4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
4BJ6C 4BJ5C 4BJTA 3K6GA 3OWTA 3CZ6A
chains in the Genus database with same CATH superfamily
2M7BA 1VQMI 1Y4CA 2KDZA 5LHIA 1QKRA 4Z9JA 3PSFA 2KIQA 3RPUA 1RI7A 3OYAA 2QCOA 4ZZDA 4UDVA 4IKFA 2OJQA 1FJLA 3GTGJ 3BPXA 5EEGA 2FRHA 4HNTA 1XD7A 2K85A 3JRGA 4R8HA 3EPZA 1QO0D 3SQNA 2GZWA 4YL3A 4CHUA 1ZARA 1YW9A 3LEOA 2M87A 1YZCA 3TO7A 2Y39A 2XKPA 3FDYA 3PCVA 4F7ZA 4NUBA 1HQCA 3C2GA 2E34A 3OL3A 1MMSA 2IS1A 2VCAA 2XM0A 3CEXA 3HBLA 1LI7A 3A03A 3FK7A 1FOWA 2M64A 4AIJA 1JTYA 2CYYA 1TC3C 2AXLA 2XGXA 2FD5A 2VJ5A 2JA8J 1A7EA 1M2VB 1POGA 3PQJA 2XLEA 3O10A 4WGZA 2LCHA 3WHNA 4A0XA 2DFHA 3OYMA 1WGXA 4BDZA 3BQZA 1LDDA 3SDGA 3U9GA 1IN8A 1TW3A 2MABA 3E9VA 1Q0KA 2IBDA 3CQZA 1TWGJ 4BDYA 5GTHC 3DE8A 2W25A 3FXMA 3V4GA 2EPNA 2XRHA 1WJFA 3MKWB 2ZFWA 5E8IA 2LY2A 5DCFA 2EZIA 2UV1A 3BG6A 2IS4A 3ERMA 4XLEA 1VYIA 1Y39A 1BI1A 1RKTA 2B7EA 3WU0A 2O5RA 2H8RA 2CMPA 3EJNA 5L3QA 1MIJA 2FUG2 3CJNA 4I0AA 3KLOA 4YN0B 3JSOA 3M4OJ 5DDGA 1PD0A 1R23A 1FSHA 5E3CA 2ZMEA 4CJGA 2OCCH 5CI8A 1P4WA 1M2VA 3KL4A 3RVYA 1G3WA 4ENJA 4KFCA 5CVRA 3QW1A 1N78A 4EBBA 1MGTA 4KDPA 4DQ2A 4IL6C 1IXRC 1HSJA 5T3WA 1DUXC 2RREA 3AG4C 4KUMA 2H8WA 4ANJA 4RB0A 2HSBA 3QPHA 3K69A 4XLFA 3V7CA 3VYRB 1P4AA 2ESNA 3LOCA 3HGGA 4XONA 4EV0A 2CYDA 2D5RB 3TQNA 3IRQA 1S5LC 4MQ9F 3COAC 2XLVA 4FWVA 4XPYA 1ZG3A 2M34A 2WC2A 2XPVA 3W6VA 4IJJA 3KP2A 2HV6A 4RBNA 2MH2A 3BTCA 4JBAA 4L9VA 2W9YA 4BHBA 2DCEA 3BDDA 1F5TA 2Z16A 4JJGA 1PYVA 3WG7H 3EYIA 2PJRB 4OAYA 2M4KA 4F55A 5JT4A 5IY5H 2VXZA 4KNWA 2HR3A 3G6EI 3A2KA 1P9QC 4BUPA 3TBIA 5JRAA 1F1ZA 1KQ9A 3H5AA 3G4ZA 2ISZA 1B6AA 3ZMVA 2GIZA 2RKHA 3CJTB 2DTZA 3QOEA 4C3HJ 5K7FA 3PNYA 3QW0A 2JJ7A 3TOMA 5L3VA 4ZLDA 1OISA 3CCLI 2G3VA 5L0JA 3UKGA 1BOBA 3MX3A 2HVSA 4BL0B 4UVBA 3ZMSA 3BR1A 3LUTB 2RD9A 3FOPA 3T5XA 4PFOA 1RPWA 2I5UA 3MEXA 2XLMA 3GM2A 4C3BA 4MVSA 1HKSA 3OV8A 1WJCA 1VTMP 3WAQA 4TV7A 1IZMA 1HF0A 2WVNA 2YRFA 3HTKC 4ER9A 3UGOA 3WGHA 1PJRA 4E7IA 4YIFA 2V79A 1KU2A 3PHF2 3BOQA 4BJ6C 2PEXA 2EV6A 3L7WA 2CQXA 2EINC 1SVOA 2PJRA 2BV6A 2QSFX 4UV9A 3HUGB 1YAUO 3JRIA 3BTIA 1YJ9I 3RKQA 4D7MA 2JTVA 5ILSA 3NMIA 3AAFA 3FAPB 3L8IA 3I53A 2DA6A 4YT5A 2BGCA 1U89A 4BQNA 2KC3A 5KYWB 4NC8A 3GYHX 2W85A 3L2WA 4G7ZF 2HNHA 3CMMA 1I4ZA 4XWJA 2OOCA 3G2BA 4M6XA 2BZTA 2YL7A 3DM5A 3HIFA 3TW7A 2ZKZA 1W0TA 2R7UA 3HKKA 2GAQA 5E1WA 4XLNF 1JUPA 2DA3A 5CVJA 3ABUA 3NWTA 5ILVA 2L6HA 1R1TA 2AQFA 2R7ZJ 2NNYA 2P6SA 3NDBB 1NG6A 1VYKA 4CS8C 1YX5A 2KGOA 1XB4A 3IKTA 4KYWA 2DLLA 4Q48A 5KYUB 2LKPA 3SFIA 5TGTA 2GWRA 5EEAA 2IS2A 2P5LC 4N4OB 3HNIA 1MMNA 2MD5A 4XEKA 5E17F 2EWNA 2W24A 1Q0DA 1T8IA 2PX0A 2QE9A 2RAEA 5E3MA 2E87A 2H7OA 4HNVA 1TWAA 2YWAA 2EV5A 2OF7A 3Q0VA 5J47A 2W4BA 5COMA 1SAUA 3GTJJ 1VQ9I 4I2OA 1R36A 2FFHA 4Y52J 3I3LA 5EEHA 5F64A 3WTXC 3CUOA 4Y13A 5KYWA 5EJCA 3W8HA 3I59B 3FMRA 4DVYP 2QLZA 2ACJA 3OEOA 1SD5A 4HQMA 2A6HF 2HVQA 1ONVA 1NZEA 3GBGA 2NS8A 3ESWB 4D0PA 2LG4A 4BHPA 3C18A 4Y15A 2L9SA 3I4UA 3VM6A 3PFIA 2EIMH 3QRFF 2OTLI 2ZJQF 5EYRA 5KYUA 1KQ0A 3BCAA 3K4NA 2YKZA 2FBKA 4UUVA 5H6QA 1SMTA 3D5SC 5D5WB 2XLWA 1NBBA 2VBWA 3GZ5A 2LLKA 3BT9A 2DOFA 5A6BD 1WSUA 1LUJB 1OFCX 2JUCA 4EM2A 1TNSA 3IAS2 1USTA 1EV7A 2PJPA 2KDOA 1VLSA 3TOBA 2B63J 1G4US 4I7HA 3UMHA 3QTHA 4B1RA 3LNRA 5GAEJ 2PN6A 5HLIA 1Z6RA 4NC6A 5JVTA 4WF2A 4ZTJA 2J9WA 2LQGA 5A6JA 3POVA 2WVOA 2F5VA 2UXXA 5F6FA 1OR7C 1JUMA 1MJAA 2VUMJ 1MNDA 3M3YJ 1RUOA 1LNWA 1TR2A 3ZDLA 3C7JA 2OQGA 4I98B 4E7KA 4BJ6A 3K33A 4J19A 2R7VA 3B73A 4ZJZA 1YA7O 1FMWA 4XRMA 2DA1A 2RVCA 1R00A 1BZ4A 3ZQ7A 1P7IA 2ETHA 3W2VA 2WV0A 4F92B 1JKQC 2PNOA 4B09A 2ELKA 2B0JA 2J9UA 1YYVA 4IHSA 1AUEA 2QGUA 1R6RA 2VPLA 1HW5A 4BBRJ 2FNAA 3QODA 2J8WA 1FBSA 3CUQB 4OIRF 1H9GA 3JRHA 4XPWA 1WH5A 3LFUA 3GZNB 2K7LA 2DMPA 2KFDA 2RNJA 5KNLA 2Q9BA 1R1VA 3EQLF 2BW3B 2W1OA 3DAFA 1T95A 3HOZJ 3HOXJ 4J32B 2OZUA 3HB9A 3BG5A 2IRFG 4EJVA 4I76A 2F2EA 2Z9OA 5E18F 4A3EJ 4HLYA 3V7OA 3S17J 3G1OA 1VLTA 3ZCOA 2R05A 1WJEA 3QPTA 4PZJA 2MLKA 2LR8A 2CSOA 2VPRA 1FR0A 4BKXA 2PLYA 1IF1A 3CCRI 2LP4A 3ZMUA 2Z15A 2COBA 3ISPA 2ZSIB 3H36A 1X4PA 4EJOA 3S28A 4ZH4F 4IJAA 1FNTc 2WB1A 3S1MJ 1SMYF 1FEXA 1MW7A 2K40A 4LB5A 3RYRA 3F3XA 3JSEO 4XK4A 4DNCA 1B68A 3T0YA 2F5EA 2Y3GA 3TQOA 4AM3A 1RKWA 3KZYA 4XRFA 3A9CA 2ZPAA 3G1LA 2R93J 4D4NA 3K1MA 3PMRA 4E7SA 3ABKC 1XGNA 1GVJA 2JPUA 3B29A 4L5JA 1LVKA 1YOVB 3JRAA 4O5VA 4MVZA 1F4KA 2KISA 1T6UA 5DEQA 2KJCA 1X19A 3QWLA 3Q0WA 5JLXA 4IRGA 1CGNA 1ZR4A 4U5BE 2X1DA 4YFXF 3BTLA 4U9DA 1FOKA 1BI0A 5HDNA 3ZP5A 1QZEA 1R4MB 2DFEA 3DXJF 3F9KA 2VONA 1FZPB 3TDZC 1ZHTA 3MCZA 1V5GA 2Z5UA 2VT2A 2IYLD 4MS2A 1SFXA 2QNLA 3G4XA 3QQAA 1YW7A 2HOEA 2XPUA 2FEZA 3NWSA 2KIUA 2QA4I 3IUOA 2MD0A 2QUFA 3EUKL 4FE7A 1OR3A 3K1IA 2DI3A 1MQVA 2P6VA 3JTLO 2HWVA 2ESHA 4IAQA 1V74B 4KIGA 4IOAF 2OD5A 1ZU4A 5L0IA 4AWXB 2E5NA 3LL7A 3DAGA 5J4VA 5KYYB 1ZGJA 4ENNA 1JPNA 2XRNA 1VQNI 3GWNA 5J3LA 3IQ6A 4E7LA 3MKLA 3I5UA 1LFPA 2XASA 1BC7C 2YU9J 1RR7A 3TULA 2HXOA 1AHDP 4JEBA 4OWRB 4ZTFA 1U8RA 5ICGA 1MSEC 3HOUJ 5IOZA 4MVRA 2IGMA 3T1BA 2MH9A 3VDXA 2R5ZB 4MIMA 1K83J 2ZJ2A 5HSWA 1Q1VA 3BJAA 1N75A 1WOLA 3MD2A 3DLLF 2CO5A 2W82A 2LKXA 2B9SA 1MBKA 5BPIA 3PIPF 2JZYA 1Z3YA 3FAJA 2QWWA 1IRXA 1BI3A 2KRCA 2R7QA 3SXKA 1I6HJ 1FY7A 2XGCA 5IP6A 5DM7F 4M9SA 3C2HA 1VQ5I 1R5ID 1TTYA 2CRGA 2EPMX 3EH2A 2FMYA 2L5QA 4GFBA 1K04A 2Q9CA 2VL8A 4RM3A 2J7PA 4G7HF 3ZMZA 2M2EA 4N9HA 1K4TA 1TWCJ 1ZZPA 4AUXA 4ETSA 1GHCA 3CDHA 1LIHA 2L01A 4ESFA 2DPUA 4P9TA 1K6YA 4BAYA 3HHGA 5KYNA 5JHUA 3BPVA 3SNHA 1HMOA 2AQEA 5IP9J 3HOWJ 2H94A 4EMSA 3EGDB 2OZ6A 4HV6A 4X1EA 1JI8A 2VKEA 2R3SA 2L4MA 2FU4A 3BR5A 3FXKA 3GTPJ 2VE9A 1Q0FA 1YZAA 2IP2A 5EF6A 2HXIA 2ICWG 3SYNA 2L9VA 4JIOA 3RW0A 1XZPA 5LGUA 4HSTA 1VQ7I 3ZQFA 2UZKA 1JJ8C 3I5PA 4U5DE 1RR8C 1AOYA 4BYYA 4I1OB 3CJRB 4C2UA 1BM9A 3SEOA 3K6BA 3IC7A 2MFZA 2TDXA 1MD0A 2XXAA 5CYVA 4H54A 1VI0A 2QQAA 2XIGA 1APLC 4RBOA 3L1PA 2YLIA 5A6AA 3OYGA 4OINF 4MVMA 2Q2EA 2D1HA 3FOOA 1J5YA 3TGNA 3OY9A 2DXIA 2X85A 2GA2A 5D6EA 3CLOA 2RGVA 1Y8RB 5L3CA 1XPXA 3Q6MA 5F28E 4Z2YA 2QVOA 3G50A 3F46A 3AG3H 1X2MA 1ST6A 2QBYB 4HDVA 1BDJB 4JTDB 3IWZA 4IHXA 2HU9A 3HNJA 1R5GA 3SJMA 1APCA 1KZHA 3L00A 4XMYA 1K79A 1DU6A 2QKLB 3H65A 2OBPA 3JRMO 1RRJA 3P9KA 3CCVI 2OA4A 2RN7A 2EA2A 2WV1A 4ENMA 1X1CA 1V55H 4BEJA 4EUKB 1SD4A 2MSYA 3RDIA 2DJIA 4L18B 1W2WA 4HOBA 2BBYA 4YEJA 2R02A 3S1QJ 4EKWA 3KCCA 1WI3A 5HS8A 2WWYA 3IV5A 1FOXA 1OW6A 1HSTA 4V19K 2HDDA 3F8FA 3Q9SA 2DDBA 1BBYA 4J30B 3EHNA 3EFOB 1G3YA 5CLSA 1FC3A 3K0LA 1UFMA 4U0VA 1KU7A 1IRZA 2HZTA 3FIWA 5M5YJ 1W7PD 3RZDJ 3KEQA 4A5MA 2GIVA 3I55I 2CGPA 5KAFC 2HYFA 1CPRA 3ZQYA 1MMGA 5FCLA 2BXYA 1OKKD 1ZGAA 1YDIA 1HKTA 3RKOF 5FZTA 3DU5A 1ZHFA 3A01B 5FLMJ 3S15J 3NRVA 2ZXOA 2IA1A 2LYCA 2YUSA 2OEVA 1UG2A 3H35A 3N2ZB 4XEFA 4L0ZB 2DMNA 2W00A 3LA7A 6PAXA 2E7XA 2Y0SN 3SZTA 3B02A 4BXXJ 1OCRH 2R03A 1RKEA 4Z9HA 4LG0B 3R2PA 5BQHA 2BVLA 1UHMA 1WTYA 2V9PA 3CO7C 2DBBA 2HYJA 3JRFA 1SFEA 3HKZA 5D5XB 3U8VA 3CZ6A 1XSDA 2R7FA 3RQFA 4BJ1A 2PG4A 2VB6A 4HX8A 4BPMA 4MQVA 1U8BA 3QYEA 4P9FA 4FASD 4ZZLA 2P6TA 3ABLH 4AD9A 2OU6A 1YX3A 5DD8A 2EA4A 2J9BA 1O87A 2KK1A 1SANA 3TKYA 3ZRGA 3CD6I 3DD7A 2AWYA 1G2HA 5AGFA 3BC8A 1XGMA 3N05A 2V3CC 4I09A 4GEHA 2EIKH 1ZHXA 4WXCA 3S1NJ 3U8PA 1UZCA 4D9JA 3HZJA 1AU7A 1ENHA 3J7AO 2XL6A 5L0DA 3E7LA 1S7ZA 3PUBA 4HNUA 2PF4E 4LG0A 4KN7X 2K9QA 3JYHA 5B1BC 3DWLE 1G59A 2VBYA 3KYIA 1GV5A 3IP4B 1Z23A 1XC5A 1L0OC 1Z7UA 5FGMA 1P4XA 1FFHA 2GOXB 3NKEA 3A0BC 3HYIA 5ERIA 1K7AA 4HLXA 3L1MA 4JYKA 4EEFG 5DS9A 4U5HA 3PQKA 5C3EJ 2EILH 2CUJA 5FLXZ 3CO6C 3KZZA 3DM9B 1IN4A 1E83A 1T08B 3TL4X 3MZYA 3J06A 1TWGA 2W48A 1DGRM 4XLHA 1OW7A 4B4CA 1FT9A 1L3PA 2HMQA 3EYYA 2HV7A 4RDAA 2KQ9A 4ESBA 1JHFA 4YG2F 3TW6A 1I50J 3GX4X 5FRNA 3KZIC 1HC8A 4D4XA 3RQ4A 2EB7A 1T56A 4CYCB 5DS6A 4L5EA 1ERDA 2IBFA 5FLXK 2K9NA 2KLOA 1XSXA 3FBNB 3H92A 4EQQA 4AU7A 1LDKB 4WWCA 1HDDC 3CSKA 2JRTA 3GM1A 4PUSA 1UG0A 2HGCA 1MKMA 2L9JA 2WAQN 3LSMA 5E8GA 2PMZN 1B8IB 2R25A 3ABMC 2M3AA 2F4IA 4FESA 3GEIA 1LJ9A 2A69F 2WB7A 1ZG1A 2WZLA 2LMDA 4I6ZA 3CP8A 2YS9A 3IKVA 1R5HA 4BQQA 2ZNYA 5DLJA 3FBIB 1YE9A 4C3JJ 1LS1A 1UHWA 2AO9A 5COGA 3IHUA 4A3GJ 5B3IA 1LEAA 3C8GB 3GUDA 1Z7LA 3ZN0A 1BJZA 4XM3A 1O4XA 4LG3A 3KEYA 2XM4A 2EK5A 3OOPA 5EG0A 5F0CA 3OIOA 5CQEA 5FFZA 3HM5A 4CYCA 3NYLA 3HG9A 1K61A 3VPRA 1F9NA 5J6XA 1B9NA 4MLOA 4M71A 3S9OA 2PBEA 3M1CB 4NQFA 1AA7A 2LF8A 4YT2A 3E5QA 1Z1DA 1RESA 2LRDA 4P1WA 3RYPA 2M45A 1U9OA 2LK2A 3JZ0A 3EETA 3TO9A 1L3LA 2DN0A 1B8IA 3O6XA 2HTJA 1AKHA 3WE3A 4G9YA 3FHZA 5LGNA 1CF7B 1OCZC 2DK5A 3BR6A 4GGGA 1EH7A 2LVSA 3ECSA 1NHAA 2LH9A 2HVRA 2LIGA 2WTEA 1D1CA 3DTEA 2FGYA 2L3DA 5F0HA 1QVTA 1G5ZA 1S29A 3H3ZA 3GFLA 2C03A 1SFKA 2DMQA 4WGYA 3ZPLA 1YS6A 4AYBA 3LESA 2QYOA 1HOMA 4OIOF 3WODF 3T6GB 4HF0A 1TQGA 2WL8A 2Y0MA 4V2GA 4UNOA 4BU2A 2BY0A 2BHYA 2VN2A 3OR1C 1DQUA 4Y4RA 5AIPA 3S3MA 2IGOA 4P5OA 5ED4A 4A3FJ 4PSXA 3SFZA 5H2FC 1E0EA 5DCMB 2MC4A 5HDGA 4K1OA 2DMUA 3JRBA 3ABTA 1Z67A 1JE8A 2VCCA 3HC7A 2DFFA 3VSKA 1CF7A 1BBHA 3QVYA 4NC3A 4YFNF 3ERED 4O6JA 1BR1A 3FXRA 3K70C 3K4MA 4FETA 3AG4H 4XKCA 3OS2A 1VMAA 5JR3A 1ZHZA 1ETWA 5M5XJ 1VK5A 3MAJA 2EPOA 2G3KA 2LD6A 4JC7A 4XKBA 3EDPA 1I3AA 4FHTA 4Y3OA 4A69C 4RDUA 1Z63A 1XWJA 4A12A 2Z2SB 2GBYA 3H9GA 2EH3A 1VFCA 1U6GA 3EG9B 3S84A 1FYLA 2A07F 3MYIA 3C63A 3OIPA 4L0YB 4YL1A 3US6A 3LQRA 1J7KA 4C9YA 1IV6A 1QNTA 1HXDA 3F21A 1IAWA 4U0WA 3HSRA 4A3LJ 3HEFA 2KRFA 3GMEA 3VAYA 3E6BA 4CGZA 2R0QC 1ETQA 2OC6A 2L81A 1XX5A 5DCMA 4BXFA 3H2VA 1HW2A 1J59A 4K0DA 3LNQA 4BE1A 4FX5A 3K4BA 4IRHA 1TQPA 2LBFB 3DKAA 4NTFA 4RD9A 4XRSG 3EGXB 1V5EA 3KEOA 4HSRA 1H9TA 3RQEA 4M3EA 4BE2A 1Y6DA 2DQLA 2ID3A 1FP1D 4DZPA 3KE2A 2JT1A 1GM5A 5J4YA 4OAZA 5CIVA 4UUSB 3P7NA 1JAFA 2OQMA 3EG9A 5AC4A 2DK8A 1ORJA 2OKUA 1S6LA 2IT0A 1YS7A 5IYDJ 1X3WB 1JJ6C 3H3VK 5ICCA 4XOTA 5DQZA 4IRIA 2Z99A 2W7NA 5F1JA 4DW6A 2P8TA 2YZSA 1QGPA 3DEEA 3WGIA 2P5VA 2DTRA 2EINH 3MQ0A 5B1AC 3A0HC 3ZQVA 4C3DA 5F0FA 2J9VA 3L34A 4I01A 1YLMA 4A6DA 2M0CA 2HKXA 1A0BA 2R4GA 2LKSA 3V8JA 3S2DJ 2ZD9A 5HVQC 1O7LA 3Q7LA 1NG7A 1B59A 3VEPA 3CMAI 2NVXJ 3EGXA 2M8GX 2V9KA 2DYRC 3F8NA 4LD5A 1W1WE 3BR3A 3ZQQA 4K7BA 3QAHA 4YT8A 2J0XA 3T6JA 4M3FA 2P1AA 4P9UA 2GQQA 3RKWA 3HOYJ 3C62A 3U9MA 5L3DA 1PV3A 4GRIA 4L9JA 1FMVA 2A1DD 5J40A 1ZRCA 2JRMA 1B72B 4LLNA 1T6QA 3KPHA 4A93J 1S9HA 1TT0A 4LITA 2L7ZA 2WAFA 4M73A 2E1CA 4DRIB 3DP7A 5FRMA 3MBGA 1RMVA 4V2FA 2XL8A 3RKXA 1EKYA 3QMKA 3F0CA 1UG7A 5CKTA 1BOAA 1YA9A 3QU6A 1TZLA 2VQCA 3H0GJ 3RZOJ 2R7RA 4G78A 1YITI 4E0HA 5CQGA 5HLTA 2P5KA 2P7VB 4NHJA 2CQNA 3O2PE 2UWMA 4N0BA 1OCCC 1WRJA 3DBRB 3B6CA 3E3VA 4R1HA 2BC5A 3AGUA 3N0TA 2G9WA 1O5HA 3BP8A 4Q47A 5JHFA 3ASOH 3LNMB 2ELHA 2IAIA 2R7XA 3OOUA 3DJNB 2H6CA 1IC8A 1U2WA 5D8KB 3DTKA 1IO2A 3KIOA 3NEUA 3QOPA 3Q7GA 2EIJH 2YX7A 2QQ9A 4L9TA 4YK5A 2KIMA 2J5PA 3HRMA 2ECCA 3ECHA 3FHNA 1I39A 3PFYA 2X0CA 5D8LB 3IQCA 2XSJC 1U0BB 1JKPC 4JX5A 4PJNA 3AG1H 2L6FA 4R32A 4NNJA 2HFHA 3RI4A 2L02A 4R79A 1VNDA 4GYIA 2Y30A 2P7VA 3K66A 3L09A 5E79C 1A36A 5DM6F 4JVSA 4JTAB 4KN4X 4FX4A 3DE9A 3R7CA 2O6GE 4JTCB 1JXSA 4JX4A 5D92A 1J09A 1MBHA 1ZH5A 2Q0OA 1J9IA 4LK0F 1QPUA 1X3UA 4MNDA 1A6QA 2NYXA 2OQRA 3HUGA 5BOXA 5TJ5E 2JPBA 1RCPA 4XEVA 3S3NA 1STZA 4P55A 3WG7C 2JVGA 4L6RA 1UELB 3M8EA 5A2QZ 1MBEA 1HBXG 3AFHA 3I9V2 4AC0A 2BL2A 1MBFA 4W1UA 4WABA 3CUQC 2QUPA 2L7FP 4JKVA 4IRUA 3JSPA 4EGYA 2AP3A 2Z1DA 2EZHA 4KA4A 3W4YA 3I5QA 4EJUA 3FHDA 4I3MA 4IZZA 4B3AA 1WZ2A 1OMIA 1ODDA 2XF6A 3E1SA 4M6YA 5A2QK 3S27A 5FKNA 1H88C 2F5FA 3LA3A 1T0FC 2JVHA 2LDUA 3M8JA 2M1BA 3KKBA 1JGSA 4KI2A 3V42A 4QPOA 3N24A 1TP4A 5AIQA 3TP0A 5F08A 3S2HJ 1UJ8A 3BEHA 3WE2A 4AL0A 2DJNA 1YJGA 5K0IA 2A61A 1XGOA 1NFNA 4PCQA 3HKZN 2JUGA 3O8HA 1MH3A 2L9RA 3M4BA 4Z6YA 1OR2A 3K1IC 4YJWA 3GEHA 2JQ7A 4DZJA 3QU3A 3I59A 1YYXA 3LSTA 3WTWC 4IX7A 3ZIBA 1WJBA 5FD6A 2OTJI 1EF4A 4GCVA 2XV4S 1J2XA 3BG3A 2R7SA 2YVKA 4UVAA 1G3TA 3R4KA 4F91B 2EPLX 1RKCA 2DB4A 1CQTA 1FX7A 3HPGA 4NDLA 3RFYA 5HNFA 4U7BA 3ABKH 4CCLA 5C4XJ 4HE8D 4II3A 4QTRA 4AIDA 2L9NA 3ZTZA 1I3QJ 4Y33A 2LY9A 3DPLC 3SP1A 4C7OB 1X1PA 3R0JA 4DBQA 1FYKA 4KICA 1WJDA 2AHQA 1TWCA 1EQ1A 1Z7Qc 2EZKA 4CCJA 1QZXA 2R7TA 1P2FA 2UUZA 1T39A 4G6QA 1FTZA 3J81Z 1N1CA 3SXZA 1TT5B 1EH8A 2ZXRA 2D4UA 1JT6A 5IYBJ 1ZGWA 3ZN1A 1FAPB 3KH2A 4NY3A 4I44A 4A3JJ 2ZC2A 4JW1A 1QPMA 1HDPA 2ADUA 4LDKA 1NK2P 5HV9A 2GA1A 3JAMZ 3J7YJ 3J81K 4XL9A 2JSCA 3GTKJ 5IT9Z 4MVOA 3AG2H 3SXYA 5D5UB 5A6BA 3DFGA 1O3QA 1IRGA 1L7CA 2O7OA 3IH4A 5IOYA 2OEXA 1W5SA 5E1ZB 3G1MA 4PGHA 3RSNA 2M4GA 3WTTC 1R1UA 3CUQA 2WZGA 2OV7A 1ZW2A 3CCEI 4RMNA 256BA 5J8CA 5L0GA 3ZXSA 1IUYA 1BA5A 5HLGA 3JAMK 3FISA 2RNGA 2HS5A 5ICEA 2KNHA 1ON1A 2BW3A 4HX7A 4MEXF 1KGSA 2JA6J 4LLCA 3RH3A 3X2QC 1OXKA 1DOVA 1T0FA 3HDDA 2XAHA 3BQYA 4P6IC 4KMUX 2KHMA 4QI0A 5TISC 2YQYA 1W0UA 1X4OA 1Z6AA 2ZO4A 2KSFA 4IPAA 4O79A 1SD6A 3ONQA 3OYHA 2XC7A 3VYUB 1MNEA 1BI2A 2VOPA 2PP4A 2Y69C 3LSKA 1JHHA 3OWTA 2YX4A 5KK1A 1R49A 4OMYA 1K6OA 4KT5C 2H6BA 4ZC3A 5AONA 1YW8A 3FDQA 5HDKA 4OIQF 1A04A 3VYWA 3VOEA 2JA5J 2P4WA 3EPVA 3U0CA 4HX4A 2X6XA 5CPRB 2KRHA 1LFBA 3BZ6A 1H89C 4ZYGA 3L2VA 3AQCA 1VQPI 2E1OA 1NFOA 3NAUA 1BJAA 2QQ8A 4E0IA 2F4OB 2OPTA 1JT0A 2K3PA 3KYLA 5LBQA 1OCOC 1WFXA 1B1BA 1IN6A 1W36C 5EGYA 5M5WJ 1X1BA 2E1MC 3K4KA 5FFXA 5HOOA 4CIPA 1FP2A 4AIKA 4ON0A 2RDPA 2A6EF 2OU2A 2XAUA 4CYDA 3FK6A 5B5EC 1MDMB 1BL0A 1ZLKA 1Z91A 2CJJA 3J80Z 2M0MA 3B9QA 2GA0A 2ISYA 3MN2A 1ZREA 3MYFA 4G0HA 2H1KA 1EA3A 1YRNB 4DGWB 3S32A 4WXHA 5K5OA 1H8AC 5GTIC 2A0UA 5FJ8J 3U3BA 5COFA 4BY1J 2ME0A 4MW8A 2L7KA 5KYYA 2HKOA 4XSXF 1ZAOA 3DKYA 4AIHA 3BROA 2K3FA 3S2WA 2E1NA 2ZB9A 1UHSA 3OSGA 3JRDA 5EK0A 3B0VC 2K9SA 1I1SA 3DZAA 1GUUA 2ELJA 3DEUA 3L2UA 3WGGA 1MSFC 4LLEA 1F1MA 2FOWA 5DS5A 2NUPB 3GM3A 3GFMA 5LFAA 4MEYF 2HJMA 3QP6A 1D1AA 3I64A 4J7TA 2JK3A 2XSEA 2R5ZA 1TL8A 1ZQ3P 1MDMA 1ETOA 2Y9ZA 1XMAA 3IAM2 3KP7A 1QA6A 2HKVA 4I0BA 2DYSC 1FTSA 4WXDA 2QQBA 5H6RA 3RKYA 1HE1A 2AWCA 2NPUA 2QLAA 4N06A 2R7WA 3I56I 1Z21A 5JP7A 1YRNA 2MBFA 2LY1A 1GDTA 3PL8A 2X1EA 1U5TB 3ROUA 3FM5A 1E86A 3UGPA 3W2AA 1UB9A 1CGPA 3QYFA 5DD4A 4A3DJ 1R22A 2C04A 4S0HB 5DUKA 3VODA 5DVWA 1GLNA 3HRSA 4FX0A 5LEJA 3D5LA 2E1MB 1MBJA 3ML6A 4A4AA 1R7JA 2AS5F 4DRJB 2K9MA 3A1YA 3JCUC 1VTNC 1SR2A 3FXOA 2NG1A 2NUPA 4HZFA 3M07A 4XKVA 1VQ4I 1LE2A 2VBZA 3CLQA 5L3FA 1ZRDA 1E3PA 2O0YA 4LFUA 2P0NA 3OYCA 3JTHA 3PO3J 4FT8A 5K7HA 3K7DA 1DP3A 3TMOA 4G7OF 3EGDA 3T8TA 4FTHA 5B66C 3EUHC 4XRSA 3FMQA 2F5DA 2ZSHB 5LD2C 2K4JA 3BWGA 3DI5A 4LJZF 1FIPA 2VKDA 4MHGA 2KL4A 2G0EA 1T6SA 2HQ5A 5F1RA 1YFHA 3PJRA 1C02A 2Q9AA 4PJMA 1Z6TA 1LKXA 2WVQA 3HNKA 3ULQB 3DBHB 1TWHJ 4U5GA 2A5WA 3WHBA 1P92A 3S8PA 3HOVJ 3OA1A 3OYDA 1HKQA 4DOZA 1OJLA 2KPMA 3ZQGA 2HOAA 1XDSA 2QEXI 3FF5A 1OW8A 1S7OA 4U87A 5D4RA 1QPIA 1IV8A 3K1PA 5L3EA 4XQFA 5DQTA 5BQIA 3M9AA 3CF5F 1K78B 3HSEA 5M3FJ 2P7CB 2P81A 4PK4A 2STWA 1BN5A 3K10A 4HW0A 3W6JB 2CW0F 5LRSA 3ZR8X 3OYLA 3CESA 1T9KA 4EJTA 5T3TA 5FD5A 3SZGA 2NUTB 4N6HA 1S3JA 2QBYA 4PDKA 3H0DA 4XKWA 4O6MA 2YL1A 5CI9A 4FE4A 4G6TB 1ZTRA 3U2LA 4N4WA 1YHQI 3OIQA 1BR4A 2XRLA 1VQKI 2KIFA 2ZXIA 3CDLA 1WJAA 4IHVA 1FYMA 5ILUA 4W8PA 2J46A 5KVRA 3E97A 4CA0A 1TBXA 1U6HA 3TK0A 1RIOH 2XL4A 1K78A 3HJEA 2X51A 2X48A 3P9CA 4PFPA 1O57A 3RCOA 3U9JA 1A7VA 3E5XA 2L7MP 2CQQA 3GW2A 2YU3A 1JTXA 2HTSA 2NUTA 1I1GA 1W7PB 2BY1A 2HI3A 3EFOA 4AX2A 1T38A 2DOAA 3PSIA 3JYYA 4CDYA 5L0FA 2CFOA 4UUTA 2ZNZA 2VI6A 3O3KA 3DCFA 4O7GA 1LB2A 2IOQA 3NMJA 3G73A 2ZJPF 4DYRA 2IXPA 4CH7A 2LTPA 2QENA 1WWXA 3A01A 2QSGX 4AVPA 3E5UA 4EIYA 1FWZA 1IN5A 3F8MA 4B8XA 4KT6A 2NS7A 3QP5A 1W5CC 2XF5A 2XSDC 4C3EA 2ZFUA 3ABMH 4F52A 3EUHA 5A69A 2M8EA 5JVEA 2XPWA 2X1CA 3GWZA 3QPSA 3VSLA 5FLVA 1T5OA 3KMIA 9ANTA 3JR9A 4M3BA 4E6KG 1YARO 2V6CA 3ZWIA 4LIUA 1YTYA 1AVOB 4EHPA 2FJ1A 4BHCA 1T6IA 4MFDA 1NG1A 2RC4A 5IPAA 2KZGA 4CDGA 3SEQA 2F22A 2XVCA 1XSVA 3C2BA 4QDLA 2CGEA 1OKKA 1C0WA 1D5VA 2YLDA 3S1RJ 1Q0MA 3JCUQ 5GAHJ 3S29A 1V4AA 2MLGA 3TP3A 2KP6A 2X6OA 2F6CA 4LLGF 2QM3A 2H1LA 1ZK8A 5K7ZA 1V54C 2V1DA 2XHKA 2VJIA 3AL0B 4HYEA 3CCQI 2YEVA 1J75A 1Z9CA 4RA2A 5GPCA 3KX2A 4A3BJ 1M6TA 2UXNA 3KYDB 4G12A 1CGME 2EBIA 4ULVA 3MKZA 2P61A 3U3FA 1HE9A 5CVIA 1ITYA 5LEKA 1D3YA 1EA8A 4LB6B 3GODA 4LK1F 4RGUA 3M79A 4EM0B 3H9QA 3CTAA 4IVNA 2EPFA 1EKEA 4MGRA 1S7EA 2CW7A 3RQGA 1RNLA 4N4NB 5B3SH 4X6AJ 1R58A 3F22A 5EZGA 2YSRA 2PX9A 1KYZA 1I5ZA 3W3CA 3PDMP 3VB2A 2CCYA 3FKIJ 2VOOA 3LAJA 1E2XA 3LSGA 5A6KA 2JPCA 2WA0A 3DBLB 4E7HA 3ABLC 4HEAJ 4XQ1A 1ETVA 1MJBA 1X3ZB 1OPCA 2ZXWC 3R0AA 2XKOA 4RGXA 3ASNC 2DA4A 2PX3A 3LSIA 1GXPA 3CCMI 2C6YA 2RSEB 4IARA 4LACB 4XBFA 1G3SA 2COMA 1JKOC 1E3OC 1C03A 4IB4A 1VOMA 1TKNA 2EIKC 5GADJ 1HCRA 4LERA 4F4BA 3RPUD 2E71A 2VE8A 1SC7A 3DWWA 2YL0A 5AC5A 1R4TA 3ZSUA 1WJ5A 3LMMA 4L5IA 2F48A 3MZ8A 5TRDA 1E85A 1VQOI 1OCPA 2EZLA 4CUGA 3M8FA 4Q7CA 3LSHA 2W4SA 3KP6A 2ZXJA 4RB2C 4HDUA 1YJWI 4QLCU 1PUEE 5GPAA 2FQ4A 2VC1A 2NOJB 1O3UA 4BEHB 3X1OA 2OAZA 5EDNA 1S72I 1A35A 4IHYA 2EILC 2E2JJ 3ECOA 3LAPA 2FF4A 3GFJA 4JRZA 3C8GA 4O6YA 1QQIA 2IA2A 2VXDA 3N4MA 5K5QA 2EFWA 2DFIA 2FSWA 3PM1A 4S04A 4WX9A 3C8ZA 4IEJA 3L0IA 3SZRA 4CZCA 2WB1N 2NSGA 4NQWB 3LJBA 4CSAC 2M30A 3RJPA 3JTGA 1YO5C 3H1CA 2ECBA 3M1CA 2KJBA 2J45A 3KYCB 3VYSB 1QZYA 2XAGA 5C4JJ 2GM4A 2STTA 2BXZA 5HS7A 5L0HA 1M56C 4XLCA 4KITB 3BG9A 3NG1A 5JS5A 3ZQIA 3DKXA 1QHGA 1S05A 2XAJA 3RVZA 4BEHA 4II2A 3NQOA 1GT0C 1EH6A 1NK3P 1Y56A 4KNVA 3N97A 4DXWA 2QF7A 1ZW3A 4JZAA 2CNWA 4AK9A 3TEDA 4BXUA 2VKHA 4DYQA 3ZQLA 2Y3DA 1O3TA 2LFDA 2M4EA 3MFNA 1EJ9A 4MTEA 2NVYJ 4NQWA 2HUJA 3GTOJ 1D1BA 2V4JC 2DYRH 2IEKA 4IO9F 2I8BA 4LGWA 2FX0A 4IQJA 3NMKA 1VZ0A 1O3RA 1D0ZA 5DYMA 3F47A 3LQQA 2JMWA 1ACIA 1JMWA 5GAGJ 3Q9VA 2MYSA 2DA7A 2GAUA 1ZVZA 5KYXB 3MLGA 5BUOA 2K27A 4CJOA 2BHZA 4FQGA 4EATA 2ZMEB 2IXMA 2VT3A 3VWBA 1Y1WJ 3DV8A 5BPDA 3HLZA 3KP3A 1WWPA 3KFWX 4DJ9A 3K9TA 5IT3A 1HLVA 4NTBA 1IRFA 4BH9A 2X4HA 1XN7A 3S93A 1JKRC 1DP7P 1SAXA 3Q3SA 1I5NA 2FOKA 3IL2A 2CH0A 4M3GA 3H2UA 2IXOA 3L2CA 2XB0X 1YVIA 1OCCH 4OD5A 2WY7Q 1XMXA 1IXSB 2E60A 5FROA 4YFKF 2IW5A 2FA5A 2VQGA 5HODA 4MW3A 4WJ0A 2I15A 3M15A 4PJJA 4CX9A 3K70D 4G6DA 4OOIA 2KT0A 2PMHA 5ICFA 1QZZA 2WBMA 5KYXA 1U0JA 3NKDA 1X58A 2EJRA 3WTUC 3NRHA 4KC9A 2LBFA 1DPUA 2CUZA 4EBKA 2CV1A 3OL4A 2NAZA 1O3SA 2DODA 2DQRA 3GZ6A 4ZDPA 4DBRA 4F93B 1T2KA 3L8JA 4RLFA 3B71A 1ZR2A 3OYBA 3KETA 4PJ0C 1TWFJ 5JFRA 1CGOA 1BW5A 3O55A 4CSAA 3V8LA 2GXAA 3P5JA 3ELKA 4UUSA 1NH3A 4C2TA 4DRHB 4NB5A 1ZU5A 4JCZA 5E33A 1JRAA 3M4CA 4HPQA 2O9XA 4EBJA 3PNVA 2XDVA 4YIIA 1REPC 1R4NB 4LOCA 3JSZA 4YRVA 4XN3A 5F5HA 5JUAA 1WH7A 3W6KB 3MFKA 2YLGA 3G3ZA 2DDAA 5J8FA 1B9MA 1KQ8A 1SYQA 3GEEA 3BCBA 3JRCA 1F43A 4PR9A 5JSLA 3NARA 1IDZA 5BS6A 3HRUA 3A4CA 2V1XA 4U88A 2TMVP 5DS4A 3A11A 4J00A 4UB6C 2Q00A 1YQAA 2KZVA 3HTSB 2DA5A 3DPUA 2VQLA 2JA2A 2EFNA 2QTVA 3FXQA 3FX3A 1T98A 4P96A 4E7JA 3PIOF 2DO7A 5TJJA 3BTJA 3SDBA 2HQNA 2VJJA 4I99C 1USSA 3MZHA 1WGWA 4GO1A 3K2ZA 3R6SA 1QBJA 3GFIA 3L2QA 2FE3A 1M2OA 4J7YA 2CFXA 2CUEA 2OCCC 3KYJA 1B72A 4HFFB 3LEVA 3C1DA 4UY8I 1LFUP 4ITVA 3OYNA 3EH1A 4GXOA 3EZHA 3IQ5A 1DPRA 4IWBA 3OS0A 2ZJRF 4PACA 2CWEA 1D8JA 4YIRX 2D45A 1YJNI 1UMQA 3HPHA 4E70A 1NU9C 1Z3IX 2IGKA 3LS0A 5FKLA 3H9JA 2GXGA 2K86A 2D1VA 2Y0SA 5L3GA 4JOMA 1V5FA 3F8CA 3OMYA 2H8AA 1OKRA 3T6BA 4IXAA 1Z77A 3I54A 4Q4ZF 2EV0A 3Q5FA 2MC3A 4EM1A 2OUMA 4XLPF 4A3KJ 3S3OA 4BG0A 2Z3YA 3BZKA 2XS8A 2TRTA 3F72A 3G71I 4EGZA 4IF4A 2ETSA 4KIFA 1OQCA 3EZIA 1JOGA 1OXBA 4JJFA 1I6XA 4MNUA 4BJ5C 3VRCA 5HS9A 2XB5A 3CC2I 1F36A 2IPQX 3A02A 5IY5C 4A3CJ 1CPQA 2JSPA 3CC4I 2VODA 2Q7RA 1ZKGA 2IS6A 1RC9A 2F5CA 1GV2A 3ZOBA 1A41A 3DQVC 4CCKA 4MVUA 3KLNA 1LPQA 4RS8A 1XDUA 3LSPA 3CQZJ 3AGTA 4MO7A 2DT5A 4M6VA 2A05A 5CVVA 5E3LA 2DMTA 3E70C 2P0WA 2HFIA 5HNHA 5D5VB 4MVQA 2HOTA 1J8YF 2CG4A 5L0CA 1JUSA 1OCTC 3LSRA 3U21A 3V7RA 1IGNA 3T9OA 4E18A 1ZG5A 2HPIA 1DU0A 2OJED 3B6AA 4U0YA 3DJUB 5E3AA 4S05A 2HOSA 4OMZA 2UUHA 3ASOC 1MBGA 3TD7A 1KTMA 5FKMA 3BR2A 2GXBA 1S7AA 2M7AA 2NS0A 1MJ9A 3BG7A 3DF8A 3FXHA 4M74A 1Q0GA 1K4SA 4NBQA 2M9HA 2RQQA 2K4BA 3MVPA 3GF2A 3WU2C 1Y6IA 3QZCA 2EIJC 4Q5SF 2VC9A 2A0BA 4E4HA 4PJLA 1C17M 1WN0A 2HQRA 2ID6A 1BIAA 4RAYA 2HMZA 4HBLA 4MTDA 5DUIA 2L6GA 5FKKA 2KJGA 3TOLA 4B6IA 1QSPA 1A7DA 3AG1C 3IEEA 4JCHA 3OYJA 1ZLJA 1TW2A 3SYTA 2IM8A 3ATPA 4KIBA 4BGDA 3EHMA 1IW7F 3X2QH 4GDFA 2Y9YA 1U78A 4RAZA 1GVDA 1KONA 1ORYA 2B0HA 2FNPA 3J7AY 2CQKA 2WAQA 2Y3HA 1PCXA 3LS1A 2V1NA 2PMZA 2O8XA 3HGYA 1YIOA 4GYGA 1UCRA 4HAMA 3AJMA 2E35A 3IH2A 4UB8C 4ESJA 4E17A 1W4MA 3W2WA 1T01A 2AXTC 3M7GA 1PDNC 5E3NA 2W4MA 4AL1A 2Y69H 2XLOA 4XTKA 1D0YA 4LMYA 2G7UA 1QHHD 2YR2A 5JI6A 2LFFA 3TJ5A 4XSZF 3FZVA 3GANA 3F6VA 3LWFA 3WTZA 3HOTA 3IQTA 1V4RA 1GXQA 3V5ZA 4WK8F 5EGOB 1Z05A 3K1NA 3RPQA 2MA3A 3I4NJ 1WCMJ 4QI2A 2VASA 2AU5A 3DMDA 5F04A 4BJ5A 2Q3TA 3CCSI 1QQ3A 3JREA 3I71A 3AKZA 2E5ZA 1TFOB 4B3XA 2DOEA 2FBIA 3WHCA 4ZYHA 3ZG1A 4ZYDA 1LQ1A 4C2MJ 3IH3A 1YLFA 2NNNA 4C7OA 1SZIA 4ABZA 4L9NA 3DPTA 3I0TA 4DYCA 1XTAA 5LHGA 5M3MJ 1OCOH 3E6MA 4IQ4A 2EIMC 2LK4A 4CZZA 4A0YA 4X0RA 4CDAA 3O6BB 4CS8A 2FBHA 1V3FA 3ZMDA 4N9IA 3IWFA 3OYIA 4LDRA 1IXCA 1D5YA 2A6TA 4BQAA 3E0JB 4W97A 4H4KC 4X0GA 5IT9K 3V5YA 1G8XA 4D1QA 4AE4B 2VBXA 2HPMA 3S90A 3S16J 2EQRA 3WU1B 3SXMA 4IHWA 1XMKA 1ZHWA 3D5RC 1SF8A 1U9NA 2LP0A 1Y8QB 2YHSA 5DV5A 2PI0A 1QRYA 5BQGA 5EGOA 1FNNA 3H3UA 3PNTA 5FB2A 1LE8B 3M1EA 2L0KA 3U1KA 2CV2A 1ETYA 2EPKX 2K9LA 2DT7B 2V9VA 2CQ7A 2IA0A 1TWHA 2DPDA 4XR6A 3LFKA 2GFHA 4QSHA 3MKYB 2YPRA 4ASNA 2M5WA 4MTGA 1VF9A 2XLDA 4U7DA 1HMDA 3RF3A 1SD7A 4OU0A 2XROA 3KP5A 2MW8A 5CJ9A 2KQRA 3U2RA 3ZGKA 1G4DA 1MNMC 4O6NA 4RGRA 1TFKB 5LGTA 3U2MA 2VQHA 3E6CC 4A3IJ 1R71A 1VQ8I 1FLIA 1P6RA 2HJ3A 2VH3A 2DYSH 5J1RA 3Q6NA 4AE4A 2JX0A 1TWAJ 1U5TC 4UHTA 2RV8A 2BVMA 4MFEA 2J7PD 3REOA 2L2OA 2HEOA 2GWWA 1GS9A 3OS1A 1PP7U 1SFOJ 1LE8A 2Y75A 1A6IA 4HEA2 2XS1A 1WASA 3DU6A 2ME6A 1O7FA 3OR2C 2WZFA 1E3HA 3T4RA 1ZYRF 2DA2A 3K4JA 3P9IA 1ORKA 3V7SA 4HF2A 1G4WR 1OR7A 1OQYA 3IPMO 2W57A 1JR8A 2LSEA 3ZVRA 3B0UX 2GDCA 1HW1A 4CICA 4A3MJ 2LF7A 4DVZA 3WTVC 2Q1ZB 1QVUA 1BC8C 3GTQJ 5D91A 4CCMA 2UUIA 3OSFA 4W8KA 4YT4A 3AG2C 4AYBN 4PSWA 4CXFA 2F4MB 3VYTB 1IN7A 3GTLJ 5IYCJ 3NYJA 4ULWA 3FMSA 4CS9C 2BEOA 1N25A 1LEBA 2J0WA 1ON2A 1LI5A 4ZYEA 2GLOA 3J80K 1RZ4A 2ZCWA 3O8GA 4CS7A 1RETA 1ORSC 1XS9A 5J1YA 1FIAA 2LC2A 4MTOA 2VC0A 2JA7J 3BRJA 4JK1X 1D8KA 1TLHB 1WHUA 2XGEA 1TNTA 2WY8Q 4XICA 4G94A 4CDVA 2RQPA 4HG2A 3K6GA 1WPKA 3LA2A 1P7JA 3GXOA 4B48A 4D5CA 2R92J 5D4SA 4CCOA 2B0LA 1WKMA 5C44J 3I4PA 4M9XA 2CDQA 2Q8KA 2PFDA 2PBIA 1FOYA 2A5YB 5GP9A 3CCJI 4HRIA 3CF2A 2VCBA 3QPLA 3K4LA 1EI7A 5BNGA 4JP0A 3L2RA 4NC7A 1W36D 4BNCA 3V5XA 4HA8A 1X1DA 3DTIA 1LE4A 4YELA 2XLHA 2XXAB 3ZQCA 4KISA 1OLTA 4B44A 1Y1VJ 2BYVE 1KYWA 3HOSA 4FCYA 1WI9A 3H5RA 2Q2EB 2E2HJ 1ZELA 3RIPA 4GQHA 1KU9A 2VIXA 2K5CA 2CUFA 5FKOA 5BQTA 3FWEA 2I8DA 2NRAC 4D5FA 3K7AJ 4E7ZA 2JD3A 5JLIA 3Q0UA 1I4YA 1M57C 3EUAA 2OCEA 1OYIA 1SEUA 4NTAA 1XCVA 4XIDA 2KKOA 2PMUA 3CMEI 4CBEA 2XAQA 1UFBA 4U5EE 2DAOA 1XG1A 2D2WA 3S0XA 1WVRA 4LIVA 1N77A 3GEZA 2V26A 3K2AA 4KMFA 1SVLA 4EVIA 2E2IJ 1T33A 1U5TA 1X1AA 4XN0A 2NVQJ 3NYMA 4U5CE 4HFKB 1HY5A 4XORA 1TQIA 5LRRA 3PO2J 3RTRA 2HZDA 4XPXA 3R60A 3RYLA 2EFPA 5T1DB 4JQFA 4RLQA 3TOAA 5E2QA 2HZ8A 3ZMTA 3U1DA 1TQMA 2BY3A 2LNBA 3D1NI 2CV0A 4B47A 4FISA 3CAXA 2IGNA 2XUBA 3MMYB 1E84A 3CCYA 3VF0A 3F8BA 3C3WA 5KCMA 4JEAA 1K40A 1ZN2A 1KNYA 2R7OA 3HSFA 2X6WA 1FFTC 1H6GA 2ZXPA 1WATA 4BQOA 5DTDA 2X0LA 3FXUA 3F23A 2NXNB 3V8KA 1B4AA 4CS9A 2G7HA 2CU7A 1Y0NA 2Y2ZA 3BJ6A 4JX6A 4YWQA 1A5JA 2EFQA 1BR2A 2K02A 4CIHA 4UV8A 4HQEA 4U9EA 4A0ZA 3BLYA 2O03A 4C30A 2MGQA 2FAPB 4M3DA 3BY6A 4HV5A 5J1UA 2Y48A 5E3OA 1H7IA 4M63A 5LHHA 3ZTMA 3HXLA 4J01A 1PUFB 4C3IJ 4QIWN 1QVXA 5GPGB 1OYWA 2MWQA 2O3FA 4UVCA 3JRTA 5B1BH 4RB3C 2O8KA 2FQ3A 2E36A 4IHTA 4BBSJ 5L3BA 2HDCA 2ZXHA 3CDIA 5KHDA 4O3MA 5EZHA 3DLAA 4QWQA 3JW4A 1RKEB 3UMIA 4RAFA 1Q1HA 1KU3A 2NOGA 2YL3A 2BE5F 4LDQA 4QPQA 3HHHA 4A2UA 3GVAA 3AL0C 1BW6A 2MG4A 2X6YA 2QY9A 3CJQB 1V54H 2NSFA 3B0PA 3ITFA 2LOOA 5K1YA 3LLIA 1WQ2A 5D6FA 3I4MJ 4KBLA 1ULYA 3AOUA 2L4AA 1QLEC 3DKWA 2O9LA 3RQIA 1LM3B 3HL2A 2DGJA 3AG3C 3F6OA 1PUFA 2OG2A 2W45A 1IG7A 4JURI 1GGQA 2QKMB 4CSWA 1DDNA 4RB1A 2HQAA 1RJ9B 4I1MA 2N8GA 3QYBA 2J5OA 2IVMA 4D7NA 1LPEA 3H5NA 2WAEA 2VJ4A 1SVMA 3IRRA 3OYFA 1G6NA 2LSOA 4A2NB 4BACA 2QSHX 2H7BA 2HDWA 2QZ8A 3TO6A 3FXLA 3S14J 1V55C 3GCMA 4XNFA 2JN6A 1H0MA 4OD4A 3UMKA 3ZC4A 2L7AA 1IDYA 5LLQA 3DEWA 1SFUA 1W7PA 2XAFA 3UNGC 3GLLA 3HTUA 2KYHA 1Z0XA 3SEZA 2D5VA 2E7WA 2IXSA 1FBUA 2ZXWH 4CCNA 4XLAA 2NVTJ 3MWMA 3ASNH 5H20A 1AWCA 3WTSC 4WCGA 1RXQA 2R5YB 4RM2A 1XGSA 3HJCA 4Z9IA 3PUFA 2MHRA 2PQ8A 2GOMA 2PFBA 1Z3XA 2ZBKA 4B43A 4IAOA 3FXJA 4PGGA 2VLAA 1LS4A 2A3SA 1D0XA 1J8MF 1KA8A 2DW4A 1RJ9A 4I02A 3FVYA 1YI2I 3GORA 5FO5A 4MTFA 4CO8A 4RAGA 1Y0UA 4IGGA 4ENKA 3FKJA 3E6DA 1FSEA 2R7DA 3HRTA 2HYGD 4RGSA 4Y17A 1PVEA 1VQLI 5CVUA 1OCZH 4KJZA 1DOWA 1K05A 1ETKA 2Q4FA 1Z5ZA 3L9FA 3TDUC 2A68F 1FBQA 1J0RA 4Y7NJ 1NLXA 1RUNA 3SZPA 2LREA 4G8XA 4M9ZA 3CMYA 1NSGB 3AQBA 3TJ6A 5HLHA 1OCRC 3GLXA 2R5YA 3QVZA 1MH4A 2KW3C 4A6EA 4BY7J 4BEMJ 2DU9A 2H27A 2CW8A 3WG9A 4DIQA 1A31A 1AEPA 4UXNA 3K1HA 5F27A 4BS9A 2LFBA 2Y3BA 3R61A 2H09A 3KP4A 5EG0B 4GYTA 1ETXA 3C8GD 1PP8F 3BR0A 3GO5A 3ZQHA 5K5RA 4M72A 4ONSA 1HA8A 5E1XA 4F3QA 4AVZA 4ZLCA 3D0SA 5IP7J 2V7FA 3LAYA 3BZCA 2AVKA 2WADA 4N6CA 4H0EA 3RIRA 3U5SA 4IOCF 2DT6A 1MMAA 2FXAA 1NTCA 2LD5A 1OYYA 3GWLA 1PD1A 3CCUI 2IJLA 1S8NA 5KAIC 3OYKA 3GTMJ 5BMZA 1I27A 3T8RA 1W5TA 1AKHB 2HSQA 3W8IA 3CC7I 1GQAA 2O61A 3LLKA 1XCBA 2I10A 1NU7D 2E19A 4U5FE 2V1UA 4EJWA 1XZQA 2H7VC 1M1EB 2JWTA 1IUFA 3HNLA 1IZ1A 2L54A 1MZBA 3J7ZI 1IJWC 1YYJA 4ZYAA 5JVGF 3OYEA 3LSJA 2FMLA 4XOPA 1DGWY 5JLWA 1JPJA 4BJTA 2CNWD 2TCTA 3JT1A 5E20A 4FAPB 1VB5A 3UR3C 1FPQA 2W84A 2ZMEC 1QU3A 2BOLA 2ASRA 2X9DA 3SHFA 2R9RB 1YG2A 4OIPF 3G4SI 1UAAA 3CP2A 4NCQA 3I58A 3BJOA 2V6EA 2IXNA 4JE9A 4A5NA 1E17A 4DJAA 1ZHYA 4KNYA 2Y31A 2BY2A 4EWCA 1X2NA 2XGDA 4BE0A 3VFZA 2G62A 3WTYC 1LVAA 1YIJI 2KMUA 2CS3A 4YL0A 2XF7A 1JGGA 1R9TJ 1U3EM 4HF1A 2VKVA 5F5FA 1VQ6I 4ZDOA 1LDJA 1FTTA 5B3SC 1MMDA 5EHHA 4K2EA 5B1AH 1BIBA 1ZRFA 4LLLA 2Z33A 3K4CA 2NVUB 2EFOA 3O39A 3FM3A 4ZDLA
chains in the Genus database with same CATH topology
2M7BA 5IY5C 3PSFA 2JSPA 2K3PA 3KYLA 3OYAA 2IS6A 1OCOC 1WFXA 3EQLF 1W36C 5EGYA 1X1BA 2BVLA 2E1MC 3K4KA 5HOOA 4IKFA 3DQVC 4CCKA 3HKZA 4HNTA 2A6EF 2XAUA 3CZ6A 3EPZA 2M0MA 4BJ1A 3E70C 2VB6A 2P0WA 3B9QA 5HNHA 1J8YF 3QYEA 4FASD 4G0HA 1EA3A 3FDYA 2Y39A 4NUBA 3C2GA 3S32A 4DGWB 3OL3A 2IS1A 1YX3A 3U21A 1O87A 3ZRGA 3DD7A 2HPIA 1M2VB 3DJUB 5E3AA 2VJ5A 3BC8A 2L7KA 5KYYA 3N05A 3DKYA 3ASOC 3TD7A 2V3CC 4GEHA 3OYMA 4BDZA 3B0VC 2M7AA 1ZHXA 3BG7A 3DZAA 2ELJA 2MABA 3L2UA 3E9VA 4D9JA 3CQZA 2RQQA 4LLEA 4BDYA 5DS5A 2NUPB 1Y6IA 2XRHA 1S7ZA 1WJFA 3PUBA 4HNUA 3MKWB 2EIJC 5LFAA 2LY2A 2IS4A 3BG6A 2UV1A 4E4HA 3JYHA 5B1BC 3DWLE 4PJLA 1D1AA 4XLEA 1G59A 1VYIA 3IP4B 1Z23A 2XSEA 3IAM2 2O5RA 2DYSC 2CMPA 1FFHA 2GOXB 1FTSA 2KJGA 3EJNA 3NKEA 4B6IA 5L3QA 2FUG2 3AG1C 3IEEA 4JCHA 4YN0B 3OYJA 4N06A 3SYTA 2R7WA 1Z21A 4U5HA 4BGDA 2LY1A 3EHMA 3PL8A 1IW7F 1PD0A 2CUJA 5E3CA 2X1EA 1KONA 3DM9B 3UGPA 3W2AA 3J7AY 5CI8A 3TL4X 4C7OA 1TWGA 3QYFA 2WAQA 1DGRM 1M2VA 1PCXA 2C04A 4XLHA 2HV7A 2Y3HA 3KL4A 2V1NA 2PMZA 3LS1A 4RDAA 1N78A 2KQ9A 5DVWA 4EBBA 1GLNA 3D5LA 2E1MB 5FRNA 5T3WA 3W2WA 2RREA 3RQ4A 2K9MA 3A1YA 2W4MA 3AG4C 4ANJA 2NG1A 4XTKA 2NUPA 1D0YA 4XLFA 4XKVA 3VYRB 1ERDA 5DS6A 1QHHD 2KLOA 3FBNB 4XONA 3GANA 2D5RB 3HOTA 4MQ9F 4AU7A 1LDKB 4FWVA 3CSKA 3OYCA 4PUSA 1UG0A 3K7DA 1DP3A 4IJJA 2HV6A 3TMOA 2L9JA 4RBNA 2W9YA 4QI2A 2VASA 4G7OF 3LSMA 3DMDA 3EGDA 3ABMC 4BJ5A 2DCEA 3EUHC 2Q3TA 2M3AA 2F4IA 2E5ZA 2Z16A 2ZSHB 4B3XA 1PYVA 3AKZA 5LD2C 4FESA 2A69F 2VKDA 2PJRB 2KL4A 4OAYA 3PJRA 2WB7A 2M4KA 2WZLA 3ZG1A 4F55A 3CP8A 4PJMA 4BQQA 1LKXA 2Q9AA 2VXZA 1SZIA 2WVQA 3DPTA 2EIMC 4KNWA 5DLJA 3FBIB 3A2KA 1P9QC 1YE9A 4IQ4A 2A5WA 3TBIA 4BUPA 1LS1A 4U5GA 4X0RA 3H5AA 3S8PA 4CS8A 3OA1A 1Z7LA 3OYDA 4XM3A 4DOZA 4LG3A 2KPMA 3KEYA 3QOEA 3OYIA 2A6TA 2NUTA 3E0JB 3PNYA 4H4KC 4U87A 4X0GA 5L3VA 5CQEA 4ZLDA 1G8XA 2G3VA 4D1QA 3HG9A 1BOBA 4XQFA 3NYLA 2HPMA 3MX3A 2HVSA 4BL0B 4AE4B 5DQTA 1ZHWA 4MLOA 3D5RC 4PK4A 1SF8A 4PFOA 2YHSA 3M1CB 4C3BA 3K10A 1AA7A 2CW0F 3PNTA 1WJCA 4YT2A 3ZR8X 3OYLA 3CESA 1IZMA 2LRDA 2WVNA 4P1WA 3SZGA 2CV2A 2NUTB 3HTKC 2K9LA 2DT7B 3UGOA 1PJRA 4E7IA 1TWHA 4XR6A 2GFHA 3H0DA 1KU2A 4XKWA 3O6XA 3PHF2 3MKYB 4BJ6C 4O6MA 5CI9A 4G6TB 2PJRA 2EINC 1OCZC 4O79A 3ECSA 3HUGB 3OIQA 1BR4A 2KQRA 3ZGKA 2LH9A 2ZXIA 2HVRA 4O6NA 3DTEA 1D1CA 2FGYA 4YT5A 1WJAA 2C03A 2VQHA 4BQNA 1SFKA 2VH3A 4AE4A 2J46A 3Q6NA 5KYWB 4CA0A 4NC8A 4G7ZF 4AYBA 3L2WA 2HNHA 3CMMA 2XL4A 2X51A 4XWJA 3G2BA 4PFPA 3DM5A 3LESA 2R7UA 4OIOF 3WODF 2BVMA 3RCOA 2J7PD 2L2OA 2WL8A 4XLNF 4BU2A 3OS1A 3NWTA 3OR1C 4HEA2 1DQUA 2AQFA 4Y4RA 3S3MA 2IGOA 3DU6A 4P5OA 1NG6A 4PSXA 1E0EA 3OR2C 1VYKA 2PF4E 1YX5A 2MC4A 2WZFA 2KGOA 3T4RA 3EFOA 4AX2A 1ZYRF 3K4JA 2DOAA 5KYUB 5TGTA 3HC7A 3VSKA 3PSIA 2LSEA 2IS2A 3ZVRA 3B0UX 4DVZA 1BR1A 4N4OB 1MMNA 2CFOA 3K4MA 4FETA 4XKCA 3OS2A 3K70C 2Q1ZB 1VMAA 1ZHZA 3LEVA 1VK5A 2PX0A 2G3KA 4CCMA 2E87A 5D91A 4W8KA 4XKBA 1TWAA 2H7OA 3AG2C 4O7GA 4YT4A 4Y3OA 4PSWA 1Z63A 3VYTB 2IOQA 3NYJA 2W4BA 2Z2SB 4ULWA 1SAUA 3H9GA 2IXPA 4CS9C 4CH7A 2FFHA 3I3LA 3EG9B 5KYWA 2J0WA 3OIPA 3W8HA 4KT6A 2XF5A 4C9YA 4C3EA 4CS7A 4DVYP 2ZFUA 3OEOA 4F52A 2X1CA 4Q5SF 3VSLA 2A6HF 2LC2A 2HVQA 3KMIA 3VAYA 1NZEA 3GBGA 3I4UA 2LG4A 2OC6A 2L9SA 4E6KG 2L81A 2WY8Q 4BXFA 4LIUA 4HG2A 3K6GA 4K0DA 5KYUA 1NG1A 4BE1A 4FX5A 3K4BA 4B48A 2LBFB 3BCAA 3K4NA 3SEQA 4RD9A 4CCOA 3EGXB 1V5EA 4HSRA 4QDLA 3D5SC 4CS8C 2CGEA 1OKKA 2CDQA 4BE2A 3JCUQ 3S29A 2PFDA 3IAS2 2KP6A 4HRIA 3CF2A 2F6CA 2KDOA 4OAZA 3UMHA 1V54C 3K4LA 3LNRA 3AL0B 2J9WA 2VJIA 3L2RA 1W36D 4NC7A 3EG9A 4ZTJA 2YEVA 1X1DA 3DTIA 3POVA 4YELA 2F5VA 2WVOA 2XXAB 3KX2A 4KISA 1OLTA 1OR7C 4B44A 1TR2A 1MNDA 3HOSA 4XOTA 3MKZA 5DQZA 3H5RA 2Q2EB 2W7NA 1ZELA 3RIPA 4E7KA 2YZSA 2VIXA 3K33A 4BJ6A 2R7VA 2K5CA 3DEEA 5B1AC 4ZJZA 4LERA 1FMWA 4C3DA 4JJGA 2I8DA 2J9VA 3GODA 2JD3A 4E7ZA 3L34A 3W2VA 4F92B 2R4GA 1M57C 3EUAA 3H9QA 2B0JA 2J9UA 5HVQC 3Q7LA 4CBEA 1NG7A 3EGXA 4U5EE 2CW7A 1R6RA 2VPLA 4N4NB 4J30B 3S0XA 3QODA 2V9KA 4LIVA 1N77A 2DYRC 2V26A 4YT8A 3ZQQA 4K7BA 4OIRF 2J0XA 3T6JA 3LFUA 1X1AA 4XN0A 3W3CA 3NYMA 4U5CE 4HFKB 5KNLA 4XORA 2Q9BA 3LSGA 2WA0A 4GRIA 3RTRA 2BW3B 2W1OA 2HZDA 4E7HA 3ABLC 1FMVA 1T95A 2A1DD 3DAFA 4HEAJ 4J32B 2ZXWC 3RYLA 5T1DB 4JQFA 4RLQA 3ASNC 5E2QA 3NDBB 2CV0A 2PX3A 3LSIA 1S9HA 1TT0A 4LITA 2WAFA 4B47A 3V7OA 2IGNA 5FRMA 3MMYB 4LACB 5KCMA 3ZCOA 1WJEA 3QMKA 2R7OA 2X6WA 5CKTA 1FFTC 1TKNA 1VOMA 2EIKC 1TZLA 2VQCA 4BQOA 3RPUD 2R7RA 2ZXPA 4F4BA 5CQGA 5HLTA 2Z15A 2ZSIB 3ZSUA 1WJ5A 2UWMA 1X4PA 3LMMA 1OCCC 3N0TA 3S28A 4CS9A 2WB1A 1SMYF 1O5HA 1MW7A 4YWQA 1BR2A 4CIHA 5JHFA 3BLYA 4C30A 4CUGA 4Q7CA 2Y3GA 4M63A 3LSHA 2R7XA 3OOUA 2W4SA 3DJNB 3HXLA 3DTKA 2ZPAA 4J01A 2NOJB 4BEHB 3PMRA 4E7SA 2MWQA 3ABKC 3Q7GA 2EILC 3JRTA 1LVKA 4O6YA 2VXDA 3FHNA 3PFYA 2ZXHA 4U5BE 1X19A 2XSJC 5KHDA 3X1OA 2X1DA 3DLAA 3UMIA 4PJNA 3L0IA 3SZRA 4CZCA 3DXJF 3LJBA 3F9KA 4NQWB 2IYLD 1ZHTA 4NNJA 4CSAC 1V5GA 2BE5F 3M1CA 4QPQA 4R79A 3AL0C 3QZCA 2X6YA 2J45A 2P7VA 3VYSB 3NWSA 3K66A 2QY9A 3IUOA 4JVSA 2MD0A 3CJQB 3B0PA 1M56C 2LOOA 4XLCA 4KITB 3EUKL 3ITFA 3LLIA 3NG1A 1J09A 5D92A 4KBLA 2P6VA 1QLEC 3DKXA 1QHGA 4MNDA 3HL2A 1ZU4A 2DGJA 3AG3C 2E5NA 3LL7A 4BEHA 2OG2A 4II2A 2W45A 3DAGA 4JURI 4KNVA 1Y56A 5KYYB 1JPNA 2QKMB 3S3NA 4JZAA 4CSWA 3WG7C 2CNWA 2JVGA 4E7LA 4AK9A 1UELB 2HQAA 1LFPA 1RJ9B 4I1MA 3QYBA 2VKHA 3AFHA 3I9V2 2Y3DA 4OWRB 4ZTFA 3H5NA 2WAEA 2VJ4A 2M4EA 3OYFA 4A2NB 4IRUA 4BACA 1D1BA 2V4JC 2Z1DA 2IGMA 2HDWA 2H7BA 2I8BA 1V55C 3VDXA 4IQJA 3FHDA 1VZ0A 4XNFA 4IZZA 3I5QA 1D0ZA 4I3MA 4OD4A 3F47A 5T3TA 3UMKA 3ZC4A 5HSWA 1N75A 2MYSA 2XF6A 3E1SA 3S27A 3MD2A 3UNGC 5KYXB 3MLGA 5BUOA 1T0FC 2JVHA 3SEZA 2IXSA 2W82A 3M8JA 4EATA 4CCNA 4XLAA 2IXMA 3VWBA 3KKBA 4KI2A 3V42A 4QPOA 3FAJA 3HJCA 4RM2A 1Z3YA 3HLZA 3N24A 2GOMA 1IRXA 2KRCA 2R7QA 4IAOA 1Z3XA 4B43A 3S93A 2VLAA 3C2HA 1D0XA 1J8MF 1RJ9A 3EH2A 2JUGA 2L5QA 2Q9CA 3FVYA 2CH0A 2VL8A 4RM3A 2IXOA 2J7PA 3K1IC 4OD5A 4YJWA 2WY7Q 3FKJA 4G7HF 2E60A 5FROA 2VQGA 4IX7A 3ZIBA 4WJ0A 1WJBA 4PJJA 3K70D 1K6YA 5KYNA 2R7SA 3SNHA 4KJZA 2AQEA 4F91B 1Z5ZA 2A68F 2WBMA 3HPGA 3EGDB 1U0JA 3NKDA 5KYXA 3RFYA 5HNFA 4U7BA 4CCLA 1JI8A 4HE8D 3NRHA 4KC9A 2LREA 2LBFA 4II3A 3AQBA 2L9NA 1OCRC 2CUZA 2CV1A 3OL4A 4Y33A 2KW3C 3SYNA 3DPLC 3SP1A 4C7OB 4DBQA 4ZDPA 4DBRA 4F93B 2CW8A 4RLFA 4DIQA 1WJDA 3OYBA 1TWCA 4HSTA 3K1HA 4BS9A 4CCJA 1QZXA 2Y3BA 2R7TA 2UUZA 3I5PA 4U5DE 4CSAA 4I1OB 3CJRB 4C2UA 4C2TA 1N1CA 4GYTA 3SEOA 3K6BA 2MFZA 2XXAA 2ZXRA 1ZU5A 5E33A 4HPQA 3OYGA 2O9XA 3PNVA 1HA8A 2XDVA 4F3QA 4NY3A 4AVZA 3KH2A 4OINF 4ZLCA 3JSZA 2V7FA 3LAYA 4I44A 4YRVA 4XN3A 3OY9A 2DXIA 5F5HA 2X85A 2WADA 4JW1A 3Q6MA 2DT6A 1MMAA 3F46A 3BCBA 1PD1A 4XL9A 3OYKA 1ST6A 3W8IA 3A4CA 2HU9A 5DS4A 3LLKA 4J00A 2KZVA 4XMYA 1NU7D 4U5FE 3DPUA 2M4GA 2QKLB 3RSNA 2H7VC 2VQLA 2JA2A 3H65A 2WZGA 2OV7A 2QTVA 4E7JA 4RMNA 4ZYAA 3SDBA 3ZXSA 3OYEA 2VJJA 4XOPA 1X1CA 1DGWY 1JPJA 4BEJA 2RNGA 4BJTA 1WGWA 2DJIA 2CNWD 2BW3A 2KNHA 3JT1A 4LLCA 3L2QA 3RH3A 3UR3C 3X2QC 1W2WA 1M2OA 1QU3A 4YEJA 2OCCC 2BOLA 4HFFB 4ITVA 3OYNA 3EH1A 4IWBA 3EZHA 4OIPF 4P6IC 1UAAA 3OS0A 3CP2A 2KHMA 4QI0A 1X4OA 1Z6AA 3HPHA 1NU9C 2V6EA 1Z3IX 3EHNA 2IGKA 3ONQA 2IXNA 3LS0A 3H9JA 3OYHA 2XC7A 2Y0SA 3EFOB 3VYUB 4DJAA 4JOMA 1V5FA 3OMYA 1MNEA 1ZHYA 2PP4A 2Y69C 3T6BA 3LSKA 4EWCA 3OWTA 4BE0A 2G62A 4Q4ZF 4ZC3A 2KMUA 2CS3A 2OUMA 4XLPF 2XF7A 3S3OA 4BG0A 3FDQA 1MMGA 5FCLA 4OIQF 1OKKD 3VYWA 3EPVA 5F5FA 4ZDOA 3EZIA 3DU5A 3RKOF 2X6XA 5CPRB 1MMDA 4JJFA 5B3SC 5EHHA 2ZXOA 2KRHA 2LYCA 4BJ5C 3H35A 3L2VA 3K4CA 3AQCA 3N2ZB 3O39A 4ZDLA 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ6 C;  4BJ5 C;  4BJT A;  3K6G A;  3OWT A;  3CZ6 A; 
#chains in the Genus database with same CATH topology
 2M7B A;  1VQM I;  1Y4C A;  2KDZ A;  5LHI A;  1QKR A;  4Z9J A;  3PSF A;  2KIQ A;  3RPU A;  1RI7 A;  3OYA A;  2QCO A;  4ZZD A;  4UDV A;  4IKF A;  2OJQ A;  1FJL A;  3GTG J;  3BPX A;  5EEG A;  2FRH A;  4HNT A;  1XD7 A;  2K85 A;  3JRG A;  4R8H A;  3EPZ A;  1QO0 D;  3SQN A;  2GZW A;  4YL3 A;  4CHU A;  1ZAR A;  1YW9 A;  3LEO A;  2M87 A;  1YZC A;  3TO7 A;  2Y39 A;  2XKP A;  3FDY A;  3PCV A;  4F7Z A;  4NUB A;  1HQC A;  3C2G A;  2E34 A;  3OL3 A;  1MMS A;  2IS1 A;  2VCA A;  2XM0 A;  3CEX A;  3HBL A;  1LI7 A;  3A03 A;  3FK7 A;  1FOW A;  2M64 A;  4AIJ A;  1JTY A;  2CYY A;  1TC3 C;  2AXL A;  2XGX A;  2FD5 A;  2VJ5 A;  2JA8 J;  1A7E A;  1M2V B;  1POG A;  3PQJ A;  2XLE A;  3O10 A;  4WGZ A;  2LCH A;  3WHN A;  4A0X A;  2DFH A;  3OYM A;  1WGX A;  4BDZ A;  3BQZ A;  1LDD A;  3SDG A;  3U9G A;  1IN8 A;  1TW3 A;  2MAB A;  3E9V A;  1Q0K A;  2IBD A;  3CQZ A;  1TWG J;  4BDY A;  5GTH C;  3DE8 A;  2W25 A;  3FXM A;  3V4G A;  2EPN A;  2XRH A;  1WJF A;  3MKW B;  2ZFW A;  5E8I A;  2LY2 A;  5DCF A;  2EZI A;  2UV1 A;  3BG6 A;  2IS4 A;  3ERM A;  4XLE A;  1VYI A;  1Y39 A;  1BI1 A;  1RKT A;  2B7E A;  3WU0 A;  2O5R A;  2H8R A;  2CMP A;  3EJN A;  5L3Q A;  1MIJ A;  2FUG 2;  3CJN A;  4I0A A;  3KLO A;  4YN0 B;  3JSO A;  3M4O J;  5DDG A;  1PD0 A;  1R23 A;  1FSH A;  5E3C A;  2ZME A;  4CJG A;  2OCC H;  5CI8 A;  1P4W A;  1M2V A;  3KL4 A;  3RVY A;  1G3W A;  4ENJ A;  4KFC A;  5CVR A;  3QW1 A;  1N78 A;  4EBB A;  1MGT A;  4KDP A;  4DQ2 A;  4IL6 C;  1IXR C;  1HSJ A;  5T3W A;  1DUX C;  2RRE A;  3AG4 C;  4KUM A;  2H8W A;  4ANJ A;  4RB0 A;  2HSB A;  3QPH A;  3K69 A;  4XLF A;  3V7C A;  3VYR B;  1P4A A;  2ESN A;  3LOC A;  3HGG A;  4XON A;  4EV0 A;  2CYD A;  2D5R B;  3TQN A;  3IRQ A;  1S5L C;  4MQ9 F;  3COA C;  2XLV A;  4FWV A;  4XPY A;  1ZG3 A;  2M34 A;  2WC2 A;  2XPV A;  3W6V A;  4IJJ A;  3KP2 A;  2HV6 A;  4RBN A;  2MH2 A;  3BTC A;  4JBA A;  4L9V A;  2W9Y A;  4BHB A;  2DCE A;  3BDD A;  1F5T A;  2Z16 A;  4JJG A;  1PYV A;  3WG7 H;  3EYI A;  2PJR B;  4OAY A;  2M4K A;  4F55 A;  5JT4 A;  5IY5 H;  2VXZ A;  4KNW A;  2HR3 A;  3G6E I;  3A2K A;  1P9Q C;  4BUP A;  3TBI A;  5JRA A;  1F1Z A;  1KQ9 A;  3H5A A;  3G4Z A;  2ISZ A;  1B6A A;  3ZMV A;  2GIZ A;  2RKH A;  3CJT B;  2DTZ A;  3QOE A;  4C3H J;  5K7F A;  3PNY A;  3QW0 A;  2JJ7 A;  3TOM A;  5L3V A;  4ZLD A;  1OIS A;  3CCL I;  2G3V A;  5L0J A;  3UKG A;  1BOB A;  3MX3 A;  2HVS A;  4BL0 B;  4UVB A;  3ZMS A;  3BR1 A;  3LUT B;  2RD9 A;  3FOP A;  3T5X A;  4PFO A;  1RPW A;  2I5U A;  3MEX A;  2XLM A;  3GM2 A;  4C3B A;  4MVS A;  1HKS A;  3OV8 A;  1WJC A;  1VTM P;  3WAQ A;  4TV7 A;  1IZM A;  1HF0 A;  2WVN A;  2YRF A;  3HTK C;  4ER9 A;  3UGO A;  3WGH A;  1PJR A;  4E7I A;  4YIF A;  2V79 A;  1KU2 A;  3PHF 2;  3BOQ A;  4BJ6 C;  2PEX A;  2EV6 A;  3L7W A;  2CQX A;  2EIN C;  1SVO A;  2PJR A;  2BV6 A;  2QSF X;  4UV9 A;  3HUG B;  1YAU O;  3JRI A;  3BTI A;  1YJ9 I;  3RKQ A;  4D7M A;  2JTV A;  5ILS A;  3NMI A;  3AAF A;  3FAP B;  3L8I A;  3I53 A;  2DA6 A;  4YT5 A;  2BGC A;  1U89 A;  4BQN A;  2KC3 A;  5KYW B;  4NC8 A;  3GYH X;  2W85 A;  3L2W A;  4G7Z F;  2HNH A;  3CMM A;  1I4Z A;  4XWJ A;  2OOC A;  3G2B A;  4M6X A;  2BZT A;  2YL7 A;  3DM5 A;  3HIF A;  3TW7 A;  2ZKZ A;  1W0T A;  2R7U A;  3HKK A;  2GAQ A;  5E1W A;  4XLN F;  1JUP A;  2DA3 A;  5CVJ A;  3ABU A;  3NWT A;  5ILV A;  2L6H A;  1R1T A;  2AQF A;  2R7Z J;  2NNY A;  2P6S A;  3NDB B;  1NG6 A;  1VYK A;  4CS8 C;  1YX5 A;  2KGO A;  1XB4 A;  3IKT A;  4KYW A;  2DLL A;  4Q48 A;  5KYU B;  2LKP A;  3SFI A;  5TGT A;  2GWR A;  5EEA A;  2IS2 A;  2P5L C;  4N4O B;  3HNI A;  1MMN A;  2MD5 A;  4XEK A;  5E17 F;  2EWN A;  2W24 A;  1Q0D A;  1T8I A;  2PX0 A;  2QE9 A;  2RAE A;  5E3M A;  2E87 A;  2H7O A;  4HNV A;  1TWA A;  2YWA A;  2EV5 A;  2OF7 A;  3Q0V A;  5J47 A;  2W4B A;  5COM A;  1SAU A;  3GTJ J;  1VQ9 I;  4I2O A;  1R36 A;  2FFH A;  4Y52 J;  3I3L A;  5EEH A;  5F64 A;  3WTX C;  3CUO A;  4Y13 A;  5KYW A;  5EJC A;  3W8H A;  3I59 B;  3FMR A;  4DVY P;  2QLZ A;  2ACJ A;  3OEO A;  1SD5 A;  4HQM A;  2A6H F;  2HVQ A;  1ONV A;  1NZE A;  3GBG A;  2NS8 A;  3ESW B;  4D0P A;  2LG4 A;  4BHP A;  3C18 A;  4Y15 A;  2L9S A;  3I4U A;  3VM6 A;  3PFI A;  2EIM H;  3QRF F;  2OTL I;  2ZJQ F;  5EYR A;  5KYU A;  1KQ0 A;  3BCA A;  3K4N A;  2YKZ A;  2FBK A;  4UUV A;  5H6Q A;  1SMT A;  3D5S C;  5D5W B;  2XLW A;  1NBB A;  2VBW A;  3GZ5 A;  2LLK A;  3BT9 A;  2DOF A;  5A6B D;  1WSU A;  1LUJ B;  1OFC X;  2JUC A;  4EM2 A;  1TNS A;  3IAS 2;  1UST A;  1EV7 A;  2PJP A;  2KDO A;  1VLS A;  3TOB A;  2B63 J;  1G4U S;  4I7H A;  3UMH A;  3QTH A;  4B1R A;  3LNR A;  5GAE J;  2PN6 A;  5HLI A;  1Z6R A;  4NC6 A;  5JVT A;  4WF2 A;  4ZTJ A;  2J9W A;  2LQG A;  5A6J A;  3POV A;  2WVO A;  2F5V A;  2UXX A;  5F6F A;  1OR7 C;  1JUM A;  1MJA A;  2VUM J;  1MND A;  3M3Y J;  1RUO A;  1LNW A;  1TR2 A;  3ZDL A;  3C7J A;  2OQG A;  4I98 B;  4E7K A;  4BJ6 A;  3K33 A;  4J19 A;  2R7V A;  3B73 A;  4ZJZ A;  1YA7 O;  1FMW A;  4XRM A;  2DA1 A;  2RVC A;  1R00 A;  1BZ4 A;  3ZQ7 A;  1P7I A;  2ETH A;  3W2V A;  2WV0 A;  4F92 B;  1JKQ C;  2PNO A;  4B09 A;  2ELK A;  2B0J A;  2J9U A;  1YYV A;  4IHS A;  1AUE A;  2QGU A;  1R6R A;  2VPL A;  1HW5 A;  4BBR J;  2FNA A;  3QOD A;  2J8W A;  1FBS A;  3CUQ B;  4OIR F;  1H9G A;  3JRH A;  4XPW A;  1WH5 A;  3LFU A;  3GZN B;  2K7L A;  2DMP A;  2KFD A;  2RNJ A;  5KNL A;  2Q9B A;  1R1V A;  3EQL F;  2BW3 B;  2W1O A;  3DAF A;  1T95 A;  3HOZ J;  3HOX J;  4J32 B;  2OZU A;  3HB9 A;  3BG5 A;  2IRF G;  4EJV A;  4I76 A;  2F2E A;  2Z9O A;  5E18 F;  4A3E J;  4HLY A;  3V7O A;  3S17 J;  3G1O A;  1VLT A;  3ZCO A;  2R05 A;  1WJE A;  3QPT A;  4PZJ A;  2MLK A;  2LR8 A;  2CSO A;  2VPR A;  1FR0 A;  4BKX A;  2PLY A;  1IF1 A;  3CCR I;  2LP4 A;  3ZMU A;  2Z15 A;  2COB A;  3ISP A;  2ZSI B;  3H36 A;  1X4P A;  4EJO A;  3S28 A;  4ZH4 F;  4IJA A;  1FNT c;  2WB1 A;  3S1M J;  1SMY F;  1FEX A;  1MW7 A;  2K40 A;  4LB5 A;  3RYR A;  3F3X A;  3JSE O;  4XK4 A;  4DNC A;  1B68 A;  3T0Y A;  2F5E A;  2Y3G A;  3TQO A;  4AM3 A;  1RKW A;  3KZY A;  4XRF A;  3A9C A;  2ZPA A;  3G1L A;  2R93 J;  4D4N A;  3K1M A;  3PMR A;  4E7S A;  3ABK C;  1XGN A;  1GVJ A;  2JPU A;  3B29 A;  4L5J A;  1LVK A;  1YOV B;  3JRA A;  4O5V A;  4MVZ A;  1F4K A;  2KIS A;  1T6U A;  5DEQ A;  2KJC A;  1X19 A;  3QWL A;  3Q0W A;  5JLX A;  4IRG A;  1CGN A;  1ZR4 A;  4U5B E;  2X1D A;  4YFX F;  3BTL A;  4U9D A;  1FOK A;  1BI0 A;  5HDN A;  3ZP5 A;  1QZE A;  1R4M B;  2DFE A;  3DXJ F;  3F9K A;  2VON A;  1FZP B;  3TDZ C;  1ZHT A;  3MCZ A;  1V5G A;  2Z5U A;  2VT2 A;  2IYL D;  4MS2 A;  1SFX A;  2QNL A;  3G4X A;  3QQA A;  1YW7 A;  2HOE A;  2XPU A;  2FEZ A;  3NWS A;  2KIU A;  2QA4 I;  3IUO A;  2MD0 A;  2QUF A;  3EUK L;  4FE7 A;  1OR3 A;  3K1I A;  2DI3 A;  1MQV A;  2P6V A;  3JTL O;  2HWV A;  2ESH A;  4IAQ A;  1V74 B;  4KIG A;  4IOA F;  2OD5 A;  1ZU4 A;  5L0I A;  4AWX B;  2E5N A;  3LL7 A;  3DAG A;  5J4V A;  5KYY B;  1ZGJ A;  4ENN A;  1JPN A;  2XRN A;  1VQN I;  3GWN A;  5J3L A;  3IQ6 A;  4E7L A;  3MKL A;  3I5U A;  1LFP A;  2XAS A;  1BC7 C;  2YU9 J;  1RR7 A;  3TUL A;  2HXO A;  1AHD P;  4JEB A;  4OWR B;  4ZTF A;  1U8R A;  5ICG A;  1MSE C;  3HOU J;  5IOZ A;  4MVR A;  2IGM A;  3T1B A;  2MH9 A;  3VDX A;  2R5Z B;  4MIM A;  1K83 J;  2ZJ2 A;  5HSW A;  1Q1V A;  3BJA A;  1N75 A;  1WOL A;  3MD2 A;  3DLL F;  2CO5 A;  2W82 A;  2LKX A;  2B9S A;  1MBK A;  5BPI A;  3PIP F;  2JZY A;  1Z3Y A;  3FAJ A;  2QWW A;  1IRX A;  1BI3 A;  2KRC A;  2R7Q A;  3SXK A;  1I6H J;  1FY7 A;  2XGC A;  5IP6 A;  5DM7 F;  4M9S A;  3C2H A;  1VQ5 I;  1R5I D;  1TTY A;  2CRG A;  2EPM X;  3EH2 A;  2FMY A;  2L5Q A;  4GFB A;  1K04 A;  2Q9C A;  2VL8 A;  4RM3 A;  2J7P A;  4G7H F;  3ZMZ A;  2M2E A;  4N9H A;  1K4T A;  1TWC J;  1ZZP A;  4AUX A;  4ETS A;  1GHC A;  3CDH A;  1LIH A;  2L01 A;  4ESF A;  2DPU A;  4P9T A;  1K6Y A;  4BAY A;  3HHG A;  5KYN A;  5JHU A;  3BPV A;  3SNH A;  1HMO A;  2AQE A;  5IP9 J;  3HOW J;  2H94 A;  4EMS A;  3EGD B;  2OZ6 A;  4HV6 A;  4X1E A;  1JI8 A;  2VKE A;  2R3S A;  2L4M A;  2FU4 A;  3BR5 A;  3FXK A;  3GTP J;  2VE9 A;  1Q0F A;  1YZA A;  2IP2 A;  5EF6 A;  2HXI A;  2ICW G;  3SYN A;  2L9V A;  4JIO A;  3RW0 A;  1XZP A;  5LGU A;  4HST A;  1VQ7 I;  3ZQF A;  2UZK A;  1JJ8 C;  3I5P A;  4U5D E;  1RR8 C;  1AOY A;  4BYY A;  4I1O B;  3CJR B;  4C2U A;  1BM9 A;  3SEO A;  3K6B A;  3IC7 A;  2MFZ A;  2TDX A;  1MD0 A;  2XXA A;  5CYV A;  4H54 A;  1VI0 A;  2QQA A;  2XIG A;  1APL C;  4RBO A;  3L1P A;  2YLI A;  5A6A A;  3OYG A;  4OIN F;  4MVM A;  2Q2E A;  2D1H A;  3FOO A;  1J5Y A;  3TGN A;  3OY9 A;  2DXI A;  2X85 A;  2GA2 A;  5D6E A;  3CLO A;  2RGV A;  1Y8R B;  5L3C A;  1XPX A;  3Q6M A;  5F28 E;  4Z2Y A;  2QVO A;  3G50 A;  3F46 A;  3AG3 H;  1X2M A;  1ST6 A;  2QBY B;  4HDV A;  1BDJ B;  4JTD B;  3IWZ A;  4IHX A;  2HU9 A;  3HNJ A;  1R5G A;  3SJM A;  1APC A;  1KZH A;  3L00 A;  4XMY A;  1K79 A;  1DU6 A;  2QKL B;  3H65 A;  2OBP A;  3JRM O;  1RRJ A;  3P9K A;  3CCV I;  2OA4 A;  2RN7 A;  2EA2 A;  2WV1 A;  4ENM A;  1X1C A;  1V55 H;  4BEJ A;  4EUK B;  1SD4 A;  2MSY A;  3RDI A;  2DJI A;  4L18 B;  1W2W A;  4HOB A;  2BBY A;  4YEJ A;  2R02 A;  3S1Q J;  4EKW A;  3KCC A;  1WI3 A;  5HS8 A;  2WWY A;  3IV5 A;  1FOX A;  1OW6 A;  1HST A;  4V19 K;  2HDD A;  3F8F A;  3Q9S A;  2DDB A;  1BBY A;  4J30 B;  3EHN A;  3EFO B;  1G3Y A;  5CLS A;  1FC3 A;  3K0L A;  1UFM A;  4U0V A;  1KU7 A;  1IRZ A;  2HZT A;  3FIW A;  5M5Y J;  1W7P D;  3RZD J;  3KEQ A;  4A5M A;  2GIV A;  3I55 I;  2CGP A;  5KAF C;  2HYF A;  1CPR A;  3ZQY A;  1MMG A;  5FCL A;  2BXY A;  1OKK D;  1ZGA A;  1YDI A;  1HKT A;  3RKO F;  5FZT A;  3DU5 A;  1ZHF A;  3A01 B;  5FLM J;  3S15 J;  3NRV A;  2ZXO A;  2IA1 A;  2LYC A;  2YUS A;  2OEV A;  1UG2 A;  3H35 A;  3N2Z B;  4XEF A;  4L0Z B;  2DMN A;  2W00 A;  3LA7 A;  6PAX A;  2E7X A;  2Y0S N;  3SZT A;  3B02 A;  4BXX J;  1OCR H;  2R03 A;  1RKE A;  4Z9H A;  4LG0 B;  3R2P A;  5BQH A;  2BVL A;  1UHM A;  1WTY A;  2V9P A;  3CO7 C;  2DBB A;  2HYJ A;  3JRF A;  1SFE A;  3HKZ A;  5D5X B;  3U8V A;  3CZ6 A;  1XSD A;  2R7F A;  3RQF A;  4BJ1 A;  2PG4 A;  2VB6 A;  4HX8 A;  4BPM A;  4MQV A;  1U8B A;  3QYE A;  4P9F A;  4FAS D;  4ZZL A;  2P6T A;  3ABL H;  4AD9 A;  2OU6 A;  1YX3 A;  5DD8 A;  2EA4 A;  2J9B A;  1O87 A;  2KK1 A;  1SAN A;  3TKY A;  3ZRG A;  3CD6 I;  3DD7 A;  2AWY A;  1G2H A;  5AGF A;  3BC8 A;  1XGM A;  3N05 A;  2V3C C;  4I09 A;  4GEH A;  2EIK H;  1ZHX A;  4WXC A;  3S1N J;  3U8P A;  1UZC A;  4D9J A;  3HZJ A;  1AU7 A;  1ENH A;  3J7A O;  2XL6 A;  5L0D A;  3E7L A;  1S7Z A;  3PUB A;  4HNU A;  2PF4 E;  4LG0 A;  4KN7 X;  2K9Q A;  3JYH A;  5B1B C;  3DWL E;  1G59 A;  2VBY A;  3KYI A;  1GV5 A;  3IP4 B;  1Z23 A;  1XC5 A;  1L0O C;  1Z7U A;  5FGM A;  1P4X A;  1FFH A;  2GOX B;  3NKE A;  3A0B C;  3HYI A;  5ERI A;  1K7A A;  4HLX A;  3L1M A;  4JYK A;  4EEF G;  5DS9 A;  4U5H A;  3PQK A;  5C3E J;  2EIL H;  2CUJ A;  5FLX Z;  3CO6 C;  3KZZ A;  3DM9 B;  1IN4 A;  1E83 A;  1T08 B;  3TL4 X;  3MZY A;  3J06 A;  1TWG A;  2W48 A;  1DGR M;  4XLH A;  1OW7 A;  4B4C A;  1FT9 A;  1L3P A;  2HMQ A;  3EYY A;  2HV7 A;  4RDA A;  2KQ9 A;  4ESB A;  1JHF A;  4YG2 F;  3TW6 A;  1I50 J;  3GX4 X;  5FRN A;  3KZI C;  1HC8 A;  4D4X A;  3RQ4 A;  2EB7 A;  1T56 A;  4CYC B;  5DS6 A;  4L5E A;  1ERD A;  2IBF A;  5FLX K;  2K9N A;  2KLO A;  1XSX A;  3FBN B;  3H92 A;  4EQQ A;  4AU7 A;  1LDK B;  4WWC A;  1HDD C;  3CSK A;  2JRT A;  3GM1 A;  4PUS A;  1UG0 A;  2HGC A;  1MKM A;  2L9J A;  2WAQ N;  3LSM A;  5E8G A;  2PMZ N;  1B8I B;  2R25 A;  3ABM C;  2M3A A;  2F4I A;  4FES A;  3GEI A;  1LJ9 A;  2A69 F;  2WB7 A;  1ZG1 A;  2WZL A;  2LMD A;  4I6Z A;  3CP8 A;  2YS9 A;  3IKV A;  1R5H A;  4BQQ A;  2ZNY A;  5DLJ A;  3FBI B;  1YE9 A;  4C3J J;  1LS1 A;  1UHW A;  2AO9 A;  5COG A;  3IHU A;  4A3G J;  5B3I A;  1LEA A;  3C8G B;  3GUD A;  1Z7L A;  3ZN0 A;  1BJZ A;  4XM3 A;  1O4X A;  4LG3 A;  3KEY A;  2XM4 A;  2EK5 A;  3OOP A;  5EG0 A;  5F0C A;  3OIO A;  5CQE A;  5FFZ A;  3HM5 A;  4CYC A;  3NYL A;  3HG9 A;  1K61 A;  3VPR A;  1F9N A;  5J6X A;  1B9N A;  4MLO A;  4M71 A;  3S9O A;  2PBE A;  3M1C B;  4NQF A;  1AA7 A;  2LF8 A;  4YT2 A;  3E5Q A;  1Z1D A;  1RES A;  2LRD A;  4P1W A;  3RYP A;  2M45 A;  1U9O A;  2LK2 A;  3JZ0 A;  3EET A;  3TO9 A;  1L3L A;  2DN0 A;  1B8I A;  3O6X A;  2HTJ A;  1AKH A;  3WE3 A;  4G9Y A;  3FHZ A;  5LGN A;  1CF7 B;  1OCZ C;  2DK5 A;  3BR6 A;  4GGG A;  1EH7 A;  2LVS A;  3ECS A;  1NHA A;  2LH9 A;  2HVR A;  2LIG A;  2WTE A;  1D1C A;  3DTE A;  2FGY A;  2L3D A;  5F0H A;  1QVT A;  1G5Z A;  1S29 A;  3H3Z A;  3GFL A;  2C03 A;  1SFK A;  2DMQ A;  4WGY A;  3ZPL A;  1YS6 A;  4AYB A;  3LES A;  2QYO A;  1HOM A;  4OIO F;  3WOD F;  3T6G B;  4HF0 A;  1TQG A;  2WL8 A;  2Y0M A;  4V2G A;  4UNO A;  4BU2 A;  2BY0 A;  2BHY A;  2VN2 A;  3OR1 C;  1DQU A;  4Y4R A;  5AIP A;  3S3M A;  2IGO A;  4P5O A;  5ED4 A;  4A3F J;  4PSX A;  3SFZ A;  5H2F C;  1E0E A;  5DCM B;  2MC4 A;  5HDG A;  4K1O A;  2DMU A;  3JRB A;  3ABT A;  1Z67 A;  1JE8 A;  2VCC A;  3HC7 A;  2DFF A;  3VSK A;  1CF7 A;  1BBH A;  3QVY A;  4NC3 A;  4YFN F;  3ERE D;  4O6J A;  1BR1 A;  3FXR A;  3K70 C;  3K4M A;  4FET A;  3AG4 H;  4XKC A;  3OS2 A;  1VMA A;  5JR3 A;  1ZHZ A;  1ETW A;  5M5X J;  1VK5 A;  3MAJ A;  2EPO A;  2G3K A;  2LD6 A;  4JC7 A;  4XKB A;  3EDP A;  1I3A A;  4FHT A;  4Y3O A;  4A69 C;  4RDU A;  1Z63 A;  1XWJ A;  4A12 A;  2Z2S B;  2GBY A;  3H9G A;  2EH3 A;  1VFC A;  1U6G A;  3EG9 B;  3S84 A;  1FYL A;  2A07 F;  3MYI A;  3C63 A;  3OIP A;  4L0Y B;  4YL1 A;  3US6 A;  3LQR A;  1J7K A;  4C9Y A;  1IV6 A;  1QNT A;  1HXD A;  3F21 A;  1IAW A;  4U0W A;  3HSR A;  4A3L J;  3HEF A;  2KRF A;  3GME A;  3VAY A;  3E6B A;  4CGZ A;  2R0Q C;  1ETQ A;  2OC6 A;  2L81 A;  1XX5 A;  5DCM A;  4BXF A;  3H2V A;  1HW2 A;  1J59 A;  4K0D A;  3LNQ A;  4BE1 A;  4FX5 A;  3K4B A;  4IRH A;  1TQP A;  2LBF B;  3DKA A;  4NTF A;  4RD9 A;  4XRS G;  3EGX B;  1V5E A;  3KEO A;  4HSR A;  1H9T A;  3RQE A;  4M3E A;  4BE2 A;  1Y6D A;  2DQL A;  2ID3 A;  1FP1 D;  4DZP A;  3KE2 A;  2JT1 A;  1GM5 A;  5J4Y A;  4OAZ A;  5CIV A;  4UUS B;  3P7N A;  1JAF A;  2OQM A;  3EG9 A;  5AC4 A;  2DK8 A;  1ORJ A;  2OKU A;  1S6L A;  2IT0 A;  1YS7 A;  5IYD J;  1X3W B;  1JJ6 C;  3H3V K;  5ICC A;  4XOT A;  5DQZ A;  4IRI A;  2Z99 A;  2W7N A;  5F1J A;  4DW6 A;  2P8T A;  2YZS A;  1QGP A;  3DEE A;  3WGI A;  2P5V A;  2DTR A;  2EIN H;  3MQ0 A;  5B1A C;  3A0H C;  3ZQV A;  4C3D A;  5F0F A;  2J9V A;  3L34 A;  4I01 A;  1YLM A;  4A6D A;  2M0C A;  2HKX A;  1A0B A;  2R4G A;  2LKS A;  3V8J A;  3S2D J;  2ZD9 A;  5HVQ C;  1O7L A;  3Q7L A;  1NG7 A;  1B59 A;  3VEP A;  3CMA I;  2NVX J;  3EGX A;  2M8G X;  2V9K A;  2DYR C;  3F8N A;  4LD5 A;  1W1W E;  3BR3 A;  3ZQQ A;  4K7B A;  3QAH A;  4YT8 A;  2J0X A;  3T6J A;  4M3F A;  2P1A A;  4P9U A;  2GQQ A;  3RKW A;  3HOY J;  3C62 A;  3U9M A;  5L3D A;  1PV3 A;  4GRI A;  4L9J A;  1FMV A;  2A1D D;  5J40 A;  1ZRC A;  2JRM A;  1B72 B;  4LLN A;  1T6Q A;  3KPH A;  4A93 J;  1S9H A;  1TT0 A;  4LIT A;  2L7Z A;  2WAF A;  4M73 A;  2E1C A;  4DRI B;  3DP7 A;  5FRM A;  3MBG A;  1RMV A;  4V2F A;  2XL8 A;  3RKX A;  1EKY A;  3QMK A;  3F0C A;  1UG7 A;  5CKT A;  1BOA A;  1YA9 A;  3QU6 A;  1TZL A;  2VQC A;  3H0G J;  3RZO J;  2R7R A;  4G78 A;  1YIT I;  4E0H A;  5CQG A;  5HLT A;  2P5K A;  2P7V B;  4NHJ A;  2CQN A;  3O2P E;  2UWM A;  4N0B A;  1OCC C;  1WRJ A;  3DBR B;  3B6C A;  3E3V A;  4R1H A;  2BC5 A;  3AGU A;  3N0T A;  2G9W A;  1O5H A;  3BP8 A;  4Q47 A;  5JHF A;  3ASO H;  3LNM B;  2ELH A;  2IAI A;  2R7X A;  3OOU A;  3DJN B;  2H6C A;  1IC8 A;  1U2W A;  5D8K B;  3DTK A;  1IO2 A;  3KIO A;  3NEU A;  3QOP A;  3Q7G A;  2EIJ H;  2YX7 A;  2QQ9 A;  4L9T A;  4YK5 A;  2KIM A;  2J5P A;  3HRM A;  2ECC A;  3ECH A;  3FHN A;  1I39 A;  3PFY A;  2X0C A;  5D8L B;  3IQC A;  2XSJ C;  1U0B B;  1JKP C;  4JX5 A;  4PJN A;  3AG1 H;  2L6F A;  4R32 A;  4NNJ A;  2HFH A;  3RI4 A;  2L02 A;  4R79 A;  1VND A;  4GYI A;  2Y30 A;  2P7V A;  3K66 A;  3L09 A;  5E79 C;  1A36 A;  5DM6 F;  4JVS A;  4JTA B;  4KN4 X;  4FX4 A;  3DE9 A;  3R7C A;  2O6G E;  4JTC B;  1JXS A;  4JX4 A;  5D92 A;  1J09 A;  1MBH A;  1ZH5 A;  2Q0O A;  1J9I A;  4LK0 F;  1QPU A;  1X3U A;  4MND A;  1A6Q A;  2NYX A;  2OQR A;  3HUG A;  5BOX A;  5TJ5 E;  2JPB A;  1RCP A;  4XEV A;  3S3N A;  1STZ A;  4P55 A;  3WG7 C;  2JVG A;  4L6R A;  1UEL B;  3M8E A;  5A2Q Z;  1MBE A;  1HBX G;  3AFH A;  3I9V 2;  4AC0 A;  2BL2 A;  1MBF A;  4W1U A;  4WAB A;  3CUQ C;  2QUP A;  2L7F P;  4JKV A;  4IRU A;  3JSP A;  4EGY A;  2AP3 A;  2Z1D A;  2EZH A;  4KA4 A;  3W4Y A;  3I5Q A;  4EJU A;  3FHD A;  4I3M A;  4IZZ A;  4B3A A;  1WZ2 A;  1OMI A;  1ODD A;  2XF6 A;  3E1S A;  4M6Y A;  5A2Q K;  3S27 A;  5FKN A;  1H88 C;  2F5F A;  3LA3 A;  1T0F C;  2JVH A;  2LDU A;  3M8J A;  2M1B A;  3KKB A;  1JGS A;  4KI2 A;  3V42 A;  4QPO A;  3N24 A;  1TP4 A;  5AIQ A;  3TP0 A;  5F08 A;  3S2H J;  1UJ8 A;  3BEH A;  3WE2 A;  4AL0 A;  2DJN A;  1YJG A;  5K0I A;  2A61 A;  1XGO A;  1NFN A;  4PCQ A;  3HKZ N;  2JUG A;  3O8H A;  1MH3 A;  2L9R A;  3M4B A;  4Z6Y A;  1OR2 A;  3K1I C;  4YJW A;  3GEH A;  2JQ7 A;  4DZJ A;  3QU3 A;  3I59 A;  1YYX A;  3LST A;  3WTW C;  4IX7 A;  3ZIB A;  1WJB A;  5FD6 A;  2OTJ I;  1EF4 A;  4GCV A;  2XV4 S;  1J2X A;  3BG3 A;  2R7S A;  2YVK A;  4UVA A;  1G3T A;  3R4K A;  4F91 B;  2EPL X;  1RKC A;  2DB4 A;  1CQT A;  1FX7 A;  3HPG A;  4NDL A;  3RFY A;  5HNF A;  4U7B A;  3ABK H;  4CCL A;  5C4X J;  4HE8 D;  4II3 A;  4QTR A;  4AID A;  2L9N A;  3ZTZ A;  1I3Q J;  4Y33 A;  2LY9 A;  3DPL C;  3SP1 A;  4C7O B;  1X1P A;  3R0J A;  4DBQ A;  1FYK A;  4KIC A;  1WJD A;  2AHQ A;  1TWC A;  1EQ1 A;  1Z7Q c;  2EZK A;  4CCJ A;  1QZX A;  2R7T A;  1P2F A;  2UUZ A;  1T39 A;  4G6Q A;  1FTZ A;  3J81 Z;  1N1C A;  3SXZ A;  1TT5 B;  1EH8 A;  2ZXR A;  2D4U A;  1JT6 A;  5IYB J;  1ZGW A;  3ZN1 A;  1FAP B;  3KH2 A;  4NY3 A;  4I44 A;  4A3J J;  2ZC2 A;  4JW1 A;  1QPM A;  1HDP A;  2ADU A;  4LDK A;  1NK2 P;  5HV9 A;  2GA1 A;  3JAM Z;  3J7Y J;  3J81 K;  4XL9 A;  2JSC A;  3GTK J;  5IT9 Z;  4MVO A;  3AG2 H;  3SXY A;  5D5U B;  5A6B A;  3DFG A;  1O3Q A;  1IRG A;  1L7C A;  2O7O A;  3IH4 A;  5IOY A;  2OEX A;  1W5S A;  5E1Z B;  3G1M A;  4PGH A;  3RSN A;  2M4G A;  3WTT C;  1R1U A;  3CUQ A;  2WZG A;  2OV7 A;  1ZW2 A;  3CCE I;  4RMN A;  256B A;  5J8C A;  5L0G A;  3ZXS A;  1IUY A;  1BA5 A;  5HLG A;  3JAM K;  3FIS A;  2RNG A;  2HS5 A;  5ICE A;  2KNH A;  1ON1 A;  2BW3 A;  4HX7 A;  4MEX F;  1KGS A;  2JA6 J;  4LLC A;  3RH3 A;  3X2Q C;  1OXK A;  1DOV A;  1T0F A;  3HDD A;  2XAH A;  3BQY A;  4P6I C;  4KMU X;  2KHM A;  4QI0 A;  5TIS C;  2YQY A;  1W0U A;  1X4O A;  1Z6A A;  2ZO4 A;  2KSF A;  4IPA A;  4O79 A;  1SD6 A;  3ONQ A;  3OYH A;  2XC7 A;  3VYU B;  1MNE A;  1BI2 A;  2VOP A;  2PP4 A;  2Y69 C;  3LSK A;  1JHH A;  3OWT A;  2YX4 A;  5KK1 A;  1R49 A;  4OMY A;  1K6O A;  4KT5 C;  2H6B A;  4ZC3 A;  5AON A;  1YW8 A;  3FDQ A;  5HDK A;  4OIQ F;  1A04 A;  3VYW A;  3VOE A;  2JA5 J;  2P4W A;  3EPV A;  3U0C A;  4HX4 A;  2X6X A;  5CPR B;  2KRH A;  1LFB A;  3BZ6 A;  1H89 C;  4ZYG A;  3L2V A;  3AQC A;  1VQP I;  2E1O A;  1NFO A;  3NAU A;  1BJA A;  2QQ8 A;  4E0I A;  2F4O B;  2OPT A;  1JT0 A;  2K3P A;  3KYL A;  5LBQ A;  1OCO C;  1WFX A;  1B1B A;  1IN6 A;  1W36 C;  5EGY A;  5M5W J;  1X1B A;  2E1M C;  3K4K A;  5FFX A;  5HOO A;  4CIP A;  1FP2 A;  4AIK A;  4ON0 A;  2RDP A;  2A6E F;  2OU2 A;  2XAU A;  4CYD A;  3FK6 A;  5B5E C;  1MDM B;  1BL0 A;  1ZLK A;  1Z91 A;  2CJJ A;  3J80 Z;  2M0M A;  3B9Q A;  2GA0 A;  2ISY A;  3MN2 A;  1ZRE A;  3MYF A;  4G0H A;  2H1K A;  1EA3 A;  1YRN B;  4DGW B;  3S32 A;  4WXH A;  5K5O A;  1H8A C;  5GTI C;  2A0U A;  5FJ8 J;  3U3B A;  5COF A;  4BY1 J;  2ME0 A;  4MW8 A;  2L7K A;  5KYY A;  2HKO A;  4XSX F;  1ZAO A;  3DKY A;  4AIH A;  3BRO A;  2K3F A;  3S2W A;  2E1N A;  2ZB9 A;  1UHS A;  3OSG A;  3JRD A;  5EK0 A;  3B0V C;  2K9S A;  1I1S A;  3DZA A;  1GUU A;  2ELJ A;  3DEU A;  3L2U A;  3WGG A;  1MSF C;  4LLE A;  1F1M A;  2FOW A;  5DS5 A;  2NUP B;  3GM3 A;  3GFM A;  5LFA A;  4MEY F;  2HJM A;  3QP6 A;  1D1A A;  3I64 A;  4J7T A;  2JK3 A;  2XSE A;  2R5Z A;  1TL8 A;  1ZQ3 P;  1MDM A;  1ETO A;  2Y9Z A;  1XMA A;  3IAM 2;  3KP7 A;  1QA6 A;  2HKV A;  4I0B A;  2DYS C;  1FTS A;  4WXD A;  2QQB A;  5H6R A;  3RKY A;  1HE1 A;  2AWC A;  2NPU A;  2QLA A;  4N06 A;  2R7W A;  3I56 I;  1Z21 A;  5JP7 A;  1YRN A;  2MBF A;  2LY1 A;  1GDT A;  3PL8 A;  2X1E A;  1U5T B;  3ROU A;  3FM5 A;  1E86 A;  3UGP A;  3W2A A;  1UB9 A;  1CGP A;  3QYF A;  5DD4 A;  4A3D J;  1R22 A;  2C04 A;  4S0H B;  5DUK A;  3VOD A;  5DVW A;  1GLN A;  3HRS A;  4FX0 A;  5LEJ A;  3D5L A;  2E1M B;  1MBJ A;  3ML6 A;  4A4A A;  1R7J A;  2AS5 F;  4DRJ B;  2K9M A;  3A1Y A;  3JCU C;  1VTN C;  1SR2 A;  3FXO A;  2NG1 A;  2NUP A;  4HZF A;  3M07 A;  4XKV A;  1VQ4 I;  1LE2 A;  2VBZ A;  3CLQ A;  5L3F A;  1ZRD A;  1E3P A;  2O0Y A;  4LFU A;  2P0N A;  3OYC A;  3JTH A;  3PO3 J;  4FT8 A;  5K7H A;  3K7D A;  1DP3 A;  3TMO A;  4G7O F;  3EGD A;  3T8T A;  4FTH A;  5B66 C;  3EUH C;  4XRS A;  3FMQ A;  2F5D A;  2ZSH B;  5LD2 C;  2K4J A;  3BWG A;  3DI5 A;  4LJZ F;  1FIP A;  2VKD A;  4MHG A;  2KL4 A;  2G0E A;  1T6S A;  2HQ5 A;  5F1R A;  1YFH A;  3PJR A;  1C02 A;  2Q9A A;  4PJM A;  1Z6T A;  1LKX A;  2WVQ A;  3HNK A;  3ULQ B;  3DBH B;  1TWH J;  4U5G A;  2A5W A;  3WHB A;  1P92 A;  3S8P A;  3HOV J;  3OA1 A;  3OYD A;  1HKQ A;  4DOZ A;  1OJL A;  2KPM A;  3ZQG A;  2HOA A;  1XDS A;  2QEX I;  3FF5 A;  1OW8 A;  1S7O A;  4U87 A;  5D4R A;  1QPI A;  1IV8 A;  3K1P A;  5L3E A;  4XQF A;  5DQT A;  5BQI A;  3M9A A;  3CF5 F;  1K78 B;  3HSE A;  5M3F J;  2P7C B;  2P81 A;  4PK4 A;  2STW A;  1BN5 A;  3K10 A;  4HW0 A;  3W6J B;  2CW0 F;  5LRS A;  3ZR8 X;  3OYL A;  3CES A;  1T9K A;  4EJT A;  5T3T A;  5FD5 A;  3SZG A;  2NUT B;  4N6H A;  1S3J A;  2QBY A;  4PDK A;  3H0D A;  4XKW A;  4O6M A;  2YL1 A;  5CI9 A;  4FE4 A;  4G6T B;  1ZTR A;  3U2L A;  4N4W A;  1YHQ I;  3OIQ A;  1BR4 A;  2XRL A;  1VQK I;  2KIF A;  2ZXI A;  3CDL A;  1WJA A;  4IHV A;  1FYM A;  5ILU A;  4W8P A;  2J46 A;  5KVR A;  3E97 A;  4CA0 A;  1TBX A;  1U6H A;  3TK0 A;  1RIO H;  2XL4 A;  1K78 A;  3HJE A;  2X51 A;  2X48 A;  3P9C A;  4PFP A;  1O57 A;  3RCO A;  3U9J A;  1A7V A;  3E5X A;  2L7M P;  2CQQ A;  3GW2 A;  2YU3 A;  1JTX A;  2HTS A;  2NUT A;  1I1G A;  1W7P B;  2BY1 A;  2HI3 A;  3EFO A;  4AX2 A;  1T38 A;  2DOA A;  3PSI A;  3JYY A;  4CDY A;  5L0F A;  2CFO A;  4UUT A;  2ZNZ A;  2VI6 A;  3O3K A;  3DCF A;  4O7G A;  1LB2 A;  2IOQ A;  3NMJ A;  3G73 A;  2ZJP F;  4DYR A;  2IXP A;  4CH7 A;  2LTP A;  2QEN A;  1WWX A;  3A01 A;  2QSG X;  4AVP A;  3E5U A;  4EIY A;  1FWZ A;  1IN5 A;  3F8M A;  4B8X A;  4KT6 A;  2NS7 A;  3QP5 A;  1W5C C;  2XF5 A;  2XSD C;  4C3E A;  2ZFU A;  3ABM H;  4F52 A;  3EUH A;  5A69 A;  2M8E A;  5JVE A;  2XPW A;  2X1C A;  3GWZ A;  3QPS A;  3VSL A;  5FLV A;  1T5O A;  3KMI A;  9ANT A;  3JR9 A;  4M3B A;  4E6K G;  1YAR O;  2V6C A;  3ZWI A;  4LIU A;  1YTY A;  1AVO B;  4EHP A;  2FJ1 A;  4BHC A;  1T6I A;  4MFD A;  1NG1 A;  2RC4 A;  5IPA A;  2KZG A;  4CDG A;  3SEQ A;  2F22 A;  2XVC A;  1XSV A;  3C2B A;  4QDL A;  2CGE A;  1OKK A;  1C0W A;  1D5V A;  2YLD A;  3S1R J;  1Q0M A;  3JCU Q;  5GAH J;  3S29 A;  1V4A A;  2MLG A;  3TP3 A;  2KP6 A;  2X6O A;  2F6C A;  4LLG F;  2QM3 A;  2H1L A;  1ZK8 A;  5K7Z A;  1V54 C;  2V1D A;  2XHK A;  2VJI A;  3AL0 B;  4HYE A;  3CCQ I;  2YEV A;  1J75 A;  1Z9C A;  4RA2 A;  5GPC A;  3KX2 A;  4A3B J;  1M6T A;  2UXN A;  3KYD B;  4G12 A;  1CGM E;  2EBI A;  4ULV A;  3MKZ A;  2P61 A;  3U3F A;  1HE9 A;  5CVI A;  1ITY A;  5LEK A;  1D3Y A;  1EA8 A;  4LB6 B;  3GOD A;  4LK1 F;  4RGU A;  3M79 A;  4EM0 B;  3H9Q A;  3CTA A;  4IVN A;  2EPF A;  1EKE A;  4MGR A;  1S7E A;  2CW7 A;  3RQG A;  1RNL A;  4N4N B;  5B3S H;  4X6A J;  1R58 A;  3F22 A;  5EZG A;  2YSR A;  2PX9 A;  1KYZ A;  1I5Z A;  3W3C A;  3PDM P;  3VB2 A;  2CCY A;  3FKI J;  2VOO A;  3LAJ A;  1E2X A;  3LSG A;  5A6K A;  2JPC A;  2WA0 A;  3DBL B;  4E7H A;  3ABL C;  4HEA J;  4XQ1 A;  1ETV A;  1MJB A;  1X3Z B;  1OPC A;  2ZXW C;  3R0A A;  2XKO A;  4RGX A;  3ASN C;  2DA4 A;  2PX3 A;  3LSI A;  1GXP A;  3CCM I;  2C6Y A;  2RSE B;  4IAR A;  4LAC B;  4XBF A;  1G3S A;  2COM A;  1JKO C;  1E3O C;  1C03 A;  4IB4 A;  1VOM A;  1TKN A;  2EIK C;  5GAD J;  1HCR A;  4LER A;  4F4B A;  3RPU D;  2E71 A;  2VE8 A;  1SC7 A;  3DWW A;  2YL0 A;  5AC5 A;  1R4T A;  3ZSU A;  1WJ5 A;  3LMM A;  4L5I A;  2F48 A;  3MZ8 A;  5TRD A;  1E85 A;  1VQO I;  1OCP A;  2EZL A;  4CUG A;  3M8F A;  4Q7C A;  3LSH A;  2W4S A;  3KP6 A;  2ZXJ A;  4RB2 C;  4HDU A;  1YJW I;  4QLC U;  1PUE E;  5GPA A;  2FQ4 A;  2VC1 A;  2NOJ B;  1O3U A;  4BEH B;  3X1O A;  2OAZ A;  5EDN A;  1S72 I;  1A35 A;  4IHY A;  2EIL C;  2E2J J;  3ECO A;  3LAP A;  2FF4 A;  3GFJ A;  4JRZ A;  3C8G A;  4O6Y A;  1QQI A;  2IA2 A;  2VXD A;  3N4M A;  5K5Q A;  2EFW A;  2DFI A;  2FSW A;  3PM1 A;  4S04 A;  4WX9 A;  3C8Z A;  4IEJ A;  3L0I A;  3SZR A;  4CZC A;  2WB1 N;  2NSG A;  4NQW B;  3LJB A;  4CSA C;  2M30 A;  3RJP A;  3JTG A;  1YO5 C;  3H1C A;  2ECB A;  3M1C A;  2KJB A;  2J45 A;  3KYC B;  3VYS B;  1QZY A;  2XAG A;  5C4J J;  2GM4 A;  2STT A;  2BXZ A;  5HS7 A;  5L0H A;  1M56 C;  4XLC A;  4KIT B;  3BG9 A;  3NG1 A;  5JS5 A;  3ZQI A;  3DKX A;  1QHG A;  1S05 A;  2XAJ A;  3RVZ A;  4BEH A;  4II2 A;  3NQO A;  1GT0 C;  1EH6 A;  1NK3 P;  1Y56 A;  4KNV A;  3N97 A;  4DXW A;  2QF7 A;  1ZW3 A;  4JZA A;  2CNW A;  4AK9 A;  3TED A;  4BXU A;  2VKH A;  4DYQ A;  3ZQL A;  2Y3D A;  1O3T A;  2LFD A;  2M4E A;  3MFN A;  1EJ9 A;  4MTE A;  2NVY J;  4NQW A;  2HUJ A;  3GTO J;  1D1B A;  2V4J C;  2DYR H;  2IEK A;  4IO9 F;  2I8B A;  4LGW A;  2FX0 A;  4IQJ A;  3NMK A;  1VZ0 A;  1O3R A;  1D0Z A;  5DYM A;  3F47 A;  3LQQ A;  2JMW A;  1ACI A;  1JMW A;  5GAG J;  3Q9V A;  2MYS A;  2DA7 A;  2GAU A;  1ZVZ A;  5KYX B;  3MLG A;  5BUO A;  2K27 A;  4CJO A;  2BHZ A;  4FQG A;  4EAT A;  2ZME B;  2IXM A;  2VT3 A;  3VWB A;  1Y1W J;  3DV8 A;  5BPD A;  3HLZ A;  3KP3 A;  1WWP A;  3KFW X;  4DJ9 A;  3K9T A;  5IT3 A;  1HLV A;  4NTB A;  1IRF A;  4BH9 A;  2X4H A;  1XN7 A;  3S93 A;  1JKR C;  1DP7 P;  1SAX A;  3Q3S A;  1I5N A;  2FOK A;  3IL2 A;  2CH0 A;  4M3G A;  3H2U A;  2IXO A;  3L2C A;  2XB0 X;  1YVI A;  1OCC H;  4OD5 A;  2WY7 Q;  1XMX A;  1IXS B;  2E60 A;  5FRO A;  4YFK F;  2IW5 A;  2FA5 A;  2VQG A;  5HOD A;  4MW3 A;  4WJ0 A;  2I15 A;  3M15 A;  4PJJ A;  4CX9 A;  3K70 D;  4G6D A;  4OOI A;  2KT0 A;  2PMH A;  5ICF A;  1QZZ A;  2WBM A;  5KYX A;  1U0J A;  3NKD A;  1X58 A;  2EJR A;  3WTU C;  3NRH A;  4KC9 A;  2LBF A;  1DPU A;  2CUZ A;  4EBK A;  2CV1 A;  3OL4 A;  2NAZ A;  1O3S A;  2DOD A;  2DQR A;  3GZ6 A;  4ZDP A;  4DBR A;  4F93 B;  1T2K A;  3L8J A;  4RLF A;  3B71 A;  1ZR2 A;  3OYB A;  3KET A;  4PJ0 C;  1TWF J;  5JFR A;  1CGO A;  1BW5 A;  3O55 A;  4CSA A;  3V8L A;  2GXA A;  3P5J A;  3ELK A;  4UUS A;  1NH3 A;  4C2T A;  4DRH B;  4NB5 A;  1ZU5 A;  4JCZ A;  5E33 A;  1JRA A;  3M4C A;  4HPQ A;  2O9X A;  4EBJ A;  3PNV A;  2XDV A;  4YII A;  1REP C;  1R4N B;  4LOC A;  3JSZ A;  4YRV A;  4XN3 A;  5F5H A;  5JUA A;  1WH7 A;  3W6K B;  3MFK A;  2YLG A;  3G3Z A;  2DDA A;  5J8F A;  1B9M A;  1KQ8 A;  1SYQ A;  3GEE A;  3BCB A;  3JRC A;  1F43 A;  4PR9 A;  5JSL A;  3NAR A;  1IDZ A;  5BS6 A;  3HRU A;  3A4C A;  2V1X A;  4U88 A;  2TMV P;  5DS4 A;  3A11 A;  4J00 A;  4UB6 C;  2Q00 A;  1YQA A;  2KZV A;  3HTS B;  2DA5 A;  3DPU A;  2VQL A;  2JA2 A;  2EFN A;  2QTV A;  3FXQ A;  3FX3 A;  1T98 A;  4P96 A;  4E7J A;  3PIO F;  2DO7 A;  5TJJ A;  3BTJ A;  3SDB A;  2HQN A;  2VJJ A;  4I99 C;  1USS A;  3MZH A;  1WGW A;  4GO1 A;  3K2Z A;  3R6S A;  1QBJ A;  3GFI A;  3L2Q A;  2FE3 A;  1M2O A;  4J7Y A;  2CFX A;  2CUE A;  2OCC C;  3KYJ A;  1B72 A;  4HFF B;  3LEV A;  3C1D A;  4UY8 I;  1LFU P;  4ITV A;  3OYN A;  3EH1 A;  4GXO A;  3EZH A;  3IQ5 A;  1DPR A;  4IWB A;  3OS0 A;  2ZJR F;  4PAC A;  2CWE A;  1D8J A;  4YIR X;  2D45 A;  1YJN I;  1UMQ A;  3HPH A;  4E70 A;  1NU9 C;  1Z3I X;  2IGK A;  3LS0 A;  5FKL A;  3H9J A;  2GXG A;  2K86 A;  2D1V A;  2Y0S A;  5L3G A;  4JOM A;  1V5F A;  3F8C A;  3OMY A;  2H8A A;  1OKR A;  3T6B A;  4IXA A;  1Z77 A;  3I54 A;  4Q4Z F;  2EV0 A;  3Q5F A;  2MC3 A;  4EM1 A;  2OUM A;  4XLP F;  4A3K J;  3S3O A;  4BG0 A;  2Z3Y A;  3BZK A;  2XS8 A;  2TRT A;  3F72 A;  3G71 I;  4EGZ A;  4IF4 A;  2ETS A;  4KIF A;  1OQC A;  3EZI A;  1JOG A;  1OXB A;  4JJF A;  1I6X A;  4MNU A;  4BJ5 C;  3VRC A;  5HS9 A;  2XB5 A;  3CC2 I;  1F36 A;  2IPQ X;  3A02 A;  5IY5 C;  4A3C J;  1CPQ A;  2JSP A;  3CC4 I;  2VOD A;  2Q7R A;  1ZKG A;  2IS6 A;  1RC9 A;  2F5C A;  1GV2 A;  3ZOB A;  1A41 A;  3DQV C;  4CCK A;  4MVU A;  3KLN A;  1LPQ A;  4RS8 A;  1XDU A;  3LSP A;  3CQZ J;  3AGT A;  4MO7 A;  2DT5 A;  4M6V A;  2A05 A;  5CVV A;  5E3L A;  2DMT A;  3E70 C;  2P0W A;  2HFI A;  5HNH A;  5D5V B;  4MVQ A;  2HOT A;  1J8Y F;  2CG4 A;  5L0C A;  1JUS A;  1OCT C;  3LSR A;  3U21 A;  3V7R A;  1IGN A;  3T9O A;  4E18 A;  1ZG5 A;  2HPI A;  1DU0 A;  2OJE D;  3B6A A;  4U0Y A;  3DJU B;  5E3A A;  4S05 A;  2HOS A;  4OMZ A;  2UUH A;  3ASO C;  1MBG A;  3TD7 A;  1KTM A;  5FKM A;  3BR2 A;  2GXB A;  1S7A A;  2M7A A;  2NS0 A;  1MJ9 A;  3BG7 A;  3DF8 A;  3FXH A;  4M74 A;  1Q0G A;  1K4S A;  4NBQ A;  2M9H A;  2RQQ A;  2K4B A;  3MVP A;  3GF2 A;  3WU2 C;  1Y6I A;  3QZC A;  2EIJ C;  4Q5S F;  2VC9 A;  2A0B A;  4E4H A;  4PJL A;  1C17 M;  1WN0 A;  2HQR A;  2ID6 A;  1BIA A;  4RAY A;  2HMZ A;  4HBL A;  4MTD A;  5DUI A;  2L6G A;  5FKK A;  2KJG A;  3TOL A;  4B6I A;  1QSP A;  1A7D A;  3AG1 C;  3IEE A;  4JCH A;  3OYJ A;  1ZLJ A;  1TW2 A;  3SYT A;  2IM8 A;  3ATP A;  4KIB A;  4BGD A;  3EHM A;  1IW7 F;  3X2Q H;  4GDF A;  2Y9Y A;  1U78 A;  4RAZ A;  1GVD A;  1KON A;  1ORY A;  2B0H A;  2FNP A;  3J7A Y;  2CQK A;  2WAQ A;  2Y3H A;  1PCX A;  3LS1 A;  2V1N A;  2PMZ A;  2O8X A;  3HGY A;  1YIO A;  4GYG A;  1UCR A;  4HAM A;  3AJM A;  2E35 A;  3IH2 A;  4UB8 C;  4ESJ A;  4E17 A;  1W4M A;  3W2W A;  1T01 A;  2AXT C;  3M7G A;  1PDN C;  5E3N A;  2W4M A;  4AL1 A;  2Y69 H;  2XLO A;  4XTK A;  1D0Y A;  4LMY A;  2G7U A;  1QHH D;  2YR2 A;  5JI6 A;  2LFF A;  3TJ5 A;  4XSZ F;  3FZV A;  3GAN A;  3F6V A;  3LWF A;  3WTZ A;  3HOT A;  3IQT A;  1V4R A;  1GXQ A;  3V5Z A;  4WK8 F;  5EGO B;  1Z05 A;  3K1N A;  3RPQ A;  2MA3 A;  3I4N J;  1WCM J;  4QI2 A;  2VAS A;  2AU5 A;  3DMD A;  5F04 A;  4BJ5 A;  2Q3T A;  3CCS I;  1QQ3 A;  3JRE A;  3I71 A;  3AKZ A;  2E5Z A;  1TFO B;  4B3X A;  2DOE A;  2FBI A;  3WHC A;  4ZYH A;  3ZG1 A;  4ZYD A;  1LQ1 A;  4C2M J;  3IH3 A;  1YLF A;  2NNN A;  4C7O A;  1SZI A;  4ABZ A;  4L9N A;  3DPT A;  3I0T A;  4DYC A;  1XTA A;  5LHG A;  5M3M J;  1OCO H;  3E6M A;  4IQ4 A;  2EIM C;  2LK4 A;  4CZZ A;  4A0Y A;  4X0R A;  4CDA A;  3O6B B;  4CS8 A;  2FBH A;  1V3F A;  3ZMD A;  4N9I A;  3IWF A;  3OYI A;  4LDR A;  1IXC A;  1D5Y A;  2A6T A;  4BQA A;  3E0J B;  4W97 A;  4H4K C;  4X0G A;  5IT9 K;  3V5Y A;  1G8X A;  4D1Q A;  4AE4 B;  2VBX A;  2HPM A;  3S90 A;  3S16 J;  2EQR A;  3WU1 B;  3SXM A;  4IHW A;  1XMK A;  1ZHW A;  3D5R C;  1SF8 A;  1U9N A;  2LP0 A;  1Y8Q B;  2YHS A;  5DV5 A;  2PI0 A;  1QRY A;  5BQG A;  5EGO A;  1FNN A;  3H3U A;  3PNT A;  5FB2 A;  1LE8 B;  3M1E A;  2L0K A;  3U1K A;  2CV2 A;  1ETY A;  2EPK X;  2K9L A;  2DT7 B;  2V9V A;  2CQ7 A;  2IA0 A;  1TWH A;  2DPD A;  4XR6 A;  3LFK A;  2GFH A;  4QSH A;  3MKY B;  2YPR A;  4ASN A;  2M5W A;  4MTG A;  1VF9 A;  2XLD A;  4U7D A;  1HMD A;  3RF3 A;  1SD7 A;  4OU0 A;  2XRO A;  3KP5 A;  2MW8 A;  5CJ9 A;  2KQR A;  3U2R A;  3ZGK A;  1G4D A;  1MNM C;  4O6N A;  4RGR A;  1TFK B;  5LGT A;  3U2M A;  2VQH A;  3E6C C;  4A3I J;  1R71 A;  1VQ8 I;  1FLI A;  1P6R A;  2HJ3 A;  2VH3 A;  2DYS H;  5J1R A;  3Q6N A;  4AE4 A;  2JX0 A;  1TWA J;  1U5T C;  4UHT A;  2RV8 A;  2BVM A;  4MFE A;  2J7P D;  3REO A;  2L2O A;  2HEO A;  2GWW A;  1GS9 A;  3OS1 A;  1PP7 U;  1SFO J;  1LE8 A;  2Y75 A;  1A6I A;  4HEA 2;  2XS1 A;  1WAS A;  3DU6 A;  2ME6 A;  1O7F A;  3OR2 C;  2WZF A;  1E3H A;  3T4R A;  1ZYR F;  2DA2 A;  3K4J A;  3P9I A;  1ORK A;  3V7S A;  4HF2 A;  1G4W R;  1OR7 A;  1OQY A;  3IPM O;  2W57 A;  1JR8 A;  2LSE A;  3ZVR A;  3B0U X;  2GDC A;  1HW1 A;  4CIC A;  4A3M J;  2LF7 A;  4DVZ A;  3WTV C;  2Q1Z B;  1QVU A;  1BC8 C;  3GTQ J;  5D91 A;  4CCM A;  2UUI A;  3OSF A;  4W8K A;  4YT4 A;  3AG2 C;  4AYB N;  4PSW A;  4CXF A;  2F4M B;  3VYT B;  1IN7 A;  3GTL J;  5IYC J;  3NYJ A;  4ULW A;  3FMS A;  4CS9 C;  2BEO A;  1N25 A;  1LEB A;  2J0W A;  1ON2 A;  1LI5 A;  4ZYE A;  2GLO A;  3J80 K;  1RZ4 A;  2ZCW A;  3O8G A;  4CS7 A;  1RET A;  1ORS C;  1XS9 A;  5J1Y A;  1FIA A;  2LC2 A;  4MTO A;  2VC0 A;  2JA7 J;  3BRJ A;  4JK1 X;  1D8K A;  1TLH B;  1WHU A;  2XGE A;  1TNT A;  2WY8 Q;  4XIC A;  4G94 A;  4CDV A;  2RQP A;  4HG2 A;  3K6G A;  1WPK A;  3LA2 A;  1P7J A;  3GXO A;  4B48 A;  4D5C A;  2R92 J;  5D4S A;  4CCO A;  2B0L A;  1WKM A;  5C44 J;  3I4P A;  4M9X A;  2CDQ A;  2Q8K A;  2PFD A;  2PBI A;  1FOY A;  2A5Y B;  5GP9 A;  3CCJ I;  4HRI A;  3CF2 A;  2VCB A;  3QPL A;  3K4L A;  1EI7 A;  5BNG A;  4JP0 A;  3L2R A;  4NC7 A;  1W36 D;  4BNC A;  3V5X A;  4HA8 A;  1X1D A;  3DTI A;  1LE4 A;  4YEL A;  2XLH A;  2XXA B;  3ZQC A;  4KIS A;  1OLT A;  4B44 A;  1Y1V J;  2BYV E;  1KYW A;  3HOS A;  4FCY A;  1WI9 A;  3H5R A;  2Q2E B;  2E2H J;  1ZEL A;  3RIP A;  4GQH A;  1KU9 A;  2VIX A;  2K5C A;  2CUF A;  5FKO A;  5BQT A;  3FWE A;  2I8D A;  2NRA C;  4D5F A;  3K7A J;  4E7Z A;  2JD3 A;  5JLI A;  3Q0U A;  1I4Y A;  1M57 C;  3EUA A;  2OCE A;  1OYI A;  1SEU A;  4NTA A;  1XCV A;  4XID A;  2KKO A;  2PMU A;  3CME I;  4CBE A;  2XAQ A;  1UFB A;  4U5E E;  2DAO A;  1XG1 A;  2D2W A;  3S0X A;  1WVR A;  4LIV A;  1N77 A;  3GEZ A;  2V26 A;  3K2A A;  4KMF A;  1SVL A;  4EVI A;  2E2I J;  1T33 A;  1U5T A;  1X1A A;  4XN0 A;  2NVQ J;  3NYM A;  4U5C E;  4HFK B;  1HY5 A;  4XOR A;  1TQI A;  5LRR A;  3PO2 J;  3RTR A;  2HZD A;  4XPX A;  3R60 A;  3RYL A;  2EFP A;  5T1D B;  4JQF A;  4RLQ A;  3TOA A;  5E2Q A;  2HZ8 A;  3ZMT A;  3U1D A;  1TQM A;  2BY3 A;  2LNB A;  3D1N I;  2CV0 A;  4B47 A;  4FIS A;  3CAX A;  2IGN A;  2XUB A;  3MMY B;  1E84 A;  3CCY A;  3VF0 A;  3F8B A;  3C3W A;  5KCM A;  4JEA A;  1K40 A;  1ZN2 A;  1KNY A;  2R7O A;  3HSF A;  2X6W A;  1FFT C;  1H6G A;  2ZXP A;  1WAT A;  4BQO A;  5DTD A;  2X0L A;  3FXU A;  3F23 A;  2NXN B;  3V8K A;  1B4A A;  4CS9 A;  2G7H A;  2CU7 A;  1Y0N A;  2Y2Z A;  3BJ6 A;  4JX6 A;  4YWQ A;  1A5J A;  2EFQ A;  1BR2 A;  2K02 A;  4CIH A;  4UV8 A;  4HQE A;  4U9E A;  4A0Z A;  3BLY A;  2O03 A;  4C30 A;  2MGQ A;  2FAP B;  4M3D A;  3BY6 A;  4HV5 A;  5J1U A;  2Y48 A;  5E3O A;  1H7I A;  4M63 A;  5LHH A;  3ZTM A;  3HXL A;  4J01 A;  1PUF B;  4C3I J;  4QIW N;  1QVX A;  5GPG B;  1OYW A;  2MWQ A;  2O3F A;  4UVC A;  3JRT A;  5B1B H;  4RB3 C;  2O8K A;  2FQ3 A;  2E36 A;  4IHT A;  4BBS J;  5L3B A;  2HDC A;  2ZXH A;  3CDI A;  5KHD A;  4O3M A;  5EZH A;  3DLA A;  4QWQ A;  3JW4 A;  1RKE B;  3UMI A;  4RAF A;  1Q1H A;  1KU3 A;  2NOG A;  2YL3 A;  2BE5 F;  4LDQ A;  4QPQ A;  3HHH A;  4A2U A;  3GVA A;  3AL0 C;  1BW6 A;  2MG4 A;  2X6Y A;  2QY9 A;  3CJQ B;  1V54 H;  2NSF A;  3B0P A;  3ITF A;  2LOO A;  5K1Y A;  3LLI A;  1WQ2 A;  5D6F A;  3I4M J;  4KBL A;  1ULY A;  3AOU A;  2L4A A;  1QLE C;  3DKW A;  2O9L A;  3RQI A;  1LM3 B;  3HL2 A;  2DGJ A;  3AG3 C;  3F6O A;  1PUF A;  2OG2 A;  2W45 A;  1IG7 A;  4JUR I;  1GGQ A;  2QKM B;  4CSW A;  1DDN A;  4RB1 A;  2HQA A;  1RJ9 B;  4I1M A;  2N8G A;  3QYB A;  2J5O A;  2IVM A;  4D7N A;  1LPE A;  3H5N A;  2WAE A;  2VJ4 A;  1SVM A;  3IRR A;  3OYF A;  1G6N A;  2LSO A;  4A2N B;  4BAC A;  2QSH X;  2H7B A;  2HDW A;  2QZ8 A;  3TO6 A;  3FXL A;  3S14 J;  1V55 C;  3GCM A;  4XNF A;  2JN6 A;  1H0M A;  4OD4 A;  3UMK A;  3ZC4 A;  2L7A A;  1IDY A;  5LLQ A;  3DEW A;  1SFU A;  1W7P A;  2XAF A;  3UNG C;  3GLL A;  3HTU A;  2KYH A;  1Z0X A;  3SEZ A;  2D5V A;  2E7W A;  2IXS A;  1FBU A;  2ZXW H;  4CCN A;  4XLA A;  2NVT J;  3MWM A;  3ASN H;  5H20 A;  1AWC A;  3WTS C;  4WCG A;  1RXQ A;  2R5Y B;  4RM2 A;  1XGS A;  3HJC A;  4Z9I A;  3PUF A;  2MHR A;  2PQ8 A;  2GOM A;  2PFB A;  1Z3X A;  2ZBK A;  4B43 A;  4IAO A;  3FXJ A;  4PGG A;  2VLA A;  1LS4 A;  2A3S A;  1D0X A;  1J8M F;  1KA8 A;  2DW4 A;  1RJ9 A;  4I02 A;  3FVY A;  1YI2 I;  3GOR A;  5FO5 A;  4MTF A;  4CO8 A;  4RAG A;  1Y0U A;  4IGG A;  4ENK A;  3FKJ A;  3E6D A;  1FSE A;  2R7D A;  3HRT A;  2HYG D;  4RGS A;  4Y17 A;  1PVE A;  1VQL I;  5CVU A;  1OCZ H;  4KJZ A;  1DOW A;  1K05 A;  1ETK A;  2Q4F A;  1Z5Z A;  3L9F A;  3TDU C;  2A68 F;  1FBQ A;  1J0R A;  4Y7N J;  1NLX A;  1RUN A;  3SZP A;  2LRE A;  4G8X A;  4M9Z A;  3CMY A;  1NSG B;  3AQB A;  3TJ6 A;  5HLH A;  1OCR C;  3GLX A;  2R5Y A;  3QVZ A;  1MH4 A;  2KW3 C;  4A6E A;  4BY7 J;  4BEM J;  2DU9 A;  2H27 A;  2CW8 A;  3WG9 A;  4DIQ A;  1A31 A;  1AEP A;  4UXN A;  3K1H A;  5F27 A;  4BS9 A;  2LFB A;  2Y3B A;  3R61 A;  2H09 A;  3KP4 A;  5EG0 B;  4GYT A;  1ETX A;  3C8G D;  1PP8 F;  3BR0 A;  3GO5 A;  3ZQH A;  5K5R A;  4M72 A;  4ONS A;  1HA8 A;  5E1X A;  4F3Q A;  4AVZ A;  4ZLC A;  3D0S A;  5IP7 J;  2V7F A;  3LAY A;  3BZC A;  2AVK A;  2WAD A;  4N6C A;  4H0E A;  3RIR A;  3U5S A;  4IOC F;  2DT6 A;  1MMA A;  2FXA A;  1NTC A;  2LD5 A;  1OYY A;  3GWL A;  1PD1 A;  3CCU I;  2IJL A;  1S8N A;  5KAI C;  3OYK A;  3GTM J;  5BMZ A;  1I27 A;  3T8R A;  1W5T A;  1AKH B;  2HSQ A;  3W8I A;  3CC7 I;  1GQA A;  2O61 A;  3LLK A;  1XCB A;  2I10 A;  1NU7 D;  2E19 A;  4U5F E;  2V1U A;  4EJW A;  1XZQ A;  2H7V C;  1M1E B;  2JWT A;  1IUF A;  3HNL A;  1IZ1 A;  2L54 A;  1MZB A;  3J7Z I;  1IJW C;  1YYJ A;  4ZYA A;  5JVG F;  3OYE A;  3LSJ A;  2FML A;  4XOP A;  1DGW Y;  5JLW A;  1JPJ A;  4BJT A;  2CNW D;  2TCT A;  3JT1 A;  5E20 A;  4FAP B;  1VB5 A;  3UR3 C;  1FPQ A;  2W84 A;  2ZME C;  1QU3 A;  2BOL A;  2ASR A;  2X9D A;  3SHF A;  2R9R B;  1YG2 A;  4OIP F;  3G4S I;  1UAA A;  3CP2 A;  4NCQ A;  3I58 A;  3BJO A;  2V6E A;  2IXN A;  4JE9 A;  4A5N A;  1E17 A;  4DJA A;  1ZHY A;  4KNY A;  2Y31 A;  2BY2 A;  4EWC A;  1X2N A;  2XGD A;  4BE0 A;  3VFZ A;  2G62 A;  3WTY C;  1LVA A;  1YIJ I;  2KMU A;  2CS3 A;  4YL0 A;  2XF7 A;  1JGG A;  1R9T J;  1U3E M;  4HF1 A;  2VKV A;  5F5F A;  1VQ6 I;  4ZDO A;  1LDJ A;  1FTT A;  5B3S C;  1MMD A;  5EHH A;  4K2E A;  5B1A H;  1BIB A;  1ZRF A;  4LLL A;  2Z33 A;  3K4C A;  2NVU B;  2EFO A;  3O39 A;  3FM3 A;  4ZDL A; 
#chains in the Genus database with same CATH homology
 2M7B A;  5IY5 C;  3PSF A;  2JSP A;  2K3P A;  3KYL A;  3OYA A;  2IS6 A;  1OCO C;  1WFX A;  3EQL F;  1W36 C;  5EGY A;  1X1B A;  2BVL A;  2E1M C;  3K4K A;  5HOO A;  4IKF A;  3DQV C;  4CCK A;  3HKZ A;  4HNT A;  2A6E F;  2XAU A;  3CZ6 A;  3EPZ A;  2M0M A;  4BJ1 A;  3E70 C;  2VB6 A;  2P0W A;  3B9Q A;  5HNH A;  1J8Y F;  3QYE A;  4FAS D;  4G0H A;  1EA3 A;  3FDY A;  2Y39 A;  4NUB A;  3C2G A;  3S32 A;  4DGW B;  3OL3 A;  2IS1 A;  1YX3 A;  3U21 A;  1O87 A;  3ZRG A;  3DD7 A;  2HPI A;  1M2V B;  3DJU B;  5E3A A;  2VJ5 A;  3BC8 A;  2L7K A;  5KYY A;  3N05 A;  3DKY A;  3ASO C;  3TD7 A;  2V3C C;  4GEH A;  3OYM A;  4BDZ A;  3B0V C;  2M7A A;  1ZHX A;  3BG7 A;  3DZA A;  2ELJ A;  2MAB A;  3L2U A;  3E9V A;  4D9J A;  3CQZ A;  2RQQ A;  4LLE A;  4BDY A;  5DS5 A;  2NUP B;  1Y6I A;  2XRH A;  1S7Z A;  1WJF A;  3PUB A;  4HNU A;  3MKW B;  2EIJ C;  5LFA A;  2LY2 A;  2IS4 A;  3BG6 A;  2UV1 A;  4E4H A;  3JYH A;  5B1B C;  3DWL E;  4PJL A;  1D1A A;  4XLE A;  1G59 A;  1VYI A;  3IP4 B;  1Z23 A;  2XSE A;  3IAM 2;  2O5R A;  2DYS C;  2CMP A;  1FFH A;  2GOX B;  1FTS A;  2KJG A;  3EJN A;  3NKE A;  4B6I A;  5L3Q A;  2FUG 2;  3AG1 C;  3IEE A;  4JCH A;  4YN0 B;  3OYJ A;  4N06 A;  3SYT A;  2R7W A;  1Z21 A;  4U5H A;  4BGD A;  2LY1 A;  3EHM A;  3PL8 A;  1IW7 F;  1PD0 A;  2CUJ A;  5E3C A;  2X1E A;  1KON A;  3DM9 B;  3UGP A;  3W2A A;  3J7A Y;  5CI8 A;  3TL4 X;  4C7O A;  1TWG A;  3QYF A;  2WAQ A;  1DGR M;  1M2V A;  1PCX A;  2C04 A;  4XLH A;  2HV7 A;  2Y3H A;  3KL4 A;  2V1N A;  2PMZ A;  3LS1 A;  4RDA A;  1N78 A;  2KQ9 A;  5DVW A;  4EBB A;  1GLN A;  3D5L A;  2E1M B;  5FRN A;  5T3W A;  3W2W A;  2RRE A;  3RQ4 A;  2K9M A;  3A1Y A;  2W4M A;  3AG4 C;  4ANJ A;  2NG1 A;  4XTK A;  2NUP A;  1D0Y A;  4XLF A;  4XKV A;  3VYR B;  1ERD A;  5DS6 A;  1QHH D;  2KLO A;  3FBN B;  4XON A;  3GAN A;  2D5R B;  3HOT A;  4MQ9 F;  4AU7 A;  1LDK B;  4FWV A;  3CSK A;  3OYC A;  4PUS A;  1UG0 A;  3K7D A;  1DP3 A;  4IJJ A;  2HV6 A;  3TMO A;  2L9J A;  4RBN A;  2W9Y A;  4QI2 A;  2VAS A;  4G7O F;  3LSM A;  3DMD A;  3EGD A;  3ABM C;  4BJ5 A;  2DCE A;  3EUH C;  2Q3T A;  2M3A A;  2F4I A;  2E5Z A;  2Z16 A;  2ZSH B;  4B3X A;  1PYV A;  3AKZ A;  5LD2 C;  4FES A;  2A69 F;  2VKD A;  2PJR B;  2KL4 A;  4OAY A;  3PJR A;  2WB7 A;  2M4K A;  2WZL A;  3ZG1 A;  4F55 A;  3CP8 A;  4PJM A;  4BQQ A;  1LKX A;  2Q9A A;  2VXZ A;  1SZI A;  2WVQ A;  3DPT A;  2EIM C;  4KNW A;  5DLJ A;  3FBI B;  3A2K A;  1P9Q C;  1YE9 A;  4IQ4 A;  2A5W A;  3TBI A;  4BUP A;  1LS1 A;  4U5G A;  4X0R A;  3H5A A;  3S8P A;  4CS8 A;  3OA1 A;  1Z7L A;  3OYD A;  4XM3 A;  4DOZ A;  4LG3 A;  2KPM A;  3KEY A;  3QOE A;  3OYI A;  2A6T A;  2NUT A;  3E0J B;  3PNY A;  4H4K C;  4U87 A;  4X0G A;  5L3V A;  5CQE A;  4ZLD A;  1G8X A;  2G3V A;  4D1Q A;  3HG9 A;  1BOB A;  4XQF A;  3NYL A;  2HPM A;  3MX3 A;  2HVS A;  4BL0 B;  4AE4 B;  5DQT A;  1ZHW A;  4MLO A;  3D5R C;  4PK4 A;  1SF8 A;  4PFO A;  2YHS A;  3M1C B;  4C3B A;  3K10 A;  1AA7 A;  2CW0 F;  3PNT A;  1WJC A;  4YT2 A;  3ZR8 X;  3OYL A;  3CES A;  1IZM A;  2LRD A;  2WVN A;  4P1W A;  3SZG A;  2CV2 A;  2NUT B;  3HTK C;  2K9L A;  2DT7 B;  3UGO A;  1PJR A;  4E7I A;  1TWH A;  4XR6 A;  2GFH A;  3H0D A;  1KU2 A;  4XKW A;  3O6X A;  3PHF 2;  3MKY B;  4BJ6 C;  4O6M A;  5CI9 A;  4G6T B;  2PJR A;  2EIN C;  1OCZ C;  4O79 A;  3ECS A;  3HUG B;  3OIQ A;  1BR4 A;  2KQR A;  3ZGK A;  2LH9 A;  2ZXI A;  2HVR A;  4O6N A;  3DTE A;  1D1C A;  2FGY A;  4YT5 A;  1WJA A;  2C03 A;  2VQH A;  4BQN A;  1SFK A;  2VH3 A;  4AE4 A;  2J46 A;  3Q6N A;  5KYW B;  4CA0 A;  4NC8 A;  4G7Z F;  4AYB A;  3L2W A;  2HNH A;  3CMM A;  2XL4 A;  2X51 A;  4XWJ A;  3G2B A;  4PFP A;  3DM5 A;  3LES A;  2R7U A;  4OIO F;  3WOD F;  2BVM A;  3RCO A;  2J7P D;  2L2O A;  2WL8 A;  4XLN F;  4BU2 A;  3OS1 A;  3NWT A;  3OR1 C;  4HEA 2;  1DQU A;  2AQF A;  4Y4R A;  3S3M A;  2IGO A;  3DU6 A;  4P5O A;  1NG6 A;  4PSX A;  1E0E A;  3OR2 C;  1VYK A;  2PF4 E;  1YX5 A;  2MC4 A;  2WZF A;  2KGO A;  3T4R A;  3EFO A;  4AX2 A;  1ZYR F;  3K4J A;  2DOA A;  5KYU B;  5TGT A;  3HC7 A;  3VSK A;  3PSI A;  2LSE A;  2IS2 A;  3ZVR A;  3B0U X;  4DVZ A;  1BR1 A;  4N4O B;  1MMN A;  2CFO A;  3K4M A;  4FET A;  4XKC A;  3OS2 A;  3K70 C;  2Q1Z B;  1VMA A;  1ZHZ A;  3LEV A;  1VK5 A;  2PX0 A;  2G3K A;  4CCM A;  2E87 A;  5D91 A;  4W8K A;  4XKB A;  1TWA A;  2H7O A;  3AG2 C;  4O7G A;  4YT4 A;  4Y3O A;  4PSW A;  1Z63 A;  3VYT B;  2IOQ A;  3NYJ A;  2W4B A;  2Z2S B;  4ULW A;  1SAU A;  3H9G A;  2IXP A;  4CS9 C;  4CH7 A;  2FFH A;  3I3L A;  3EG9 B;  5KYW A;  2J0W A;  3OIP A;  3W8H A;  4KT6 A;  2XF5 A;  4C9Y A;  4C3E A;  4CS7 A;  4DVY P;  2ZFU A;  3OEO A;  4F52 A;  2X1C A;  4Q5S F;  3VSL A;  2A6H F;  2LC2 A;  2HVQ A;  3KMI A;  3VAY A;  1NZE A;  3GBG A;  3I4U A;  2LG4 A;  2OC6 A;  2L9S A;  4E6K G;  2L81 A;  2WY8 Q;  4BXF A;  4LIU A;  4HG2 A;  3K6G A;  4K0D A;  5KYU A;  1NG1 A;  4BE1 A;  4FX5 A;  3K4B A;  4B48 A;  2LBF B;  3BCA A;  3K4N A;  3SEQ A;  4RD9 A;  4CCO A;  3EGX B;  1V5E A;  4HSR A;  4QDL A;  3D5S C;  4CS8 C;  2CGE A;  1OKK A;  2CDQ A;  4BE2 A;  3JCU Q;  3S29 A;  2PFD A;  3IAS 2;  2KP6 A;  4HRI A;  3CF2 A;  2F6C A;  2KDO A;  4OAZ A;  3UMH A;  1V54 C;  3K4L A;  3LNR A;  3AL0 B;  2J9W A;  2VJI A;  3L2R A;  1W36 D;  4NC7 A;  3EG9 A;  4ZTJ A;  2YEV A;  1X1D A;  3DTI A;  3POV A;  4YEL A;  2F5V A;  2WVO A;  2XXA B;  3KX2 A;  4KIS A;  1OLT A;  1OR7 C;  4B44 A;  1TR2 A;  1MND A;  3HOS A;  4XOT A;  3MKZ A;  5DQZ A;  3H5R A;  2Q2E B;  2W7N A;  1ZEL A;  3RIP A;  4E7K A;  2YZS A;  2VIX A;  3K33 A;  4BJ6 A;  2R7V A;  2K5C A;  3DEE A;  5B1A C;  4ZJZ A;  4LER A;  1FMW A;  4C3D A;  4JJG A;  2I8D A;  2J9V A;  3GOD A;  2JD3 A;  4E7Z A;  3L34 A;  3W2V A;  4F92 B;  2R4G A;  1M57 C;  3EUA A;  3H9Q A;  2B0J A;  2J9U A;  5HVQ C;  3Q7L A;  4CBE A;  1NG7 A;  3EGX A;  4U5E E;  2CW7 A;  1R6R A;  2VPL A;  4N4N B;  4J30 B;  3S0X A;  3QOD A;  2V9K A;  4LIV A;  1N77 A;  2DYR C;  2V26 A;  4YT8 A;  3ZQQ A;  4K7B A;  4OIR F;  2J0X A;  3T6J A;  3LFU A;  1X1A A;  4XN0 A;  3W3C A;  3NYM A;  4U5C E;  4HFK B;  5KNL A;  4XOR A;  2Q9B A;  3LSG A;  2WA0 A;  4GRI A;  3RTR A;  2BW3 B;  2W1O A;  2HZD A;  4E7H A;  3ABL C;  1FMV A;  1T95 A;  2A1D D;  3DAF A;  4HEA J;  4J32 B;  2ZXW C;  3RYL A;  5T1D B;  4JQF A;  4RLQ A;  3ASN C;  5E2Q A;  3NDB B;  2CV0 A;  2PX3 A;  3LSI A;  1S9H A;  1TT0 A;  4LIT A;  2WAF A;  4B47 A;  3V7O A;  2IGN A;  5FRM A;  3MMY B;  4LAC B;  5KCM A;  3ZCO A;  1WJE A;  3QMK A;  2R7O A;  2X6W A;  5CKT A;  1FFT C;  1TKN A;  1VOM A;  2EIK C;  1TZL A;  2VQC A;  4BQO A;  3RPU D;  2R7R A;  2ZXP A;  4F4B A;  5CQG A;  5HLT A;  2Z15 A;  2ZSI B;  3ZSU A;  1WJ5 A;  2UWM A;  1X4P A;  3LMM A;  1OCC C;  3N0T A;  3S28 A;  4CS9 A;  2WB1 A;  1SMY F;  1O5H A;  1MW7 A;  4YWQ A;  1BR2 A;  4CIH A;  5JHF A;  3BLY A;  4C30 A;  4CUG A;  4Q7C A;  2Y3G A;  4M63 A;  3LSH A;  2R7X A;  3OOU A;  2W4S A;  3DJN B;  3HXL A;  3DTK A;  2ZPA A;  4J01 A;  2NOJ B;  4BEH B;  3PMR A;  4E7S A;  2MWQ A;  3ABK C;  3Q7G A;  2EIL C;  3JRT A;  1LVK A;  4O6Y A;  2VXD A;  3FHN A;  3PFY A;  2ZXH A;  4U5B E;  1X19 A;  2XSJ C;  5KHD A;  3X1O A;  2X1D A;  3DLA A;  3UMI A;  4PJN A;  3L0I A;  3SZR A;  4CZC A;  3DXJ F;  3LJB A;  3F9K A;  4NQW B;  2IYL D;  1ZHT A;  4NNJ A;  4CSA C;  1V5G A;  2BE5 F;  3M1C A;  4QPQ A;  4R79 A;  3AL0 C;  3QZC A;  2X6Y A;  2J45 A;  2P7V A;  3VYS B;  3NWS A;  3K66 A;  2QY9 A;  3IUO A;  4JVS A;  2MD0 A;  3CJQ B;  3B0P A;  1M56 C;  2LOO A;  4XLC A;  4KIT B;  3EUK L;  3ITF A;  3LLI A;  3NG1 A;  1J09 A;  5D92 A;  4KBL A;  2P6V A;  1QLE C;  3DKX A;  1QHG A;  4MND A;  3HL2 A;  1ZU4 A;  2DGJ A;  3AG3 C;  2E5N A;  3LL7 A;  4BEH A;  2OG2 A;  4II2 A;  2W45 A;  3DAG A;  4JUR I;  4KNV A;  1Y56 A;  5KYY B;  1JPN A;  2QKM B;  3S3N A;  4JZA A;  4CSW A;  3WG7 C;  2CNW A;  2JVG A;  4E7L A;  4AK9 A;  1UEL B;  2HQA A;  1LFP A;  1RJ9 B;  4I1M A;  3QYB A;  2VKH A;  3AFH A;  3I9V 2;  2Y3D A;  4OWR B;  4ZTF A;  3H5N A;  2WAE A;  2VJ4 A;  2M4E A;  3OYF A;  4A2N B;  4IRU A;  4BAC A;  1D1B A;  2V4J C;  2Z1D A;  2IGM A;  2HDW A;  2H7B A;  2I8B A;  1V55 C;  3VDX A;  4IQJ A;  3FHD A;  1VZ0 A;  4XNF A;  4IZZ A;  3I5Q A;  1D0Z A;  4I3M A;  4OD4 A;  3F47 A;  5T3T A;  3UMK A;  3ZC4 A;  5HSW A;  1N75 A;  2MYS A;  2XF6 A;  3E1S A;  3S27 A;  3MD2 A;  3UNG C;  5KYX B;  3MLG A;  5BUO A;  1T0F C;  2JVH A;  3SEZ A;  2IXS A;  2W82 A;  3M8J A;  4EAT A;  4CCN A;  4XLA A;  2IXM A;  3VWB A;  3KKB A;  4KI2 A;  3V42 A;  4QPO A;  3FAJ A;  3HJC A;  4RM2 A;  1Z3Y A;  3HLZ A;  3N24 A;  2GOM A;  1IRX A;  2KRC A;  2R7Q A;  4IAO A;  1Z3X A;  4B43 A;  3S93 A;  2VLA A;  3C2H A;  1D0X A;  1J8M F;  1RJ9 A;  3EH2 A;  2JUG A;  2L5Q A;  2Q9C A;  3FVY A;  2CH0 A;  2VL8 A;  4RM3 A;  2IXO A;  2J7P A;  3K1I C;  4OD5 A;  4YJW A;  2WY7 Q;  3FKJ A;  4G7H F;  2E60 A;  5FRO A;  2VQG A;  4IX7 A;  3ZIB A;  4WJ0 A;  1WJB A;  4PJJ A;  3K70 D;  1K6Y A;  5KYN A;  2R7S A;  3SNH A;  4KJZ A;  2AQE A;  4F91 B;  1Z5Z A;  2A68 F;  2WBM A;  3HPG A;  3EGD B;  1U0J A;  3NKD A;  5KYX A;  3RFY A;  5HNF A;  4U7B A;  4CCL A;  1JI8 A;  4HE8 D;  3NRH A;  4KC9 A;  2LRE A;  2LBF A;  4II3 A;  3AQB A;  2L9N A;  1OCR C;  2CUZ A;  2CV1 A;  3OL4 A;  4Y33 A;  2KW3 C;  3SYN A;  3DPL C;  3SP1 A;  4C7O B;  4DBQ A;  4ZDP A;  4DBR A;  4F93 B;  2CW8 A;  4RLF A;  4DIQ A;  1WJD A;  3OYB A;  1TWC A;  4HST A;  3K1H A;  4BS9 A;  4CCJ A;  1QZX A;  2Y3B A;  2R7T A;  2UUZ A;  3I5P A;  4U5D E;  4CSA A;  4I1O B;  3CJR B;  4C2U A;  4C2T A;  1N1C A;  4GYT A;  3SEO A;  3K6B A;  2MFZ A;  2XXA A;  2ZXR A;  1ZU5 A;  5E33 A;  4HPQ A;  3OYG A;  2O9X A;  3PNV A;  1HA8 A;  2XDV A;  4F3Q A;  4NY3 A;  4AVZ A;  3KH2 A;  4OIN F;  4ZLC A;  3JSZ A;  2V7F A;  3LAY A;  4I44 A;  4YRV A;  4XN3 A;  3OY9 A;  2DXI A;  5F5H A;  2X85 A;  2WAD A;  4JW1 A;  3Q6M A;  2DT6 A;  1MMA A;  3F46 A;  3BCB A;  1PD1 A;  4XL9 A;  3OYK A;  1ST6 A;  3W8I A;  3A4C A;  2HU9 A;  5DS4 A;  3LLK A;  4J00 A;  2KZV A;  4XMY A;  1NU7 D;  4U5F E;  3DPU A;  2M4G A;  2QKL B;  3RSN A;  2H7V C;  2VQL A;  2JA2 A;  3H65 A;  2WZG A;  2OV7 A;  2QTV A;  4E7J A;  4RMN A;  4ZYA A;  3SDB A;  3ZXS A;  3OYE A;  2VJJ A;  4XOP A;  1X1C A;  1DGW Y;  1JPJ A;  4BEJ A;  2RNG A;  4BJT A;  1WGW A;  2DJI A;  2CNW D;  2BW3 A;  2KNH A;  3JT1 A;  4LLC A;  3L2Q A;  3RH3 A;  3UR3 C;  3X2Q C;  1W2W A;  1M2O A;  1QU3 A;  4YEJ A;  2OCC C;  2BOL A;  4HFF B;  4ITV A;  3OYN A;  3EH1 A;  4IWB A;  3EZH A;  4OIP F;  4P6I C;  1UAA A;  3OS0 A;  3CP2 A;  2KHM A;  4QI0 A;  1X4O A;  1Z6A A;  3HPH A;  1NU9 C;  2V6E A;  1Z3I X;  3EHN A;  2IGK A;  3ONQ A;  2IXN A;  3LS0 A;  3H9J A;  3OYH A;  2XC7 A;  2Y0S A;  3EFO B;  3VYU B;  4DJA A;  4JOM A;  1V5F A;  3OMY A;  1MNE A;  1ZHY A;  2PP4 A;  2Y69 C;  3T6B A;  3LSK A;  4EWC A;  3OWT A;  4BE0 A;  2G62 A;  4Q4Z F;  4ZC3 A;  2KMU A;  2CS3 A;  2OUM A;  4XLP F;  2XF7 A;  3S3O A;  4BG0 A;  3FDQ A;  1MMG A;  5FCL A;  4OIQ F;  1OKK D;  3VYW A;  3EPV A;  5F5F A;  4ZDO A;  3EZI A;  3DU5 A;  3RKO F;  2X6X A;  5CPR B;  1MMD A;  4JJF A;  5B3S C;  5EHH A;  2ZXO A;  2KRH A;  2LYC A;  4BJ5 C;  3H35 A;  3L2V A;  3K4C A;  3AQC A;  3N2Z B;  3O39 A;  4ZDL A;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...