VA 2E1MC 4EBBA 2LOOA 4JURI 4OINF 4B3XA 3B0PA 2CUJA 2P7VA 2Y0SA 3ABLC 3CP8A 3JCUQ 4IQ4A 2IXOA 3RYLA 1U0JA 1S9HA 2HPIA 4KJZA 2UV1A 5T1DB 2KNHA 4OAZA 3DPLC 3E0JB 1Z21A 1MMDA 3IAS2 4CCJA 3IAM2 2WBMA 4OD4A 4E7JA 2J45A 1Y6IA 2CMPA 4H4KC 2WVOA 5HOOA 2L9NA 3UMIA 4CSAC 2Q9BA 4I3MA 2KW3C 4KISA 3OS0A 4HEAJ 2QTVA 1RJ9A 1ZU4A 1J09A 4XN0A 2NUPB 2R7UA 1GLNA 2UUZA 4G0HA 3Q7LA 3H9GA 2X1CA 4G6TB 5B1BC 3M8JA 3T4RA 2Q3TA 4BDZA 4ULWA 1OKKD 2WB1A 2IYLD 2WVNA 3LEVA 3K4BA 2DOAA 4PFOA 1IRXA 4B47A 3EZIA 3OYKA 1DP3A 2KPMA 4C3DA 3DLAA 1LDKB 1MMAA 2GFHA 3NWSA 4EATA 3C2GA 3EUHC 2ZFUA 1FMVA 3EH2A 2DCEA 3BC8A 4E7SA 3NKEA 4HNUA 3IP4B 1OCCC 4CCLA 2W4BA 4X0GA 4G7ZF 4IX7A 3H5RA 1ST6A 2C03A 3LSMA 4DJAA 3QZCA 2F4IA 2OV7A 2WVQA 1FFHA 2XRHA 1TWHA 3MLGA 4XORA 4E7KA 2O9XA 4A2NB 3L2RA 3LMMA 4HEA2 1DQUA 4GYTA 3UGOA 4U5GA 3SZRA 1D0XA 2CDQA 4YT2A 3S27A 1X1AA 2MWQA 2FUG2 4C30A 2WAEA 2OG2A 4OIOF 2KL4A 3GODA 4G7HF 2L81A 3DZAA 1ZHWA 3KMIA 1O87A 3IUOA 2E87A 2YHSA 2IGOA 4NC8A 4BQQA 2V26A 3OYMA 3HOTA 3DTIA 4BE0A 3I5PA 4OIQF 2M4KA 1TR2A 3PHF2 2G3KA 3NYMA 3EFOB 4Q4ZF 3B0VC 2DT6A 2XAUA 2PF4E 1X1BA 1AA7A 3MX3A 2Q2EB 4JCHA 2VLAA 2R7RA 2IGNA 4I1OB 4EWCA 3OYHA 2Q9CA 4LERA 1E0EA 3EUKL 1FMWA 3OYLA 3K70D 1Z6AA 4U5EE 4U87A 2M4GA 3UNGC 3RIPA 2ZXHA 3DM9B 3BG6A 1HA8A 1IZMA 1OKKA 2RREA 1BR1A 1D1AA 2KRCA 2JVHA 4MLOA 2R7TA 4U5CE 3S93A 2W9YA 4I1MA 3TBIA 3MMYB 1WJFA 4ZDLA 4JJFA 5T3TA 4ZC3A 4GEHA 2HVRA 3OEOA 3KYLA 2X6YA 1WJAA 3GBGA 3DAGA 3S29A 1UG0A 4X0RA 3OYEA 2WB7A 4IJJA 3SNHA 2ZSHB 3NKDA 1Z7LA 3D5LA 5DS4A 5KHDA 1OCRC 2KDOA 4YEJA 1PCXA 2F5VA 1LFPA 2VL8A 2Z1DA 3C2HA 4K0DA 2M7BA 3RKOF 2VKDA 3KKBA 2L5QA 4BEHA 3OL4A 2OCCC 4IZZA 4FX5A 3W8IA 1TKNA 4N4NB 1M56C 1X1DA 4LLEA 3AL0C 3PSIA 3SEZA 5KYUB 4CZCA 3JSZA 3NWTA 3NYLA 1VMAA 2VH3A 4YT5A 3DPTA 4PUSA 2ZXPA 3E9VA 2UWMA 4PJLA 4N06A 1NG6A 5KYYB 4HSRA 1ZYRF 4FETA 4ZYAA 2W7NA 1LS1A 2XSJC 3D5RC 4RBNA 2XF7A 3I9V2 3JYHA 3OYJA 5LFAA 3EGXB 3N24A 2JA2A 2VQCA 3QYEA 1ZHZA 3ZSUA 2CGEA 4ZTFA 3DTKA 2MC4A 3OYAA 3AFHA 1NZEA 4RM2A 1NG7A 1EA3A 2C04A 4U5DE 1SFKA 1X4PA 2AQEA 4AYBA 3QYBA 2DT7B 4BUPA 2IS4A 5KYXB 1Z3XA 3EG9B 3X1OA 4KBLA 2VJJA 4BACA 3TL4X 4CS7A 4HE8D 1DGRM 4W8KA 3UMHA 4JZAA 2IXSA 4BE1A 3S28A 3VDXA 4XKVA 4CS9A 3SZGA 3VWBA 3H65A 5JHFA 5B1AC 3S3NA 4CH7A 4JQFA 4ZDOA 4LACB 2ZXIA 2ZXOA 4II2A 2YZSA 2RQQA 3NRHA 2KZVA 4C7OB 5DLJA 2LBFB 5E33A 4AE4B 4BG0A 1OLTA 1G59A 4ANJA 4CCKA 2A5WA 4BU2A 2DGJA 1DGWY 3DJUB 1K6YA 4E7LA 2V6EA 3DKXA 4Y3OA 4LG3A 4BE2A 5CQEA 2BE5F 4AU7A 2X1DA 3S8PA 1N78A 3LAYA 3RCOA 2WAQA 3L2WA 1QHGA 3K70C 1QU3A 5LD2C 4CCOA 2KQ9A 2IGKA 2KQRA 3K4CA 3OL3A 3AG2C 2IS1A 3EZHA 3T6BA 3ZIBA 2E1MB 3PNVA 3W3CA 4CCNA 4KITB 1QLEC 4PJMA 2DXIA 5CI8A 2CS3A 4F91B 3QMKA 3RTRA 1SAUA 1W36D 4XM3A 4LITA 2LH9A 5HNFA 2EIKC 3EPVA 3OY9A 4CS9C 3POVA 2Y3BA 4OD5A 1TWCA 2WADA 4C3BA 3MKWB 5L3VA 3OYIA 3W2VA 2XXAB 2K3PA 1P9QC 1M57C 2W00A 3HOSA 2KP6A 5B3SC 1ZHXA 2IXMA 1ZHYA 2XL4A 5KYWB 3W8HA 4GRIA 2XF6A 4C2TA 1X19A 1J8MF 4CBEA 2KMUA 3V42A 1FTSA 4FESA 2LRDA 3FBNB 2R7XA 2W4SA 4HG2A 2E5NA 4MNDA 4BEJA 2A6TA 2BW3A 3OOUA 4P1WA 2X51A 2H7VC 3KX2A 4O6YA 4XTKA 3VSKA 1TT0A 3OS1A 4O6NA 3H5AA 3VAYA 3SEQA 2Y69C 2GOXB 3JT1A 4NY3A 3ITFA 4YWQA 1YE9A 2CW8A 2IGMA 3ASOC 3K66A 4ZJZA 3UMKA 1LVKA 4YT8A 2VKHA 2X6WA 3K4LA 3AG3C 2Y3DA 3DXJF 2LSEA 5CI9A 4FASD 3L2VA 3LESA 4KI2A 4BGDA 4OIPF 3OMYA 4RLFA 3FVYA 3EGDA 2PFDA 1RJ9B 2R4GA 4R79A 2CH0A 3DPUA 4XKBA 4F93B 3HKZA 1SF8A 4PSWA 3ABMC 3CMMA 3RQ4A 3K1HA 2KRHA 5FCLA 4XLHA 1PD1A 5KNLA 3EJNA 3M1CA 4YT4A 3MKYB 4LIUA 4D9JA 3HUGB 2DJIA 4Y4RA 1O5HA 3CZ6A 4N4OB 1PD0A 4AX2A 1SMYF 4ZTJA 1S7ZA 2OUMA 2LYCA 3H9JA 4DIQA 1IW7F 1VK5A 3EQLF 4BS9A 1Z23A 3I5QA 4NQWB 4HFFB 3S3OA 2KLOA 4BDYA 3CESA 1WFXA 2WAFA 4E7HA 2EIJC 3EHMA 3KH2A 2HDWA 4YRVA 3WG7C 2ELJA 4XR6A 4YJWA 2RNGA 3LSHA 1YX3A 4YELA 2PX3A 2IXNA 4E4HA 1OCZC 4JW1A 3TMOA 2M4EA 4U7BA 4ITVA 1R6RA 3LJBA 3NG1A 3HC7A 3ZQQA 2PJRA 2IS2A 2HV6A 1SZIA 3KL4A 4HSTA 4U5FE 3PSFA 2R7WA 4XQFA 4BQNA 2YEVA 3RFYA 2J7PD 3ZVRA 4BJ5A 4ZLCA 3N05A 5BUOA 2HQAA 4O6MA 2XC7A 1M2VA 3RSNA 3L0IA 1BR4A 4HFKB 3QODA 4OWRB 4J00A 3UGPA 3TD7A 1FFTC 1N75A 3OIQA 4RMNA 3DAFA 1TWGA 4B48A 2VQLA 4B43A 3FKJA 5CPRB 1Z3IX 2NUTA 4G7OF 4XKWA 2ZXRA 4DVYP 3B0UX 4KC9A 2QKLB 3N0TA 2HPMA 3WODF 1PJRA 2J0XA 4IRUA 3OWTA 2D5RB 3AL0B 2V1NA 1W2WA 3J7AY 2MYSA 4XOPA 3HJCA 2QKMB 2FGYA 1LKXA 4FWVA 1MW7A 3EH1A 1YX5A 2V9KA 3MD2A 4B44A 1JPNA 3HLZA 4M63A 4RLQA 3AKZA 4DVZA 4BXFA 3E70C 4ZLDA 1T95A 1NG1A 3N2ZB 4XWJA 2X1EA 4QPQA 2F6CA 2HNHA 4PK4A 3OYGA 3VYWA 1V5FA 2BOLA 4BJ5C 4U5BE 4HRIA 3HG9A 3E1SA 5KYNA 4XLAA 4BJTA 2HVQA 2Q9AA 3K6GA 3CQZA 3OA1A 4C2UA 2HV7A 2LY1A 4XMYA 2JSPA 2BVLA 2IXPA 5IY5C 4XOTA 4BJ6A 3AQCA 3DEEA 4DBQA 1G8XA 2R7OA 4BQOA 2W4MA 2KGOA 2JVGA 3CP2A 5HVQC 2R7SA 2H7OA 4BEHB 3OS2A 4E7IA 4JVSA 2Y3GA 1Z3YA 2P6VA 3PFYA 3JRTA 4F55A 1WJDA 4P6IC 3LS0A 3Q6NA 2J7PA 4XN3A 4HPQA 3UR3C 2CW7A 3MKZA 2VJ5A 1UAAA 2NUPA 3ECSA 3K33A 4IKFA 2A6EF 2EIMC 3A2KA 3AG4C 3OR1C 1N1CA 2K9MA 5TGTA 4JOMA 5E3CA 3K10A 3BLYA 1ZU5A 4BL0B 2M7AA 1V5EA 3LFUA 3OYBA 1KU2A 3GANA 4DBRA 2VQHA 4LIVA 5KCMA 5DQZA 3ZXSA 2VXDA 3H0DA 3K1IC 4RM3A 3FBIB 3VYUB 2V4JC 3HPGA 3PL8A 3OYFA 5DVWA 2CV0A 2V3CC 3L34A 4IWBA 4F3QA 1BOBA 3DJNB 3F9KA 5HNHA 5HSWA 2FFHA 3HTKC 4AK9A 2HZDA 2EINC 3I4UA 3A1YA 3OIPA 4CSWA 2XSEA 2VXZA 3T6JA 3FAJA 4NNJA 3OYCA 4J30B 1QHHD 4J01A 2J9WA 2NOJB 2XF5A 2WA0A 2DYRC 4ZDPA 4LLCA 5D91A 3V7OA 1KONA 3X2QC 3EPZA 3OR2C 3BCAA 2QY9A 3F46A 4KNWA 3K4NA 2CFOA 3LS1A 2CW0F 2E5ZA 1X1CA 4QDLA 5FROA 2LREA 3L2UA 3LSKA 3EFOA 1D0YA 2VPLA 4XONA 3FHNA 2KHMA 3K4MA 3LSIA 2VASA 2XDVA 4XL9A 3DWLE 2Z2SB 2OC6A 4CA0A 3DU5A 3CJRB 4DOZA 1N77A 1ZELA 1MNDA 1MNEA 4AVZA 2ZXWC 3SP1A 2KJGA 4XLFA 2E60A 1D1BA 1MMGA 2LC2A 3DU6A 4XLEA 2L7KA 2PP4A 2WL8A 4HNTA 3AQBA 4CUGA 3U21A 2R7QA 4P5OA 5HLTA 3DD7A 3D5SC 3ABKC 2O5RA 1WJ5A 3K7DA 3NYJA 3NDBB 5F5FA 2Y39A 4RDAA 3ZRGA 2AQFA 4Q5SF 3W2WA 4XLNF 1V54C 3SYNA 5CKTA 1J8YF 4F92B 3OYNA 3PJRA 2Y3HA 3DM5A 3BCBA 3LL7A 4CCMA 2CV2A 3FHDA 2X85A 4XNFA 3ZR8X 1V5GA 1TZLA 3DTEA 3G2BA 3HXLA 4DGWB 4QI2A 2CNWD 4C9YA 4YN0B 4XKCA 1ERDA 3PUBA 5CQGA 2WZGA 4WJ0A 4KT6A 4OIRF 2MFZA 3Q7GA 1Y56A 2BW3B 3H35A 5FRMA 2H7BA 5DS5A 2B0JA 2WY8Q 2VQGA 4D1QA 3K4JA 1UELB 3KEYA 2L9SA 3S32A 5KYUA 2VJ4A 2EILC 1VZ0A 2K9LA 3A4CA 1X4OA 3DKYA 5KYYA 3PMRA 1BR2A 2MABA 1W36C 2VB6A 4NC7A 2L9JA 3O6XA 2CUZA 3SDBA 3LLKA 3LNRA 3O39A 3PNYA 2ZSIB 3AG1C 2HVSA 3HL2A 3EGXA 4CS8A 3ZC4A 5DQTA 4QI0A 2R7VA 3I3LA 2GOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  3OWT A;  4BJ5 C;  3CZ6 A;  4BJT A;  4BJ6 C; 
#chains in the Genus database with same CATH topology
 1XTA A;  2M0C A;  4IJA A;  3FDQ A;  4GDF A;  1G3W A;  3NMK A;  3RPU D;  4A3L J;  4IQJ A;  4JX5 A;  2Y2Z A;  4PSX A;  4RS8 A;  3TW6 A;  4JTC B;  4B4C A;  2AVK A;  3NMI A;  2IPQ X;  1FIP A;  2R7F A;  2JX0 A;  4IRH A;  1W1W E;  3QU6 A;  4YIR X;  1JPJ A;  2J46 A;  2M0M A;  2RKH A;  3BR0 A;  2HYJ A;  3M1C B;  2NXN B;  1ZW3 A;  3CC7 I;  1YA9 A;  4A3J J;  3M15 A;  2L2O A;  3HPH A;  2F4O B;  3LAJ A;  1OR7 A;  3T6G B;  4E6K G;  5EHH A;  2F2E A;  2LLK A;  2B9S A;  3R2P A;  4MO7 A;  4Y7N J;  3L2Q A;  1R71 A;  1SFO J;  4C3E A;  2WZL A;  3ROU A;  1RKW A;  4HOB A;  4UB8 C;  5IY5 H;  1QZX A;  3K6B A;  1QPU A;  4U0V A;  1YJN I;  1OCO C;  4BJ6 C;  3MZH A;  2OF7 A;  2Z16 A;  3FK6 A;  1TC3 C;  3G1L A;  2A0B A;  4RD9 A;  2FJ1 A;  3VYR B;  3JAM K;  1SFE A;  4A3G J;  3U9G A;  2PJR B;  4GYI A;  1G3S A;  2DN0 A;  2PX0 A;  1VYI A;  1RR8 C;  2I8B A;  1MJB A;  4EBK A;  4J32 B;  1WJB A;  3ZGK A;  1D1C A;  1OFC X;  5EDN A;  5JFR A;  4L5J A;  2XLH A;  2STW A;  2A1D D;  2KIF A;  3M4B A;  5F0H A;  4GO1 A;  1FT9 A;  2JPB A;  4I99 C;  1OQC A;  5TRD A;  1V55 C;  2DQL A;  2G3V A;  5EGY A;  2NUT B;  4MQ9 F;  2BZT A;  3E3V A;  3C62 A;  2J0W A;  4AIJ A;  3BQZ A;  5EGO B;  1RPW A;  2W45 A;  3RPU A;  2IM8 A;  3SYT A;  3SEO A;  2P0W A;  3GFL A;  2GAQ A;  1NU9 C;  3F47 A;  4BYY A;  2JUG A;  3F6V A;  2WC2 A;  1I50 J;  4D7M A;  2BYV E;  2IS6 A;  1XMX A;  2XAG A;  2YPR A;  3ONQ A;  5E3N A;  5JHU A;  3JRH A;  3G3Z A;  4L5E A;  3B71 A;  4NUB A;  2J9V A;  1QKR A;  3ABL C;  3VB2 A;  5FKO A;  1SFX A;  5L0I A;  3GCM A;  3WTT C;  3JCU Q;  1FR0 A;  4MFD A;  3R61 A;  1U0J A;  2Y0M A;  4I2O A;  3FOO A;  1MMD A;  1P2F A;  3HHG A;  1HF0 A;  1SR2 A;  5J1R A;  1Y8R B;  256B A;  2OJQ A;  4L0Y B;  4OD4 A;  5A6K A;  2DO7 A;  3JRD A;  2E2I J;  2J45 A;  4XPY A;  1WOL A;  1FOX A;  2L6H A;  4H4K C;  5HOO A;  3QOP A;  4EJW A;  1HMO A;  3U0C A;  3HB9 A;  3I56 I;  2ISZ A;  1FNN A;  1X2N A;  3H3U A;  1ZU4 A;  3RVY A;  2MHR A;  4XN0 A;  2PBE A;  3GEH A;  2Q7R A;  5DYM A;  4OMY A;  3ECH A;  2BXZ A;  3Q7L A;  2X1C A;  4G6T B;  2GQQ A;  1Q0G A;  2ZO4 A;  3M8J A;  1BDJ B;  5A69 A;  2O03 A;  3G1M A;  4CGZ A;  2WVN A;  3LEV A;  2LFD A;  3K4B A;  3RI4 A;  4PFO A;  4B47 A;  4C3D A;  2HKV A;  2IVM A;  3C2G A;  3EUH C;  3HUG A;  4D0P A;  1E3H A;  4E7S A;  1XSV A;  3NKE A;  3IP4 B;  1V3F A;  5LGU A;  3DFG A;  1IN8 A;  4U0Y A;  1ST6 A;  4DJA A;  3U5S A;  3BWG A;  5D8K B;  2IRF G;  4HAM A;  2WVQ A;  1EH7 A;  1GV5 A;  1TWA J;  2FF4 A;  2VKE A;  4FIS A;  5K7Z A;  3G73 A;  1MIJ A;  2W24 A;  3LMM A;  4HEA 2;  5HLI A;  3PO3 J;  1YOV B;  1XZP A;  4AYB N;  2Q8K A;  1X1A A;  3I4N J;  2FUG 2;  4FCY A;  1R4N B;  2MWQ A;  2WAE A;  4P9F A;  2OG2 A;  2KL4 A;  4G7H F;  2E19 A;  1IRF A;  3SJM A;  3DZA A;  1ZHW A;  3KMI A;  5A2Q K;  1XGO A;  3E5Q A;  3FK7 A;  4NC8 A;  1Z91 A;  3CCY A;  4Y13 A;  1FTZ A;  2JA8 J;  4MTE A;  4M9S A;  1OCT C;  2IT0 A;  4Q4Z F;  4U9E A;  2OTJ I;  2XAU A;  2ZJ2 A;  5J8C A;  2Q2E B;  1ZAR A;  1F36 A;  3PUF A;  4RAY A;  5J6X A;  2A61 A;  5COG A;  1Z6R A;  5BPD A;  2OJE D;  2ZBK A;  4LER A;  2IAI A;  4XPW A;  2EPF A;  4P9T A;  4NDL A;  3AOU A;  3FIS A;  1LM3 B;  3L1M A;  1ZTR A;  1HA8 A;  4ZYH A;  4KIG A;  2ETS A;  4MLO A;  2FU4 A;  2KRC A;  2JVH A;  3KP5 A;  3C18 A;  3S93 A;  1S72 I;  4PDK A;  4QLC U;  2W9Y A;  3LST A;  1XPX A;  1EV7 A;  2IA0 A;  3K1P A;  2P8T A;  3MMY B;  1P4X A;  4LLL A;  4JJF A;  4ZC3 A;  1QPI A;  4LG0 B;  1YA7 O;  1ON2 A;  3OEO A;  3KYL A;  5JI6 A;  3LSP A;  3GBG A;  3HOX J;  4IJJ A;  3N4M A;  3QQA A;  1GVJ A;  1Z7L A;  1LEB A;  3NKD A;  4Z9J A;  3H3V K;  1OCR C;  4FAP B;  1P4W A;  3KZY A;  3ABU A;  1SVL A;  2IW5 A;  5E3L A;  2Z1D A;  3C2H A;  4K0D A;  1LPE A;  2VKD A;  3RKO F;  1G3Y A;  2L5Q A;  3MVP A;  3LA2 A;  1XWJ A;  3W8I A;  3Q0U A;  1TKN A;  4N4N B;  1FBU A;  4KA4 A;  1X1D A;  1OW8 A;  3GZN B;  2NRA C;  3AL0 C;  4LLE A;  4UVB A;  1EKE A;  5E18 F;  5JVE A;  2TMV P;  3WGG A;  1NTC A;  5LRS A;  1U3E M;  1U78 A;  2GWR A;  5H6R A;  3E9V A;  1VQK I;  2MG4 A;  2LKP A;  1GS9 A;  3V7C A;  4ZYA A;  4N9I A;  2JMW A;  3D5R C;  2XF7 A;  2NVY J;  2XVC A;  1FC3 A;  3N24 A;  5FB2 A;  2XRL A;  3V7S A;  1W0U A;  1ZHZ A;  1YAR O;  2CO5 A;  4XPX A;  1RNL A;  3OYA A;  4V2F A;  1MH3 A;  3AFH A;  4U5D E;  1NG7 A;  1EA3 A;  3CAX A;  2R0Q C;  5J1U A;  1SFK A;  1N25 A;  1MBE A;  2X0C A;  3LA7 A;  1TWC J;  2AQE A;  2E7X A;  4AYB A;  2GWW A;  2DT7 B;  2J5O A;  3FF5 A;  2DMN A;  4BUP A;  2IS4 A;  2P6T A;  4UV8 A;  2YU3 A;  3C7J A;  2XB5 A;  3UMH A;  1DGR M;  3RYP A;  3CCM I;  4BE1 A;  4JZA A;  5M5Y J;  3S28 A;  3VDX A;  1ZGA A;  1T08 B;  5JHF A;  2PEX A;  3LFK A;  2ZFW A;  4KNY A;  4ZDO A;  2HWV A;  5EJC A;  2GLO A;  2QE9 A;  2ZXO A;  4CHU A;  3HNI A;  3JYY A;  1MSF C;  1ETK A;  2VT3 A;  4ANJ A;  2A5W A;  2NS0 A;  3DJU B;  3V7R A;  1DU0 A;  3DKX A;  4LG3 A;  2XLO A;  5CQE A;  1FX7 A;  3TDZ C;  3K70 C;  1BIB A;  3BG3 A;  2KQ9 A;  2IGK A;  3NAR A;  3M1E A;  3C63 A;  3FXM A;  5DCF A;  2IS1 A;  4KIT B;  3W3C A;  3A01 B;  4M9X A;  4DYR A;  2CS3 A;  2CGP A;  1SAU A;  4XM3 A;  3CMY A;  2EPN A;  2XAF A;  4LIT A;  1H89 C;  2EIK C;  1K7A A;  1GQA A;  3OY9 A;  3POV A;  5M3M J;  2QQ8 A;  2Y3B A;  2HDC A;  5DCM A;  1LE2 A;  3CME I;  2NVT J;  4IOA F;  1R22 A;  4OD5 A;  4C3B A;  2GDC A;  4U9D A;  2I5U A;  4NTA A;  4R8H A;  2ELK A;  1P9Q C;  3E6B A;  4ON0 A;  3SXY A;  2W00 A;  3HOS A;  2KP6 A;  1KQ9 A;  5KYW B;  1IG7 A;  3W8H A;  3CJT B;  1ZQ3 P;  4C2T A;  1J8M F;  3NRV A;  5F1R A;  1LUJ B;  3M9A A;  1T8I A;  4CYC B;  2KDZ A;  3VAY A;  1TT0 A;  2EFO A;  1RET A;  3Q5F A;  4HW0 A;  2LFF A;  4HX4 A;  4R1H A;  3C8G B;  3OSF A;  4AID A;  3ITF A;  2IGM A;  3J7Y J;  4ZJZ A;  4YT8 A;  5F6F A;  3GM3 A;  2WV1 A;  4C3J J;  2VKH A;  4AD9 A;  2LSE A;  1X58 A;  2EIL H;  5CI9 A;  1W7P D;  2OCE A;  3LES A;  4KI2 A;  5TIS C;  4BGD A;  3GTO J;  4OIP F;  4RLF A;  4LLG F;  4ETS A;  4XRF A;  5KK1 A;  3WTY C;  1QQI A;  2M1B A;  4PSW A;  4WXD A;  1BC8 C;  4YL0 A;  4IRI A;  4WXH A;  3RQ4 A;  2ACJ A;  2KRH A;  4CJG A;  1YZC A;  2V1D A;  3G4Z A;  2XM4 A;  3M07 A;  4A3M J;  1SFU A;  1VLT A;  4LIU A;  4OMZ A;  3F23 A;  2DA4 A;  3RDI A;  3JR9 A;  2YS9 A;  3CZ6 A;  1DPU A;  1ONV A;  1UJ8 A;  3U8P A;  1S7Z A;  3BTC A;  3EQL F;  4DIQ A;  3I5Q A;  2RV8 A;  4IGG A;  4UV9 A;  2XHK A;  4NQW B;  3CES A;  1WI3 A;  2HKX A;  3MN2 A;  3KP2 A;  3WG7 C;  4YRV A;  4GCV A;  1S7O A;  4XR6 A;  3R4K A;  1GXQ A;  3LSH A;  1T9K A;  1MQV A;  1I1G A;  4E4H A;  2IXN A;  1OCZ C;  3TOB A;  2OCC H;  1I1S A;  3RKQ A;  2M4E A;  3HC7 A;  1SZI A;  4O3M A;  4MS2 A;  4XQF A;  4LB5 A;  2J7P D;  4ZLC A;  5BUO A;  5B66 C;  3KE2 A;  2YLI A;  2ME6 A;  3RSN A;  1IC8 A;  2D1H A;  3TD7 A;  1DU6 A;  2BY3 A;  2ID6 A;  1W7P A;  2XB0 X;  5KVR A;  5CPR B;  4ZH4 F;  5CVU A;  3S84 A;  4XKW A;  2ZXR A;  4DVY P;  3HZJ A;  3B0U X;  2H94 A;  3HRM A;  3ERM A;  2QKL B;  2YLD A;  1O57 A;  5AC4 A;  2MA3 A;  1PJR A;  1T56 A;  5HOD A;  3OWT A;  4IRU A;  1QRY A;  2D5R B;  2FAP B;  2YL0 A;  1FYK A;  4BBS J;  4XOP A;  3HJC A;  5B3I A;  1MW7 A;  1YX5 A;  2V9K A;  3MD2 A;  3J80 Z;  3QWL A;  4RLQ A;  4RAZ A;  4DVZ A;  2E71 A;  1NG1 A;  2XGE A;  3F8M A;  5M5X J;  3F8C A;  4PK4 A;  5DUI A;  3KP6 A;  3OYG A;  1V5F A;  4KN4 X;  2FBK A;  4BJ5 C;  3CCQ I;  2YUS A;  5GP9 A;  3FKI J;  1OJL A;  1YQA A;  3HG9 A;  1DOW A;  2P81 A;  4XLA A;  4BJT A;  1QVU A;  4D5F A;  2AHQ A;  2E2H J;  3K1I A;  2R5Y B;  3RKY A;  4XMY A;  1H0M A;  1BI1 A;  1S5L C;  4BQO A;  1APC A;  2W4M A;  4QSH A;  1IAW A;  2JVG A;  3CP2 A;  3ESW B;  5HVQ C;  1RUN A;  1M1E B;  2R7S A;  2CUE A;  2LF7 A;  3AG2 H;  4P6I C;  1Z3Y A;  2P6V A;  2KFD A;  4F55 A;  3LS0 A;  1EI7 A;  2J7P A;  4ENM A;  1H9G A;  1HKS A;  2NUP A;  3MKZ A;  2VJ5 A;  4UB6 C;  1E83 A;  1LFU P;  4IKF A;  3A2K A;  4PJ0 C;  4H0E A;  1I4Z A;  3OR1 C;  1LIH A;  5TGT A;  5LLQ A;  5E3C A;  3F8B A;  1WI9 A;  3I71 A;  4AL0 A;  3DKW A;  1V5E A;  1YIO A;  3OYB A;  2DB4 A;  4E0H A;  2YQY A;  2VQH A;  4K2E A;  5B1B H;  1XDU A;  4MFE A;  3H0D A;  1KYZ A;  3HGG A;  2R03 A;  4IHV A;  4EIY A;  3SQN A;  2V4J C;  3OYF A;  3GXO A;  2JTV A;  3DJN B;  3F9K A;  2DQR A;  5LHG A;  4YFX F;  3J81 Z;  2HZD A;  2O9L A;  1YYV A;  3FIW A;  3T6J A;  3EET A;  1VQ9 I;  4NNJ A;  1XG1 A;  2PQ8 A;  2Y69 H;  4FE7 A;  4BAY A;  2WA0 A;  2DK5 A;  3IPM O;  1ZGJ A;  4ZDP A;  2XAJ A;  4C3I J;  1PP7 U;  1YRN A;  3ATP A;  3LS1 A;  3U9J A;  4QDL A;  5FRO A;  1ZG5 A;  3U2M A;  1YJ9 I;  3TO6 A;  3EFO A;  2OA4 A;  3LOC A;  5FKN A;  2VPL A;  4YK5 A;  3ZQY A;  1HMD A;  2CUF A;  1B6A A;  2KHM A;  3BTJ A;  3GME A;  3K4M A;  1QZE A;  4EGY A;  2XM0 A;  2XDV A;  2L4A A;  2R7Z J;  2OC6 A;  1WVR A;  3QAH A;  3CJR B;  4DOZ A;  1N77 A;  1MND A;  5L0G A;  2K86 A;  5IT9 K;  2KJG A;  4R32 A;  3TGN A;  2R9R B;  5FKK A;  3T4R A;  3DU6 A;  1NFO A;  4XLE A;  2L7K A;  4AM3 A;  1PV3 A;  4HNT A;  1K78 A;  1TW2 A;  3J7Z I;  2R7Q A;  2FNA A;  3D5S C;  2O5R A;  1WJ5 A;  2OQR A;  4B3A A;  2OKU A;  3NYJ A;  4ESF A;  1L3L A;  1I3A A;  3LNQ A;  3BOQ A;  1IO2 A;  4MHG A;  4XLN F;  3W2W A;  4PGH A;  4A12 A;  4YFN F;  4DQ2 A;  5CKT A;  5ICE A;  2Y3H A;  1SEU A;  2XLD A;  3CDH A;  3SZT A;  1W5T A;  2P5K A;  1CGO A;  1RR7 A;  3HYI A;  2X85 A;  4XNF A;  1TZL A;  4DGW B;  3G2B A;  5K7H A;  3CLQ A;  2JA5 J;  3A11 A;  1FLI A;  4MNU A;  3PUB A;  1A35 A;  4KT6 A;  3FWE A;  3Q7G A;  1IRG A;  2BY1 A;  2CQN A;  5FRM A;  4I7H A;  5FLX Z;  1T6Q A;  2K3F A;  1JUM A;  3KEY A;  1FYL A;  1O3S A;  2BY0 A;  1XCV A;  2AXL A;  5AIQ A;  5E20 A;  3S1Q J;  2WTE A;  2EIL C;  1RKC A;  2XL8 A;  1F9N A;  3KPH A;  1BR2 A;  1LQ1 A;  4NC7 A;  1VFC A;  1QBJ A;  3PNY A;  2Q4F A;  3AG1 C;  3NQO A;  4NC6 A;  3EGX A;  4M3B A;  4QI0 A;  3I3L A;  4BJ6 A;  3ZQ7 A;  3KP3 A;  3EUA A;  2C6Y A;  3TP0 A;  3EGD B;  2KZG A;  3S2D J;  1LE4 A;  2DYS C;  3DEU A;  4PJJ A;  2M45 A;  3VYS B;  4JP0 A;  5L3C A;  2EPL X;  2MH9 A;  1D0Z A;  4NTF A;  5E2Q A;  5TJ5 E;  5L3Q A;  4JX6 A;  1GM5 A;  5HS7 A;  2HOA A;  1IN4 A;  3CUQ B;  4G6D A;  2ICW G;  4BJ1 A;  4Y33 A;  4J7Y A;  2P7C B;  1IN5 A;  3MZ8 A;  1YAU O;  1F1Z A;  1OXK A;  2IBF A;  4I6Z A;  3FDY A;  2M64 A;  1T39 A;  2OQG A;  2LBF A;  2XGX A;  3A0H C;  3DQV C;  4MGR A;  3RYR A;  4AE4 A;  2WY7 Q;  1GT0 C;  4IOC F;  3S0X A;  4CS8 C;  4PFP A;  5ILV A;  3S16 J;  3GOR A;  3RJP A;  5EG0 A;  1U6G A;  1KU3 A;  2X6X A;  4CIP A;  1T2K A;  3MFK A;  1Z5Z A;  3ABT A;  1PUF B;  1ZRE A;  4LDR A;  4W1U A;  4KDP A;  3GLL A;  2LFB A;  1ZHT A;  2EIM H;  3W2A A;  4N4W A;  1OW7 A;  2OEX A;  1WQ2 A;  2L7A A;  4KIB A;  1C02 A;  2EWN A;  1XCB A;  1FYM A;  1IUY A;  1VOM A;  5GTI C;  1OYY A;  3KYJ A;  3LWF A;  2IOQ A;  4QPO A;  5FKM A;  4OOI A;  4IVN A;  3I4M J;  1JI8 A;  4HQM A;  2R05 A;  3ZG1 A;  4GXO A;  2VIX A;  4BH9 A;  5T3W A;  2XXA A;  2BHZ A;  3CF2 A;  1MDM A;  3S14 J;  1A7E A;  1R23 A;  3JRF A;  3V8J A;  3VRC A;  2FQ4 A;  3ZMZ A;  3DV8 A;  1P4A A;  2JD3 A;  3H2U A;  3FXQ A;  3AGT A;  4U5H A;  4F4B A;  3GWZ A;  1T6U A;  1HSJ A;  1BI0 A;  1U5T B;  5KAF C;  2RD9 A;  2EIN H;  4KIF A;  2QF7 A;  5KAI C;  4ENJ A;  1VQP I;  5C4X J;  4NCQ A;  2R92 J;  2E1M C;  4RBO A;  5EZG A;  1VTN C;  1FBS A;  4DRH B;  3HOY J;  3EUH A;  2BEO A;  1S7A A;  3CP8 A;  4IXA A;  4IQ4 A;  1MBJ A;  1W0T A;  3CD6 I;  3WGH A;  2KSF A;  4KJZ A;  2HPI A;  5T1D B;  2UV1 A;  2XRO A;  4N0B A;  2H1L A;  1D3Y A;  5M5W J;  3IAS 2;  4CCJ A;  1K6O A;  4ULV A;  1LNW A;  3DCF A;  5CVV A;  4JCZ A;  1ZK8 A;  1XGS A;  2DA1 A;  2LK2 A;  2RGV A;  3WG9 A;  1R4M B;  1Y6I A;  4DYC A;  1TFK B;  2Q9B A;  2KW3 C;  2E2J J;  3OS0 A;  1QGP A;  2VI6 A;  2XGD A;  5ILU A;  2E35 A;  5HLH A;  4LOC A;  3TQN A;  4HDV A;  4BXU A;  4FX4 A;  4IHS A;  1RJ9 A;  2QTV A;  2Y30 A;  1H7I A;  1ZVZ A;  4G0H A;  2ZKZ A;  3H9G A;  4UNO A;  1FBQ A;  2KIQ A;  1JUS A;  4IPA A;  2AP3 A;  1ZLJ A;  2HMZ A;  5B1B C;  1I5N A;  2WB1 A;  2IYL D;  2DOA A;  2V9V A;  5K0I A;  1OMI A;  3OYK A;  2KPM A;  4AC0 A;  2XPW A;  1DP3 A;  1LDK B;  1MMA A;  3QPL A;  1C17 M;  2L3D A;  1IXS B;  3R0J A;  4EAT A;  1RKE A;  3K69 A;  5AGF A;  2VN2 A;  1V54 H;  3VFZ A;  1OCC C;  1P6R A;  3EYI A;  2BY2 A;  3KYI A;  2DDA A;  3KLO A;  1TWH A;  3MLG A;  4E7K A;  2JPU A;  5JUA A;  1UB9 A;  4DZJ A;  3L2R A;  1CF7 A;  1I5Z A;  4UUS A;  2CDQ A;  4YT2 A;  4EBJ A;  1IV8 A;  4ZZD A;  2KT0 A;  4OIO F;  4XRS G;  3GOD A;  2L81 A;  4KFC A;  2R5Z A;  1O87 A;  5K5O A;  3FXR A;  2K4B A;  2IGO A;  4CO8 A;  1JKQ C;  3OYM A;  2V26 A;  4BE0 A;  2XLV A;  3I5P A;  3L2C A;  1ETQ A;  4RDU A;  3GTJ J;  4HF2 A;  1TR2 A;  4DNC A;  3IKT A;  3U3F A;  3SXZ A;  1B72 B;  3MX3 A;  3I55 I;  2VLA A;  3HKK A;  1POG A;  2IGN A;  4X6A J;  3OYH A;  3ZWI A;  2XIG A;  1FY7 A;  3L09 A;  1FMW A;  3OYL A;  3K70 D;  4EMS A;  2B63 J;  4U87 A;  2DOD A;  1UST A;  1UZC A;  3CO7 C;  2WAQ N;  3GTK J;  2ZXH A;  5BQT A;  1RES A;  5JVG F;  2RC4 A;  1LE8 A;  2PFB A;  2RRE A;  2QVO A;  2RSE B;  1D1A A;  1P7I A;  2CSO A;  2R7T A;  3ZTM A;  1BW6 A;  4JUR I;  2DMQ A;  1RRJ A;  2M30 A;  1WJF A;  2B0L A;  3RPQ A;  3U8V A;  4ZDL A;  2O8K A;  3FMS A;  2HVR A;  2I15 A;  3ASN H;  5J4Y A;  4KYW A;  4XRS A;  3DAG A;  3S29 A;  4L9T A;  4ER9 A;  3HTU A;  4X0R A;  2FRH A;  1WPK A;  3PQJ A;  2WB7 A;  1JOG A;  1W4M A;  3D5L A;  2NS7 A;  1UG7 A;  2KDO A;  4YEJ A;  1PCX A;  1HW2 A;  3I5U A;  2VL8 A;  1JMW A;  2EH3 A;  3BJ6 A;  3ZQH A;  3KKB A;  2VPR A;  3KIO A;  2VC1 A;  2MD5 A;  5FFZ A;  1M56 C;  5GPG B;  2DA2 A;  3PSI A;  1VB5 A;  3HNK A;  4HBL A;  1JKP C;  2EPM X;  3JSZ A;  3LEO A;  4YT5 A;  1WWX A;  3DPT A;  5DD4 A;  1G4W R;  4PUS A;  2ZXP A;  2UWM A;  2V1X A;  1NG6 A;  2VT2 A;  1ZYR F;  4HSR A;  4FET A;  1YI2 I;  4LD5 A;  2W7N A;  1XSD A;  1YVI A;  2XSJ C;  3JAM Z;  5BQG A;  2W57 A;  1ZHF A;  3OYJ A;  2HDD A;  3ZSU A;  1K61 A;  2ISY A;  2CGE A;  2E34 A;  2HYG D;  4HZF A;  2MC4 A;  2O0Y A;  2FSW A;  5FLV A;  5F08 A;  1KNY A;  4U7D A;  1NZE A;  2C04 A;  5DM7 F;  2JN6 A;  1FPQ A;  3MBG A;  5DUK A;  4XIC A;  1Y0N A;  1BI2 A;  1DP7 P;  3C8Z A;  2JJ7 A;  2M8G X;  3DWW A;  2LR8 A;  1Z3X A;  3Q0W A;  3RZO J;  3X1O A;  1SD6 A;  2VJJ A;  5EEG A;  4BAC A;  5FD5 A;  2LIG A;  3HOV J;  4YL1 A;  3F72 A;  3FM3 A;  3WU2 C;  1HW5 A;  5K5R A;  3PIP F;  4KUM A;  3SZG A;  3H65 A;  1R5I D;  5JSL A;  3HKZ N;  4CH7 A;  1A31 A;  2JA6 J;  3HRS A;  1VQL I;  3DP7 A;  4UUT A;  2J5P A;  3NRH A;  1ETW A;  3QP5 A;  2PX9 A;  5E33 A;  2WWY A;  4G78 A;  4BG0 A;  3BY6 A;  1B8I A;  1G59 A;  2GIZ A;  4CCK A;  4A3E J;  4BU2 A;  2DGJ A;  1HE1 A;  2V6E A;  2MH2 A;  3JRM O;  2EK5 A;  4G12 A;  3SHF A;  5COM A;  2BE5 F;  3L7W A;  2X1D A;  3S8P A;  3CO6 C;  2XRN A;  1QPM A;  4B09 A;  2WAQ A;  4KMF A;  3A02 A;  1QHG A;  1XB4 A;  1R4T A;  5LD2 C;  4CCO A;  4EM2 A;  2OOC A;  3ZIB A;  3T6B A;  4CCN A;  2QA4 I;  4PJM A;  2VBX A;  2L7Z A;  1IDY A;  4XK4 A;  2STT A;  5CI8 A;  3CDL A;  3QMK A;  2XLE A;  2ZXJ A;  2PN6 A;  2X4H A;  4CXF A;  2XKP A;  4CS9 C;  1ZZP A;  2P1A A;  1ITY A;  1HKT A;  1R5G A;  3TOA A;  1BOA A;  3GZ5 A;  3P7N A;  3TQO A;  3VOE A;  1XD7 A;  3GTQ J;  1HQC A;  1YW7 A;  2P4W A;  1HC8 A;  1ZHX A;  1ZHY A;  5EEH A;  4JEB A;  2IA1 A;  2R3S A;  2EZI A;  5HLG A;  5CIV A;  2KMU A;  2CG4 A;  4NHJ A;  2XPU A;  3GEZ A;  2DLL A;  4BHC A;  2R7X A;  2GXB A;  3JTL O;  4FES A;  5D5X B;  1JXS A;  2W4S A;  4M9Z A;  4HLX A;  4MND A;  4BEJ A;  2A6T A;  2BW3 A;  3OOU A;  1JKR C;  2X51 A;  4O6Y A;  2UUI A;  4J19 A;  3VSK A;  3OS1 A;  2Y48 A;  3H5A A;  3JRG A;  4BXX J;  4A93 J;  1AVO B;  4LK1 F;  1VND A;  2CW8 A;  3RW0 A;  3K66 A;  4WGZ A;  4PGG A;  4LB6 B;  1A7V A;  1KTM A;  1HY5 A;  3BQY A;  2QZ8 A;  3K4L A;  4JEA A;  1ZH5 A;  5LBQ A;  3M3Y J;  2XUB A;  3PCV A;  2L02 A;  2RNJ A;  2Y75 A;  3OMY A;  4CX9 A;  3FVY A;  4QIW N;  5A2Q Z;  3IWZ A;  3FMQ A;  2A3S A;  3TOL A;  4ZYG A;  1VLS A;  2CH0 A;  4LGW A;  2JUC A;  3IQ5 A;  3HKZ A;  5EF6 A;  2KGO A;  4EV0 A;  5BMZ A;  1XX5 A;  3QTH A;  3K1H A;  1X1P A;  5FCL A;  1YW8 A;  2UUH A;  4XLH A;  1ZGW A;  1PD1 A;  5KNL A;  3EJN A;  5L0C A;  4WX9 A;  2OU2 A;  1EKY A;  4D9J A;  3DEW A;  3HUG B;  5J40 A;  1MH4 A;  3MWM A;  2D45 A;  2E1C A;  1SMY F;  3WHN A;  1VK5 A;  4HFF B;  2ZCW A;  1R1U A;  1Y1V J;  3S3O A;  2FOK A;  1WFX A;  2WAF A;  4E7H A;  3KH2 A;  3BR6 A;  2ELJ A;  3WHB A;  4YJW A;  2RNG A;  1L3P A;  1WN0 A;  4RB3 C;  2ME0 A;  3BZK A;  3D1N I;  3TMO A;  1JE8 A;  4JW1 A;  1WTY A;  3LJB A;  2IS2 A;  2L6F A;  4I0B A;  3IQT A;  4HST A;  2VUM J;  4LDK A;  4MVS A;  3S1R J;  4U5F E;  4BQN A;  3ZVR A;  5GPA A;  2LK4 A;  2Q00 A;  4BJ5 A;  3FXU A;  1BZ4 A;  2XLW A;  2XC7 A;  1M2V A;  4JE9 A;  1E84 A;  2MGQ A;  2XL6 A;  3L0I A;  4HFK B;  5D5W B;  4A4A A;  4RMN A;  3OIQ A;  4UXN A;  1Z9C A;  4JK1 X;  2VQL A;  4B43 A;  1R49 A;  3FKJ A;  4G7O F;  2B0H A;  2FBI A;  1OYW A;  5GAH J;  1QSP A;  2QM3 A;  3N0T A;  1S8N A;  1TP4 A;  2F5C A;  5EK0 A;  2MYS A;  2QKM B;  4A3F J;  2JK3 A;  4D7N A;  2BL2 A;  1JPN A;  3AKZ A;  2XS8 A;  4HEA J;  4ZYE A;  5L3G A;  4XQ1 A;  3N2Z B;  1IN7 A;  3JTH A;  2X1E A;  4QPQ A;  2F6C A;  3CCR I;  1Q1V A;  3O8G A;  4J7T A;  1EH8 A;  3E1S A;  3HSR A;  4Z6Y A;  2XPV A;  5BOX A;  4V19 K;  3K6G A;  2AO9 A;  1ZR4 A;  1GUU A;  3CQZ A;  3S1N J;  1E17 A;  2R02 A;  2KJB A;  2IXP A;  3BR2 A;  1RXQ A;  5IY5 C;  3MFN A;  3CUO A;  2CQX A;  4A2U A;  2OU6 A;  3GUD A;  4CZZ A;  2QLA A;  5FKL A;  3FXJ A;  5IP9 J;  3PFY A;  1OXB A;  4GYG A;  3JRI A;  2V9P A;  4IB4 A;  2NS8 A;  3V5Z A;  1U2W A;  3HRT A;  3O3K A;  3H36 A;  2A6E F;  1S3J A;  1DUX C;  2XAS A;  1GHC A;  1WKM A;  3HEF A;  3S15 J;  1N1C A;  2DFE A;  3K10 A;  1USS A;  3QPH A;  4BL0 B;  4HF0 A;  5AIP A;  1LB2 A;  2M9H A;  5ED4 A;  1ZLK A;  4FE4 A;  4LLN A;  2YKZ A;  1R5H A;  4DBR A;  1UCR A;  1RMV A;  4IAQ A;  4A3I J;  5KCM A;  5DQZ A;  4E18 A;  3MYI A;  2L4M A;  4M3D A;  5K5Q A;  1PUE E;  5JLI A;  4RM3 A;  1R58 A;  3REO A;  2K9Q A;  3HPG A;  3DE8 A;  3L34 A;  4IWB A;  1BOB A;  3GWN A;  3BRO A;  5HNH A;  2FQ3 A;  1QA6 A;  3I59 A;  3RQE A;  2QSH X;  1Z77 A;  1HBX G;  4DJ9 A;  3WGI A;  5E1X A;  4M3G A;  3I4U A;  1MBK A;  4A3K J;  1JJ8 C;  3MEX A;  4EJU A;  5JP7 A;  5BS6 A;  3CF5 F;  3TOM A;  1RZ4 A;  2Q0O A;  2NOJ B;  2EJR A;  2RAE A;  3ASO H;  3CCL I;  4ZZL A;  2AWY A;  2LMD A;  2CFO A;  1T6S A;  1ETV A;  3AG3 H;  2QSG X;  1XMA A;  1LDJ A;  4XON A;  3FAP B;  5H6Q A;  1Y0U A;  4XL9 A;  2MLG A;  5E8I A;  2PI0 A;  1OCP A;  3DU5 A;  5LGN A;  4AVZ A;  3K0L A;  3ABM H;  1YO5 C;  2F48 A;  4JX4 A;  4XLF A;  2LC2 A;  1D1B A;  3H92 A;  2NSG A;  3V8K A;  2PP4 A;  2HKO A;  4CUG A;  5DCM B;  3SDG A;  5HLT A;  3WU0 A;  3CC4 I;  3PDM P;  3NDB B;  1TWG J;  2V79 A;  2Y39 A;  5BPI A;  4RDA A;  2AQF A;  3ZMU A;  4Q5S F;  1SD4 A;  1J8Y F;  2Y9Z A;  3PJR A;  1AHD P;  1SD5 A;  3DM5 A;  2OPT A;  3L8I A;  4QI2 A;  2JSC A;  2DU9 A;  1ULY A;  4C9Y A;  4XID A;  4YN0 B;  2QYO A;  2CCY A;  1U8B A;  1ZW2 A;  3G71 I;  3W6J B;  4UY8 I;  2J9B A;  2MFZ A;  1D5V A;  1Y56 A;  4NBQ A;  1R00 A;  3T0Y A;  2NVU B;  3QU3 A;  1LEA A;  3Q9V A;  5DTD A;  4E0I A;  1Y39 A;  4EHP A;  1YTY A;  5KYU A;  1JAF A;  3ZMT A;  2FXA A;  5CYV A;  2DA3 A;  2K9L A;  3A4C A;  5EEA A;  3DKY A;  2W25 A;  5KYY A;  1B1B A;  3CCJ I;  2VB6 A;  2L9J A;  2Y0S N;  2FX0 A;  4X1E A;  4O5V A;  5GAD J;  4CS8 A;  1Q1H A;  5F27 A;  3RF3 A;  3ISP A;  2EV5 A;  4HNV A;  1HLV A;  3T8T A;  2IEK A;  4A3B J;  2DOE A;  3QOE A;  1HOM A;  3WAQ A;  2KRF A;  1NSG B;  1VYK A;  5BQI A;  4XLP F;  1TWA A;  2VE8 A;  3RKW A;  4CDA A;  5KYX A;  3H1C A;  3EG9 A;  4B6I A;  4CDY A;  4CIH A;  2F5F A;  3BG7 A;  2A69 F;  5A6B D;  5L0J A;  1JGS A;  1D5Y A;  1NU7 D;  3CJQ B;  4DRI B;  2Z15 A;  1O3Q A;  2W82 A;  2HU9 A;  1YLM A;  4C7O A;  4QTR A;  5HS9 A;  4XSX F;  2WZF A;  4WK8 F;  4II3 A;  3IRQ A;  3RH3 A;  3FXO A;  2LY2 A;  3COA C;  1B9N A;  5D6F A;  1K4S A;  1NHA A;  2DFF A;  2NNN A;  1K79 A;  1WHU A;  3A03 A;  3L8J A;  3IQ6 A;  3KEO A;  2BHY A;  1H6G A;  1TQM A;  5J4V A;  1U9N A;  2LP4 A;  2PMH A;  5D92 A;  2CQK A;  5DEQ A;  4IHW A;  1ORJ A;  3WU1 B;  2ZPA A;  1TNT A;  4UUV A;  3VM6 A;  5E3A A;  5D8L B;  2HTS A;  4IF4 A;  4JYK A;  3CCU I;  3GEE A;  2Q1Z B;  5DD8 A;  3AG4 H;  4RB0 A;  3GTP J;  4NTB A;  2NG1 A;  2YSR A;  1PYV A;  1OQY A;  2H6C A;  3T8R A;  4OAY A;  3H0G J;  3Q6M A;  4K7B A;  4E7Z A;  1LI5 A;  1SYQ A;  2DTR A;  2W1O A;  1KZH A;  1IV6 A;  2P0N A;  1W7P B;  2CQQ A;  2NOG A;  3K4K A;  2ZME B;  3IH4 A;  4XLC A;  5FGM A;  2O61 A;  1D8J A;  2HJ3 A;  3ZDL A;  1WGW A;  1STZ A;  4I44 A;  1HDP A;  4BEM J;  1X3W B;  3H3Z A;  1APL C;  3JCU C;  2HXO A;  5A6A A;  2V7F A;  1XN7 A;  3EYY A;  2CRG A;  4PCQ A;  2MD0 A;  5A6B A;  3JW4 A;  2NNY A;  4CDG A;  4LK0 F;  5B3S H;  3LAP A;  4JJG A;  1Z63 A;  2TDX A;  3BT9 A;  3OIO A;  1XGN A;  2BVM A;  5EYR A;  5HDG A;  2K9S A;  1RIO H;  3BJA A;  4I01 A;  2JWT A;  2P7V A;  2Y0S A;  4PR9 A;  2IXO A;  1ETY A;  1S9H A;  3IH2 A;  1CQT A;  2KNH A;  4OAZ A;  3DPL C;  1Z21 A;  1MD0 A;  3E97 A;  3IAM 2;  4EVI A;  4AUX A;  1HE9 A;  1I27 A;  1MMS A;  2WBM A;  1GGQ A;  3E5X A;  4E7J A;  4JC7 A;  4JRZ A;  1K83 J;  1IN6 A;  2CMP A;  3BPV A;  3TW7 A;  2L9N A;  4RGU A;  1LDD A;  1A6Q A;  4GFB A;  4CSA C;  4D5C A;  2MBF A;  1MNM C;  2VCC A;  2NUP B;  1GLN A;  2UUZ A;  2DOF A;  2G7U A;  1TQI A;  4BNC A;  1VQ6 I;  3JZ0 A;  3QW0 A;  2HR3 A;  4I76 A;  2HFH A;  4ULW A;  1MZB A;  3DLL F;  3GFM A;  3M79 A;  4BKX A;  3EZI A;  2COB A;  2L0K A;  1HST A;  2KYH A;  2GXG A;  3NWS A;  3KEQ A;  5FLM J;  1NH3 A;  4D4N A;  1FMV A;  2DCE A;  1X3U A;  3BC8 A;  4HNU A;  3E6D A;  1T5O A;  2W4B A;  4LDQ A;  4EKW A;  1VTM P;  4X0G A;  4G7Z F;  1NLX A;  4IX7 A;  5IT9 Z;  3H5R A;  2C03 A;  3QZC A;  4JBA A;  2K4J A;  2OV7 A;  4YL3 A;  2VOD A;  1FFH A;  4XOR A;  4A2N B;  5J8F A;  2EV6 A;  3ZPL A;  1WH5 A;  2DT5 A;  1DQU A;  3TKY A;  3UGO A;  4U5G A;  3ZQG A;  3SZR A;  2EIJ H;  1V4R A;  1SMT A;  3JTG A;  4C30 A;  1TBX A;  1WH7 A;  3DE9 A;  3B73 A;  1OW6 A;  1VQ8 I;  4RA2 A;  1YZA A;  2QEN A;  4RB1 A;  5AON A;  2E87 A;  2YHS A;  1YRN B;  3G4X A;  4RGS A;  4OIQ F;  4WWC A;  3HOT A;  1VQ4 I;  3DTI A;  1P92 A;  1A41 A;  2M4K A;  4HLY A;  3FHZ A;  4IRG A;  3GTL J;  5IT3 A;  3SFZ A;  2D1V A;  1ORS C;  3EFO B;  3M8F A;  2DT6 A;  2PF4 E;  2G0E A;  1X1B A;  3TJ6 A;  3E7L A;  4HX8 A;  1AUE A;  1Y8Q B;  4EM1 A;  1H88 C;  4I1O B;  3HTS B;  3FXH A;  4EEF G;  1E0E A;  3EUK L;  1Z6A A;  2JT1 A;  2HJM A;  2M4G A;  3RIP A;  3WTZ A;  2LKX A;  3GM1 A;  1IZM A;  2LCH A;  1BR1 A;  2L9R A;  2P61 A;  3ZP5 A;  2CQ7 A;  4I0A A;  3TBI A;  1K78 B;  2B7E A;  1UG2 A;  2LTP A;  2KIU A;  2X6Y A;  3RYL A;  3GVA A;  2WV0 A;  1PP8 F;  1WJA A;  2HOS A;  1FJL A;  3OYE A;  3SNH A;  3KP7 A;  4MTD A;  3B02 A;  5DS4 A;  1BBH A;  1FP1 D;  1ZRD A;  3BTL A;  1K04 A;  3U2R A;  1WAT A;  4B1R A;  1Z05 A;  2F5V A;  1YG2 A;  4YFK F;  3BEH A;  2WB1 N;  2M7B A;  4BEH A;  3OL4 A;  2OCC C;  2DPU A;  4FX5 A;  1CPQ A;  3R6S A;  2TRT A;  3LSR A;  3BR5 A;  3Q9S A;  2QBY A;  4CZC A;  3NYL A;  3NWT A;  1VMA A;  2YL7 A;  2MLK A;  1IZ1 A;  2RDP A;  3WTW C;  3ZN0 A;  3QW1 A;  5GAE J;  2OAZ A;  5E79 C;  2EFW A;  3GTG J;  1LS1 A;  3I9V 2;  3EGX B;  2VQC A;  3QYE A;  2YLG A;  1U0B B;  3DTK A;  3VF0 A;  5ERI A;  4RM2 A;  1GV2 A;  1TL8 A;  2LNB A;  2KIM A;  5K7F A;  2AS5 F;  1X4P A;  1AKH A;  2EB7 A;  3QP6 A;  3ZN1 A;  1YJW I;  2HEO A;  2QCO A;  3S2W A;  4A3C J;  4HQE A;  5IOY A;  4CS7 A;  3GYH X;  5ICF A;  1BIA A;  4XKV A;  3LQR A;  1SVO A;  2ID3 A;  4S05 A;  3M4O J;  1BM9 A;  1V74 B;  4CS9 A;  1YYJ A;  3IKV A;  4LAC B;  2E1O A;  2ZXI A;  3BRJ A;  4II2 A;  2OEV A;  2RQQ A;  2KZV A;  5IYD J;  2DFH A;  2LBF B;  3RZD J;  4AE4 B;  3MZY A;  2EFN A;  3GF2 A;  1OLT A;  1T01 A;  3L1P A;  2HZT A;  2EPO A;  2J8W A;  1O3R A;  4L6R A;  3RKX A;  1DGW Y;  3TO9 A;  1K6Y A;  4ABZ A;  1WGX A;  2PMU A;  4QWQ A;  2LD6 A;  4A5M A;  2W48 A;  2KIS A;  4AU7 A;  5IPA A;  5EG0 B;  3ZMD A;  3RCO A;  1WCM J;  4EJV A;  1BC7 C;  2QQB A;  3L2W A;  1QU3 A;  2FBH A;  1OR2 A;  3AG2 C;  3OL3 A;  1BL0 A;  2DMT A;  3K4C A;  2GA0 A;  3I64 A;  2CWE A;  1QLE C;  4MVQ A;  2DXI A;  2NVX J;  4P9U A;  1O4X A;  1Q0D A;  1YIJ I;  3Q0V A;  3R7C A;  2EFP A;  3PO2 J;  4BHP A;  2VOO A;  2ZNZ A;  2OTL I;  3K2A A;  3CC2 I;  2WAD A;  1LS4 A;  1AWC A;  1FTT A;  3MKW B;  5DDG A;  5L3V A;  1S29 A;  5IYC J;  5D5U B;  3OYI A;  2XXA B;  1MDM B;  2K3P A;  3D0S A;  1M57 C;  5B3S C;  3GWL A;  2IXM A;  3ABK H;  1ORY A;  1MKM A;  4OU0 A;  2XF6 A;  3OV8 A;  3V42 A;  5AC5 A;  3R60 A;  2LRD A;  2L7M P;  3FBN B;  4RGX A;  4A69 C;  2JZY A;  2OD5 A;  4RAG A;  3IL2 A;  4G8X A;  3G4S I;  4P1W A;  2MC3 A;  1XZQ A;  1XMK A;  2ETH A;  3P9K A;  3I0T A;  3JRE A;  2Y69 C;  3DKA A;  4MVZ A;  3FMR A;  1JGG A;  4NY3 A;  4YWQ A;  1YE9 A;  3G50 A;  2DA6 A;  3UMK A;  1LVK A;  2X6W A;  1AEP A;  3DXJ F;  4FAS D;  2IJL A;  2ECC A;  3N97 A;  5JLW A;  1U6H A;  2P5L C;  1BW5 A;  4M72 A;  2PFD A;  4A6D A;  1RJ9 B;  4R79 A;  3C3W A;  4W8P A;  3V5X A;  4F93 B;  1SF8 A;  5L3B A;  1Y1W J;  4Y17 A;  1FZP B;  1J5Y A;  2FD5 A;  2EPK X;  2M2E A;  4EUK B;  2FE3 A;  3M1C A;  5CJ9 A;  2L9V A;  4YT4 A;  1RKE B;  4HA8 A;  5E1Z B;  4N4O B;  4AX2 A;  4HDU A;  2OUM A;  2LYC A;  3H9J A;  4DYQ A;  1A5J A;  2EIJ C;  2KLO A;  4BDY A;  2VCA A;  3WTX C;  3LNM B;  3EHM A;  5DS9 A;  2HDW A;  2FA5 A;  3L9F A;  1I6X A;  1VQN I;  1MJ9 A;  2EA4 A;  4WGY A;  4M6Y A;  1CGM E;  4YEL A;  2PX3 A;  1AU7 A;  2XV4 S;  1CF7 B;  2O3F A;  4MW8 A;  3CCV I;  5E3O A;  4UUS B;  4ITV A;  4U7B A;  3NG1 A;  2PJR A;  6PAX A;  1KGS A;  4Q48 A;  3V8L A;  3PSF A;  3RFY A;  2DI3 A;  1S7E A;  2R5Z B;  3KFW X;  2HQA A;  3C1D A;  1JRA A;  4O6M A;  4S04 A;  1BR4 A;  2F5E A;  1WZ2 A;  2F22 A;  3CUQ C;  1KU7 A;  1N75 A;  3IV5 A;  5L0H A;  1LFB A;  4B48 A;  1U8R A;  4F7Z A;  1Z3I X;  2NUT A;  4L18 B;  1UHM A;  4KC9 A;  4XEV A;  5EGO A;  3PM1 A;  2COM A;  1LI7 A;  1MSE C;  3AL0 B;  2V1N A;  1ZG3 A;  2RVC A;  3E6C C;  5LHH A;  2FGY A;  1LE8 B;  1LKX A;  4FWV A;  3EH1 A;  3HLZ A;  4M63 A;  1HKQ A;  4XRM A;  2VOP A;  1DDN A;  4BXF A;  2W84 A;  5B1A H;  1O3T A;  2NVQ J;  2HNH A;  4G94 A;  3O2P E;  4P96 A;  2DW4 A;  3HRU A;  2BOL A;  5LHI A;  4U5B E;  3VYW A;  4DXW A;  2PNO A;  2GXA A;  5KYN A;  2LDU A;  3BDD A;  2E7W A;  2HVQ A;  4BBR J;  3S9O A;  1K40 A;  1VF9 A;  4IL6 C;  1FIA A;  3O6B B;  2JSP A;  4XOT A;  5HV9 A;  3AQC A;  4YIF A;  4DBQ A;  2R7O A;  5LEK A;  3US6 A;  3UKG A;  4MIM A;  4E7I A;  4K1O A;  3KCC A;  3G1O A;  3JRT A;  1WJD A;  3I54 A;  4LFU A;  3OSG A;  3LSJ A;  5M3F J;  1JUP A;  1ZG1 A;  1XDS A;  2H8W A;  2M34 A;  1AOY A;  1JHF A;  5JS5 A;  1U5T C;  5LEJ A;  2EIM C;  5E1W A;  2FEZ A;  1FP2 A;  1R1V A;  2EIK H;  2K9M A;  3K9T A;  1J7K A;  4HF1 A;  4UDV A;  3BLY A;  4CDV A;  1ZU5 A;  4AIK A;  2JRM A;  3VPR A;  2MSY A;  2M7A A;  4Q7C A;  1KU2 A;  2TCT A;  2FOW A;  4LIV A;  4A5N A;  3IWF A;  2QQ9 A;  3ZXS A;  2ZNY A;  1VQO I;  1T6I A;  1CGN A;  3E5U A;  3FBI B;  4M3E A;  1E3P A;  2H09 A;  3VYU B;  2G7H A;  3PL8 A;  2BGC A;  2JPC A;  2CV0 A;  4F3Q A;  3HSE A;  3WTV C;  2ZJP F;  5HSW A;  2FFH A;  2KK1 A;  4BQA A;  5C44 J;  4AK9 A;  2EIN C;  1Z1D A;  4CSW A;  2XSE A;  5B1A C;  3FAJ A;  1F5T A;  3LUT B;  2HUJ A;  4ENN A;  1SAN A;  4J30 B;  4JIO A;  1JTX A;  1A36 A;  2J9W A;  4L5I A;  1QNT A;  2CU7 A;  1QO0 D;  2ELH A;  4L9J A;  1VQ7 I;  4ASN A;  1B8I B;  1QZZ A;  3EPZ A;  4KNW A;  3K4N A;  3FM5 A;  1U89 A;  2NAZ A;  2CW0 F;  1G5Z A;  2E5Z A;  2LRE A;  3L2U A;  3LSK A;  2HMQ A;  2H6B A;  2OZU A;  4N9H A;  5L0F A;  2Q2E A;  2VAS A;  3ZOB A;  3BG5 A;  3DWL E;  2ADU A;  4Y15 A;  1KYW A;  3TED A;  2YU9 J;  4M71 A;  4CA0 A;  3ELK A;  4YG2 F;  4ESJ A;  1KU9 A;  2HZ8 A;  1OIS A;  4FX0 A;  3BR3 A;  2JA7 J;  2CYY A;  1MMG A;  4AVP A;  1Z7U A;  1EA8 A;  2WL8 A;  4ESB A;  2QNL A;  3ZMS A;  5IOZ A;  2R25 A;  4N6C A;  1LJ9 A;  2QSF X;  4P5O A;  4TV7 A;  3ABK C;  5F28 E;  2P6S A;  5F5F A;  4LG0 A;  3ZRG A;  4MVO A;  1V54 C;  3SYN A;  3OYN A;  3BTI A;  1BI3 A;  3BCB A;  3SZP A;  3LL7 A;  2PMZ N;  3ML6 A;  3WG7 H;  4CCM A;  3FHD A;  1EQ1 A;  1MBF A;  3HXL A;  4CYD A;  2CNW D;  1DPR A;  1H9T A;  4XKC A;  3QVY A;  1OCZ H;  2WZG A;  5CQG A;  1HDD C;  4WJ0 A;  4KMU X;  4MEY F;  2BC5 A;  1TQP A;  1JJ6 C;  2BW3 B;  3I4P A;  3U3B A;  3H35 A;  5DS5 A;  1MBH A;  2VON A;  2B0J A;  4HYE A;  2VQG A;  3ZQV A;  2HQ5 A;  3K1N A;  2L9S A;  3S32 A;  3NMJ A;  2K02 A;  1XC5 A;  1UHS A;  2VJ4 A;  5J3L A;  1I6H J;  3ZQC A;  1J0R A;  1X4O A;  1TWF J;  1ZRF A;  1S05 A;  3A9C A;  3O6X A;  1I3Q J;  3O39 A;  4MW3 A;  2HVS A;  2HSB A;  2VKV A;  2R93 J;  2R7V A;  1MGT A;  3ZMV A;  2GOM A;  3CSK A;  2A68 F;  2I8D A;  1SD7 A;  5F5H A;  2ECB A;  2CV1 A;  2A6H F;  3RVZ A;  2VJI A;  1G4D A;  4E17 A;  3H9Q A;  3CEX A;  3P9I A;  3CMA I;  2AWC A;  4S0H B;  1Z7Q c;  4Y52 J;  4O79 A;  3ERE D;  1WJE A;  3LLI A;  1BJA A;  3QRF F;  1I39 A;  5FJ8 J;  2M3A A;  4IAO A;  1WJC A;  3GW2 A;  5L3D A;  2H8A A;  4XEF A;  2QBY B;  3AGU A;  3ASN C;  1Y6D A;  5FRN A;  3VEP A;  2LG4 A;  2D2W A;  1A0B A;  2CYD A;  3C8G D;  1O3U A;  2CNW A;  2EBI A;  3B9Q A;  4WXC A;  1JT0 A;  4O7G A;  1EH6 A;  4I02 A;  1T0F C;  4PJN A;  3VSL A;  3BZ6 A;  2BV6 A;  3H5N A;  3I58 A;  1B4A A;  5GPC A;  1YW9 A;  3B6A A;  1Y4C A;  3AJM A;  1MMN A;  5F0C A;  2HTJ A;  3A01 A;  4BPM A;  2HQN A;  3EHN A;  4F52 A;  3S3M A;  1YYX A;  3IEE A;  5ILS A;  3SXM A;  3VYT B;  1M2V B;  2PBI A;  4YII A;  2K5C A;  3HBL A;  3DBL B;  1VQM I;  3J7A O;  4D4X A;  1OPC A;  3OYD A;  3MQ0 A;  3LSG A;  1LVA A;  1Q0M A;  5L3E A;  3DMD A;  3V5Y A;  5ICG A;  2PMZ A;  2LD5 A;  1OR7 C;  2FNP A;  2G62 A;  4M6X A;  4MTF A;  1FOK A;  2YVK A;  4KNV A;  5COF A;  4CSA A;  1YJG A;  2J9U A;  4IHY A;  5KYW A;  1R1T A;  5JLX A;  9ANT A;  2F5D A;  2YL1 A;  1SVM A;  2QLZ A;  5DS6 A;  3PNT A;  1GVD A;  5BQH A;  1FWZ A;  2QGU A;  1J2X A;  3EDP A;  1FOW A;  5F1J A;  3K1M A;  1M2O A;  3ZCO A;  3F8F A;  3MAJ A;  3QYF A;  4EBB A;  2LOO A;  4OIN F;  1IUF A;  2K7L A;  4B3X A;  4CYC A;  3BZC A;  2CUJ A;  3WTS C;  3F21 A;  2YL3 A;  3B0P A;  1T98 A;  1CPR A;  1BA5 A;  3IC7 A;  3C8G A;  5F04 A;  1B68 A;  3E0J B;  3LA3 A;  2K85 A;  1X2M A;  1O7L A;  1A6I A;  2GA1 A;  2H1K A;  5IYB J;  2BBY A;  5IP6 A;  1ORK A;  2WVO A;  4PAC A;  3UMI A;  4MTG A;  3K7A J;  4I3M A;  4KIS A;  1ZKG A;  2FMY A;  1JR8 A;  2MW8 A;  1J09 A;  2GBY A;  4AWX B;  2R7U A;  4M3F A;  2EQR A;  3M8E A;  2CFX A;  3B29 A;  4C2M J;  1RCP A;  2Q3T A;  4BDZ A;  4Z2Y A;  4DRJ B;  1L7C A;  1OKK D;  5D4S A;  4DZP A;  1KQ8 A;  1IRX A;  1JKO C;  3CTA A;  1PDN C;  3DLA A;  1YHQ I;  2DMP A;  4A3D J;  1R7J A;  2GFH A;  3WHC A;  2ZFU A;  1UFM A;  3EH2 A;  4V2G A;  4ONS A;  4CCL A;  3GFI A;  2DAO A;  5CVI A;  3JRB A;  4A6E A;  3LSM A;  3M7G A;  2VE9 A;  4NQW A;  3HHH A;  2F4I A;  3LQQ A;  3HDD A;  2XRH A;  1QVT A;  3TK0 A;  2O9X A;  2EZH A;  5CVJ A;  2M87 A;  2K9N A;  3I59 B;  2XLM A;  3PIO F;  4GYT A;  3SXK A;  2PLY A;  3T9O A;  3M4C A;  5F64 A;  1D0X A;  3CJN A;  2DMU A;  1F43 A;  3S27 A;  2DFI A;  5IP7 J;  1TLH B;  1WRJ A;  4W97 A;  2Z3Y A;  4C3H J;  4AL1 A;  2HQR A;  3IUO A;  2F4M B;  4UVC A;  4BQQ A;  2V6C A;  5DV5 A;  1BN5 A;  3Q3S A;  3CCS I;  1YLF A;  2IA2 A;  3GO5 A;  1J9I A;  1T33 A;  3MYF A;  3AG1 H;  4Q47 A;  2G3K A;  2LSO A;  4M6V A;  1K4T A;  3NYM A;  3PHF 2;  1FEX A;  2E36 A;  2X6O A;  1ZRC A;  1Z67 A;  2GA2 A;  2PG4 A;  1BJZ A;  2ZJQ F;  3B0V C;  1AA7 A;  2O6G E;  2Z5U A;  1NBB A;  2DYS H;  4JCH A;  2R7R A;  4EWC A;  1IGN A;  2Q9C A;  5D5V B;  1J75 A;  3JRA A;  3HM5 A;  4U5E E;  1G6N A;  3UNG C;  1ENH A;  3F6O A;  3DM9 B;  3BG6 A;  1OKK A;  3BJO A;  2L54 A;  2VBZ A;  2R7D A;  3CDI A;  2ZB9 A;  4U5C E;  3DBR B;  3CLO A;  5JR3 A;  3DF8 A;  1ON1 A;  4IHX A;  4I1M A;  4NC3 A;  1M6T A;  3BR1 A;  1IXR C;  2VBW A;  5T3T A;  1IJW C;  4GEH A;  2YX7 A;  1C0W A;  3IHU A;  3KET A;  3HNL A;  5TJJ A;  1UG0 A;  1VQ5 I;  3HJE A;  3NEU A;  2ZSH B;  2R5Y A;  1RUO A;  2EZK A;  5KHD A;  5HS8 A;  1LFP A;  5B5E C;  1JHH A;  3ZQI A;  2EV0 A;  4IZZ A;  4L9N A;  2DBB A;  1OR3 A;  3SEZ A;  4H54 A;  5LRR A;  5KYU B;  2ZME A;  2VH3 A;  1OKR A;  3BG9 A;  4KN7 X;  1TQG A;  3KZI C;  3HOZ J;  3F8N A;  4PJL A;  4B8X A;  4N06 A;  1L0O C;  5HDN A;  1Z6T A;  3U9M A;  5KYY B;  2DTZ A;  4E70 A;  1LPQ A;  3JSO A;  2D4U A;  2VCB A;  4RBN A;  1YIT I;  4DW6 A;  3JYH A;  1RKT A;  5LFA A;  3C2B A;  1TTY A;  5JVT A;  2JA2 A;  1JT6 A;  2P5V A;  3J80 K;  4LMY A;  2L6G A;  4ZTF A;  1NK3 P;  1MBG A;  2A05 A;  5F0F A;  2A07 F;  2V1U A;  4MVM A;  3S17 J;  2KC3 A;  2M5W A;  3GM2 A;  3U2L A;  5HDK A;  4ENK A;  3WTU C;  3IQC A;  2VBY A;  4IAR A;  2ZJR F;  1REP C;  1YFH A;  3F22 A;  3U1D A;  2M8E A;  3QYB A;  2QUF A;  5KYX B;  3EG9 B;  4KBL A;  3HIF A;  2VC0 A;  3TL4 X;  4BY1 J;  4HE8 D;  4W8K A;  2IXS A;  5D4R A;  2XAH A;  2A5Y B;  3JRC A;  4KIC A;  3VWB A;  3S3N A;  4MTO A;  4JQF A;  2H27 A;  2YZS A;  1E85 A;  1HXD A;  3PQK A;  4C7O B;  4JKV A;  1QQ3 A;  5DLJ A;  3RQI A;  3ZQL A;  5A6J A;  3GX4 X;  3TDU C;  2ESH A;  3FZV A;  1FNT c;  4E7L A;  4M74 A;  1TNS A;  1TWH J;  4Y3O A;  4BE2 A;  1FSE A;  1ETX A;  2DYR H;  1SAX A;  1N78 A;  3LAY A;  3X2Q H;  1W5S A;  4MVU A;  3TJ5 A;  2LY9 A;  3EZH A;  2KQR A;  4G9Y A;  1Z0X A;  4GGG A;  4U88 A;  2E1M B;  3PNV A;  1RI7 A;  3GTM J;  4IO9 F;  4BY7 J;  1A04 A;  1H8A C;  3GEI A;  4F91 B;  1UFB A;  3RTR A;  1W36 D;  1NK2 P;  4I98 B;  2LH9 A;  3NAU A;  3GLX A;  5HNF A;  3QVZ A;  3EPV A;  4P55 A;  4G6Q A;  2A0U A;  1TWC A;  5LGT A;  2LF8 A;  1ODD A;  2ZXW H;  2LQG A;  4FQG A;  3J81 K;  4WCG A;  1B59 A;  4JTA B;  2IP2 A;  3QPS A;  4I09 A;  3W2V A;  1OCC H;  2YR2 A;  5J47 A;  2ZD9 A;  1W5C C;  2UZK A;  2JQ7 A;  1ACI A;  3TUL A;  2OZ6 A;  1ZAO A;  1TW3 A;  2EA2 A;  3DI5 A;  2XL4 A;  2ZC2 A;  4GRI A;  1Q0F A;  1X19 A;  4CBE A;  1FTS A;  3S2H J;  4Z9I A;  2ASR A;  2UXN A;  3K2Z A;  4HG2 A;  2E5N A;  4L9V A;  4ZLD A;  5FFX A;  1YS7 A;  2H7V C;  2QWW A;  3KX2 A;  4XTK A;  5K1Y A;  1TT5 B;  4U0W A;  4O6N A;  1JTY A;  2HS5 A;  2P7V B;  5E8G A;  3SEQ A;  5DM6 F;  2QEX I;  4EQQ A;  2GOX B;  3JT1 A;  2O7O A;  1HCR A;  1KA8 A;  1XS9 A;  1IXC A;  4CIC A;  3ASO C;  1E86 A;  1Q0K A;  4A0X A;  2Y3D A;  1E3O C;  3AG3 C;  3L2V A;  3B6C A;  2GZW A;  2XKO A;  1E2X A;  4ZYD A;  3EGD A;  2HI3 A;  1A7D A;  2HFI A;  2R4G A;  2DDB A;  3A0B C;  3O8H A;  2X0L A;  1I4Y A;  3DPU A;  4XKB A;  4RGR A;  3ZQF A;  3OOP A;  3WE3 A;  3ABM C;  3CMM A;  2LKS A;  1P7J A;  3VOD A;  1GXP A;  2XGC A;  5GTH C;  2DPD A;  3H2V A;  4Z9H A;  3P5J A;  3W6V A;  1RC9 A;  3CUQ A;  5J1Y A;  2AXT C;  3MKY B;  2BXY A;  2PJP A;  4Y4R A;  2DJI A;  1O5H A;  3SFI A;  1PD0 A;  5C3E J;  4ZTJ A;  4XBF A;  1IW7 F;  5FLX K;  4BS9 A;  1Z23 A;  1ETO A;  1T38 A;  5FZT A;  4IEJ A;  1V4A A;  3AAF A;  1YX3 A;  2W85 A;  2GIV A;  4UHT A;  3MCZ A;  2NYX A;  5D6E A;  4XEK A;  2IBD A;  3CCE I;  3HOU J;  1R6R A;  4KT5 C;  3ZQQ A;  1WAS A;  2HV6 A;  3KZZ A;  3HOW J;  3KL4 A;  3F0C A;  4MEX F;  2G9W A;  1PUF A;  1OCO H;  2YRF A;  5EZH A;  2R7W A;  2YEV A;  3N05 A;  4WAB A;  2Y31 A;  4L0Z B;  4A0Z A;  3HNJ A;  3QOD A;  4OWR B;  4J00 A;  3UGP A;  1U9O A;  1FFT C;  2EZL A;  3DAF A;  1TWG A;  4O6J A;  1O7F A;  3R0A A;  1D8K A;  1X3Z B;  3RQF A;  3WOD F;  2HPM A;  4FT8 A;  4EGZ A;  5JRA A;  2J0X A;  1V55 H;  3BPX A;  4RB2 C;  2DA5 A;  1W2W A;  3J7A Y;  2KJC A;  2AU5 A;  4N6H A;  3WE2 A;  1U5T A;  4B44 A;  5CLS A;  3HSF A;  3E70 C;  2Z33 A;  2OBP A;  1T95 A;  4XWJ A;  1UMQ A;  2YWA A;  1XGM A;  3BP8 A;  2LVS A;  1WSU A;  4HRI A;  1YDI A;  1IF1 A;  3IRR A;  1FAP B;  2X9D A;  3KP4 A;  2Q9A A;  3OA1 A;  4C2U A;  2HV7 A;  2H8R A;  5CVR A;  2LY1 A;  3MKL A;  4CJO A;  1XSX A;  1MJA A;  2BVL A;  2ZME C;  1C03 A;  3ABL H;  3DEE A;  1G8X A;  4HV5 A;  1CGP A;  1ZR2 A;  2H7O A;  4BEH B;  3OS2 A;  4JVS A;  3QPT A;  2X48 A;  2Y3G A;  3E6M A;  5GAG J;  3Q6N A;  4XN3 A;  1R36 A;  2GAU A;  2E1N A;  3PFI A;  2CW7 A;  4HPQ A;  3UR3 C;  3L00 A;  2GM4 A;  1UAA A;  3ECS A;  1FSH A;  2HGC A;  3K33 A;  3KLN A;  3AG4 C;  1GDT A;  3U1K A;  3FXL A;  5C4J J;  4JOM A;  2YX4 A;  4EM0 B;  1EF4 A;  2NPU A;  1SC7 A;  3P9C A;  3LFU A;  2HSQ A;  3GAN A;  4PZJ A;  2UXX A;  4FTH A;  1NFN A;  3KYD B;  1K05 A;  1OYI A;  2VXD A;  3K1I C;  3FXK A;  4UVA A;  5DVW A;  1BBY A;  3GFJ A;  1WWP A;  3W6K B;  5FO5 A;  1AKH B;  2V3C C;  1HW1 A;  3F3X A;  2RN7 A;  4EJT A;  1QVX A;  5FD6 A;  2XSD C;  2L01 A;  5H2F C;  2D5V A;  3HTK C;  1UHW A;  3S1M J;  4A0Y A;  3RIR A;  3A1Y A;  3OIP A;  4RAF A;  2VXZ A;  2LP0 A;  4HX7 A;  3OYC A;  1QHH D;  4J01 A;  3S90 A;  4XSZ F;  2ESN A;  5BNG A;  2Y9Y A;  2XF5 A;  3W4Y A;  2DYR C;  3T5X A;  4BHB A;  4LLC A;  5D91 A;  3V7O A;  3X2Q C;  1KON A;  1S6L A;  2I10 A;  3OR2 C;  3BCA A;  2QY9 A;  3F46 A;  1PVE A;  1X1C A;  2DJN A;  2DA7 A;  2Z99 A;  1D0Y A;  2VC9 A;  5L0D A;  3FHN A;  1B72 A;  3JSP A;  2EFQ A;  1QZY A;  3KYC B;  3LSI A;  2HYF A;  1IRZ A;  2K40 A;  3J06 A;  2Z2S B;  4FHT A;  3HGY A;  1TFO B;  1EJ9 A;  4MQV A;  4IHT A;  1FOY A;  2K27 A;  3I53 A;  1ZEL A;  2HOE A;  1MNE A;  5H20 A;  3TO7 A;  3ECO A;  3GZ6 A;  2ZXW C;  4GQH A;  3RQG A;  3SP1 A;  2E60 A;  2QQA A;  1B9M A;  1G4U S;  4JTD B;  3AQB A;  1ZN2 A;  3U21 A;  1YS6 A;  3DD7 A;  2L7F P;  3K7D A;  1R9T J;  2XS1 A;  2QUP A;  2XAQ A;  3ZTZ A;  2N8G A;  3T1B A;  4F92 B;  2DK8 A;  3FOP A;  3O55 A;  2HOT A;  1F1M A;  1VI0 A;  2RQP A;  4WF2 A;  5E3M A;  3G6E I;  2CV2 A;  3ZR8 X;  5L3F A;  1V5G A;  3DTE A;  1J59 A;  4MVR A;  4EJO A;  2CJJ A;  3JSE O;  3V4G A;  1ERD A;  4OIR F;  3TP3 A;  1IDZ A;  3ULQ B;  1OCR H;  4HV6 A;  2HXI A;  2H7B A;  4M73 A;  5JT4 A;  2WY8 Q;  4D1Q A;  2O8X A;  2NSF A;  3K4J A;  1UEL B;  2FML A;  3DBH B;  2JRT A;  5ICC A;  3O10 A;  1VZ0 A;  4AIH A;  1G3T A;  3FX3 A;  5E17 F;  4LJZ F;  1KQ0 A;  3CQZ J;  2Z9O A;  3PMR A;  2MAB A;  1W36 C;  2KKO A;  1F4K A;  4NQF A;  2CUZ A;  3SDB A;  1DOV A;  3LLK A;  3IH3 A;  4NB5 A;  3LNR A;  2ZSI B;  1G2H A;  3HL2 A;  2OQM A;  3ZC4 A;  5DQT A;  1T0F A; 
#chains in the Genus database with same CATH homology
 3CSK A;  3EUA A;  2I8D A;  2A68 F;  5F5H A;  3EGD B;  2DYS C;  2CV1 A;  2A6H F;  2VJI A;  3QOE A;  4PJJ A;  3VYS B;  3RPU D;  3H9Q A;  1VYK A;  4XLP F;  1TWA A;  1D0Z A;  4IQJ A;  5E2Q A;  3EG9 A;  4O79 A;  4B6I A;  5KYX A;  1WJE A;  4PSX A;  3BG7 A;  4CIH A;  5L3Q A;  2A69 F;  3LLI A;  2M3A A;  4IAO A;  1WJC A;  1NU7 D;  3CJQ B;  1JPJ A;  2M0M A;  2J46 A;  3M1C B;  4BJ1 A;  2Z15 A;  4Y33 A;  2W82 A;  2L2O A;  3HPH A;  2HU9 A;  3FDY A;  4C7O A;  3ASN C;  2LBF A;  5FRN A;  3DQV C;  4E6K G;  2WZF A;  4AE4 A;  2LG4 A;  4II3 A;  5EHH A;  3RH3 A;  3L2Q A;  2WY7 Q;  3FDQ A;  2LY2 A;  4C3E A;  2WZL A;  2CNW A;  1QZX A;  3B9Q A;  3S0X A;  3K6B A;  4PFP A;  4CS8 C;  4O7G A;  1OCO C;  1T0F C;  4BJ6 C;  2Z16 A;  4PJN A;  4RD9 A;  3VSL A;  3H5N A;  3VYR B;  2X6X A;  5D92 A;  2PJR B;  1Z5Z A;  1MMN A;  2PX0 A;  2ZPA A;  1VYI A;  2I8B A;  5E3A A;  3EHN A;  4F52 A;  3S3M A;  1ZHT A;  3IEE A;  3W2A A;  2Q1Z B;  4J32 B;  1WJB A;  3ZGK A;  1D1C A;  3VYT B;  1M2V B;  2NG1 A;  2K5C A;  1PYV A;  2A1D D;  3Q6M A;  4OAY A;  4K7B A;  3OYD A;  4E7Z A;  3LSG A;  4Q7C A;  2W1O A;  1VOM A;  3DMD A;  2G3V A;  3K4K A;  1V55 C;  4XLC A;  2IOQ A;  4QPO A;  1JI8 A;  2PMZ A;  2NUT B;  5EGY A;  3ZG1 A;  1WGW A;  4MQ9 F;  2VIX A;  1OR7 C;  2G62 A;  5T3W A;  3CF2 A;  4I44 A;  2XXA A;  2J0W A;  2W45 A;  3SEO A;  2JD3 A;  4KNV A;  4CSA A;  3SYT A;  2P0W A;  2J9U A;  2V7F A;  1NU9 C;  3F47 A;  5KYW A;  4U5H A;  2JUG A;  4F4B A;  2MD0 A;  2IS6 A;  3PNT A;  5DS6 A;  3ONQ A;  4JJG A;  1Z63 A;  1M2O A;  3ZCO A;  4NUB A;  2BVM A;  3QYF A;  2J9V A;  2E1M C;  4EBB A;  2LOO A;  4JUR I;  4OIN F;  4B3X A;  3B0P A;  2CUJ A;  2P7V A;  2Y0S A;  3ABL C;  3CP8 A;  3JCU Q;  4IQ4 A;  2IXO A;  3RYL A;  1U0J A;  1S9H A;  2HPI A;  4KJZ A;  2UV1 A;  5T1D B;  2KNH A;  4OAZ A;  3DPL C;  3E0J B;  1Z21 A;  1MMD A;  3IAS 2;  4CCJ A;  3IAM 2;  2WBM A;  4OD4 A;  4E7J A;  2J45 A;  1Y6I A;  2CMP A;  4H4K C;  2WVO A;  5HOO A;  2L9N A;  3UMI A;  4CSA C;  2Q9B A;  4I3M A;  2KW3 C;  4KIS A;  3OS0 A;  4HEA J;  2QTV A;  1RJ9 A;  1ZU4 A;  1J09 A;  4XN0 A;  2NUP B;  2R7U A;  1GLN A;  2UUZ A;  4G0H A;  3Q7L A;  3H9G A;  2X1C A;  4G6T B;  5B1B C;  3M8J A;  3T4R A;  2Q3T A;  4BDZ A;  4ULW A;  1OKK D;  2WB1 A;  2IYL D;  2WVN A;  3LEV A;  3K4B A;  2DOA A;  4PFO A;  1IRX A;  4B47 A;  3EZI A;  3OYK A;  1DP3 A;  2KPM A;  4C3D A;  3DLA A;  1LDK B;  1MMA A;  2GFH A;  3NWS A;  4EAT A;  3C2G A;  3EUH C;  2ZFU A;  1FMV A;  3EH2 A;  2DCE A;  3BC8 A;  4E7S A;  3NKE A;  4HNU A;  3IP4 B;  1OCC C;  4CCL A;  2W4B A;  4X0G A;  4G7Z F;  4IX7 A;  3H5R A;  1ST6 A;  2C03 A;  3LSM A;  4DJA A;  3QZC A;  2F4I A;  2OV7 A;  2WVQ A;  1FFH A;  2XRH A;  1TWH A;  3MLG A;  4XOR A;  4E7K A;  2O9X A;  4A2N B;  3L2R A;  3LMM A;  4HEA 2;  1DQU A;  4GYT A;  3UGO A;  4U5G A;  3SZR A;  1D0X A;  2CDQ A;  4YT2 A;  3S27 A;  1X1A A;  2MWQ A;  2FUG 2;  4C30 A;  2WAE A;  2OG2 A;  4OIO F;  2KL4 A;  3GOD A;  4G7H F;  2L81 A;  3DZA A;  1ZHW A;  3KMI A;  1O87 A;  3IUO A;  2E87 A;  2YHS A;  2IGO A;  4NC8 A;  4BQQ A;  2V26 A;  3OYM A;  3HOT A;  3DTI A;  4BE0 A;  3I5P A;  4OIQ F;  2M4K A;  1TR2 A;  3PHF 2;  2G3K A;  3NYM A;  3EFO B;  4Q4Z F;  3B0V C;  2DT6 A;  2XAU A;  2PF4 E;  1X1B A;  1AA7 A;  3MX3 A;  2Q2E B;  4JCH A;  2VLA A;  2R7R A;  2IGN A;  4I1O B;  4EWC A;  3OYH A;  2Q9C A;  4LER A;  1E0E A;  3EUK L;  1FMW A;  3OYL A;  3K70 D;  1Z6A A;  4U5E E;  4U87 A;  2M4G A;  3UNG C;  3RIP A;  2ZXH A;  3DM9 B;  3BG6 A;  1HA8 A;  1IZM A;  1OKK A;  2RRE A;  1BR1 A;  1D1A A;  2KRC A;  2JVH A;  4MLO A;  2R7T A;  4U5C E;  3S93 A;  2W9Y A;  4I1M A;  3TBI A;  3MMY B;  1WJF A;  4ZDL A;  4JJF A;  5T3T A;  4ZC3 A;  4GEH A;  2HVR A;  3OEO A;  3KYL A;  2X6Y A;  1WJA A;  3GBG A;  3DAG A;  3S29 A;  1UG0 A;  4X0R A;  3OYE A;  2WB7 A;  4IJJ A;  3SNH A;  2ZSH B;  3NKD A;  1Z7L A;  3D5L A;  5DS4 A;  5KHD A;  1OCR C;  2KDO A;  4YEJ A;  1PCX A;  2F5V A;  1LFP A;  2VL8 A;  2Z1D A;  3C2H A;  4K0D A;  2M7B A;  3RKO F;  2VKD A;  3KKB A;  2L5Q A;  4BEH A;  3OL4 A;  2OCC C;  4IZZ A;  4FX5 A;  3W8I A;  1TKN A;  4N4N B;  1M56 C;  1X1D A;  4LLE A;  3AL0 C;  3PSI A;  3SEZ A;  5KYU B;  4CZC A;  3JSZ A;  3NWT A;  3NYL A;  1VMA A;  2VH3 A;  4YT5 A;  3DPT A;  4PUS A;  2ZXP A;  3E9V A;  2UWM A;  4PJL A;  4N06 A;  1NG6 A;  5KYY B;  4HSR A;  1ZYR F;  4FET A;  4ZYA A;  2W7N A;  1LS1 A;  2XSJ C;  3D5R C;  4RBN A;  2XF7 A;  3I9V 2;  3JYH A;  3OYJ A;  5LFA A;  3EGX B;  3N24 A;  2JA2 A;  2VQC A;  3QYE A;  1ZHZ A;  3ZSU A;  2CGE A;  4ZTF A;  3DTK A;  2MC4 A;  3OYA A;  3AFH A;  1NZE A;  4RM2 A;  1NG7 A;  1EA3 A;  2C04 A;  4U5D E;  1SFK A;  1X4P A;  2AQE A;  4AYB A;  3QYB A;  2DT7 B;  4BUP A;  2IS4 A;  5KYX B;  1Z3X A;  3EG9 B;  3X1O A;  4KBL A;  2VJJ A;  4BAC A;  3TL4 X;  4CS7 A;  4HE8 D;  1DGR M;  4W8K A;  3UMH A;  4JZA A;  2IXS A;  4BE1 A;  3S28 A;  3VDX A;  4XKV A;  4CS9 A;  3SZG A;  3VWB A;  3H65 A;  5JHF A;  5B1A C;  3S3N A;  4CH7 A;  4JQF A;  4ZDO A;  4LAC B;  2ZXI A;  2ZXO A;  4II2 A;  2YZS A;  2RQQ A;  3NRH A;  2KZV A;  4C7O B;  5DLJ A;  2LBF B;  5E33 A;  4AE4 B;  4BG0 A;  1OLT A;  1G59 A;  4ANJ A;  4CCK A;  2A5W A;  4BU2 A;  2DGJ A;  1DGW Y;  3DJU B;  1K6Y A;  4E7L A;  2V6E A;  3DKX A;  4Y3O A;  4LG3 A;  4BE2 A;  5CQE A;  2BE5 F;  4AU7 A;  2X1D A;  3S8P A;  1N78 A;  3LAY A;  3RCO A;  2WAQ A;  3L2W A;  1QHG A;  3K70 C;  1QU3 A;  5LD2 C;  4CCO A;  2KQ9 A;  2IGK A;  2KQR A;  3K4C A;  3OL3 A;  3AG2 C;  2IS1 A;  3EZH A;  3T6B A;  3ZIB A;  2E1M B;  3PNV A;  3W3C A;  4CCN A;  4KIT B;  1QLE C;  4PJM A;  2DXI A;  5CI8 A;  2CS3 A;  4F91 B;  3QMK A;  3RTR A;  1SAU A;  1W36 D;  4XM3 A;  4LIT A;  2LH9 A;  5HNF A;  2EIK C;  3EPV A;  3OY9 A;  4CS9 C;  3POV A;  2Y3B A;  4OD5 A;  1TWC A;  2WAD A;  4C3B A;  3MKW B;  5L3V A;  3OYI A;  3W2V A;  2XXA B;  2K3P A;  1P9Q C;  1M57 C;  2W00 A;  3HOS A;  2KP6 A;  5B3S C;  1ZHX A;  2IXM A;  1ZHY A;  2XL4 A;  5KYW B;  3W8H A;  4GRI A;  2XF6 A;  4C2T A;  1X19 A;  1J8M F;  4CBE A;  2KMU A;  3V42 A;  1FTS A;  4FES A;  2LRD A;  3FBN B;  2R7X A;  2W4S A;  4HG2 A;  2E5N A;  4MND A;  4BEJ A;  2A6T A;  2BW3 A;  3OOU A;  4P1W A;  2X51 A;  2H7V C;  3KX2 A;  4O6Y A;  4XTK A;  3VSK A;  1TT0 A;  3OS1 A;  4O6N A;  3H5A A;  3VAY A;  3SEQ A;  2Y69 C;  2GOX B;  3JT1 A;  4NY3 A;  3ITF A;  4YWQ A;  1YE9 A;  2CW8 A;  2IGM A;  3ASO C;  3K66 A;  4ZJZ A;  3UMK A;  1LVK A;  4YT8 A;  2VKH A;  2X6W A;  3K4L A;  3AG3 C;  2Y3D A;  3DXJ F;  2LSE A;  5CI9 A;  4FAS D;  3L2V A;  3LES A;  4KI2 A;  4BGD A;  4OIP F;  3OMY A;  4RLF A;  3FVY A;  3EGD A;  2PFD A;  1RJ9 B;  2R4G A;  4R79 A;  2CH0 A;  3DPU A;  4XKB A;  4F93 B;  3HKZ A;  1SF8 A;  4PSW A;  3ABM C;  3CMM A;  3RQ4 A;  3K1H A;  2KRH A;  5FCL A;  4XLH A;  1PD1 A;  5KNL A;  3EJN A;  3M1C A;  4YT4 A;  3MKY B;  4LIU A;  4D9J A;  3HUG B;  2DJI A;  4Y4R A;  1O5H A;  3CZ6 A;  4N4O B;  1PD0 A;  4AX2 A;  1SMY F;  4ZTJ A;  1S7Z A;  2OUM A;  2LYC A;  3H9J A;  4DIQ A;  1IW7 F;  1VK5 A;  3EQL F;  4BS9 A;  1Z23 A;  3I5Q A;  4NQW B;  4HFF B;  3S3O A;  2KLO A;  4BDY A;  3CES A;  1WFX A;  2WAF A;  4E7H A;  2EIJ C;  3EHM A;  3KH2 A;  2HDW A;  4YRV A;  3WG7 C;  2ELJ A;  4XR6 A;  4YJW A;  2RNG A;  3LSH A;  1YX3 A;  4YEL A;  2PX3 A;  2IXN A;  4E4H A;  1OCZ C;  4JW1 A;  3TMO A;  2M4E A;  4U7B A;  4ITV A;  1R6R A;  3LJB A;  3NG1 A;  3HC7 A;  3ZQQ A;  2PJR A;  2IS2 A;  2HV6 A;  1SZI A;  3KL4 A;  4HST A;  4U5F E;  3PSF A;  2R7W A;  4XQF A;  4BQN A;  2YEV A;  3RFY A;  2J7P D;  3ZVR A;  4BJ5 A;  4ZLC A;  3N05 A;  5BUO A;  2HQA A;  4O6M A;  2XC7 A;  1M2V A;  3RSN A;  3L0I A;  1BR4 A;  4HFK B;  3QOD A;  4OWR B;  4J00 A;  3UGP A;  3TD7 A;  1FFT C;  1N75 A;  3OIQ A;  4RMN A;  3DAF A;  1TWG A;  4B48 A;  2VQL A;  4B43 A;  3FKJ A;  5CPR B;  1Z3I X;  2NUT A;  4G7O F;  4XKW A;  2ZXR A;  4DVY P;  3B0U X;  4KC9 A;  2QKL B;  3N0T A;  2HPM A;  3WOD F;  1PJR A;  2J0X A;  4IRU A;  3OWT A;  2D5R B;  3AL0 B;  2V1N A;  1W2W A;  3J7A Y;  2MYS A;  4XOP A;  3HJC A;  2QKM B;  2FGY A;  1LKX A;  4FWV A;  1MW7 A;  3EH1 A;  1YX5 A;  2V9K A;  3MD2 A;  4B44 A;  1JPN A;  3HLZ A;  4M63 A;  4RLQ A;  3AKZ A;  4DVZ A;  4BXF A;  3E70 C;  4ZLD A;  1T95 A;  1NG1 A;  3N2Z B;  4XWJ A;  2X1E A;  4QPQ A;  2F6C A;  2HNH A;  4PK4 A;  3OYG A;  3VYW A;  1V5F A;  2BOL A;  4BJ5 C;  4U5B E;  4HRI A;  3HG9 A;  3E1S A;  5KYN A;  4XLA A;  4BJT A;  2HVQ A;  2Q9A A;  3K6G A;  3CQZ A;  3OA1 A;  4C2U A;  2HV7 A;  2LY1 A;  4XMY A;  2JSP A;  2BVL A;  2IXP A;  5IY5 C;  4XOT A;  4BJ6 A;  3AQC A;  3DEE A;  4DBQ A;  1G8X A;  2R7O A;  4BQO A;  2W4M A;  2KGO A;  2JVG A;  3CP2 A;  5HVQ C;  2R7S A;  2H7O A;  4BEH B;  3OS2 A;  4E7I A;  4JVS A;  2Y3G A;  1Z3Y A;  2P6V A;  3PFY A;  3JRT A;  4F55 A;  1WJD A;  4P6I C;  3LS0 A;  3Q6N A;  2J7P A;  4XN3 A;  4HPQ A;  3UR3 C;  2CW7 A;  3MKZ A;  2VJ5 A;  1UAA A;  2NUP A;  3ECS A;  3K33 A;  4IKF A;  2A6E F;  2EIM C;  3A2K A;  3AG4 C;  3OR1 C;  1N1C A;  2K9M A;  5TGT A;  4JOM A;  5E3C A;  3K10 A;  3BLY A;  1ZU5 A;  4BL0 B;  2M7A A;  1V5E A;  3LFU A;  3OYB A;  1KU2 A;  3GAN A;  4DBR A;  2VQH A;  4LIV A;  5KCM A;  5DQZ A;  3ZXS A;  2VXD A;  3H0D A;  3K1I C;  4RM3 A;  3FBI B;  3VYU B;  2V4J C;  3HPG A;  3PL8 A;  3OYF A;  5DVW A;  2CV0 A;  2V3C C;  3L34 A;  4IWB A;  4F3Q A;  1BOB A;  3DJN B;  3F9K A;  5HNH A;  5HSW A;  2FFH A;  3HTK C;  4AK9 A;  2HZD A;  2EIN C;  3I4U A;  3A1Y A;  3OIP A;  4CSW A;  2XSE A;  2VXZ A;  3T6J A;  3FAJ A;  4NNJ A;  3OYC A;  4J30 B;  1QHH D;  4J01 A;  2J9W A;  2NOJ B;  2XF5 A;  2WA0 A;  2DYR C;  4ZDP A;  4LLC A;  5D91 A;  3V7O A;  1KON A;  3X2Q C;  3EPZ A;  3OR2 C;  3BCA A;  2QY9 A;  3F46 A;  4KNW A;  3K4N A;  2CFO A;  3LS1 A;  2CW0 F;  2E5Z A;  1X1C A;  4QDL A;  5FRO A;  2LRE A;  3L2U A;  3LSK A;  3EFO A;  1D0Y A;  2VPL A;  4XON A;  3FHN A;  2KHM A;  3K4M A;  3LSI A;  2VAS A;  2XDV A;  4XL9 A;  3DWL E;  2Z2S B;  2OC6 A;  4CA0 A;  3DU5 A;  3CJR B;  4DOZ A;  1N77 A;  1ZEL A;  1MND A;  1MNE A;  4AVZ A;  2ZXW C;  3SP1 A;  2KJG A;  4XLF A;  2E60 A;  1D1B A;  1MMG A;  2LC2 A;  3DU6 A;  4XLE A;  2L7K A;  2PP4 A;  2WL8 A;  4HNT A;  3AQB A;  4CUG A;  3U21 A;  2R7Q A;  4P5O A;  5HLT A;  3DD7 A;  3D5S C;  3ABK C;  2O5R A;  1WJ5 A;  3K7D A;  3NYJ A;  3NDB B;  5F5F A;  2Y39 A;  4RDA A;  3ZRG A;  2AQF A;  4Q5S F;  3W2W A;  4XLN F;  1V54 C;  3SYN A;  5CKT A;  1J8Y F;  4F92 B;  3OYN A;  3PJR A;  2Y3H A;  3DM5 A;  3BCB A;  3LL7 A;  4CCM A;  2CV2 A;  3FHD A;  2X85 A;  4XNF A;  3ZR8 X;  1V5G A;  1TZL A;  3DTE A;  3G2B A;  3HXL A;  4DGW B;  4QI2 A;  2CNW D;  4C9Y A;  4YN0 B;  4XKC A;  1ERD A;  3PUB A;  5CQG A;  2WZG A;  4WJ0 A;  4KT6 A;  4OIR F;  2MFZ A;  3Q7G A;  1Y56 A;  2BW3 B;  3H35 A;  5FRM A;  2H7B A;  5DS5 A;  2B0J A;  2WY8 Q;  2VQG A;  4D1Q A;  3K4J A;  1UEL B;  3KEY A;  2L9S A;  3S32 A;  5KYU A;  2VJ4 A;  2EIL C;  1VZ0 A;  2K9L A;  3A4C A;  1X4O A;  3DKY A;  5KYY A;  3PMR A;  1BR2 A;  2MAB A;  1W36 C;  2VB6 A;  4NC7 A;  2L9J A;  3O6X A;  2CUZ A;  3SDB A;  3LLK A;  3LNR A;  3O39 A;  3PNY A;  2ZSI B;  3AG1 C;  2HVS A;  3HL2 A;  3EGX A;  4CS8 A;  3ZC4 A;  5DQT A;  4QI0 A;  2R7V A;  3I3L A;  2GOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...