4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RAP1-INTERACTING FACTOR 2
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
4BJ6C 4BJ5C 3CZ6A 3K6GA 3OWTA 4BJTA
chains in the Genus database with same CATH superfamily
1X2MA 1TWCA 2GLOA 2V79A 5E3MA 3PDMP 4HX4A 2LH9A 1ZR4A 2VJIA 3I4MJ 1A7DA 3F21A 3GM3A 2FBKA 4XM3A 4M74A 1WCMJ 1TWGA 2J46A 3CLQA 1F1MA 1OCOC 1UAAA 3HOWJ 5ICGA 1XG1A 2X4HA 2QTVA 2XPUA 3P9KA 5CVIA 4PJLA 3PFYA 4LB5A 1OYIA 4WXHA 2VJ5A 4Z2YA 4FX5A 5HS9A 2KIMA 2QQBA 4AIDA 1YRNB 3WHCA 2DMNA 2J5OA 2FF4A 2PP4A 5M5WJ 3KYCB 3L2QA 2JA8J 1KA8A 5FGMA 1G3SA 4HPQA 3U5SA 3RYRA 1ZU4A 3T6JA 5E1XA 1WJEA 1LE4A 5E3NA 2IBFA 4ZJZA 4DNCA 3OYFA 4IQJA 2R3SA 1DGWY 4UNOA 3EG9B 1ZGJA 4L9VA 3TOMA 4HF1A 2M4EA 1W1WE 1BR2A 1UHSA 1JGGA 1RRJA 4WCGA 3O55A 2LKXA 4OAZA 1WTYA 5BPDA 3LAYA 3L7WA 3Q9VA 5E18F 2HQRA 1VOMA 3G2BA 4CDAA 3ZQIA 4XKVA 3DU6A 2XAGA 1CGOA 2HZDA 3OYCA 1IRFA 2QWWA 4IPAA 1EH8A 2PMZA 3KIOA 3KEYA 1T9KA 5KYYB 4QI2A 5C4JJ 256BA 3CP8A 3MFKA 3EGDA 1ETWA 2AQEA 2Z5UA 3LSRA 1ZRDA 1IO2A 1TWFJ 1N25A 4J30B 4ZDPA 4U9DA 1D1CA 2Y39A 5M5YJ 2Y2ZA 1D1AA 2DA2A 2FNAA 3DTEA 2EPLX 2LIGA 4LLLA 3M8EA 3KYIA 1MJBA 4KA4A 3HLZA 3LS0A 4JE9A 3SYNA 1RR8C 1J7KA 1AEPA 2EBIA 4Z9IA 2Q00A 3FXRA 4ESFA 5T3TA 4NBQA 3SZRA 2DFFA 1OKRA 3ZQVA 3G73A 3I4NJ 4MTGA 2L81A 2XPVA 4ZTFA 3GTMJ 3K69A 3F22A 1LI5A 2HV6A 2IJLA 3D1NI 1YAUO 3K1MA 3TDUC 4XKWA 1AOYA 1A7EA 1P7JA 1FWZA 4CO8A 3OYJA 2VKEA 5E3OA 3C8ZA 2HOEA 1OKKA 1XN7A 4HQMA 1USTA 3DCFA 4YK5A 1EH7A 2N8GA 2VIXA 3H3UA 4I98B 4HNTA 5GTHC 3H35A 3K2ZA 3QU6A 3J81K 1V54C 3K0LA 3RZDJ 4RDUA 2LREA 4X1EA 2RD9A 4N9HA 4KBLA 4XQ1A 4GQHA 4OMZA 4KICA 3WHNA 4LJZF 3LLIA 4I76A 3K70C 1HW2A 3FIWA 4ZLDA 3OR1C 4PCQA 3OSGA 3TBIA 2XV4S 3LSHA 3DPLC 3T0YA 2H8RA 3V5XA 2M7AA 5EJCA 3OY9A 1JRAA 3EFOB 3AAFA 1I27A 3R0JA 1WOLA 3IH3A 2OEVA 3E5XA 4PSXA 3DP7A 4G7HF 3MYIA 1XCVA 2H6BA 1ORJA 2H8WA 1Y8RB 5AIQA 5IT9Z 3BG3A 5KK1A 2JUCA 4ETSA 1T6SA 1GS9A 3C8GA 3OL4A 1EJ9A 2DA7A 4EATA 1TWAJ 1VQOI 1A7VA 2BXYA 3ASNC 2F5EA 3R0AA 5JFRA 5JLWA 3IRRA 1ZHWA 4BG0A 3WE2A 3AG2H 1U89A 2VBZA 2QSGX 2I8DA 3LUTB 3BR3A 4L6RA 2G7HA 3RVYA 3T4RA 1KTMA 2RGVA 5F1RA 3CO6C 3HHGA 3IQTA 4ZYDA 3WTYC 1V4AA 2Q2EB 3GFJA 3BR1A 5E8GA 2JX0A 2QY9A 2DMPA 3TOBA 3FKIJ 2ZNYA 1RCPA 5CJ9A 1J5YA 1EQ1A 3F3XA 4JQFA 3OS1A 3LWFA 2HI3A 4KUMA 2O7OA 2DAOA 1GM5A 2I10A 1E0EA 2R5YA 5E20A 1OKKD 4W97A 3ERED 5IPAA 3POVA 2OCEA 3HPHA 2P61A 2B7EA 2CU7A 3ULQB 5DM6F 1A04A 2DA6A 1FOWA 2LY2A 3GEEA 4II2A 1FIPA 1U8RA 1T6UA 2OCCC 4IGGA 2E36A 2HGCA 2GFHA 5E1ZB 4MVQA 2DQRA 4DYQA 3KYJA 1I4YA 1AA7A 3HJEA 3GTOJ 2Z3YA 4XN0A 1SYQA 5HV9A 1T8IA 2VODA 4MFEA 5JS5A 4LD5A 3A4CA 4L9NA 1K83J 3QVYA 4G78A 1LJ9A 5DTDA 4PZJA 1T56A 5DYMA 1ONVA 3AOUA 4CSWA 4K1OA 5AIPA 4ANJA 4P9TA 2EB7A 3V4GA 1E17A 2PBEA 3K1PA 4C2TA 1TFOB 3S0XA 4E7HA 2WB1N 3R4KA 3US6A 3HIFA 1S7EA 1NK2P 4HAMA 4X6AJ 2E87A 3DWWA 4QWQA 1LFUP 4GEHA 5DQZA 1QNTA 3H3ZA 5HLGA 2ELHA 3RKQA 3CCLI 1D1BA 2DTRA 2MFZA 3ISPA 1J0RA 3LA3A 2CJJA 1K04A 3ZQQA 3VDXA 2PMZN 4LIVA 5M3MJ 3L2RA 3F6VA 4AL1A 1W5SA 2P5KA 4E6KG 3CCVI 1RPWA 2EPFA 3N24A 5IYBJ 1QVXA 1ETKA 3E9VA 2XLVA 1IXCA 4I0BA 5HNHA 3MKLA 5DUIA 2XL8A 5BMZA 2WV0A 3QP6A 4NTFA 3MQ0A 2E71A 1PP8F 4XSXF 2XF6A 4G6TB 3U9GA 4LACB 3S1RJ 2Y48A 2JA5J 3K4BA 3JSOA 3GORA 2EFPA 3CCRI 5GP9A 5D8KB 2QQ9A 1AWCA 1RKEA 4YIIA 1MMAA 4C3BA 4WXCA 3CCJI 3QW1A 4DIQA 4JRZA 5AGFA 4RB2C 2M7BA 3CD6I 5H2FC 1BIAA 1UJ8A 3W4YA 1RUOA 3L1MA 2XXAA 4UB8C 1O3SA 1K78B 3L0IA 4ZC3A 4H54A 4HFFB 4EEFG 1TWHJ 4CUGA 4QPOA 1OR3A 2XSDC 3EQLF 4IVNA 3CMMA 2E5NA 4O6MA 1OR2A 4C2UA 3LFKA 1SFOJ 1N77A 4EVIA 2WY8Q 4IQ4A 3EG9A 1KU7A 1WN0A 3BWGA 3F8CA 4UUSA 1FYLA 1K6OA 4M9SA 3ZCOA 2J7PD 3GW2A 2L7AA 1X4OA 2AWYA 1S7AA 4ENKA 2BL2A 3A01B 2IEKA 2LF7A 5JT4A 1VYIA 3DJUB 4YT5A 3O39A 3EUHC 3ECSA 3CLOA 3S2HJ 3K66A 1NTCA 5FKNA 4P6IC 2PF4E 5F27A 2GM4A 2MA3A 4RLFA 3GTPJ 1J9IA 1YYVA 1A6IA 2M1BA 1V5GA 4M9XA 5F04A 2K86A 5EGYA 3VEPA 3CCMI 1MH4A 2VASA 1QGPA 4XOPA 5B3SH 3T6BA 3A03A 1EKEA 2EFOA 2OD5A 3QPTA 1EI7A 1B72B 4O5VA 5LEJA 4RBNA 2O9XA 2Y3DA 2OPTA 1FC3A 3I54A 4HX7A 1T0FC 3OOUA 1W0UA 4CYDA 1DOWA 4I3MA 4YWQA 3KKBA 2M9HA 4XLFA 4R1HA 4BY1J 3ABMC 4RB0A 3RKXA 5BOXA 2HUJA 3QMKA 2KZGA 4JZAA 3BP8A 1O3QA 1QQ3A 1I1GA 2A68F 3TP3A 5J4VA 1KQ0A 1U6HA 4DVYP 3EETA 1HXDA 3DBRB 1OISA 1OMIA 3VYUB 3K33A 2FE3A 2OTJI 2QNLA 4CCNA 1ODDA 1V3FA 5A2QZ 1FEXA 1RKCA 3IP4B 1FTSA 4L18B 1EKYA 3H2UA 4DYRA 3PNTA 1XDUA 2IAIA 4E7LA 3NMJA 3F72A 2V1DA 3BR6A 1WGXA 2OV7A 2DMUA 2JT1A 1ZHFA 5HVQC 2DLLA 4V19K 3FXQA 4JKVA 2MC3A 2JRTA 2VOPA 3ZQHA 3J80K 1Z5ZA 3FOPA 2NVUB 4LLNA 4L5EA 3OYAA 3LAPA 5KYNA 4HFKB 2W25A 4BHBA 2DFEA 4IO9F 2KSFA 1R4TA 2R9RB 3MLGA 3DZAA 1O3RA 1O3UA 3TJ5A 1SD5A 3ZR8X 4MEXF 3L2WA 2M4KA 4Q5SF 2AQFA 1IZ1A 2HKXA 3V7SA 2YL7A 5JLIA 1BI3A 4DXWA 1WPKA 4MTEA 4YIRX 1JHFA 3L9FA 4BY7J 1TBXA 4BXUA 3A01A 1QO0D 4MLOA 2A3SA 4XKBA 4A2UA 2AVKA 1YFHA 3JRIA 5LD2C 3VYWA 1DGRM 2W82A 2Q9BA 2BZTA 1HSTA 3SDBA 1OCRH 3CCQI 1G8XA 3E5QA 3P5JA 3C8GB 3I3LA 3X1OA 4B44A 2ID3A 3ASNH 2JVGA 4RGSA 1B8IB 3CAXA 1LEAA 4G12A 4BACA 4XBFA 3JAMZ 4PDKA 4CDYA 2A5YB 5HDNA 2K3FA 2J9WA 3A11A 3S14J 4C9YA 2CQNA 4E7SA 5DD4A 3ZTMA 4CCKA 1LUJB 1T33A 3WG7C 2W4MA 3HNJA 3VAYA 3ZMZA 4F93B 1LVKA 2EV5A 3WGHA 4ZH4F 1OCRC 1T39A 2X9DA 2NVXJ 1U0BB 5F5FA 4AL0A 1MBFA 2BY3A 2L9NA 4JTDB 1R7JA 5H6QA 1PUEE 3FX3A 5FLXZ 3QVZA 3MKWB 4PACA 2ESNA 2K5CA 3K70D 1FFTC 4CIHA 2F5VA 2LBFA 2HZTA 3HSFA 2K9LA 1NHAA 2Y69H 3F8MA 4ITVA 5FFZA 4AYBA 4E4HA 4KDPA 2A07F 4EJWA 1WJ5A 4RLQA 1UFMA 3NRVA 3J7ZI 2EILC 1G4DA 2KP6A 4F55A 3VF0A 2EPNA 1JKPC 4MW8A 3PM1A 2XS1A 4A93J 2IXMA 2Y0MA 3BQZA 3H1CA 1FBUA 3BZKA 3JSPA 2HDCA 1RKTA 3ZN0A 5L3CA 1SD7A 1ON2A 1QRYA 1G3TA 1Q1HA 1Z7LA 2KQRA 2L0KA 5IY5H 2FGYA 4HDUA 1VQKI 2KQ9A 2DK8A 4B4CA 2ZPAA 3W6KB 1HMDA 2DOFA 3SNHA 1O7FA 1IXRC 5E3CA 3RTRA 2DQLA 1HE1A 3K1HA 4C3IJ 4F91B 1TWCJ 3RKWA 4B47A 1R5ID 5JHFA 2LQGA 1Z7Qc 2J7PA 5KYWB 2VQHA 3EYIA 1RXQA 4A4AA 1Z05A 1VQ5I 1QZXA 1Z7UA 1F9NA 5DM7F 1EA8A 1OXBA 4GYIA 4BJ5A 2E2JJ 5HOOA 1LDKB 3K4MA 1FAPB 3W8HA 1OR7C 2HS5A 2VJ4A 5D5WB 1FMWA 1R4MB 2X51A 2A0BA 1O3TA 2ZXJA 1PUFB 4C30A 4LK1F 3M1CB 1FNNA 3B73A 2XGCA 2IA0A 1OCCC 2JWTA 3QPLA 2MD5A 4RB1A 2CNWD 4U5BE 2IW5A 4BXFA 2DYSH 1SVOA 5D5UB 3T9OA 4IKFA 1JJ8C 3UMKA 4ZZLA 2VT3A 3O3KA 1VTMP 1YX5A 2F4MB 1VLTA 2L6FA 3DE8A 4ULWA 4W8KA 1R49A 2E1MB 1AHDP 1F5TA 1TFKB 3FHNA 4FT8A 4L5JA 3CJQB 2P6SA 2V4JC 4RMNA 5DD8A 5DUKA 2ZFUA 3HXLA 4LLCA 3PIOF 5F5HA 4GFBA 2LKSA 2OOCA 5D91A 2WB7A 1Q0GA 2VBXA 3QYFA 3V5ZA 4G9YA 2ETSA 2Y3BA 2JVHA 4QIWN 3MFNA 4U5FE 4J32B 1B9NA 1Y1VJ 2XLDA 3B71A 4YT2A 1Z21A 4PJ0C 3ERMA 2M5WA 2NNNA 2RNGA 3C3WA 4EGZA 3FHZA 4E7JA 3HUGB 2JMWA 3OS0A 2WV1A 5F0FA 3N97A 1TQGA 3OA1A 2Z2SB 1ETVA 1P4WA 2H1KA 3EYYA 2ZXIA 2J5PA 2ADUA 3LQQA 4WJ0A 1I3AA 1YIJI 3B02A 1P7IA 2P4WA 5IY5C 1N75A 2L7MP 4XKCA 4XLCA 2XHKA 4YN0B 3KP2A 1EH6A 3JRAA 4FISA 2QUPA 2EZLA 4F4BA 2BHYA 3HRMA 3RQGA 4OIQF 5ILVA 3WTSC 2R7SA 3WTTC 1Y6IA 5F0CA 3JW4A 1MBGA 2P6TA 2WVNA 2XAFA 1PCXA 1JUPA 4NC3A 1U5TC 2F5DA 2R7WA 3FXOA 5K5QA 3BTLA 3CTAA 2EV6A 3DBLB 3CC7I 2DI3A 2HYJA 4Z6YA 1ZG5A 2A6EF 4YRVA 2XPWA 4BQQA 3D5LA 3S16J 3S28A 4MTFA 2P5LC 4LIUA 3EGXB 1JTYA 1X19A 5KYXB 4BL0B 3HNLA 1UFBA 1ZARA 2Z1DA 1I39A 4R79A 3F23A 2JRMA 1TKNA 2DYRC 1FPQA 1X58A 3LESA 5EEHA 2UXXA 1D0XA 2RV8A 2Y9YA 4WXDA 5JSLA 3GFLA 2OQMA 3L00A 4M3FA 5H20A 5DCMA 4U7DA 4EM1A 1JT6A 5GAHJ 1GT0C 2XB0X 1S7ZA 1ZN2A 3HJCA 1RMVA 5JRAA 4HW0A 1Y0UA 1P4XA 3M8FA 2JSCA 3CO7C 1E84A 3I64A 4FETA 1V5FA 1O4XA 2YZSA 5IP9J 3HEFA 3EFOA 1QU3A 2M30A 3DEWA 1LB2A 1KGSA 4HV6A 4BGDA 1MNMC 2X1DA 1XGSA 1JTXA 1JJ6C 1FJLA 1IJWC 1HC8A 3SXKA 4A3DJ 1R6RA 1LE2A 3Q0WA 4JP0A 2DTZA 3CUOA 3J7AO 3HOVJ 4M63A 1GUUA 4ESJA 1CGME 4IARA 3SZTA 1K4SA 3DD7A 3DI5A 2JN6A 2CUJA 2K27A 2E5ZA 4A3KJ 1RI7A 4A3JJ 2ZB9A 3M4OJ 4IHYA 6PAXA 3QW0A 5J8CA 3VM6A 1GV5A 3PHF2 4U7BA 1BC8C 1Z23A 3I0TA 5KYYA 4BEHA 4AD9A 1WI3A 4MHGA 4PJNA 1T5OA 4P5OA 5J1YA 4FWVA 1FMVA 3FISA 1TNSA 1WATA 3ITFA 4MIMA 3UR3C 3GEIA 3MZHA 1FTZA 3WU1B 2VQCA 1IXSB 3FMRA 1ZQ3P 1LIHA 4DW6A 2Z9OA 2ZMEA 3HC7A 2ZFWA 2STWA 3S1QJ 1OLTA 1S7OA 2VKHA 3IL2A 3PJRA 1T6IA 3U9JA 5CVRA 4IHVA 3DTIA 3IUOA 1XSDA 3C62A 2XRLA 2KIFA 1OQYA 1JPNA 1K40A 1XB4A 3FDYA 4HA8A 2X6OA 3ZRGA 5C4XJ 5HDGA 1SMYF 3JSEO 1KNYA 2PMHA 3NYMA 4ZLCA 3NAUA 3S27A 2FNPA 1R22A 3FXKA 1SZIA 3FXUA 2FAPB 3JSZA 4MQVA 2Q8KA 1Y0NA 2P8TA 2OAZA 2EIMC 2DODA 2X6YA 3N0TA 2JK3A 2GQQA 2HFIA 3KP4A 1HY5A 2M3AA 1P2FA 4D5FA 1QQIA 1YS6A 3L8JA 2NRAC 2WBMA 4CA0A 3G1OA 3V5YA 5L0CA 1S3JA 3KE2A 3TOAA 2EFWA 3TO6A 1JT0A 3ECOA 1X1PA 3MVPA 4PR9A 5T1DB 1HE9A 3EH2A 5L3FA 1NFOA 4MNUA 3ZQLA 5ILUA 4L5IA 4XPXA 3ZC4A 4E18A 2M64A 5L3VA 1B4AA 4A5NA 4A3EJ 4HE8D 4NC7A 1TT5B 1X3ZB 2A0UA 2A61A 4G8XA 3WTWC 1YYJA 2A6TA 3FF5A 4Y52J 1ZW3A 2CQQA 3B29A 1ZTRA 5C3EJ 3QPHA 3LSJA 3NWTA 4BEHB 4Y7NJ 3NYJA 2PFDA 1GVJA 5B66C 4E0IA 4PJJA 3OIQA 1VQ6I 5TJ5E 3O6XA 2ZXOA 4Q48A 3OWTA 3OYHA 3B0PA 3E0JB 4IJAA 4ZYAA 2PEXA 1OW6A 4NDLA 2QLZA 3WTVC 1JKOC 5KYWA 3JR9A 3HYIA 1RC9A 4O6YA 1YZCA 3HSRA 4EBJA 2YSRA 5EG0A 5A6AA 1WKMA 1R36A 5JLXA 2UXNA 2DOAA 1YLFA 2L7ZA 4N9IA 2YL1A 4YFXF 4NQFA 2VPLA 2HMZA 5ICCA 2VLAA 3WU2C 1IRXA 1FOKA 1ZHTA 4NQWA 3GLXA 3CJNA 1MNDA 2ZSHB 3KLNA 5K1YA 1PV3A 3BTJA 2KGOA 1K6YA 4IZZA 3L34A 3C8GD 4YFKF 2MABA 3ASOC 1R71A 1W7PB 4BBSJ 2WWYA 1RKWA 3OIPA 3AG4C 3QAHA 2KRHA 3TDZC 1VQ4I 1N1CA 2FXAA 1JE8A 3BCBA 3DM5A 4OINF 4NHJA 2AHQA 3ZTZA 1TT0A 1T01A 3DKWA 4CS9C 1CGNA 3EZHA 3H9QA 3SHFA 3KH2A 1Z63A 2CQXA 4KMUX 3NRHA 2DB4A 1LS4A 4CJGA 2WAFA 3BY6A 3N05A 3GTGJ 1ZRCA 1SFUA 3K1IC 3QYEA 1SVLA 1LFPA 2VI6A 4MVRA 4NTBA 2QCOA 1Q0DA 2EINH 2X6WA 3WG7H 2LC2A 1R23A 2QKLB 4A0XA 3RZOJ 2ZC2A 2H09A 3HOXJ 2ZJ2A 4FE7A 1GHCA 1HQCA 3GBGA 2L01A 3JCUQ 1JMWA 3DMDA 1W4MA 4MTOA 2JTVA 3WTUC 2R7TA 4EHPA 2CUEA 4A5MA 1J59A 4FQGA 5B1AH 1D5YA 3C2HA 2NOGA 4MVUA 1Y1WJ 3IQCA 1ORKA 2DBBA 4G6QA 4CSAC 4FHTA 4A3IJ 1GV2A 4H0EA 4LLGF 1VQ9I 1R5GA 4XEKA 3CUQA 1YA7O 2Z33A 3WODF 2F2EA 1WJDA 2ZNZA 2LD5A 4AE4B 2G0EA 1JAFA 3AGUA 1VNDA 2LLKA 3E3VA 1ORYA 2MG4A 2CNWA 2RSEB 2EA2A 1TQPA 1UHWA 1QPMA 2TCTA 5LFAA 2ACJA 3NMKA 2OUMA 1TW3A 2BHZA 1YDIA 3U3BA 2DJIA 4KC9A 2PN6A 5HLIA 2P1AA 3SZPA 3J06A 3FBIB 2DT6A 3HDDA 2R7QA 2XLMA 2M87A 4HDVA 2HYGD 1HCRA 2L7FP 2NUTA 3QQAA 3EUAA 5KYXA 3ABLC 3IEEA 2RQQA 4K2EA 3DJNB 2NOJB 2NAZA 2M8GX 2VE8A 5AC5A 2IPQX 1HDPA 4I7HA 1IN4A 3CDLA 4RGXA 3ZPLA 2YVKA 2KIUA 2GAQA 3TK0A 1IV6A 4LG3A 5CQEA 1J09A 3BG5A 2XRNA 1XD7A 2X85A 3K7AJ 4UV9A 4LK0F 4LGWA 1ZW2A 2ME6A 3ZWIA 3QODA 3D5SC 4KT5C 1IUYA 3JRMO 4CYCA 2Z15A 3MZYA 4U0VA 4M71A 1YJNI 2LFBA 4XEFA 3GZNB 2G62A 4P9FA 2LSEA 2Z16A 1HKSA 2R7FA 2R7OA 2OQRA 4B3XA 1MW7A 1NK3P 2CWEA 4U87A 3BZCA 2Y9ZA 2K9SA 2GXAA 1ZHXA 3K6BA 1ZKGA 2FOKA 4IAOA 2CUFA 4XRSG 4XQFA 3S2DJ 2RKHA 3FDQA 2UWMA 4GCVA 4J7TA 4IOCF 5KAIC 3RF3A 1V55H 4HYEA 4HOBA 4OU0A 5C44J 1S29A 2VCCA 2V26A 1U9OA 3GFIA 1OPCA 2YS9A 2X0LA 3K4JA 2EWNA 5E8IA 3CC2I 3UMHA 2DFIA 3OYNA 5EEGA 1BZ4A 3HNIA 4CZCA 1TQIA 1OW8A 3ABTA 3HZJA 3CF2A 1G5ZA 3DFGA 3OYKA 3IV5A 3ZMTA 3LLKA 1JUSA 5J6XA 2WAEA 1QKRA 3V8KA 3C18A 1MJ9A 1ORSC 4II3A 1YS7A 1U5TA 2UV1A 1G3WA 4JX5A 4AX2A 3O8HA 3F6OA 3KFWX 5F08A 4I2OA 3MKZA 1DOVA 5D92A 3C2BA 2EJRA 4GO1A 4EQQA 1L7CA 1NBBA 1YW8A 1K78A 4CJOA 4J19A 1Z1DA 2CGEA 2XUBA 4LERA 2GIVA 3H36A 1RNLA 3S3OA 2VC0A 5B5EC 3GODA 1JI8A 3M1CA 2IA2A 4I0AA 4ESBA 1K05A 2JPBA 2LMDA 2WC2A 4ASNA 1PVEA 4BHCA 1T08B 3CUQC 2W24A 3PO3J 3KP6A 4BDYA 1YI2I 3U1KA 5GAGJ 3L2VA 2R92J 4UUSB 2YUSA 2VB6A 3V8JA 3ZSUA 1U0JA 4BS9A 4KJZA 3I5UA 4RS8A 2M34A 2R4GA 2V9VA 3VOEA 4MVSA 3TQOA 3ZDLA 5A69A 1WI9A 3DKAA 1LE8B 3MYFA 5L0HA 5IYDJ 3HNKA 4S0HB 1J75A 4U0WA 1BW6A 2RVCA 2R0QC 4BJTA 5M3FJ 4QI0A 2EIKC 1TL8A 1D3YA 2X1CA 1TWHA 3SEOA 3CCYA 5LHGA 4CSAA 2Z99A 2HKOA 5HLTA 4P96A 2KK1A 3I53A 2VOOA 4L9JA 2J8WA 3SXMA 2FQ3A 2P7VB 2IS4A 3AL0C 2GBYA 2XAQA 1M1EB 2A5WA 4G6DA 1KZHA 4I02A 3F8FA 1MMSA 5EGOA 2QF7A 2CQ7A 2DJNA 1H7IA 3DBHB 2Q3TA 2LNBA 3KMIA 3U1DA 2R03A 1H89C 4BQOA 3CEXA 1YLMA 2XLOA 1L3LA 3KEOA 4R32A 4MNDA 2GDCA 2IGOA 1NG1A 2KC3A 1B59A 2CV2A 1KU2A 3H0DA 1VI0A 5DS6A 4OMYA 1M2VA 4IHSA 1FTTA 2R5ZB 1J8MF 2XAJA 1D8JA 3VPRA 3L2CA 2NUPB 2J0XA 2XRHA 5CI8A 3Q0VA 4O7GA 3M3YJ 1IN8A 1N78A 1LNWA 2YLDA 2L54A 3A2KA 1HF0A 1EF4A 2CUZA 5CPRB 4NC6A 3VSKA 2ECBA 2Y69C 2GIZA 3I59B 2QSFX 2X6XA 1EV7A 4EV0A 1Y56A 2B9SA 4ABZA 4CHUA 5IYCJ 3D0SA 2BC5A 2HQAA 3BTIA 2QA4I 4BQAA 2DN0A 3AG1C 2HFHA 1WJFA 1MZBA 2A6HF 4AIKA 4I44A 5EZGA 2H6CA 1KYZA 2DOEA 3BZ6A 5BS6A 1APLC 3EHMA 3GEZA 3CZ6A 3DV8A 4CDGA 3LOCA 4I6ZA 2GWWA 2LD6A 1IUFA 3ML6A 4N4OB 3HTUA 3VYTB 3NARA 5FKMA 3R6SA 1WGWA 1R4NB 3HB9A 5DVWA 1NSGB 1BBHA 3K4CA 4BHPA 4CICA 4EGYA 2F6CA 4G7ZF 2Y30A 3GTQJ 3KCCA 4A2NB 4XLPF 4CS8C 2IS1A 1M2OA 2A05A 2M8EA 5EEAA 4BQNA 4S05A 1VK5A 5FROA 3NMIA 4AIJA 1WJBA 1FSEA 5COFA 4D7NA 3KETA 2I5UA 4FASD 2OKUA 3LJBA 1WWXA 1GVDA 5E3LA 2QBYA 2VXZA 1FNTc 5KHDA 3MBGA 1QZYA 2Q4FA 4A12A 3SFZA 1HKTA 4D9JA 3NWSA 3ZQYA 3M9AA 1YA9A 2P0NA 2LFFA 1MH3A 4XWJA 3DU5A 1V5EA 3ABUA 3JYYA 1S8NA 4EJUA 1B72A 3JT1A 2R7XA 3U8PA 3K6GA 3OYDA 2H7BA 2Q7RA 3VSLA 4RD9A 2CSOA 2HVSA 4NTAA 1BJZA 1R58A 2JA2A 4D7MA 1U8BA 5ILSA 2GXGA 1A35A 3SJMA 4YL0A 3J7YJ 4ON0A 3LSPA 1H8AC 1H9GA 4UY8I 2EQRA 3TP0A 4BYYA 5A2QK 4D5CA 2HSQA 4DVZA 1FLIA 2K7LA 2G7UA 3RYPA 3MAJA 1MQVA 2XLEA 4AK9A 3HL2A 1KQ8A 3AL0B 1Z6TA 3U3FA 3AG1H 2QZ8A 5B1BH 3B0UX 3FWEA 3WTXC 3G3ZA 2K85A 3VYRB 3FAJA 4YL3A 1MMGA 2GWRA 4W1UA 1B9MA 1XC5A 3QOPA 1FFHA 2EILH 1D8KA 2ZMEC 4DZJA 1CPQA 3SFIA 1X1BA 1OW7A 4DQ2A 1ZZPA 5A6KA 2V3CC 1FYKA 3GXOA 3LS1A 2XGXA 1FYMA 2V9PA 1IDZA 1P9QC 2L9JA 5L3QA 1I5ZA 3RJPA 1IN5A 4A3FJ 3CMEI 1DU6A 3VYSB 2A1DD 4DRJB 2K4BA 2LY9A 3ZG1A 2E7XA 2YRFA 1YW7A 2HTJA 2KISA 1HMOA 5L3EA 4JJFA 3H2VA 1SD6A 2B0JA 4EUKB 4F3QA 3MZ8A 5E3AA 2BYVE 2R7RA 1O5HA 4JTAB 2BVMA 2KDZA 4IHWA 4YG2F 5H6RA 1GLNA 3ECHA 2L6HA 1E3PA 1C0WA 2VBWA 2XAUA 2QQ8A 3R7CA 2YL3A 1M6TA 1MMNA 3AG4H 2X48A 2HQNA 2F22A 1X3UA 3S9OA 3CJTB 3U2MA 1BOBA 2R93J 5D4SA 5EDNA 4GYGA 5A6BA 5GPCA 1SAUA 2NS7A 4AIHA 4E70A 4MTDA 1QPUA 1H88C 4I01A 1S72I 1XMAA 1OCCH 3GO5A 3RCOA 1D5VA 5FJ8J 1V54H 4FX4A 4EJOA 1SFKA 1HW1A 1A41A 2TRTA 4P1WA 3H9JA 3KP3A 3GVAA 4P55A 3JREA 2EIKH 1IGNA 4HNUA 3AKZA 1F4KA 2JJ7A 2UUHA 1SFXA 4KT6A 5EZHA 3T6GB 3ZIBA 1TWAA 2EH3A 2NUPA 4OD5A 4BU2A 4DBQA 1MDMA 2DA5A 1REPC 2JD3A 5F64A 2MYSA 3REOA 4PGHA 3RVZA 3F8NA 2XIGA 1A36A 2O3FA 2CCYA 2CQKA 2VN2A 2HWVA 4OWRB 2AS5F 3J80Z 2LP4A 4HRIA 3ZQ7A 2GA0A 2V6EA 3GTKJ 1K79A 3I59A 1MBEA 2GA1A 2XM4A 4B8XA 5K7FA 1H6GA 4B09A 1MDMB 2PG4A 3EDPA 4N0BA 3U9MA 1PYVA 2WZLA 5DS4A 2KZVA 4ZYEA 4LG0A 1ZU5A 2VC9A 1ETQA 3I9V2 5CKTA 3GYHX 1VMAA 4Q47A 2WY7Q 4K0DA 2Y0SA 3SP1A 1HLVA 2PX3A 1IG7A 3K4LA 3L1PA 4JEBA 1VZ0A 5CLSA 3MX3A 3AG3C 4U5HA 5CI9A 3OSFA 3ELKA 3OL3A 5LGUA 1MGTA 4RAYA 5LGNA 4W8PA 3SXZA 3LQRA 3CQZA 5JR3A 5L0JA 2I15A 5D8LB 2TMVP 4XOTA 4FCYA 1WJCA 3JAMK 4RBOA 4FESA 4ENNA 2D4UA 5BUOA 2MC4A 5FRNA 2BBYA 3GF2A 3ABKC 3ZMUA 4G94A 1RKEB 3FMQA 5K5RA 3LMMA 2MBFA 4D1QA 1NZEA 4JEAA 2XB5A 1GXPA 2XSEA 3TOLA 4DJ9A 2OZ6A 4BUPA 1BW5A 2MHRA 3EUKL 4FTHA 2CG4A 2VQGA 3DWLE 5F0HA 4U5CE 4EBKA 2XM0A 2E1NA 4XICA 3LNMB 4BDZA 2CMPA 2F4OB 1G59A 3QTHA 1TWGJ 1USSA 2EFNA 4LLEA 1F1ZA 2P7CB 1BIBA 2QYOA 3OYMA 3S93A 3SEZA 4RGRA 3NQOA 4EBBA 2XASA 3CUQB 4YIFA 2DDBA 2NS0A 4AWXB 2IRFG 3M79A 1IW7F 2D2WA 1FBQA 3RYLA 5BNGA 2VT2A 2PQ8A 4IRGA 4CZZA 2CRGA 4WGYA 1WWPA 1YHQI 3RFYA 3G1LA 4RA2A 1B68A 5BQIA 2BY0A 4B3AA 1AUEA 1LKXA 2LFDA 2P7VA 5E2QA 2V6CA 4A0ZA 2YWAA 1R00A 2BGCA 4PK4A 3DLLF 1YTYA 1WFXA 3CDHA 5JVEA 1KYWA 1I3QJ 4KI2A 2JQ7A 2HQ5A 3I55I 3AFHA 1I50J 4YJWA 1P4AA 2Q9CA 4IF4A 2HYFA 5L3DA 3W2WA 5HDKA 1WQ2A 2GAUA 3HKKA 2W45A 4PFPA 3DM9B 5CIVA 2YHSA 2HVRA 5KYUB 3R60A 2M4GA 2CW8A 1B8IA 2YKZA 3N2ZB 4XRFA 1HSJA 3TL4X 1SAXA 3VRCA 2X0CA 1XZPA 3BTCA 1X4PA 1U5TB 4X0GA 1ZELA 2MLKA 2AWCA 4CX9A 3D5RC 3WTZA 2R5YB 4O6JA 2ZXPA 5BQTA 4B6IA 3WGGA 1ZGAA 1U9NA 2DGJA 3Q9SA 2JUGA 3AG2C 5KNLA 4L0ZB 2DK5A 3ZQCA 2DA3A 2LY1A 3JTGA 1CF7A 1YRNA 1E3HA 1QVTA 1WHUA 2NXNB 4UV8A 1DUXC 4O6NA 3DEUA 3S3NA 4GDFA 3ESWB 3CCSI 3RQFA 3N4MA 3T8RA 1TP4A 5LHHA 4M73A 1ENHA 2AXLA 2JZYA 2QQAA 2IS6A 3NG1A 5HODA 2VC1A 4N4WA 3UMIA 5FD6A 1I6XA 4XNFA 1QHHD 3MCZA 1YG2A 1MNEA 4BNCA 2ZXWC 4OIOF 3RIPA 2K3PA 2KT0A 3A02A 2FMLA 3K9TA 2NPUA 3BROA 2O03A 3HKZA 2R7ZJ 1JOGA 2AXTC 1DDNA 3H5AA 2C6YA 1AVOB 3JYHA 5TGTA 4BAYA 4Y3OA 2FQ4A 2MGQA 1H0MA 4AE4A 1VQ7I 3K2AA 3A1YA 5GADJ 2MWQA 3GANA 1YIOA 3BR0A 3O6BB 4CBEA 4KIBA 4EM2A 4NNJA 3TJ6A 2PJRB 1C02A 1XMXA 2E60A 1FSHA 1GQAA 4A6DA 2K9QA 2QSHX 1JKQC 2COBA 3HRTA 1W2WA 2W9YA 4RM2A 3FXLA 3GWZA 2WAQA 4BBRJ 2HNHA 2NUTB 3C1DA 1WH5A 2W1OA 2YR2A 4MS2A 4BE0A 3HOSA 3QPSA 3KYDB 4GYTA 1FOXA 1LS1A 4E7ZA 1M56C 2VCAA 2XLWA 2OEXA 2L9RA 4ZDOA 5CVUA 3WU0A 4AUXA 2IS2A 1OCOH 1FX7A 1YJ9I 2NSGA 5F6FA 1OCZH 3E6CC 1NFNA 4HX8A 3VB2A 4I1MA 3JRDA 3HOTA 5ICFA 1DPUA 3IH2A 2E1MC 4J01A 4BE2A 2Y3HA 1X1AA 4HG2A 4ENJA 1ST6A 2L3DA 4JCHA 2HSBA 4PGGA 2E1OA 4KITB 3ZQFA 4CS9A 4MFDA 3W2VA 2D1HA 4DBRA 3LAJA 4HV5A 2RAEA 4U9EA 1QBJA 5GAEJ 2ZXHA 3TMOA 4X0RA 2EIJH 3RW0A 1NG6A 3MN2A 2DFHA 2EZHA 4EKWA 1YVIA 2YX7A 1FR0A 3GLLA 1I4ZA 2H7OA 3FBNB 4NQWB 4XEVA 4LOCA 2XLHA 3GX4X 1BC7C 2FFHA 3BG7A 1ETXA 1JHHA 2G9WA 1KU9A 2OZUA 2W48A 4A3CJ 3O2PE 5J47A 5TISC 2MW8A 2M0CA 1SD4A 2DDAA 3MMYB 4TV7A 4A3MJ 4JJGA 1UELB 2W84A 2B0LA 3O8GA 4BJ6A 4K7BA 4NB5A 3JTHA 1CQTA 1XGNA 2GOMA 3CJRB 2XSJC 3GTLJ 1ACIA 2KFDA 3QWLA 2BY1A 2OTLI 2CO5A 3E97A 3U2RA 2PLYA 4C7OB 2BEOA 3BOQA 4C3JJ 3Q5FA 2EPMX 3NDBB 2D5RB 4E7IA 4WABA 1QLEC 1C17M 3B0VC 1ZAOA 3TULA 4AU7A 3TO9A 4HEA2 5L3BA 3H5RA 4G7OF 3SDGA 3ABKH 4QPQA 1TTYA 3FMSA 5D4RA 3I5QA 3TW7A 1V74B 5GPGB 4JW1A 5J1RA 1X2NA 3CP2A 2NNYA 2PJPA 1YITI 2LCHA 5LHIA 3K7DA 9ANTA 3AGTA 5LBQA 1IAWA 3BDDA 3U2LA 2F5CA 2HDDA 1YZAA 5ERIA 5FD5A 1J2XA 1W7PD 4UUTA 1RJ9B 1Z6AA 2UZKA 3F47A 3HTSB 1ZLKA 1MBKA 1UB9A 4KFCA 1HA8A 1Z6RA 3I4PA 4OIRF 1L3PA 2EPOA 3S8PA 2IXNA 2RNJA 3RQ4A 1VQLI 2PJRA 3P9CA 1O87A 3DPUA 3IQ5A 5DLJA 2HMQA 1TQMA 1RUNA 2DT5A 5IT9K 4M6YA 2JPUA 5LGTA 1LDJA 2EINC 1OYYA 1P92A 2X1EA 2OC6A 4RAZA 3DE9A 4JX6A 1Q0KA 1VLSA 1OQCA 2IYLD 3H0GJ 4MGRA 2G3VA 1IV8A 5LLQA 5A6BD 3OYBA 1Q0FA 1T0FA 3R61A 3M4CA 3HOUJ 4M72A 4KIGA 2HOAA 4F92B 4Y15A 2HEOA 3JRCA 1XGOA 3ZGKA 3S1MJ 1BA5A 3ZMSA 1PP7U 3Q7LA 1BI0A 2KHMA 3DF8A 5JUAA 1YOVB 1DQUA 3FHDA 5F1JA 3L8IA 3BCAA 1ITYA 3S2WA 1NU7D 1LM3B 3C2GA 3LFUA 3P9IA 2V7FA 3M4BA 3BEHA 3PIPF 4F52A 5J1UA 1XS9A 2Q2EA 1BN5A 2E35A 2LOOA 5DV5A 5LRSA 1CPRA 1D0YA 1JUMA 1UG2A 4CCOA 3DXJF 4DJAA 1T38A 3ONQA 3W8IA 3G4SI 2LRDA 3B9QA 1B6AA 2FSWA 3H65A 1S9HA 3UGOA 3L2UA 4XORA 4JTCB 3TKYA 2P0WA 3JZ0A 1QZZA 3JRFA 2ETHA 5JHUA 3CF5F 2FOWA 4M9ZA 4XTKA 3S84A 2STTA 2V1NA 5J8FA 1XTAA 2COMA 1A0BA 2OA4A 4PUSA 2BVLA 1JR8A 1T95A 3EPZA 2ISZA 4IRIA 1GDTA 2IGMA 4IX7A 4N4NB 3KP5A 3MWMA 2LVSA 1ZG3A 5DEQA 2O8KA 4C3EA 1A5JA 1AKHB 2IXPA 2OJED 2OF7A 4UVAA 1I1SA 5BQHA 2XVCA 1TC3C 2XL4A 1Y39A 1ON1A 4RB3C 3PMRA 1SANA 2A69F 4RGUA 2RC4A 4Y4RA 3JRGA 3QYBA 3JRHA 3A0HC 1M57C 1BOAA 2VJJA 2ZXRA 2ZXWH 3S15J 2V1UA 2W00A 3L09A 3T8TA 3I4UA 5KYUA 1TNTA 1MSFC 2Q1ZB 1OCTC 3G4ZA 2KPMA 3BG6A 4A69C 1EA3A 1IDYA 1X1DA 4EIYA 1UHMA 2XC7A 1TR2A 5EYRA 2P6VA 4Q4ZF 3I5PA 1APCA 3CCEI 2L6GA 2V1XA 4BEMJ 2EIMH 1PD0A 3EH1A 4YEJA 2H27A 2B63J 3RH3A 4XPYA 2Y75A 3J7AY 1RETA 2XGEA 4ER9A 2ZSIB 2O9LA 5D5VB 4OD4A 4HNVA 2VXDA 5EG0B 2HJ3A 3NKEA 2R7UA 4XSZF 4IB4A 1ZYRF 1LPEA 5E1WA 5L3GA 2L9VA 3MD2A 2K9MA 2ZJRF 3LSTA 2HXIA 1NLXA 2F48A 5HS8A 1I5NA 4WK8F 2OG2A 2FRHA 2QKMB 5BPIA 3BR5A 2IA1A 2ZJPF 4UHTA 4D0PA 1R1UA 1ETYA 2ELKA 3LSGA 4QTRA 2BW3A 3LNRA 2QBYB 2FU4A 1ZVZA 1QZEA 2EA4A 2CDQA 1MMDA 3FM5A 3GZ5A 1UZCA 5CVJA 4DOZA 3EGDB 3OOPA 4XN3A 1P6RA 3KLOA 2PBIA 4LMYA 4JOMA 1MKMA 2OBPA 3IKTA 1S5LC 1MBJA 2LR8A 3AQBA 3EJNA 1R5HA 4I09A 2E19A 5FLVA 2M0MA 5E33A 1IN6A 4NC8A 1IRZA 3PSIA 1O7LA 5IP6A 5IT3A 2VH3A 5L0DA 5L0IA 3CCUI 3LA2A 4HLYA 2E2HJ 3ZOBA 3JTLO 4H4KC 2VPRA 4YT8A 2OU6A 4CIPA 1RZ4A 1VQMI 4DRHB 2CYYA 3HBLA 1MD0A 1R9TJ 4Y33A 3ZN1A 2HV7A 2LKPA 3DPTA 1ZR2A 4L0YB 3OEOA 3HTKC 3BC8A 4V2FA 3LA7A 2EK5A 2E7WA 3IH4A 1YO5C 4ZDLA 4Y13A 2DU9A 4HF2A 2L4MA 1MBHA 1ZHYA 2YLGA 3R2PA 1OR7A 3B6CA 2IT0A 4C3HJ 3BT9A 3I56I 3OIOA 3QP5A 4J00A 2HOSA 1VYKA 1OCPA 2FEZA 4BJ5C 5EF6A 5K7ZA 1QSPA 3WAQA 4E17A 3CESA 2VUMJ 3F46A 4CS7A 5K7HA 1NG7A 3F8BA 4HF0A 4XMYA 3KP7A 3BJ6A 4XIDA 2XAHA 2JA6J 2IGNA 3DTKA 4L9TA 2J9VA 2DW4A 3AQCA 1T6QA 4DYCA 3TEDA 1STZA 4N06A 3ZXSA 2J45A 1FY7A 2D5VA 2MD0A 2FBHA 3NYLA 5COGA 2CFOA 2QVOA 2NVYJ 3WG9A 2W7NA 2R02A 4MVOA 4BEJA 2O5RA 3OR2C 1XSXA 2LYCA 2JPCA 4IHTA 2DCEA 2GA2A 1DPRA 1BR1A 1ULYA 3ABLH 3BJAA 4Z9HA 1PUFA 1X3WB 4IWBA 4CCJA 1T2KA 1A31A 2R05A 3EPVA 4AYBN 4M3GA 4EWCA 3RPQA 3S90A 2NVQJ 2E34A 2LSOA 2J9BA 1SMTA 3GUDA 4A3GJ 4BXXJ 1KONA 2WB1A 5HS7A 2F4IA 3RDIA 2QEXI 3Q3SA 1G4US 2DYRH 4KIFA 5DS9A 2XGDA 3A0BC 4DGWB 3CQZJ 1BR4A 4QSHA 4ZYGA 4JYKA 4PSWA 1YJWI 2R7VA 3ASOH 3HKZN 3K10A 2W4SA 4AVZA 2DT7B 1AU7A 2XL6A 3IPMO 1YW9A 5DCMB 2R25A 5A6JA 2FX0A 4GXOA 1WVRA 4UB6C 3OYLA 2TDXA 2CW0F 3HOZJ 1ZGWA 4PFOA 1UG0A 5GTIC 1Z3YA 2KNHA 4N6CA 1E85A 1VTNC 1ETOA 4M3EA 4IHXA 3S29A 2CW7A 1SVMA 2EV0A 4P9UA 2RDPA 3EGXA 4M6XA 4KNWA 3T5XA 1Z77A 2ZKZA 3VWBA 1WJAA 1FOYA 2OJQA 3TO7A 3E7LA 4UVBA 2K9NA 3GCMA 3BPVA 4PJMA 1VQPI 5FRMA 1HKQA 3AG3H 3GZ6A 1A6QA 3FZVA 5F28E 3U0CA 2R7DA 4CCLA 3CC4I 5FLXK 2EZIA 4E7KA 3HHHA 2ZJQF 4IOAF 1LDDA 1W5CC 2L7KA 4J7YA 1XGMA 3PQJA 2YU9J 4IEJA 2ZCWA 3V8LA 2Y0SN 1IC8A 1Z91A 4BH9A 1WASA 2Y3GA 4RDAA 2DXIA 4R8HA 5HSWA 1FP1D 3OYGA 1VF9A 4B1RA 4GRIA 1G2HA 2XF7A 2O8XA 4JVSA 2KW3C 1OCZC 3I58A 4AM3A 4LG0B 2LBFB 2HJMA 5DDGA 3LEOA 1W36C 3K4KA 3KZIC 3W3CA 3ATPA 5HLHA 1XZQA 3ROUA 1YQAA 3K4NA 1ZREA 3FXHA 2D1VA 3KZYA 2DA1A 3EUHA 2NG1A 3AJMA 5FKOA 3SXYA 4YL1A 2DPDA 5D6FA 1SR2A 1G6NA 3GM1A 2CV1A 3GM2A 2MH2A 3ZP5A 4JURI 4KN4X 1O57A 2PFBA 2BOLA 3LEVA 1Z3IX 4HLXA 3RKOF 3G1MA 2KDOA 1VB5A 2NYXA 4I1OB 4XRMA 2KL4A 2IOQA 3UNGC 5TRDA 2IGKA 2KJBA 2ELJA 2L02A 3QU3A 4U88A 4HSRA 3C7JA 1R1TA 3IAS2 3PQKA 2ESHA 5KVRA 4RM3A 3IWZA 1U78A 1Y8QB 1ZLJA 1RESA 2WADA 3CDIA 3FXMA 4M3DA 2C03A 3GWNA 4U5GA 3KZZA 2KLOA 5E79C 4QLCU 3M7GA 4GGGA 2DMTA 5KAFC 5FZTA 1KU3A 1W5TA 1M2VB 1BM9A 3SZGA 1Z0XA 2C04A 3HRUA 3SYTA 4XPWA 2ICWG 2L2OA 2GXBA 3X2QC 4JIOA 3KL4A 4OIPF 2O6GE 3EZIA 2YLIA 3QOEA 2RQPA 4KN7X 4BJ6C 1ZG1A 3IWFA 4M6VA 2L9SA 3E6DA 5D6EA 3DQVC 5D5XB 4XK4A 4IRHA 1JKRC 1JPJA 3BR2A 4Y17A 1IZMA 3W6JB 4U5EE 2VCBA 5EK0A 1BBYA 2CFXA 2OU2A 2ZMEB 3S32A 1D0ZA 4XONA 4YFNF 5M5XJ 3CMAI 1V55C 4EM0B 3LNQA 2XF5A 2HU9A 1DU0A 5B3IA 2PX0A 1W0TA 5K5OA 4ZTJA 4ULVA 1HOMA 1XCBA 2HZ8A 1E86A 2DMQA 3V42A 3S3MA 3M8JA 5FKLA 4RAFA 3DEEA 2KJGA 3Q6MA 2E1CA 2R5ZA 2RREA 1S6LA 4ENMA 1Q0MA 1TLHB 4JBAA 3IRQA 2ME0A 2RN7A 2FD5A 1CF7B 3OYEA 2YEVA 3IAM2 5E17F 1ZHZA 4AC0A 2GOXB 2JSPA 1LE8A 3PFIA 2QM3A 1QHGA 4JCZA 5EGOB 2CS3A 1XX5A 3BRJA 2O61A 3RPUA 2ASRA 3E70C 2QUFA 3FVYA 3PNYA 2LTPA 2PMUA 3FXJA 1HBXG 1WH7A 3OV8A 2WA0A 3RPUD 1VFCA 4IAQA 4IJJA 4F7ZA 2W4BA 1FT9A 2ZD9A 2PNOA 2AO9A 4WF2A 4O79A 3FAPB 2LDUA 2IXSA 3K1NA 4N6HA 3RQEA 4LB6B 1SF8A 4CS8A 4B48A 1FZPB 2E2IJ 1KQ9A 2J0WA 1IF1A 4NY3A 4CH7A 4G0HA 2OQGA 5ICEA 4UDVA 3LSMA 3WGIA 1XMKA 4HBLA 2BW3B 1G3YA 4B43A 1FIAA 1GGQA 2H1LA 1UG7A 2AU5A 2KRCA 4DRIB 3ABMH 2PX9A 5KCMA 3DLAA 3KPHA 1YYXA 3Q0UA 3E1SA 1RIOH 3HOYJ 2EIJC 2H7VC 4C7OA 5BQGA 1E83A 3BLYA 3G4XA 5GPAA 2JA7J 3U21A 4A0YA 4KNVA 1F36A 1FBSA 3V7RA 4XLHA 5L0FA 3O10A 1J8YF 1SC7A 5DQTA 3T1BA 4YELA 3FOOA 1YE9A 1JXSA 2I8BA 3C63A 1OJLA 1TW2A 5FLMJ 4FAPB 3ZMVA 3E6MA 3FKJA 4AVPA 1LI7A 1NU9C 3WE3A 3GEHA 4MO7A 1XPXA 5AC4A 4EJVA 2LP0A 3IHUA 4QDLA 2KIQA 2HPIA 3PNVA 3HGGA 1BI1A 1K61A 3J81Z 5CYVA 1RR7A 2Q0OA 3TW6A 1LFBA 2FUG2 1XWJA 1B1BA 2HDWA 3F9KA 2ZO4A 2HPMA 4LDKA 2LG4A 2QE9A 3QZCA 4NUBA 2DO7A 1WZ2A 2ECCA 3MKYB 2VONA 1I6HJ 1G4WR 2WZFA 3CSKA 5HNFA 3TGNA 1U3EM 2K02A 4O3MA 3B6AA 2VKDA 1HW5A 4V2GA 3HG9A 5ED4A 1JGSA 3HGYA 3RIRA 1SEUA 2UUZA 2W85A 3G6EI 4BE1A 2Q9AA 2WVQA 4WWCA 5IOZA 3X2QH 1W7PA 4U0YA 4Q7CA 3F0CA 2CGPA 1IN7A 1U6GA 2M2EA 3FM3A 2BY2A 1YARO 4U5DE 2YL0A 3QRFF 1UMQA 4HQEA 1DP7P 2K4JA 5LRRA 1Z3XA 3GMEA 2NSFA 3DKYA 3UGPA 4YT4A 4UVCA 3E6BA 4UUVA 1ERDA 3IQ6A 4MEYF 4XLEA 3G50A 4CGZA 5J40A 2XDVA 5COMA 3PSFA 4ZZDA 2XS8A 1C03A 3I71A 4MVZA 2KKOA 1F43A 4CXFA 1U2WA 2YX4A 3VFZA 3EHNA 3ZMDA 4EMSA 4A3BJ 2AP3A 2DA4A 3GFMA 1RJ9A 1Y4CA 2CYDA 5FCLA 3HRSA 3ZQGA 2DPUA 1ZH5A 4D4NA 2BE5F 2HTSA 2IVMA 1WRJA 3PUFA 1Q1VA 3HPGA 1LQ1A 2QENA 2IP2A 3H92A 1UCRA 2WL8A 4JC7A 3SQNA 4MW3A 3LL7A 1DP3A 4M3BA 3TQNA 2IM8A 3GTJJ 2HKVA 4XLAA 4CCMA 2YQYA 2BXZA 3K1IA 5J3LA 3HUGA 4XLNF 4KMFA 4MVMA 5EHHA 3DAFA 4IRUA 5K0IA 2L5QA 3NEUA 3WHBA 2J9UA 1OFCX 2K40A 2O0YA 2LK2A 3UKGA 4RAGA 1V4RA 3H9GA 1Y6DA 2HR3A 1L0OC 2VQLA 5B3SC 1MIJA 3KX2A 2DYSC 3JRBA 3RI4A 1W36D 1PDNC 2BV6A 4JK1X 4HZFA 4LDQA 4D4XA 3DKXA 3S17J 2ZBKA 2VBYA 1H9TA 3HSEA 5FKKA 3M15A 2KYHA 5LEKA 2LK4A 2XROA 3Q6NA 1BJAA 2YPRA 5JVTA 1X1CA 5B1BC 2QLAA 1PJRA 2EFQA 4KISA 2MSYA 3ZVRA 2V9KA 3KEQA 3BPXA 4KYWA 3DAGA 2XXAB 1OXKA 1YX3A 3M07A 2Y31A 3OYIA 3E5UA 1Z67A 5JP7A 1QVUA 5CQGA 4BKXA 3OS2A 2HVQA 4E0HA 2EZKA 4OOIA 5J4YA 4XR6A 3H5NA 1XDSA 4Z9JA 4LITA 1YJGA 5FB2A 5FFXA 4A3LJ 2W57A 2XKPA 3RQIA 1LVAA 2HXOA 1K4TA 1ZRFA 4EJTA 3OMYA 3HM5A 3IC7A 2WAQN 3MEXA 3CMYA 2WZGA 2FJ1A 4C2MJ 2FBIA 4KNYA 1BL0A 1BI2A 4NCQA 4A6EA 4I99C 1WSUA 3COAC 1QA6A 2PI0A 1LEBA 4OAYA 4IL6C 2CH0A 5DCFA 1SFEA 5IOYA 3NKDA 3TD7A 1NH3A 2XKOA 3Q7GA 2VL8A 2ID6A 3KYLA 4LDRA 2IBDA 4UXNA 2EPKX 4MQ9F 2IXOA 3U8VA 2KMUA 2P5VA 3LSIA 3BQYA 3RKYA 1VQNI 1GXQA 3VODA 5JI6A 2CV0A 1VQ8I 3PL8A 3P7NA 5T3WA 3RSNA 1OYWA 5JVGF 3FK7A 1Z9CA 3H3VK 1R1VA 2FA5A 3BJOA 4FE4A 2HOTA 1TZLA 1POGA 2VKVA 3G71I 3A9CA 2H8AA 2MH9A 2NVTJ 2OCCH 1PD1A 2NS8A 3SEQA 1K7AA 3IKVA 2YU3A 2B0HA 2D45A 1E2XA 4S04A 2KRFA 3JRTA 3V7OA 2ISYA 1CGPA 4C3DA 5FO5A 5AONA 1QPIA 3S1NJ 2F5FA 1AKHA 2WVOA 4BJ1A 4HEAJ 4XRSA 3V7CA 3M1EA 1IRGA 4WX9A 3PUBA 4HSTA 3LSKA 4IXAA 4LFUA 1ZK8A 2KJCA 2P81A 2M45A 1XSVA 1T98A 1LPQA 2UUIA 1S05A 1BDJB 4ONSA 2G3KA 5L0GA 4WGZA 4ZYHA 1E3OC 4BPMA 3PCVA 2QGUA 1HDDC 5TJJA 5CVVA 4CYCB 2L4AA 1MJAA 3PO2J 4CDVA 3W6VA 5IP7J 2H94A 3JCUC 4FX0A 5DS5A 1FP2A 4XL9A 2WTEA 1MSEC 2GZWA 3W2AA 3BG9A 2VE9A 5B1AC 4DZPA 3GWLA 4JX4A 2LF8A 3FK6A 2FMYA 2MLGA
chains in the Genus database with same CATH topology
1TWCA 4F4BA 2OG2A 2QKMB 2LH9A 4OIQF 4DVZA 2R7SA 2VJIA 1Y6IA 4AK9A 3HL2A 3LSGA 4XM3A 2WVNA 2BW3A 1PCXA 1TWGA 3AL0B 2J46A 2CDQA 3LNRA 1MMDA 4DOZA 2R7WA 1UAAA 1OCOC 3EGDB 2QTVA 3B0UX 4XN3A 3VYRB 4PJLA 3FAJA 3PFYA 4JOMA 1MMGA 2A6EF 4YRVA 4BQQA 3D5LA 3S28A 2VJ5A 3AQBA 3EJNA 4FX5A 4LIUA 3EGXB 2M0MA 5E33A 1FFHA 1X19A 4NC8A 3PSIA 5KYXB 4BL0B 2VH3A 2PP4A 2Z1DA 3L2QA 2V3CC 4R79A 1X1BA 1TKNA 2DYRC 4HPQA 3LS1A 3T6JA 1ZU4A 4H4KC 3LESA 1D0XA 1WJEA 4YT8A 1P9QC 2L9JA 5L3QA 2A1DD 3VYSB 4Y33A 4ZJZA 3DPTA 3OYFA 1S7ZA 2HV7A 4IQJA 3HJCA 3OEOA 1DGWY 3EG9B 3HTKC 3BC8A 4FETA 1V5FA 2M4EA 2YZSA 4JJFA 4ZDLA 2B0JA 1BR2A 3EFOA 1QU3A 1ZHYA 4F3QA 5E3AA 2R7RA 4BGDA 4OAZA 1O5HA 2BVMA 2X1DA 3LAYA 4J00A 1VYKA 1VOMA 1GLNA 1R6RA 3G2BA 4BJ5C 3CESA 4XKVA 3F46A 3DU6A 4CS7A 1NG7A 4XMYA 1MMNA 4M63A 2HZDA 3OYCA 4QI2A 2PMZA 3KEYA 5KYYB 1BOBA 2IGNA 3DTKA 3CP8A 2J9VA 3DD7A 3AQCA 3EGDA 2AQEA 2CUJA 2E5ZA 4J30B 1SAUA 4ZDPA 1D1CA 2Y39A 3ZXSA 2J45A 4N06A 3PHF2 4U7BA 1D1AA 2MD0A 3DTEA 3RCOA 1Z23A 3NYLA 5KYYA 4BEHA 2CFOA 3HLZA 4PJNA 3LS0A 1SFKA 2W7NA 3SYNA 4P5OA 4BEJA 2O5RA 3OR2C 2LYCA 4P1WA 4FWVA 1FMVA 3H9JA 3ITFA 2DCEA 5T3TA 4HNUA 3AKZA 3UR3C 3SZRA 1BR1A 4KT6A 3ZIBA 2VQCA 1TWAA 2NUPA 4OD5A 4BU2A 4DBQA 4IWBA 2JD3A 4CCJA 2MYSA 2L81A 3HC7A 4ZTFA 1OLTA 3EPVA 2HV6A 4EWCA 2VKHA 3PJRA 3DTIA 3IUOA 4OWRB 4XKWA 4HRIA 1JPNA 2V6EA 1KONA 2WB1A 2F4IA 3OYJA 3FDYA 3ZRGA 1SMYF 1OKKA 3NYMA 4ZLCA 5DS4A 1PYVA 4DGWB 2WZLA 3S27A 2VIXA 4HNTA 1BR4A 2KZVA 3H35A 1SZIA 3JSZA 1V54C 1ZU5A 3I9V2 5CKTA 4PSWA 1VMAA 2LREA 2WY7Q 2R7VA 4KBLA 4K0DA 2EIMC 2Y0SA 2X6YA 3K10A 2PX3A 2W4SA 4AVZA 2DT7B 3N0TA 3K4LA 3SP1A 2M3AA 1VZ0A 3LLIA 3K70C 4ZLDA 3MX3A 3AG3C 3OYLA 4U5HA 5CI9A 3OR1C 2WBMA 3OL3A 3TBIA 4CA0A 3LSHA 3DPLC 2CW0F 2M7AA 4PFOA 3CQZA 1UG0A 2KNHA 1Z3YA 3OY9A 3EFOB 4XOTA 1WJCA 3S29A 2CW7A 4FESA 5T1DB 4PSXA 3EH2A 5BUOA 4G7HF 3EGXA 3ZC4A 2MC4A 4KNWA 5L3VA 5FRNA 4HE8D 3ABKC 4NC7A 3VWBA 1WJAA 3LMMA 4D1QA 4PJMA 1NZEA 5FRMA 3OL4A 2A6TA 2XSEA 4EATA 4BUPA 4CCLA 3EUKL 3ASNC 4E7KA 3NWTA 4BEHB 2VQGA 3DWLE 2L7KA 1ZHWA 2PFDA 3NYJA 4U5CE 4PJJA 4BG0A 3OIQA 3T4RA 2Y3GA 2I8DA 2CMPA 4BDZA 1G59A 3O6XA 2ZXOA 4LLEA 4RDAA 2DXIA 3OWTA 3OYGA 3OYHA 3B0PA 3E0JB 4GRIA 4ZYAA 2XF7A 4JVSA 2KW3C 2Q2EB 3OYMA 1OCZC 3S93A 3SEZA 2LBFB 2QY9A 5KYWA 4EBBA 1W36C 3K4KA 3W3CA 4O6YA 3OS1A 4JQFA 1IW7F 3K4NA 3RYLA 1E0EA 2DOAA 1OKKD 3ZG1A 2NG1A 2VPLA 3POVA 2CV1A 3HPHA 2VLAA 1IRXA 1ZHTA 4JURI 3RFYA 1MNDA 2ZSHB 2KGOA 2LY2A 4II2A 2BOLA 2OCCC 1K6YA 1LKXA 4IZZA 2P7VA 3L34A 3LEVA 1Z3IX 5E2QA 3RKOF 2GFHA 2MABA 4PK4A 2KDOA 3ASOC 4I1OB 2KL4A 1AA7A 1WFXA 4XN0A 3OIPA 2IOQA 3AG4C 4KI2A 3UNGC 2IGKA 2KRHA 2ELJA 1N1CA 3DM5A 3A4CA 3AFHA 3BCBA 4HSRA 4YJWA 4OINF 2Q9CA 3W2WA 4CS9C 1TT0A 3IAS2 3EZHA 3H9QA 3KH2A 4RM3A 2EILC 5DS6A 5HSWA 2C03A 2W45A 2WADA 1Z63A 4CSWA 4PFPA 3NRHA 4U5GA 3DM9B 2WAFA 3N05A 2KLOA 4ANJA 2YHSA 2HVRA 1M2VB 3K1IC 5KYUB 3SZGA 3QYEA 4C2TA 2C04A 2M4GA 2CW8A 1LFPA 3SYTA 3N2ZB 3TL4X 4E7HA 3S0XA 2L2OA 3X2QC 1X4PA 3KL4A 2X6WA 4X0GA 1ZELA 4OIPF 3EZIA 2LC2A 3QOEA 4BJ6C 2QKLB 2E87A 4GEHA 3D5RC 5DQZA 2ZXPA 3GBGA 2L9SA 3JCUQ 4B6IA 1D1BA 3DQVC 5EHHA 2MFZA 3DMDA 1JPJA 2DGJA 2JUGA 2R7TA 3AG2C 5KNLA 3ZQQA 3VDXA 1IZMA 2LY1A 4LIVA 3L2RA 4O6NA 3C2HA 4U5EE 3S32A 1D0ZA 4XONA 3S3NA 4E6KG 1V55C 3N24A 2XF5A 2HU9A 4CSAC 2PX0A 3E9VA 4ZTJA 5HNHA 3V42A 3S3MA 3M8JA 2KJGA 3Q6MA 3DEEA 2IS6A 3NG1A 3UMIA 2RREA 3WODF 2XF6A 4G6TB 1WJDA 4LACB 4AE4B 4XNFA 3K4BA 1QHHD 2YEVA 1MNEA 3OYEA 2ZXWC 4OIOF 3RIPA 2CNWA 2K3PA 3IAM2 1ZHZA 1MMAA 2GOXB 4C3BA 2JSPA 5LFAA 3HKZA 4DIQA 1QHGA 2OUMA 2CS3A 3H5AA 2DJIA 4KC9A 2M7BA 3JYHA 3FBIB 5TGTA 2DT6A 3E70C 4Y3OA 3FVYA 3PNYA 2R7QA 4AE4A 2XXAA 3RPUD 2WA0A 2MWQA 3A1YA 4ZC3A 3L0IA 4HFFB 3EUAA 4IJJA 3GANA 2W4BA 3ABLC 4CUGA 3IEEA 4QPOA 5KYXA 2RQQA 3DJNB 2NOJB 4O79A 4CBEA 3EQLF 2IXSA 3CMMA 4NNJA 2E5NA 4O6MA 1SF8A 2PJRB 4CS8A 2E60A 4B48A 4C2UA 2J0WA 4NY3A 5B3SC 1W2WA 2W9YA 1N77A 4RM2A 4CH7A 4G0HA 2WY8Q 4LG3A 5CQEA 1J09A 4IQ4A 2WAQA 3EG9A 2HNHA 2NUTB 3LSMA 4C3DA 2W1OA 2X85A 2BW3B 4B43A 4BE0A 3HOSA 4GYTA 1LS1A 3QODA 3D5SC 3ZCOA 2KRCA 4E7ZA 1M56C 5KCMA 1X4OA 2J7PD 3DLAA 4ZDOA 2Z15A 2IS2A 3E1SA 1VYIA 2EIJC 3DJUB 4YT5A 2H7VC 3O39A 3EUHC 4C7OA 3ECSA 3BLYA 4KNVA 3U21A 3K66A 4I1MA 3HOTA 2G62A 4XLHA 2PF4E 4P6IC 2LSEA 1J8YF 2E1MC 2Z16A 4J01A 4RLFA 4BE2A 5DQTA 1X1AA 4HG2A 2R7OA 4YELA 1MW7A 4B3XA 1YE9A 1V5GA 2I8BA 4U87A 1ST6A 3K6BA 1ZHXA 4IAOA 4JCHA 3JT1A 3FDQA 4KITB 4XQFA 5EGYA 4CS9A 3FKJA 1NU9C 3W2VA 2VASA 2UWMA 4XOPA 4DBRA 4QDLA 3T6BA 2HPIA 3PNVA 2V26A 2ZXHA 3K4JA 4RBNA 3TMOA 2O9XA 2Y3DA 4X0RA 3UMHA 2NUTA 4I3MA 3OYNA 1NG6A 1T0FC 2FUG2 3OOUA 4YWQA 3F9KA 2HDWA 3KKBA 4CZCA 2HPMA 4XLFA 2LG4A 3ABMC 3QZCA 3CF2A 4NUBA 3OYKA 2H7OA 3MKYB 2WZFA 3LLKA 3FBNB 4NQWB 2WAEA 3CSKA 5HNFA 3QMKA 4JZAA 2FFHA 2VKDA 4II3A 3BG7A 3HG9A 2A68F 2UV1A 2Y3HA 4DVYP 2UUZA 4BE1A 2WVQA 2Q9AA 4AX2A 5D92A 3VYUB 3MKZA 3K33A 4JJGA 4Q7CA 3MMYB 4CCNA 1UELB 4BJ6A 4K7BA 3IP4B 2CGEA 1FTSA 4U5DE 4LERA 2GOMA 3CJRB 2XSJC 3PNTA 4E7LA 3S3OA 1Z3XA 3UGPA 3DKYA 3GODA 4YT4A 1JI8A 4C7OB 3M1CA 2OV7A 1ERDA 5HVQC 3NDBB 2D5RB 4E7IA 4XLEA 1QLEC 2XDVA 3B0VC 3PSFA 4AU7A 4HEA2 1Z5ZA 4BDYA 3H5RA 3L2VA 4G7OF 3OYAA 5KYNA 4HFKB 3EHNA 3MLGA 4QPQA 2VB6A 3ZSUA 1U0JA 1RJ9A 3DZAA 3I5QA 5FCLA 3ZR8X 4KJZA 4BS9A 3L2WA 2M4KA 4JW1A 2AQFA 2R4GA 3CP2A 2BE5F 4Q5SF 3K7DA 3HPGA 2WL8A 4MLOA 3LL7A 4XKBA 1DP3A 4BJTA 4QI0A 4XLAA 5LD2C 4CCMA 2EIKC 3VYWA 1DGRM 2W82A 2Q9BA 3SDBA 2X1CA 1RJ9B 1TWHA 1G8XA 1Z6AA 3DAFA 3F47A 4XLNF 1HA8A 3SEOA 4IRUA 2L5QA 4CSAA 3I3LA 3X1OA 2J9UA 4B44A 4OIRF 5HLTA 2JVGA 3S8PA 4BACA 2IXNA 3H9GA 2VQLA 3RQ4A 2PJRA 3AL0C 2IS4A 1O87A 3DPUA 3KX2A 4C9YA 2DYSC 4E7SA 2J9WA 1W36D 5DLJA 2A5WA 4CCKA 3DKXA 3WG7C 2W4MA 3VAYA 2EINC 4F93B 2Q3TA 3KMIA 1LVKA 2X1EA 2OC6A 4BQOA 1OCRC 2IYLD 3Q6NA 1X1CA 2G3VA 5F5FA 5B1BC 2L9NA 1PJRA 4KISA 3ZVRA 3OYBA 2V9KA 4CIHA 3MKWB 2K5CA 3K70D 1FFTC 3DAGA 2XXAB 2F5VA 2LBFA 4F92B 1YX3A 4MNDA 4ITVA 2K9LA 3ZGKA 2IGOA 4AYBA 3OYIA 1NG1A 4E4HA 2CV2A 5CQGA 3Q7LA 1WJ5A 3OS2A 2HVQA 4RLQA 3H0DA 1KU2A 2KHMA 2KP6A 1DQUA 3H5NA 4XR6A 4F55A 1M2VA 3FHDA 1J8MF 4LITA 2IXMA 5CI8A 3BCAA 2NUPB 2J0XA 2XRHA 1NU7D 3C2GA 4O7GA 1Z7LA 3LFUA 1N78A 2FGYA 2V7FA 2KQRA 2KQ9A 3OMYA 4F52A 3A2KA 2ZPAA 3SNHA 2CUZA 2WZGA 5CPRB 3VSKA 5E3CA 3RTRA 2Y69C 3K1HA 2LOOA 4F91B 4B47A 1D0YA 2X6XA 5JHFA 1Y56A 4CCOA 4OAYA 2J7PA 4DJAA 3DXJF 2VQHA 2CH0A 3ONQA 5KYWB 2HQAA 3NKDA 3TD7A 3Q7GA 1QZXA 3W8IA 2LRDA 2VL8A 3AG1C 3B9QA 1WJFA 2A6HF 4I44A 3KYLA 3H65A 1S9HA 3UGOA 3L2UA 4BJ5A 4XORA 3EHMA 2P0WA 4MQ9F 2IXOA 3CZ6A 5HOOA 2KMUA 3LSIA 1LDKB 3K4MA 4XTKA 3W8HA 2CV0A 1OR7C 2V1NA 2VJ4A 1FMWA 2X51A 3PL8A 4N4OB 3RSNA 3VYTB 5T3WA 4PUSA 2BVLA 4C30A 1T95A 3EPZA 1WGWA 3M1CB 5DVWA 1TZLA 2IGMA 4IX7A 4N4NB 3K4CA 1OCCC 2CNWD 2F6CA 4U5BE 4BXFA 4C3EA 4G7ZF 2IXPA 4A2NB 4XLPF 1PD1A 4IKFA 2IS1A 1M2OA 3UMKA 3SEQA 4CS8C 4BQNA 2XL4A 5KYUA 1VK5A 5FROA 1YX5A 1WJBA 3JRTA 3PMRA 4ULWA 4W8KA 3V7OA 2E1MB 3FHNA 4FASD 3CJQB 4RMNA 2V4JC 2A69F 3LJBA 4Y4RA 2ZFUA 3QYBA 1M57C 3HXLA 2VXZA 2VJJA 2WVOA 5KHDA 4HEAJ 2ZXRA 4LLCA 5F5HA 4BJ1A 5D91A 2W00A 2WB7A 3PUBA 4D9JA 4HSTA 3LSKA 3NWSA 3QYFA 3I4UA 2Q1ZB 2Y3BA 2JVHA 4U5FE 4XWJA 2KPMA 4J32B 3DU5A 3BG6A 1V5EA 1EA3A 4YT2A 1X1DA 1Z21A 2XC7A 2R7XA 1TR2A 2P6VA 2G3KA 3K6GA 3OYDA 2RNGA 2H7BA 3I5PA 4Q4ZF 3VSLA 4RD9A 4E7JA 3HUGB 1PD0A 3EH1A 4YEJA 3OS0A 3RH3A 3J7AY 2HVSA 3OA1A 2Z2SB 2ZSIB 4OD4A 2VXDA 2JA2A 2ZXIA 5DS5A 3NKEA 2R7UA 4XL9A 4WJ0A 1ZYRF 3W2AA 3MD2A 5IY5C 5B1AC 1N75A 4XKCA 4XLCA 2K9MA 4YN0B 2XAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ6 C;  4BJ5 C;  3CZ6 A;  3K6G A;  3OWT A;  4BJT A; 
#chains in the Genus database with same CATH topology
 1X2M A;  1TWC A;  2GLO A;  2V79 A;  5E3M A;  3PDM P;  4HX4 A;  2LH9 A;  1ZR4 A;  2VJI A;  3I4M J;  1A7D A;  3F21 A;  3GM3 A;  2FBK A;  4XM3 A;  4M74 A;  1WCM J;  1TWG A;  2J46 A;  3CLQ A;  1F1M A;  1OCO C;  1UAA A;  3HOW J;  5ICG A;  1XG1 A;  2X4H A;  2QTV A;  2XPU A;  3P9K A;  5CVI A;  4PJL A;  3PFY A;  4LB5 A;  1OYI A;  4WXH A;  2VJ5 A;  4Z2Y A;  4FX5 A;  5HS9 A;  2KIM A;  2QQB A;  4AID A;  1YRN B;  3WHC A;  2DMN A;  2J5O A;  2FF4 A;  2PP4 A;  5M5W J;  3KYC B;  3L2Q A;  2JA8 J;  1KA8 A;  5FGM A;  1G3S A;  4HPQ A;  3U5S A;  3RYR A;  1ZU4 A;  3T6J A;  5E1X A;  1WJE A;  1LE4 A;  5E3N A;  2IBF A;  4ZJZ A;  4DNC A;  3OYF A;  4IQJ A;  2R3S A;  1DGW Y;  4UNO A;  3EG9 B;  1ZGJ A;  4L9V A;  3TOM A;  4HF1 A;  2M4E A;  1W1W E;  1BR2 A;  1UHS A;  1JGG A;  1RRJ A;  4WCG A;  3O55 A;  2LKX A;  4OAZ A;  1WTY A;  5BPD A;  3LAY A;  3L7W A;  3Q9V A;  5E18 F;  2HQR A;  1VOM A;  3G2B A;  4CDA A;  3ZQI A;  4XKV A;  3DU6 A;  2XAG A;  1CGO A;  2HZD A;  3OYC A;  1IRF A;  2QWW A;  4IPA A;  1EH8 A;  2PMZ A;  3KIO A;  3KEY A;  1T9K A;  5KYY B;  4QI2 A;  5C4J J;  256B A;  3CP8 A;  3MFK A;  3EGD A;  1ETW A;  2AQE A;  2Z5U A;  3LSR A;  1ZRD A;  1IO2 A;  1TWF J;  1N25 A;  4J30 B;  4ZDP A;  4U9D A;  1D1C A;  2Y39 A;  5M5Y J;  2Y2Z A;  1D1A A;  2DA2 A;  2FNA A;  3DTE A;  2EPL X;  2LIG A;  4LLL A;  3M8E A;  3KYI A;  1MJB A;  4KA4 A;  3HLZ A;  3LS0 A;  4JE9 A;  3SYN A;  1RR8 C;  1J7K A;  1AEP A;  2EBI A;  4Z9I A;  2Q00 A;  3FXR A;  4ESF A;  5T3T A;  4NBQ A;  3SZR A;  2DFF A;  1OKR A;  3ZQV A;  3G73 A;  3I4N J;  4MTG A;  2L81 A;  2XPV A;  4ZTF A;  3GTM J;  3K69 A;  3F22 A;  1LI5 A;  2HV6 A;  2IJL A;  3D1N I;  1YAU O;  3K1M A;  3TDU C;  4XKW A;  1AOY A;  1A7E A;  1P7J A;  1FWZ A;  4CO8 A;  3OYJ A;  2VKE A;  5E3O A;  3C8Z A;  2HOE A;  1OKK A;  1XN7 A;  4HQM A;  1UST A;  3DCF A;  4YK5 A;  1EH7 A;  2N8G A;  2VIX A;  3H3U A;  4I98 B;  4HNT A;  5GTH C;  3H35 A;  3K2Z A;  3QU6 A;  3J81 K;  1V54 C;  3K0L A;  3RZD J;  4RDU A;  2LRE A;  4X1E A;  2RD9 A;  4N9H A;  4KBL A;  4XQ1 A;  4GQH A;  4OMZ A;  4KIC A;  3WHN A;  4LJZ F;  3LLI A;  4I76 A;  3K70 C;  1HW2 A;  3FIW A;  4ZLD A;  3OR1 C;  4PCQ A;  3OSG A;  3TBI A;  2XV4 S;  3LSH A;  3DPL C;  3T0Y A;  2H8R A;  3V5X A;  2M7A A;  5EJC A;  3OY9 A;  1JRA A;  3EFO B;  3AAF A;  1I27 A;  3R0J A;  1WOL A;  3IH3 A;  2OEV A;  3E5X A;  4PSX A;  3DP7 A;  4G7H F;  3MYI A;  1XCV A;  2H6B A;  1ORJ A;  2H8W A;  1Y8R B;  5AIQ A;  5IT9 Z;  3BG3 A;  5KK1 A;  2JUC A;  4ETS A;  1T6S A;  1GS9 A;  3C8G A;  3OL4 A;  1EJ9 A;  2DA7 A;  4EAT A;  1TWA J;  1VQO I;  1A7V A;  2BXY A;  3ASN C;  2F5E A;  3R0A A;  5JFR A;  5JLW A;  3IRR A;  1ZHW A;  4BG0 A;  3WE2 A;  3AG2 H;  1U89 A;  2VBZ A;  2QSG X;  2I8D A;  3LUT B;  3BR3 A;  4L6R A;  2G7H A;  3RVY A;  3T4R A;  1KTM A;  2RGV A;  5F1R A;  3CO6 C;  3HHG A;  3IQT A;  4ZYD A;  3WTY C;  1V4A A;  2Q2E B;  3GFJ A;  3BR1 A;  5E8G A;  2JX0 A;  2QY9 A;  2DMP A;  3TOB A;  3FKI J;  2ZNY A;  1RCP A;  5CJ9 A;  1J5Y A;  1EQ1 A;  3F3X A;  4JQF A;  3OS1 A;  3LWF A;  2HI3 A;  4KUM A;  2O7O A;  2DAO A;  1GM5 A;  2I10 A;  1E0E A;  2R5Y A;  5E20 A;  1OKK D;  4W97 A;  3ERE D;  5IPA A;  3POV A;  2OCE A;  3HPH A;  2P61 A;  2B7E A;  2CU7 A;  3ULQ B;  5DM6 F;  1A04 A;  2DA6 A;  1FOW A;  2LY2 A;  3GEE A;  4II2 A;  1FIP A;  1U8R A;  1T6U A;  2OCC C;  4IGG A;  2E36 A;  2HGC A;  2GFH A;  5E1Z B;  4MVQ A;  2DQR A;  4DYQ A;  3KYJ A;  1I4Y A;  1AA7 A;  3HJE A;  3GTO J;  2Z3Y A;  4XN0 A;  1SYQ A;  5HV9 A;  1T8I A;  2VOD A;  4MFE A;  5JS5 A;  4LD5 A;  3A4C A;  4L9N A;  1K83 J;  3QVY A;  4G78 A;  1LJ9 A;  5DTD A;  4PZJ A;  1T56 A;  5DYM A;  1ONV A;  3AOU A;  4CSW A;  4K1O A;  5AIP A;  4ANJ A;  4P9T A;  2EB7 A;  3V4G A;  1E17 A;  2PBE A;  3K1P A;  4C2T A;  1TFO B;  3S0X A;  4E7H A;  2WB1 N;  3R4K A;  3US6 A;  3HIF A;  1S7E A;  1NK2 P;  4HAM A;  4X6A J;  2E87 A;  3DWW A;  4QWQ A;  1LFU P;  4GEH A;  5DQZ A;  1QNT A;  3H3Z A;  5HLG A;  2ELH A;  3RKQ A;  3CCL I;  1D1B A;  2DTR A;  2MFZ A;  3ISP A;  1J0R A;  3LA3 A;  2CJJ A;  1K04 A;  3ZQQ A;  3VDX A;  2PMZ N;  4LIV A;  5M3M J;  3L2R A;  3F6V A;  4AL1 A;  1W5S A;  2P5K A;  4E6K G;  3CCV I;  1RPW A;  2EPF A;  3N24 A;  5IYB J;  1QVX A;  1ETK A;  3E9V A;  2XLV A;  1IXC A;  4I0B A;  5HNH A;  3MKL A;  5DUI A;  2XL8 A;  5BMZ A;  2WV0 A;  3QP6 A;  4NTF A;  3MQ0 A;  2E71 A;  1PP8 F;  4XSX F;  2XF6 A;  4G6T B;  3U9G A;  4LAC B;  3S1R J;  2Y48 A;  2JA5 J;  3K4B A;  3JSO A;  3GOR A;  2EFP A;  3CCR I;  5GP9 A;  5D8K B;  2QQ9 A;  1AWC A;  1RKE A;  4YII A;  1MMA A;  4C3B A;  4WXC A;  3CCJ I;  3QW1 A;  4DIQ A;  4JRZ A;  5AGF A;  4RB2 C;  2M7B A;  3CD6 I;  5H2F C;  1BIA A;  1UJ8 A;  3W4Y A;  1RUO A;  3L1M A;  2XXA A;  4UB8 C;  1O3S A;  1K78 B;  3L0I A;  4ZC3 A;  4H54 A;  4HFF B;  4EEF G;  1TWH J;  4CUG A;  4QPO A;  1OR3 A;  2XSD C;  3EQL F;  4IVN A;  3CMM A;  2E5N A;  4O6M A;  1OR2 A;  4C2U A;  3LFK A;  1SFO J;  1N77 A;  4EVI A;  2WY8 Q;  4IQ4 A;  3EG9 A;  1KU7 A;  1WN0 A;  3BWG A;  3F8C A;  4UUS A;  1FYL A;  1K6O A;  4M9S A;  3ZCO A;  2J7P D;  3GW2 A;  2L7A A;  1X4O A;  2AWY A;  1S7A A;  4ENK A;  2BL2 A;  3A01 B;  2IEK A;  2LF7 A;  5JT4 A;  1VYI A;  3DJU B;  4YT5 A;  3O39 A;  3EUH C;  3ECS A;  3CLO A;  3S2H J;  3K66 A;  1NTC A;  5FKN A;  4P6I C;  2PF4 E;  5F27 A;  2GM4 A;  2MA3 A;  4RLF A;  3GTP J;  1J9I A;  1YYV A;  1A6I A;  2M1B A;  1V5G A;  4M9X A;  5F04 A;  2K86 A;  5EGY A;  3VEP A;  3CCM I;  1MH4 A;  2VAS A;  1QGP A;  4XOP A;  5B3S H;  3T6B A;  3A03 A;  1EKE A;  2EFO A;  2OD5 A;  3QPT A;  1EI7 A;  1B72 B;  4O5V A;  5LEJ A;  4RBN A;  2O9X A;  2Y3D A;  2OPT A;  1FC3 A;  3I54 A;  4HX7 A;  1T0F C;  3OOU A;  1W0U A;  4CYD A;  1DOW A;  4I3M A;  4YWQ A;  3KKB A;  2M9H A;  4XLF A;  4R1H A;  4BY1 J;  3ABM C;  4RB0 A;  3RKX A;  5BOX A;  2HUJ A;  3QMK A;  2KZG A;  4JZA A;  3BP8 A;  1O3Q A;  1QQ3 A;  1I1G A;  2A68 F;  3TP3 A;  5J4V A;  1KQ0 A;  1U6H A;  4DVY P;  3EET A;  1HXD A;  3DBR B;  1OIS A;  1OMI A;  3VYU B;  3K33 A;  2FE3 A;  2OTJ I;  2QNL A;  4CCN A;  1ODD A;  1V3F A;  5A2Q Z;  1FEX A;  1RKC A;  3IP4 B;  1FTS A;  4L18 B;  1EKY A;  3H2U A;  4DYR A;  3PNT A;  1XDU A;  2IAI A;  4E7L A;  3NMJ A;  3F72 A;  2V1D A;  3BR6 A;  1WGX A;  2OV7 A;  2DMU A;  2JT1 A;  1ZHF A;  5HVQ C;  2DLL A;  4V19 K;  3FXQ A;  4JKV A;  2MC3 A;  2JRT A;  2VOP A;  3ZQH A;  3J80 K;  1Z5Z A;  3FOP A;  2NVU B;  4LLN A;  4L5E A;  3OYA A;  3LAP A;  5KYN A;  4HFK B;  2W25 A;  4BHB A;  2DFE A;  4IO9 F;  2KSF A;  1R4T A;  2R9R B;  3MLG A;  3DZA A;  1O3R A;  1O3U A;  3TJ5 A;  1SD5 A;  3ZR8 X;  4MEX F;  3L2W A;  2M4K A;  4Q5S F;  2AQF A;  1IZ1 A;  2HKX A;  3V7S A;  2YL7 A;  5JLI A;  1BI3 A;  4DXW A;  1WPK A;  4MTE A;  4YIR X;  1JHF A;  3L9F A;  4BY7 J;  1TBX A;  4BXU A;  3A01 A;  1QO0 D;  4MLO A;  2A3S A;  4XKB A;  4A2U A;  2AVK A;  1YFH A;  3JRI A;  5LD2 C;  3VYW A;  1DGR M;  2W82 A;  2Q9B A;  2BZT A;  1HST A;  3SDB A;  1OCR H;  3CCQ I;  1G8X A;  3E5Q A;  3P5J A;  3C8G B;  3I3L A;  3X1O A;  4B44 A;  2ID3 A;  3ASN H;  2JVG A;  4RGS A;  1B8I B;  3CAX A;  1LEA A;  4G12 A;  4BAC A;  4XBF A;  3JAM Z;  4PDK A;  4CDY A;  2A5Y B;  5HDN A;  2K3F A;  2J9W A;  3A11 A;  3S14 J;  4C9Y A;  2CQN A;  4E7S A;  5DD4 A;  3ZTM A;  4CCK A;  1LUJ B;  1T33 A;  3WG7 C;  2W4M A;  3HNJ A;  3VAY A;  3ZMZ A;  4F93 B;  1LVK A;  2EV5 A;  3WGH A;  4ZH4 F;  1OCR C;  1T39 A;  2X9D A;  2NVX J;  1U0B B;  5F5F A;  4AL0 A;  1MBF A;  2BY3 A;  2L9N A;  4JTD B;  1R7J A;  5H6Q A;  1PUE E;  3FX3 A;  5FLX Z;  3QVZ A;  3MKW B;  4PAC A;  2ESN A;  2K5C A;  3K70 D;  1FFT C;  4CIH A;  2F5V A;  2LBF A;  2HZT A;  3HSF A;  2K9L A;  1NHA A;  2Y69 H;  3F8M A;  4ITV A;  5FFZ A;  4AYB A;  4E4H A;  4KDP A;  2A07 F;  4EJW A;  1WJ5 A;  4RLQ A;  1UFM A;  3NRV A;  3J7Z I;  2EIL C;  1G4D A;  2KP6 A;  4F55 A;  3VF0 A;  2EPN A;  1JKP C;  4MW8 A;  3PM1 A;  2XS1 A;  4A93 J;  2IXM A;  2Y0M A;  3BQZ A;  3H1C A;  1FBU A;  3BZK A;  3JSP A;  2HDC A;  1RKT A;  3ZN0 A;  5L3C A;  1SD7 A;  1ON2 A;  1QRY A;  1G3T A;  1Q1H A;  1Z7L A;  2KQR A;  2L0K A;  5IY5 H;  2FGY A;  4HDU A;  1VQK I;  2KQ9 A;  2DK8 A;  4B4C A;  2ZPA A;  3W6K B;  1HMD A;  2DOF A;  3SNH A;  1O7F A;  1IXR C;  5E3C A;  3RTR A;  2DQL A;  1HE1 A;  3K1H A;  4C3I J;  4F91 B;  1TWC J;  3RKW A;  4B47 A;  1R5I D;  5JHF A;  2LQG A;  1Z7Q c;  2J7P A;  5KYW B;  2VQH A;  3EYI A;  1RXQ A;  4A4A A;  1Z05 A;  1VQ5 I;  1QZX A;  1Z7U A;  1F9N A;  5DM7 F;  1EA8 A;  1OXB A;  4GYI A;  4BJ5 A;  2E2J J;  5HOO A;  1LDK B;  3K4M A;  1FAP B;  3W8H A;  1OR7 C;  2HS5 A;  2VJ4 A;  5D5W B;  1FMW A;  1R4M B;  2X51 A;  2A0B A;  1O3T A;  2ZXJ A;  1PUF B;  4C30 A;  4LK1 F;  3M1C B;  1FNN A;  3B73 A;  2XGC A;  2IA0 A;  1OCC C;  2JWT A;  3QPL A;  2MD5 A;  4RB1 A;  2CNW D;  4U5B E;  2IW5 A;  4BXF A;  2DYS H;  1SVO A;  5D5U B;  3T9O A;  4IKF A;  1JJ8 C;  3UMK A;  4ZZL A;  2VT3 A;  3O3K A;  1VTM P;  1YX5 A;  2F4M B;  1VLT A;  2L6F A;  3DE8 A;  4ULW A;  4W8K A;  1R49 A;  2E1M B;  1AHD P;  1F5T A;  1TFK B;  3FHN A;  4FT8 A;  4L5J A;  3CJQ B;  2P6S A;  2V4J C;  4RMN A;  5DD8 A;  5DUK A;  2ZFU A;  3HXL A;  4LLC A;  3PIO F;  5F5H A;  4GFB A;  2LKS A;  2OOC A;  5D91 A;  2WB7 A;  1Q0G A;  2VBX A;  3QYF A;  3V5Z A;  4G9Y A;  2ETS A;  2Y3B A;  2JVH A;  4QIW N;  3MFN A;  4U5F E;  4J32 B;  1B9N A;  1Y1V J;  2XLD A;  3B71 A;  4YT2 A;  1Z21 A;  4PJ0 C;  3ERM A;  2M5W A;  2NNN A;  2RNG A;  3C3W A;  4EGZ A;  3FHZ A;  4E7J A;  3HUG B;  2JMW A;  3OS0 A;  2WV1 A;  5F0F A;  3N97 A;  1TQG A;  3OA1 A;  2Z2S B;  1ETV A;  1P4W A;  2H1K A;  3EYY A;  2ZXI A;  2J5P A;  2ADU A;  3LQQ A;  4WJ0 A;  1I3A A;  1YIJ I;  3B02 A;  1P7I A;  2P4W A;  5IY5 C;  1N75 A;  2L7M P;  4XKC A;  4XLC A;  2XHK A;  4YN0 B;  3KP2 A;  1EH6 A;  3JRA A;  4FIS A;  2QUP A;  2EZL A;  4F4B A;  2BHY A;  3HRM A;  3RQG A;  4OIQ F;  5ILV A;  3WTS C;  2R7S A;  3WTT C;  1Y6I A;  5F0C A;  3JW4 A;  1MBG A;  2P6T A;  2WVN A;  2XAF A;  1PCX A;  1JUP A;  4NC3 A;  1U5T C;  2F5D A;  2R7W A;  3FXO A;  5K5Q A;  3BTL A;  3CTA A;  2EV6 A;  3DBL B;  3CC7 I;  2DI3 A;  2HYJ A;  4Z6Y A;  1ZG5 A;  2A6E F;  4YRV A;  2XPW A;  4BQQ A;  3D5L A;  3S16 J;  3S28 A;  4MTF A;  2P5L C;  4LIU A;  3EGX B;  1JTY A;  1X19 A;  5KYX B;  4BL0 B;  3HNL A;  1UFB A;  1ZAR A;  2Z1D A;  1I39 A;  4R79 A;  3F23 A;  2JRM A;  1TKN A;  2DYR C;  1FPQ A;  1X58 A;  3LES A;  5EEH A;  2UXX A;  1D0X A;  2RV8 A;  2Y9Y A;  4WXD A;  5JSL A;  3GFL A;  2OQM A;  3L00 A;  4M3F A;  5H20 A;  5DCM A;  4U7D A;  4EM1 A;  1JT6 A;  5GAH J;  1GT0 C;  2XB0 X;  1S7Z A;  1ZN2 A;  3HJC A;  1RMV A;  5JRA A;  4HW0 A;  1Y0U A;  1P4X A;  3M8F A;  2JSC A;  3CO7 C;  1E84 A;  3I64 A;  4FET A;  1V5F A;  1O4X A;  2YZS A;  5IP9 J;  3HEF A;  3EFO A;  1QU3 A;  2M30 A;  3DEW A;  1LB2 A;  1KGS A;  4HV6 A;  4BGD A;  1MNM C;  2X1D A;  1XGS A;  1JTX A;  1JJ6 C;  1FJL A;  1IJW C;  1HC8 A;  3SXK A;  4A3D J;  1R6R A;  1LE2 A;  3Q0W A;  4JP0 A;  2DTZ A;  3CUO A;  3J7A O;  3HOV J;  4M63 A;  1GUU A;  4ESJ A;  1CGM E;  4IAR A;  3SZT A;  1K4S A;  3DD7 A;  3DI5 A;  2JN6 A;  2CUJ A;  2K27 A;  2E5Z A;  4A3K J;  1RI7 A;  4A3J J;  2ZB9 A;  3M4O J;  4IHY A;  6PAX A;  3QW0 A;  5J8C A;  3VM6 A;  1GV5 A;  3PHF 2;  4U7B A;  1BC8 C;  1Z23 A;  3I0T A;  5KYY A;  4BEH A;  4AD9 A;  1WI3 A;  4MHG A;  4PJN A;  1T5O A;  4P5O A;  5J1Y A;  4FWV A;  1FMV A;  3FIS A;  1TNS A;  1WAT A;  3ITF A;  4MIM A;  3UR3 C;  3GEI A;  3MZH A;  1FTZ A;  3WU1 B;  2VQC A;  1IXS B;  3FMR A;  1ZQ3 P;  1LIH A;  4DW6 A;  2Z9O A;  2ZME A;  3HC7 A;  2ZFW A;  2STW A;  3S1Q J;  1OLT A;  1S7O A;  2VKH A;  3IL2 A;  3PJR A;  1T6I A;  3U9J A;  5CVR A;  4IHV A;  3DTI A;  3IUO A;  1XSD A;  3C62 A;  2XRL A;  2KIF A;  1OQY A;  1JPN A;  1K40 A;  1XB4 A;  3FDY A;  4HA8 A;  2X6O A;  3ZRG A;  5C4X J;  5HDG A;  1SMY F;  3JSE O;  1KNY A;  2PMH A;  3NYM A;  4ZLC A;  3NAU A;  3S27 A;  2FNP A;  1R22 A;  3FXK A;  1SZI A;  3FXU A;  2FAP B;  3JSZ A;  4MQV A;  2Q8K A;  1Y0N A;  2P8T A;  2OAZ A;  2EIM C;  2DOD A;  2X6Y A;  3N0T A;  2JK3 A;  2GQQ A;  2HFI A;  3KP4 A;  1HY5 A;  2M3A A;  1P2F A;  4D5F A;  1QQI A;  1YS6 A;  3L8J A;  2NRA C;  2WBM A;  4CA0 A;  3G1O A;  3V5Y A;  5L0C A;  1S3J A;  3KE2 A;  3TOA A;  2EFW A;  3TO6 A;  1JT0 A;  3ECO A;  1X1P A;  3MVP A;  4PR9 A;  5T1D B;  1HE9 A;  3EH2 A;  5L3F A;  1NFO A;  4MNU A;  3ZQL A;  5ILU A;  4L5I A;  4XPX A;  3ZC4 A;  4E18 A;  2M64 A;  5L3V A;  1B4A A;  4A5N A;  4A3E J;  4HE8 D;  4NC7 A;  1TT5 B;  1X3Z B;  2A0U A;  2A61 A;  4G8X A;  3WTW C;  1YYJ A;  2A6T A;  3FF5 A;  4Y52 J;  1ZW3 A;  2CQQ A;  3B29 A;  1ZTR A;  5C3E J;  3QPH A;  3LSJ A;  3NWT A;  4BEH B;  4Y7N J;  3NYJ A;  2PFD A;  1GVJ A;  5B66 C;  4E0I A;  4PJJ A;  3OIQ A;  1VQ6 I;  5TJ5 E;  3O6X A;  2ZXO A;  4Q48 A;  3OWT A;  3OYH A;  3B0P A;  3E0J B;  4IJA A;  4ZYA A;  2PEX A;  1OW6 A;  4NDL A;  2QLZ A;  3WTV C;  1JKO C;  5KYW A;  3JR9 A;  3HYI A;  1RC9 A;  4O6Y A;  1YZC A;  3HSR A;  4EBJ A;  2YSR A;  5EG0 A;  5A6A A;  1WKM A;  1R36 A;  5JLX A;  2UXN A;  2DOA A;  1YLF A;  2L7Z A;  4N9I A;  2YL1 A;  4YFX F;  4NQF A;  2VPL A;  2HMZ A;  5ICC A;  2VLA A;  3WU2 C;  1IRX A;  1FOK A;  1ZHT A;  4NQW A;  3GLX A;  3CJN A;  1MND A;  2ZSH B;  3KLN A;  5K1Y A;  1PV3 A;  3BTJ A;  2KGO A;  1K6Y A;  4IZZ A;  3L34 A;  3C8G D;  4YFK F;  2MAB A;  3ASO C;  1R71 A;  1W7P B;  4BBS J;  2WWY A;  1RKW A;  3OIP A;  3AG4 C;  3QAH A;  2KRH A;  3TDZ C;  1VQ4 I;  1N1C A;  2FXA A;  1JE8 A;  3BCB A;  3DM5 A;  4OIN F;  4NHJ A;  2AHQ A;  3ZTZ A;  1TT0 A;  1T01 A;  3DKW A;  4CS9 C;  1CGN A;  3EZH A;  3H9Q A;  3SHF A;  3KH2 A;  1Z63 A;  2CQX A;  4KMU X;  3NRH A;  2DB4 A;  1LS4 A;  4CJG A;  2WAF A;  3BY6 A;  3N05 A;  3GTG J;  1ZRC A;  1SFU A;  3K1I C;  3QYE A;  1SVL A;  1LFP A;  2VI6 A;  4MVR A;  4NTB A;  2QCO A;  1Q0D A;  2EIN H;  2X6W A;  3WG7 H;  2LC2 A;  1R23 A;  2QKL B;  4A0X A;  3RZO J;  2ZC2 A;  2H09 A;  3HOX J;  2ZJ2 A;  4FE7 A;  1GHC A;  1HQC A;  3GBG A;  2L01 A;  3JCU Q;  1JMW A;  3DMD A;  1W4M A;  4MTO A;  2JTV A;  3WTU C;  2R7T A;  4EHP A;  2CUE A;  4A5M A;  1J59 A;  4FQG A;  5B1A H;  1D5Y A;  3C2H A;  2NOG A;  4MVU A;  1Y1W J;  3IQC A;  1ORK A;  2DBB A;  4G6Q A;  4CSA C;  4FHT A;  4A3I J;  1GV2 A;  4H0E A;  4LLG F;  1VQ9 I;  1R5G A;  4XEK A;  3CUQ A;  1YA7 O;  2Z33 A;  3WOD F;  2F2E A;  1WJD A;  2ZNZ A;  2LD5 A;  4AE4 B;  2G0E A;  1JAF A;  3AGU A;  1VND A;  2LLK A;  3E3V A;  1ORY A;  2MG4 A;  2CNW A;  2RSE B;  2EA2 A;  1TQP A;  1UHW A;  1QPM A;  2TCT A;  5LFA A;  2ACJ A;  3NMK A;  2OUM A;  1TW3 A;  2BHZ A;  1YDI A;  3U3B A;  2DJI A;  4KC9 A;  2PN6 A;  5HLI A;  2P1A A;  3SZP A;  3J06 A;  3FBI B;  2DT6 A;  3HDD A;  2R7Q A;  2XLM A;  2M87 A;  4HDV A;  2HYG D;  1HCR A;  2L7F P;  2NUT A;  3QQA A;  3EUA A;  5KYX A;  3ABL C;  3IEE A;  2RQQ A;  4K2E A;  3DJN B;  2NOJ B;  2NAZ A;  2M8G X;  2VE8 A;  5AC5 A;  2IPQ X;  1HDP A;  4I7H A;  1IN4 A;  3CDL A;  4RGX A;  3ZPL A;  2YVK A;  2KIU A;  2GAQ A;  3TK0 A;  1IV6 A;  4LG3 A;  5CQE A;  1J09 A;  3BG5 A;  2XRN A;  1XD7 A;  2X85 A;  3K7A J;  4UV9 A;  4LK0 F;  4LGW A;  1ZW2 A;  2ME6 A;  3ZWI A;  3QOD A;  3D5S C;  4KT5 C;  1IUY A;  3JRM O;  4CYC A;  2Z15 A;  3MZY A;  4U0V A;  4M71 A;  1YJN I;  2LFB A;  4XEF A;  3GZN B;  2G62 A;  4P9F A;  2LSE A;  2Z16 A;  1HKS A;  2R7F A;  2R7O A;  2OQR A;  4B3X A;  1MW7 A;  1NK3 P;  2CWE A;  4U87 A;  3BZC A;  2Y9Z A;  2K9S A;  2GXA A;  1ZHX A;  3K6B A;  1ZKG A;  2FOK A;  4IAO A;  2CUF A;  4XRS G;  4XQF A;  3S2D J;  2RKH A;  3FDQ A;  2UWM A;  4GCV A;  4J7T A;  4IOC F;  5KAI C;  3RF3 A;  1V55 H;  4HYE A;  4HOB A;  4OU0 A;  5C44 J;  1S29 A;  2VCC A;  2V26 A;  1U9O A;  3GFI A;  1OPC A;  2YS9 A;  2X0L A;  3K4J A;  2EWN A;  5E8I A;  3CC2 I;  3UMH A;  2DFI A;  3OYN A;  5EEG A;  1BZ4 A;  3HNI A;  4CZC A;  1TQI A;  1OW8 A;  3ABT A;  3HZJ A;  3CF2 A;  1G5Z A;  3DFG A;  3OYK A;  3IV5 A;  3ZMT A;  3LLK A;  1JUS A;  5J6X A;  2WAE A;  1QKR A;  3V8K A;  3C18 A;  1MJ9 A;  1ORS C;  4II3 A;  1YS7 A;  1U5T A;  2UV1 A;  1G3W A;  4JX5 A;  4AX2 A;  3O8H A;  3F6O A;  3KFW X;  5F08 A;  4I2O A;  3MKZ A;  1DOV A;  5D92 A;  3C2B A;  2EJR A;  4GO1 A;  4EQQ A;  1L7C A;  1NBB A;  1YW8 A;  1K78 A;  4CJO A;  4J19 A;  1Z1D A;  2CGE A;  2XUB A;  4LER A;  2GIV A;  3H36 A;  1RNL A;  3S3O A;  2VC0 A;  5B5E C;  3GOD A;  1JI8 A;  3M1C A;  2IA2 A;  4I0A A;  4ESB A;  1K05 A;  2JPB A;  2LMD A;  2WC2 A;  4ASN A;  1PVE A;  4BHC A;  1T08 B;  3CUQ C;  2W24 A;  3PO3 J;  3KP6 A;  4BDY A;  1YI2 I;  3U1K A;  5GAG J;  3L2V A;  2R92 J;  4UUS B;  2YUS A;  2VB6 A;  3V8J A;  3ZSU A;  1U0J A;  4BS9 A;  4KJZ A;  3I5U A;  4RS8 A;  2M34 A;  2R4G A;  2V9V A;  3VOE A;  4MVS A;  3TQO A;  3ZDL A;  5A69 A;  1WI9 A;  3DKA A;  1LE8 B;  3MYF A;  5L0H A;  5IYD J;  3HNK A;  4S0H B;  1J75 A;  4U0W A;  1BW6 A;  2RVC A;  2R0Q C;  4BJT A;  5M3F J;  4QI0 A;  2EIK C;  1TL8 A;  1D3Y A;  2X1C A;  1TWH A;  3SEO A;  3CCY A;  5LHG A;  4CSA A;  2Z99 A;  2HKO A;  5HLT A;  4P96 A;  2KK1 A;  3I53 A;  2VOO A;  4L9J A;  2J8W A;  3SXM A;  2FQ3 A;  2P7V B;  2IS4 A;  3AL0 C;  2GBY A;  2XAQ A;  1M1E B;  2A5W A;  4G6D A;  1KZH A;  4I02 A;  3F8F A;  1MMS A;  5EGO A;  2QF7 A;  2CQ7 A;  2DJN A;  1H7I A;  3DBH B;  2Q3T A;  2LNB A;  3KMI A;  3U1D A;  2R03 A;  1H89 C;  4BQO A;  3CEX A;  1YLM A;  2XLO A;  1L3L A;  3KEO A;  4R32 A;  4MND A;  2GDC A;  2IGO A;  1NG1 A;  2KC3 A;  1B59 A;  2CV2 A;  1KU2 A;  3H0D A;  1VI0 A;  5DS6 A;  4OMY A;  1M2V A;  4IHS A;  1FTT A;  2R5Z B;  1J8M F;  2XAJ A;  1D8J A;  3VPR A;  3L2C A;  2NUP B;  2J0X A;  2XRH A;  5CI8 A;  3Q0V A;  4O7G A;  3M3Y J;  1IN8 A;  1N78 A;  1LNW A;  2YLD A;  2L54 A;  3A2K A;  1HF0 A;  1EF4 A;  2CUZ A;  5CPR B;  4NC6 A;  3VSK A;  2ECB A;  2Y69 C;  2GIZ A;  3I59 B;  2QSF X;  2X6X A;  1EV7 A;  4EV0 A;  1Y56 A;  2B9S A;  4ABZ A;  4CHU A;  5IYC J;  3D0S A;  2BC5 A;  2HQA A;  3BTI A;  2QA4 I;  4BQA A;  2DN0 A;  3AG1 C;  2HFH A;  1WJF A;  1MZB A;  2A6H F;  4AIK A;  4I44 A;  5EZG A;  2H6C A;  1KYZ A;  2DOE A;  3BZ6 A;  5BS6 A;  1APL C;  3EHM A;  3GEZ A;  3CZ6 A;  3DV8 A;  4CDG A;  3LOC A;  4I6Z A;  2GWW A;  2LD6 A;  1IUF A;  3ML6 A;  4N4O B;  3HTU A;  3VYT B;  3NAR A;  5FKM A;  3R6S A;  1WGW A;  1R4N B;  3HB9 A;  5DVW A;  1NSG B;  1BBH A;  3K4C A;  4BHP A;  4CIC A;  4EGY A;  2F6C A;  4G7Z F;  2Y30 A;  3GTQ J;  3KCC A;  4A2N B;  4XLP F;  4CS8 C;  2IS1 A;  1M2O A;  2A05 A;  2M8E A;  5EEA A;  4BQN A;  4S05 A;  1VK5 A;  5FRO A;  3NMI A;  4AIJ A;  1WJB A;  1FSE A;  5COF A;  4D7N A;  3KET A;  2I5U A;  4FAS D;  2OKU A;  3LJB A;  1WWX A;  1GVD A;  5E3L A;  2QBY A;  2VXZ A;  1FNT c;  5KHD A;  3MBG A;  1QZY A;  2Q4F A;  4A12 A;  3SFZ A;  1HKT A;  4D9J A;  3NWS A;  3ZQY A;  3M9A A;  1YA9 A;  2P0N A;  2LFF A;  1MH3 A;  4XWJ A;  3DU5 A;  1V5E A;  3ABU A;  3JYY A;  1S8N A;  4EJU A;  1B72 A;  3JT1 A;  2R7X A;  3U8P A;  3K6G A;  3OYD A;  2H7B A;  2Q7R A;  3VSL A;  4RD9 A;  2CSO A;  2HVS A;  4NTA A;  1BJZ A;  1R58 A;  2JA2 A;  4D7M A;  1U8B A;  5ILS A;  2GXG A;  1A35 A;  3SJM A;  4YL0 A;  3J7Y J;  4ON0 A;  3LSP A;  1H8A C;  1H9G A;  4UY8 I;  2EQR A;  3TP0 A;  4BYY A;  5A2Q K;  4D5C A;  2HSQ A;  4DVZ A;  1FLI A;  2K7L A;  2G7U A;  3RYP A;  3MAJ A;  1MQV A;  2XLE A;  4AK9 A;  3HL2 A;  1KQ8 A;  3AL0 B;  1Z6T A;  3U3F A;  3AG1 H;  2QZ8 A;  5B1B H;  3B0U X;  3FWE A;  3WTX C;  3G3Z A;  2K85 A;  3VYR B;  3FAJ A;  4YL3 A;  1MMG A;  2GWR A;  4W1U A;  1B9M A;  1XC5 A;  3QOP A;  1FFH A;  2EIL H;  1D8K A;  2ZME C;  4DZJ A;  1CPQ A;  3SFI A;  1X1B A;  1OW7 A;  4DQ2 A;  1ZZP A;  5A6K A;  2V3C C;  1FYK A;  3GXO A;  3LS1 A;  2XGX A;  1FYM A;  2V9P A;  1IDZ A;  1P9Q C;  2L9J A;  5L3Q A;  1I5Z A;  3RJP A;  1IN5 A;  4A3F J;  3CME I;  1DU6 A;  3VYS B;  2A1D D;  4DRJ B;  2K4B A;  2LY9 A;  3ZG1 A;  2E7X A;  2YRF A;  1YW7 A;  2HTJ A;  2KIS A;  1HMO A;  5L3E A;  4JJF A;  3H2V A;  1SD6 A;  2B0J A;  4EUK B;  4F3Q A;  3MZ8 A;  5E3A A;  2BYV E;  2R7R A;  1O5H A;  4JTA B;  2BVM A;  2KDZ A;  4IHW A;  4YG2 F;  5H6R A;  1GLN A;  3ECH A;  2L6H A;  1E3P A;  1C0W A;  2VBW A;  2XAU A;  2QQ8 A;  3R7C A;  2YL3 A;  1M6T A;  1MMN A;  3AG4 H;  2X48 A;  2HQN A;  2F22 A;  1X3U A;  3S9O A;  3CJT B;  3U2M A;  1BOB A;  2R93 J;  5D4S A;  5EDN A;  4GYG A;  5A6B A;  5GPC A;  1SAU A;  2NS7 A;  4AIH A;  4E70 A;  4MTD A;  1QPU A;  1H88 C;  4I01 A;  1S72 I;  1XMA A;  1OCC H;  3GO5 A;  3RCO A;  1D5V A;  5FJ8 J;  1V54 H;  4FX4 A;  4EJO A;  1SFK A;  1HW1 A;  1A41 A;  2TRT A;  4P1W A;  3H9J A;  3KP3 A;  3GVA A;  4P55 A;  3JRE A;  2EIK H;  1IGN A;  4HNU A;  3AKZ A;  1F4K A;  2JJ7 A;  2UUH A;  1SFX A;  4KT6 A;  5EZH A;  3T6G B;  3ZIB A;  1TWA A;  2EH3 A;  2NUP A;  4OD5 A;  4BU2 A;  4DBQ A;  1MDM A;  2DA5 A;  1REP C;  2JD3 A;  5F64 A;  2MYS A;  3REO A;  4PGH A;  3RVZ A;  3F8N A;  2XIG A;  1A36 A;  2O3F A;  2CCY A;  2CQK A;  2VN2 A;  2HWV A;  4OWR B;  2AS5 F;  3J80 Z;  2LP4 A;  4HRI A;  3ZQ7 A;  2GA0 A;  2V6E A;  3GTK J;  1K79 A;  3I59 A;  1MBE A;  2GA1 A;  2XM4 A;  4B8X A;  5K7F A;  1H6G A;  4B09 A;  1MDM B;  2PG4 A;  3EDP A;  4N0B A;  3U9M A;  1PYV A;  2WZL A;  5DS4 A;  2KZV A;  4ZYE A;  4LG0 A;  1ZU5 A;  2VC9 A;  1ETQ A;  3I9V 2;  5CKT A;  3GYH X;  1VMA A;  4Q47 A;  2WY7 Q;  4K0D A;  2Y0S A;  3SP1 A;  1HLV A;  2PX3 A;  1IG7 A;  3K4L A;  3L1P A;  4JEB A;  1VZ0 A;  5CLS A;  3MX3 A;  3AG3 C;  4U5H A;  5CI9 A;  3OSF A;  3ELK A;  3OL3 A;  5LGU A;  1MGT A;  4RAY A;  5LGN A;  4W8P A;  3SXZ A;  3LQR A;  3CQZ A;  5JR3 A;  5L0J A;  2I15 A;  5D8L B;  2TMV P;  4XOT A;  4FCY A;  1WJC A;  3JAM K;  4RBO A;  4FES A;  4ENN A;  2D4U A;  5BUO A;  2MC4 A;  5FRN A;  2BBY A;  3GF2 A;  3ABK C;  3ZMU A;  4G94 A;  1RKE B;  3FMQ A;  5K5R A;  3LMM A;  2MBF A;  4D1Q A;  1NZE A;  4JEA A;  2XB5 A;  1GXP A;  2XSE A;  3TOL A;  4DJ9 A;  2OZ6 A;  4BUP A;  1BW5 A;  2MHR A;  3EUK L;  4FTH A;  2CG4 A;  2VQG A;  3DWL E;  5F0H A;  4U5C E;  4EBK A;  2XM0 A;  2E1N A;  4XIC A;  3LNM B;  4BDZ A;  2CMP A;  2F4O B;  1G59 A;  3QTH A;  1TWG J;  1USS A;  2EFN A;  4LLE A;  1F1Z A;  2P7C B;  1BIB A;  2QYO A;  3OYM A;  3S93 A;  3SEZ A;  4RGR A;  3NQO A;  4EBB A;  2XAS A;  3CUQ B;  4YIF A;  2DDB A;  2NS0 A;  4AWX B;  2IRF G;  3M79 A;  1IW7 F;  2D2W A;  1FBQ A;  3RYL A;  5BNG A;  2VT2 A;  2PQ8 A;  4IRG A;  4CZZ A;  2CRG A;  4WGY A;  1WWP A;  1YHQ I;  3RFY A;  3G1L A;  4RA2 A;  1B68 A;  5BQI A;  2BY0 A;  4B3A A;  1AUE A;  1LKX A;  2LFD A;  2P7V A;  5E2Q A;  2V6C A;  4A0Z A;  2YWA A;  1R00 A;  2BGC A;  4PK4 A;  3DLL F;  1YTY A;  1WFX A;  3CDH A;  5JVE A;  1KYW A;  1I3Q J;  4KI2 A;  2JQ7 A;  2HQ5 A;  3I55 I;  3AFH A;  1I50 J;  4YJW A;  1P4A A;  2Q9C A;  4IF4 A;  2HYF A;  5L3D A;  3W2W A;  5HDK A;  1WQ2 A;  2GAU A;  3HKK A;  2W45 A;  4PFP A;  3DM9 B;  5CIV A;  2YHS A;  2HVR A;  5KYU B;  3R60 A;  2M4G A;  2CW8 A;  1B8I A;  2YKZ A;  3N2Z B;  4XRF A;  1HSJ A;  3TL4 X;  1SAX A;  3VRC A;  2X0C A;  1XZP A;  3BTC A;  1X4P A;  1U5T B;  4X0G A;  1ZEL A;  2MLK A;  2AWC A;  4CX9 A;  3D5R C;  3WTZ A;  2R5Y B;  4O6J A;  2ZXP A;  5BQT A;  4B6I A;  3WGG A;  1ZGA A;  1U9N A;  2DGJ A;  3Q9S A;  2JUG A;  3AG2 C;  5KNL A;  4L0Z B;  2DK5 A;  3ZQC A;  2DA3 A;  2LY1 A;  3JTG A;  1CF7 A;  1YRN A;  1E3H A;  1QVT A;  1WHU A;  2NXN B;  4UV8 A;  1DUX C;  4O6N A;  3DEU A;  3S3N A;  4GDF A;  3ESW B;  3CCS I;  3RQF A;  3N4M A;  3T8R A;  1TP4 A;  5LHH A;  4M73 A;  1ENH A;  2AXL A;  2JZY A;  2QQA A;  2IS6 A;  3NG1 A;  5HOD A;  2VC1 A;  4N4W A;  3UMI A;  5FD6 A;  1I6X A;  4XNF A;  1QHH D;  3MCZ A;  1YG2 A;  1MNE A;  4BNC A;  2ZXW C;  4OIO F;  3RIP A;  2K3P A;  2KT0 A;  3A02 A;  2FML A;  3K9T A;  2NPU A;  3BRO A;  2O03 A;  3HKZ A;  2R7Z J;  1JOG A;  2AXT C;  1DDN A;  3H5A A;  2C6Y A;  1AVO B;  3JYH A;  5TGT A;  4BAY A;  4Y3O A;  2FQ4 A;  2MGQ A;  1H0M A;  4AE4 A;  1VQ7 I;  3K2A A;  3A1Y A;  5GAD J;  2MWQ A;  3GAN A;  1YIO A;  3BR0 A;  3O6B B;  4CBE A;  4KIB A;  4EM2 A;  4NNJ A;  3TJ6 A;  2PJR B;  1C02 A;  1XMX A;  2E60 A;  1FSH A;  1GQA A;  4A6D A;  2K9Q A;  2QSH X;  1JKQ C;  2COB A;  3HRT A;  1W2W A;  2W9Y A;  4RM2 A;  3FXL A;  3GWZ A;  2WAQ A;  4BBR J;  2HNH A;  2NUT B;  3C1D A;  1WH5 A;  2W1O A;  2YR2 A;  4MS2 A;  4BE0 A;  3HOS A;  3QPS A;  3KYD B;  4GYT A;  1FOX A;  1LS1 A;  4E7Z A;  1M56 C;  2VCA A;  2XLW A;  2OEX A;  2L9R A;  4ZDO A;  5CVU A;  3WU0 A;  4AUX A;  2IS2 A;  1OCO H;  1FX7 A;  1YJ9 I;  2NSG A;  5F6F A;  1OCZ H;  3E6C C;  1NFN A;  4HX8 A;  3VB2 A;  4I1M A;  3JRD A;  3HOT A;  5ICF A;  1DPU A;  3IH2 A;  2E1M C;  4J01 A;  4BE2 A;  2Y3H A;  1X1A A;  4HG2 A;  4ENJ A;  1ST6 A;  2L3D A;  4JCH A;  2HSB A;  4PGG A;  2E1O A;  4KIT B;  3ZQF A;  4CS9 A;  4MFD A;  3W2V A;  2D1H A;  4DBR A;  3LAJ A;  4HV5 A;  2RAE A;  4U9E A;  1QBJ A;  5GAE J;  2ZXH A;  3TMO A;  4X0R A;  2EIJ H;  3RW0 A;  1NG6 A;  3MN2 A;  2DFH A;  2EZH A;  4EKW A;  1YVI A;  2YX7 A;  1FR0 A;  3GLL A;  1I4Z A;  2H7O A;  3FBN B;  4NQW B;  4XEV A;  4LOC A;  2XLH A;  3GX4 X;  1BC7 C;  2FFH A;  3BG7 A;  1ETX A;  1JHH A;  2G9W A;  1KU9 A;  2OZU A;  2W48 A;  4A3C J;  3O2P E;  5J47 A;  5TIS C;  2MW8 A;  2M0C A;  1SD4 A;  2DDA A;  3MMY B;  4TV7 A;  4A3M J;  4JJG A;  1UEL B;  2W84 A;  2B0L A;  3O8G A;  4BJ6 A;  4K7B A;  4NB5 A;  3JTH A;  1CQT A;  1XGN A;  2GOM A;  3CJR B;  2XSJ C;  3GTL J;  1ACI A;  2KFD A;  3QWL A;  2BY1 A;  2OTL I;  2CO5 A;  3E97 A;  3U2R A;  2PLY A;  4C7O B;  2BEO A;  3BOQ A;  4C3J J;  3Q5F A;  2EPM X;  3NDB B;  2D5R B;  4E7I A;  4WAB A;  1QLE C;  1C17 M;  3B0V C;  1ZAO A;  3TUL A;  4AU7 A;  3TO9 A;  4HEA 2;  5L3B A;  3H5R A;  4G7O F;  3SDG A;  3ABK H;  4QPQ A;  1TTY A;  3FMS A;  5D4R A;  3I5Q A;  3TW7 A;  1V74 B;  5GPG B;  4JW1 A;  5J1R A;  1X2N A;  3CP2 A;  2NNY A;  2PJP A;  1YIT I;  2LCH A;  5LHI A;  3K7D A;  9ANT A;  3AGT A;  5LBQ A;  1IAW A;  3BDD A;  3U2L A;  2F5C A;  2HDD A;  1YZA A;  5ERI A;  5FD5 A;  1J2X A;  1W7P D;  4UUT A;  1RJ9 B;  1Z6A A;  2UZK A;  3F47 A;  3HTS B;  1ZLK A;  1MBK A;  1UB9 A;  4KFC A;  1HA8 A;  1Z6R A;  3I4P A;  4OIR F;  1L3P A;  2EPO A;  3S8P A;  2IXN A;  2RNJ A;  3RQ4 A;  1VQL I;  2PJR A;  3P9C A;  1O87 A;  3DPU A;  3IQ5 A;  5DLJ A;  2HMQ A;  1TQM A;  1RUN A;  2DT5 A;  5IT9 K;  4M6Y A;  2JPU A;  5LGT A;  1LDJ A;  2EIN C;  1OYY A;  1P92 A;  2X1E A;  2OC6 A;  4RAZ A;  3DE9 A;  4JX6 A;  1Q0K A;  1VLS A;  1OQC A;  2IYL D;  3H0G J;  4MGR A;  2G3V A;  1IV8 A;  5LLQ A;  5A6B D;  3OYB A;  1Q0F A;  1T0F A;  3R61 A;  3M4C A;  3HOU J;  4M72 A;  4KIG A;  2HOA A;  4F92 B;  4Y15 A;  2HEO A;  3JRC A;  1XGO A;  3ZGK A;  3S1M J;  1BA5 A;  3ZMS A;  1PP7 U;  3Q7L A;  1BI0 A;  2KHM A;  3DF8 A;  5JUA A;  1YOV B;  1DQU A;  3FHD A;  5F1J A;  3L8I A;  3BCA A;  1ITY A;  3S2W A;  1NU7 D;  1LM3 B;  3C2G A;  3LFU A;  3P9I A;  2V7F A;  3M4B A;  3BEH A;  3PIP F;  4F52 A;  5J1U A;  1XS9 A;  2Q2E A;  1BN5 A;  2E35 A;  2LOO A;  5DV5 A;  5LRS A;  1CPR A;  1D0Y A;  1JUM A;  1UG2 A;  4CCO A;  3DXJ F;  4DJA A;  1T38 A;  3ONQ A;  3W8I A;  3G4S I;  2LRD A;  3B9Q A;  1B6A A;  2FSW A;  3H65 A;  1S9H A;  3UGO A;  3L2U A;  4XOR A;  4JTC B;  3TKY A;  2P0W A;  3JZ0 A;  1QZZ A;  3JRF A;  2ETH A;  5JHU A;  3CF5 F;  2FOW A;  4M9Z A;  4XTK A;  3S84 A;  2STT A;  2V1N A;  5J8F A;  1XTA A;  2COM A;  1A0B A;  2OA4 A;  4PUS A;  2BVL A;  1JR8 A;  1T95 A;  3EPZ A;  2ISZ A;  4IRI A;  1GDT A;  2IGM A;  4IX7 A;  4N4N B;  3KP5 A;  3MWM A;  2LVS A;  1ZG3 A;  5DEQ A;  2O8K A;  4C3E A;  1A5J A;  1AKH B;  2IXP A;  2OJE D;  2OF7 A;  4UVA A;  1I1S A;  5BQH A;  2XVC A;  1TC3 C;  2XL4 A;  1Y39 A;  1ON1 A;  4RB3 C;  3PMR A;  1SAN A;  2A69 F;  4RGU A;  2RC4 A;  4Y4R A;  3JRG A;  3QYB A;  3JRH A;  3A0H C;  1M57 C;  1BOA A;  2VJJ A;  2ZXR A;  2ZXW H;  3S15 J;  2V1U A;  2W00 A;  3L09 A;  3T8T A;  3I4U A;  5KYU A;  1TNT A;  1MSF C;  2Q1Z B;  1OCT C;  3G4Z A;  2KPM A;  3BG6 A;  4A69 C;  1EA3 A;  1IDY A;  1X1D A;  4EIY A;  1UHM A;  2XC7 A;  1TR2 A;  5EYR A;  2P6V A;  4Q4Z F;  3I5P A;  1APC A;  3CCE I;  2L6G A;  2V1X A;  4BEM J;  2EIM H;  1PD0 A;  3EH1 A;  4YEJ A;  2H27 A;  2B63 J;  3RH3 A;  4XPY A;  2Y75 A;  3J7A Y;  1RET A;  2XGE A;  4ER9 A;  2ZSI B;  2O9L A;  5D5V B;  4OD4 A;  4HNV A;  2VXD A;  5EG0 B;  2HJ3 A;  3NKE A;  2R7U A;  4XSZ F;  4IB4 A;  1ZYR F;  1LPE A;  5E1W A;  5L3G A;  2L9V A;  3MD2 A;  2K9M A;  2ZJR F;  3LST A;  2HXI A;  1NLX A;  2F48 A;  5HS8 A;  1I5N A;  4WK8 F;  2OG2 A;  2FRH A;  2QKM B;  5BPI A;  3BR5 A;  2IA1 A;  2ZJP F;  4UHT A;  4D0P A;  1R1U A;  1ETY A;  2ELK A;  3LSG A;  4QTR A;  2BW3 A;  3LNR A;  2QBY B;  2FU4 A;  1ZVZ A;  1QZE A;  2EA4 A;  2CDQ A;  1MMD A;  3FM5 A;  3GZ5 A;  1UZC A;  5CVJ A;  4DOZ A;  3EGD B;  3OOP A;  4XN3 A;  1P6R A;  3KLO A;  2PBI A;  4LMY A;  4JOM A;  1MKM A;  2OBP A;  3IKT A;  1S5L C;  1MBJ A;  2LR8 A;  3AQB A;  3EJN A;  1R5H A;  4I09 A;  2E19 A;  5FLV A;  2M0M A;  5E33 A;  1IN6 A;  4NC8 A;  1IRZ A;  3PSI A;  1O7L A;  5IP6 A;  5IT3 A;  2VH3 A;  5L0D A;  5L0I A;  3CCU I;  3LA2 A;  4HLY A;  2E2H J;  3ZOB A;  3JTL O;  4H4K C;  2VPR A;  4YT8 A;  2OU6 A;  4CIP A;  1RZ4 A;  1VQM I;  4DRH B;  2CYY A;  3HBL A;  1MD0 A;  1R9T J;  4Y33 A;  3ZN1 A;  2HV7 A;  2LKP A;  3DPT A;  1ZR2 A;  4L0Y B;  3OEO A;  3HTK C;  3BC8 A;  4V2F A;  3LA7 A;  2EK5 A;  2E7W A;  3IH4 A;  1YO5 C;  4ZDL A;  4Y13 A;  2DU9 A;  4HF2 A;  2L4M A;  1MBH A;  1ZHY A;  2YLG A;  3R2P A;  1OR7 A;  3B6C A;  2IT0 A;  4C3H J;  3BT9 A;  3I56 I;  3OIO A;  3QP5 A;  4J00 A;  2HOS A;  1VYK A;  1OCP A;  2FEZ A;  4BJ5 C;  5EF6 A;  5K7Z A;  1QSP A;  3WAQ A;  4E17 A;  3CES A;  2VUM J;  3F46 A;  4CS7 A;  5K7H A;  1NG7 A;  3F8B A;  4HF0 A;  4XMY A;  3KP7 A;  3BJ6 A;  4XID A;  2XAH A;  2JA6 J;  2IGN A;  3DTK A;  4L9T A;  2J9V A;  2DW4 A;  3AQC A;  1T6Q A;  4DYC A;  3TED A;  1STZ A;  4N06 A;  3ZXS A;  2J45 A;  1FY7 A;  2D5V A;  2MD0 A;  2FBH A;  3NYL A;  5COG A;  2CFO A;  2QVO A;  2NVY J;  3WG9 A;  2W7N A;  2R02 A;  4MVO A;  4BEJ A;  2O5R A;  3OR2 C;  1XSX A;  2LYC A;  2JPC A;  4IHT A;  2DCE A;  2GA2 A;  1DPR A;  1BR1 A;  1ULY A;  3ABL H;  3BJA A;  4Z9H A;  1PUF A;  1X3W B;  4IWB A;  4CCJ A;  1T2K A;  1A31 A;  2R05 A;  3EPV A;  4AYB N;  4M3G A;  4EWC A;  3RPQ A;  3S90 A;  2NVQ J;  2E34 A;  2LSO A;  2J9B A;  1SMT A;  3GUD A;  4A3G J;  4BXX J;  1KON A;  2WB1 A;  5HS7 A;  2F4I A;  3RDI A;  2QEX I;  3Q3S A;  1G4U S;  2DYR H;  4KIF A;  5DS9 A;  2XGD A;  3A0B C;  4DGW B;  3CQZ J;  1BR4 A;  4QSH A;  4ZYG A;  4JYK A;  4PSW A;  1YJW I;  2R7V A;  3ASO H;  3HKZ N;  3K10 A;  2W4S A;  4AVZ A;  2DT7 B;  1AU7 A;  2XL6 A;  3IPM O;  1YW9 A;  5DCM B;  2R25 A;  5A6J A;  2FX0 A;  4GXO A;  1WVR A;  4UB6 C;  3OYL A;  2TDX A;  2CW0 F;  3HOZ J;  1ZGW A;  4PFO A;  1UG0 A;  5GTI C;  1Z3Y A;  2KNH A;  4N6C A;  1E85 A;  1VTN C;  1ETO A;  4M3E A;  4IHX A;  3S29 A;  2CW7 A;  1SVM A;  2EV0 A;  4P9U A;  2RDP A;  3EGX A;  4M6X A;  4KNW A;  3T5X A;  1Z77 A;  2ZKZ A;  3VWB A;  1WJA A;  1FOY A;  2OJQ A;  3TO7 A;  3E7L A;  4UVB A;  2K9N A;  3GCM A;  3BPV A;  4PJM A;  1VQP I;  5FRM A;  1HKQ A;  3AG3 H;  3GZ6 A;  1A6Q A;  3FZV A;  5F28 E;  3U0C A;  2R7D A;  4CCL A;  3CC4 I;  5FLX K;  2EZI A;  4E7K A;  3HHH A;  2ZJQ F;  4IOA F;  1LDD A;  1W5C C;  2L7K A;  4J7Y A;  1XGM A;  3PQJ A;  2YU9 J;  4IEJ A;  2ZCW A;  3V8L A;  2Y0S N;  1IC8 A;  1Z91 A;  4BH9 A;  1WAS A;  2Y3G A;  4RDA A;  2DXI A;  4R8H A;  5HSW A;  1FP1 D;  3OYG A;  1VF9 A;  4B1R A;  4GRI A;  1G2H A;  2XF7 A;  2O8X A;  4JVS A;  2KW3 C;  1OCZ C;  3I58 A;  4AM3 A;  4LG0 B;  2LBF B;  2HJM A;  5DDG A;  3LEO A;  1W36 C;  3K4K A;  3KZI C;  3W3C A;  3ATP A;  5HLH A;  1XZQ A;  3ROU A;  1YQA A;  3K4N A;  1ZRE A;  3FXH A;  2D1V A;  3KZY A;  2DA1 A;  3EUH A;  2NG1 A;  3AJM A;  5FKO A;  3SXY A;  4YL1 A;  2DPD A;  5D6F A;  1SR2 A;  1G6N A;  3GM1 A;  2CV1 A;  3GM2 A;  2MH2 A;  3ZP5 A;  4JUR I;  4KN4 X;  1O57 A;  2PFB A;  2BOL A;  3LEV A;  1Z3I X;  4HLX A;  3RKO F;  3G1M A;  2KDO A;  1VB5 A;  2NYX A;  4I1O B;  4XRM A;  2KL4 A;  2IOQ A;  3UNG C;  5TRD A;  2IGK A;  2KJB A;  2ELJ A;  2L02 A;  3QU3 A;  4U88 A;  4HSR A;  3C7J A;  1R1T A;  3IAS 2;  3PQK A;  2ESH A;  5KVR A;  4RM3 A;  3IWZ A;  1U78 A;  1Y8Q B;  1ZLJ A;  1RES A;  2WAD A;  3CDI A;  3FXM A;  4M3D A;  2C03 A;  3GWN A;  4U5G A;  3KZZ A;  2KLO A;  5E79 C;  4QLC U;  3M7G A;  4GGG A;  2DMT A;  5KAF C;  5FZT A;  1KU3 A;  1W5T A;  1M2V B;  1BM9 A;  3SZG A;  1Z0X A;  2C04 A;  3HRU A;  3SYT A;  4XPW A;  2ICW G;  2L2O A;  2GXB A;  3X2Q C;  4JIO A;  3KL4 A;  4OIP F;  2O6G E;  3EZI A;  2YLI A;  3QOE A;  2RQP A;  4KN7 X;  4BJ6 C;  1ZG1 A;  3IWF A;  4M6V A;  2L9S A;  3E6D A;  5D6E A;  3DQV C;  5D5X B;  4XK4 A;  4IRH A;  1JKR C;  1JPJ A;  3BR2 A;  4Y17 A;  1IZM A;  3W6J B;  4U5E E;  2VCB A;  5EK0 A;  1BBY A;  2CFX A;  2OU2 A;  2ZME B;  3S32 A;  1D0Z A;  4XON A;  4YFN F;  5M5X J;  3CMA I;  1V55 C;  4EM0 B;  3LNQ A;  2XF5 A;  2HU9 A;  1DU0 A;  5B3I A;  2PX0 A;  1W0T A;  5K5O A;  4ZTJ A;  4ULV A;  1HOM A;  1XCB A;  2HZ8 A;  1E86 A;  2DMQ A;  3V42 A;  3S3M A;  3M8J A;  5FKL A;  4RAF A;  3DEE A;  2KJG A;  3Q6M A;  2E1C A;  2R5Z A;  2RRE A;  1S6L A;  4ENM A;  1Q0M A;  1TLH B;  4JBA A;  3IRQ A;  2ME0 A;  2RN7 A;  2FD5 A;  1CF7 B;  3OYE A;  2YEV A;  3IAM 2;  5E17 F;  1ZHZ A;  4AC0 A;  2GOX B;  2JSP A;  1LE8 A;  3PFI A;  2QM3 A;  1QHG A;  4JCZ A;  5EGO B;  2CS3 A;  1XX5 A;  3BRJ A;  2O61 A;  3RPU A;  2ASR A;  3E70 C;  2QUF A;  3FVY A;  3PNY A;  2LTP A;  2PMU A;  3FXJ A;  1HBX G;  1WH7 A;  3OV8 A;  2WA0 A;  3RPU D;  1VFC A;  4IAQ A;  4IJJ A;  4F7Z A;  2W4B A;  1FT9 A;  2ZD9 A;  2PNO A;  2AO9 A;  4WF2 A;  4O79 A;  3FAP B;  2LDU A;  2IXS A;  3K1N A;  4N6H A;  3RQE A;  4LB6 B;  1SF8 A;  4CS8 A;  4B48 A;  1FZP B;  2E2I J;  1KQ9 A;  2J0W A;  1IF1 A;  4NY3 A;  4CH7 A;  4G0H A;  2OQG A;  5ICE A;  4UDV A;  3LSM A;  3WGI A;  1XMK A;  4HBL A;  2BW3 B;  1G3Y A;  4B43 A;  1FIA A;  1GGQ A;  2H1L A;  1UG7 A;  2AU5 A;  2KRC A;  4DRI B;  3ABM H;  2PX9 A;  5KCM A;  3DLA A;  3KPH A;  1YYX A;  3Q0U A;  3E1S A;  1RIO H;  3HOY J;  2EIJ C;  2H7V C;  4C7O A;  5BQG A;  1E83 A;  3BLY A;  3G4X A;  5GPA A;  2JA7 J;  3U21 A;  4A0Y A;  4KNV A;  1F36 A;  1FBS A;  3V7R A;  4XLH A;  5L0F A;  3O10 A;  1J8Y F;  1SC7 A;  5DQT A;  3T1B A;  4YEL A;  3FOO A;  1YE9 A;  1JXS A;  2I8B A;  3C63 A;  1OJL A;  1TW2 A;  5FLM J;  4FAP B;  3ZMV A;  3E6M A;  3FKJ A;  4AVP A;  1LI7 A;  1NU9 C;  3WE3 A;  3GEH A;  4MO7 A;  1XPX A;  5AC4 A;  4EJV A;  2LP0 A;  3IHU A;  4QDL A;  2KIQ A;  2HPI A;  3PNV A;  3HGG A;  1BI1 A;  1K61 A;  3J81 Z;  5CYV A;  1RR7 A;  2Q0O A;  3TW6 A;  1LFB A;  2FUG 2;  1XWJ A;  1B1B A;  2HDW A;  3F9K A;  2ZO4 A;  2HPM A;  4LDK A;  2LG4 A;  2QE9 A;  3QZC A;  4NUB A;  2DO7 A;  1WZ2 A;  2ECC A;  3MKY B;  2VON A;  1I6H J;  1G4W R;  2WZF A;  3CSK A;  5HNF A;  3TGN A;  1U3E M;  2K02 A;  4O3M A;  3B6A A;  2VKD A;  1HW5 A;  4V2G A;  3HG9 A;  5ED4 A;  1JGS A;  3HGY A;  3RIR A;  1SEU A;  2UUZ A;  2W85 A;  3G6E I;  4BE1 A;  2Q9A A;  2WVQ A;  4WWC A;  5IOZ A;  3X2Q H;  1W7P A;  4U0Y A;  4Q7C A;  3F0C A;  2CGP A;  1IN7 A;  1U6G A;  2M2E A;  3FM3 A;  2BY2 A;  1YAR O;  4U5D E;  2YL0 A;  3QRF F;  1UMQ A;  4HQE A;  1DP7 P;  2K4J A;  5LRR A;  1Z3X A;  3GME A;  2NSF A;  3DKY A;  3UGP A;  4YT4 A;  4UVC A;  3E6B A;  4UUV A;  1ERD A;  3IQ6 A;  4MEY F;  4XLE A;  3G50 A;  4CGZ A;  5J40 A;  2XDV A;  5COM A;  3PSF A;  4ZZD A;  2XS8 A;  1C03 A;  3I71 A;  4MVZ A;  2KKO A;  1F43 A;  4CXF A;  1U2W A;  2YX4 A;  3VFZ A;  3EHN A;  3ZMD A;  4EMS A;  4A3B J;  2AP3 A;  2DA4 A;  3GFM A;  1RJ9 A;  1Y4C A;  2CYD A;  5FCL A;  3HRS A;  3ZQG A;  2DPU A;  1ZH5 A;  4D4N A;  2BE5 F;  2HTS A;  2IVM A;  1WRJ A;  3PUF A;  1Q1V A;  3HPG A;  1LQ1 A;  2QEN A;  2IP2 A;  3H92 A;  1UCR A;  2WL8 A;  4JC7 A;  3SQN A;  4MW3 A;  3LL7 A;  1DP3 A;  4M3B A;  3TQN A;  2IM8 A;  3GTJ J;  2HKV A;  4XLA A;  4CCM A;  2YQY A;  2BXZ A;  3K1I A;  5J3L A;  3HUG A;  4XLN F;  4KMF A;  4MVM A;  5EHH A;  3DAF A;  4IRU A;  5K0I A;  2L5Q A;  3NEU A;  3WHB A;  2J9U A;  1OFC X;  2K40 A;  2O0Y A;  2LK2 A;  3UKG A;  4RAG A;  1V4R A;  3H9G A;  1Y6D A;  2HR3 A;  1L0O C;  2VQL A;  5B3S C;  1MIJ A;  3KX2 A;  2DYS C;  3JRB A;  3RI4 A;  1W36 D;  1PDN C;  2BV6 A;  4JK1 X;  4HZF A;  4LDQ A;  4D4X A;  3DKX A;  3S17 J;  2ZBK A;  2VBY A;  1H9T A;  3HSE A;  5FKK A;  3M15 A;  2KYH A;  5LEK A;  2LK4 A;  2XRO A;  3Q6N A;  1BJA A;  2YPR A;  5JVT A;  1X1C A;  5B1B C;  2QLA A;  1PJR A;  2EFQ A;  4KIS A;  2MSY A;  3ZVR A;  2V9K A;  3KEQ A;  3BPX A;  4KYW A;  3DAG A;  2XXA B;  1OXK A;  1YX3 A;  3M07 A;  2Y31 A;  3OYI A;  3E5U A;  1Z67 A;  5JP7 A;  1QVU A;  5CQG A;  4BKX A;  3OS2 A;  2HVQ A;  4E0H A;  2EZK A;  4OOI A;  5J4Y A;  4XR6 A;  3H5N A;  1XDS A;  4Z9J A;  4LIT A;  1YJG A;  5FB2 A;  5FFX A;  4A3L J;  2W57 A;  2XKP A;  3RQI A;  1LVA A;  2HXO A;  1K4T A;  1ZRF A;  4EJT A;  3OMY A;  3HM5 A;  3IC7 A;  2WAQ N;  3MEX A;  3CMY A;  2WZG A;  2FJ1 A;  4C2M J;  2FBI A;  4KNY A;  1BL0 A;  1BI2 A;  4NCQ A;  4A6E A;  4I99 C;  1WSU A;  3COA C;  1QA6 A;  2PI0 A;  1LEB A;  4OAY A;  4IL6 C;  2CH0 A;  5DCF A;  1SFE A;  5IOY A;  3NKD A;  3TD7 A;  1NH3 A;  2XKO A;  3Q7G A;  2VL8 A;  2ID6 A;  3KYL A;  4LDR A;  2IBD A;  4UXN A;  2EPK X;  4MQ9 F;  2IXO A;  3U8V A;  2KMU A;  2P5V A;  3LSI A;  3BQY A;  3RKY A;  1VQN I;  1GXQ A;  3VOD A;  5JI6 A;  2CV0 A;  1VQ8 I;  3PL8 A;  3P7N A;  5T3W A;  3RSN A;  1OYW A;  5JVG F;  3FK7 A;  1Z9C A;  3H3V K;  1R1V A;  2FA5 A;  3BJO A;  4FE4 A;  2HOT A;  1TZL A;  1POG A;  2VKV A;  3G71 I;  3A9C A;  2H8A A;  2MH9 A;  2NVT J;  2OCC H;  1PD1 A;  2NS8 A;  3SEQ A;  1K7A A;  3IKV A;  2YU3 A;  2B0H A;  2D45 A;  1E2X A;  4S04 A;  2KRF A;  3JRT A;  3V7O A;  2ISY A;  1CGP A;  4C3D A;  5FO5 A;  5AON A;  1QPI A;  3S1N J;  2F5F A;  1AKH A;  2WVO A;  4BJ1 A;  4HEA J;  4XRS A;  3V7C A;  3M1E A;  1IRG A;  4WX9 A;  3PUB A;  4HST A;  3LSK A;  4IXA A;  4LFU A;  1ZK8 A;  2KJC A;  2P81 A;  2M45 A;  1XSV A;  1T98 A;  1LPQ A;  2UUI A;  1S05 A;  1BDJ B;  4ONS A;  2G3K A;  5L0G A;  4WGZ A;  4ZYH A;  1E3O C;  4BPM A;  3PCV A;  2QGU A;  1HDD C;  5TJJ A;  5CVV A;  4CYC B;  2L4A A;  1MJA A;  3PO2 J;  4CDV A;  3W6V A;  5IP7 J;  2H94 A;  3JCU C;  4FX0 A;  5DS5 A;  1FP2 A;  4XL9 A;  2WTE A;  1MSE C;  2GZW A;  3W2A A;  3BG9 A;  2VE9 A;  5B1A C;  4DZP A;  3GWL A;  4JX4 A;  2LF8 A;  3FK6 A;  2FMY A;  2MLG A; 
#chains in the Genus database with same CATH homology
 1TWC A;  4F4B A;  2OG2 A;  2QKM B;  2LH9 A;  4OIQ F;  4DVZ A;  2R7S A;  2VJI A;  1Y6I A;  4AK9 A;  3HL2 A;  3LSG A;  4XM3 A;  2WVN A;  2BW3 A;  1PCX A;  1TWG A;  3AL0 B;  2J46 A;  2CDQ A;  3LNR A;  1MMD A;  4DOZ A;  2R7W A;  1UAA A;  1OCO C;  3EGD B;  2QTV A;  3B0U X;  4XN3 A;  3VYR B;  4PJL A;  3FAJ A;  3PFY A;  4JOM A;  1MMG A;  2A6E F;  4YRV A;  4BQQ A;  3D5L A;  3S28 A;  2VJ5 A;  3AQB A;  3EJN A;  4FX5 A;  4LIU A;  3EGX B;  2M0M A;  5E33 A;  1FFH A;  1X19 A;  4NC8 A;  3PSI A;  5KYX B;  4BL0 B;  2VH3 A;  2PP4 A;  2Z1D A;  3L2Q A;  2V3C C;  4R79 A;  1X1B A;  1TKN A;  2DYR C;  4HPQ A;  3LS1 A;  3T6J A;  1ZU4 A;  4H4K C;  3LES A;  1D0X A;  1WJE A;  4YT8 A;  1P9Q C;  2L9J A;  5L3Q A;  2A1D D;  3VYS B;  4Y33 A;  4ZJZ A;  3DPT A;  3OYF A;  1S7Z A;  2HV7 A;  4IQJ A;  3HJC A;  3OEO A;  1DGW Y;  3EG9 B;  3HTK C;  3BC8 A;  4FET A;  1V5F A;  2M4E A;  2YZS A;  4JJF A;  4ZDL A;  2B0J A;  1BR2 A;  3EFO A;  1QU3 A;  1ZHY A;  4F3Q A;  5E3A A;  2R7R A;  4BGD A;  4OAZ A;  1O5H A;  2BVM A;  2X1D A;  3LAY A;  4J00 A;  1VYK A;  1VOM A;  1GLN A;  1R6R A;  3G2B A;  4BJ5 C;  3CES A;  4XKV A;  3F46 A;  3DU6 A;  4CS7 A;  1NG7 A;  4XMY A;  1MMN A;  4M63 A;  2HZD A;  3OYC A;  4QI2 A;  2PMZ A;  3KEY A;  5KYY B;  1BOB A;  2IGN A;  3DTK A;  3CP8 A;  2J9V A;  3DD7 A;  3AQC A;  3EGD A;  2AQE A;  2CUJ A;  2E5Z A;  4J30 B;  1SAU A;  4ZDP A;  1D1C A;  2Y39 A;  3ZXS A;  2J45 A;  4N06 A;  3PHF 2;  4U7B A;  1D1A A;  2MD0 A;  3DTE A;  3RCO A;  1Z23 A;  3NYL A;  5KYY A;  4BEH A;  2CFO A;  3HLZ A;  4PJN A;  3LS0 A;  1SFK A;  2W7N A;  3SYN A;  4P5O A;  4BEJ A;  2O5R A;  3OR2 C;  2LYC A;  4P1W A;  4FWV A;  1FMV A;  3H9J A;  3ITF A;  2DCE A;  5T3T A;  4HNU A;  3AKZ A;  3UR3 C;  3SZR A;  1BR1 A;  4KT6 A;  3ZIB A;  2VQC A;  1TWA A;  2NUP A;  4OD5 A;  4BU2 A;  4DBQ A;  4IWB A;  2JD3 A;  4CCJ A;  2MYS A;  2L81 A;  3HC7 A;  4ZTF A;  1OLT A;  3EPV A;  2HV6 A;  4EWC A;  2VKH A;  3PJR A;  3DTI A;  3IUO A;  4OWR B;  4XKW A;  4HRI A;  1JPN A;  2V6E A;  1KON A;  2WB1 A;  2F4I A;  3OYJ A;  3FDY A;  3ZRG A;  1SMY F;  1OKK A;  3NYM A;  4ZLC A;  5DS4 A;  1PYV A;  4DGW B;  2WZL A;  3S27 A;  2VIX A;  4HNT A;  1BR4 A;  2KZV A;  3H35 A;  1SZI A;  3JSZ A;  1V54 C;  1ZU5 A;  3I9V 2;  5CKT A;  4PSW A;  1VMA A;  2LRE A;  2WY7 Q;  2R7V A;  4KBL A;  4K0D A;  2EIM C;  2Y0S A;  2X6Y A;  3K10 A;  2PX3 A;  2W4S A;  4AVZ A;  2DT7 B;  3N0T A;  3K4L A;  3SP1 A;  2M3A A;  1VZ0 A;  3LLI A;  3K70 C;  4ZLD A;  3MX3 A;  3AG3 C;  3OYL A;  4U5H A;  5CI9 A;  3OR1 C;  2WBM A;  3OL3 A;  3TBI A;  4CA0 A;  3LSH A;  3DPL C;  2CW0 F;  2M7A A;  4PFO A;  3CQZ A;  1UG0 A;  2KNH A;  1Z3Y A;  3OY9 A;  3EFO B;  4XOT A;  1WJC A;  3S29 A;  2CW7 A;  4FES A;  5T1D B;  4PSX A;  3EH2 A;  5BUO A;  4G7H F;  3EGX A;  3ZC4 A;  2MC4 A;  4KNW A;  5L3V A;  5FRN A;  4HE8 D;  3ABK C;  4NC7 A;  3VWB A;  1WJA A;  3LMM A;  4D1Q A;  4PJM A;  1NZE A;  5FRM A;  3OL4 A;  2A6T A;  2XSE A;  4EAT A;  4BUP A;  4CCL A;  3EUK L;  3ASN C;  4E7K A;  3NWT A;  4BEH B;  2VQG A;  3DWL E;  2L7K A;  1ZHW A;  2PFD A;  3NYJ A;  4U5C E;  4PJJ A;  4BG0 A;  3OIQ A;  3T4R A;  2Y3G A;  2I8D A;  2CMP A;  4BDZ A;  1G59 A;  3O6X A;  2ZXO A;  4LLE A;  4RDA A;  2DXI A;  3OWT A;  3OYG A;  3OYH A;  3B0P A;  3E0J B;  4GRI A;  4ZYA A;  2XF7 A;  4JVS A;  2KW3 C;  2Q2E B;  3OYM A;  1OCZ C;  3S93 A;  3SEZ A;  2LBF B;  2QY9 A;  5KYW A;  4EBB A;  1W36 C;  3K4K A;  3W3C A;  4O6Y A;  3OS1 A;  4JQF A;  1IW7 F;  3K4N A;  3RYL A;  1E0E A;  2DOA A;  1OKK D;  3ZG1 A;  2NG1 A;  2VPL A;  3POV A;  2CV1 A;  3HPH A;  2VLA A;  1IRX A;  1ZHT A;  4JUR I;  3RFY A;  1MND A;  2ZSH B;  2KGO A;  2LY2 A;  4II2 A;  2BOL A;  2OCC C;  1K6Y A;  1LKX A;  4IZZ A;  2P7V A;  3L34 A;  3LEV A;  1Z3I X;  5E2Q A;  3RKO F;  2GFH A;  2MAB A;  4PK4 A;  2KDO A;  3ASO C;  4I1O B;  2KL4 A;  1AA7 A;  1WFX A;  4XN0 A;  3OIP A;  2IOQ A;  3AG4 C;  4KI2 A;  3UNG C;  2IGK A;  2KRH A;  2ELJ A;  1N1C A;  3DM5 A;  3A4C A;  3AFH A;  3BCB A;  4HSR A;  4YJW A;  4OIN F;  2Q9C A;  3W2W A;  4CS9 C;  1TT0 A;  3IAS 2;  3EZH A;  3H9Q A;  3KH2 A;  4RM3 A;  2EIL C;  5DS6 A;  5HSW A;  2C03 A;  2W45 A;  2WAD A;  1Z63 A;  4CSW A;  4PFP A;  3NRH A;  4U5G A;  3DM9 B;  2WAF A;  3N05 A;  2KLO A;  4ANJ A;  2YHS A;  2HVR A;  1M2V B;  3K1I C;  5KYU B;  3SZG A;  3QYE A;  4C2T A;  2C04 A;  2M4G A;  2CW8 A;  1LFP A;  3SYT A;  3N2Z B;  3TL4 X;  4E7H A;  3S0X A;  2L2O A;  3X2Q C;  1X4P A;  3KL4 A;  2X6W A;  4X0G A;  1ZEL A;  4OIP F;  3EZI A;  2LC2 A;  3QOE A;  4BJ6 C;  2QKL B;  2E87 A;  4GEH A;  3D5R C;  5DQZ A;  2ZXP A;  3GBG A;  2L9S A;  3JCU Q;  4B6I A;  1D1B A;  3DQV C;  5EHH A;  2MFZ A;  3DMD A;  1JPJ A;  2DGJ A;  2JUG A;  2R7T A;  3AG2 C;  5KNL A;  3ZQQ A;  3VDX A;  1IZM A;  2LY1 A;  4LIV A;  3L2R A;  4O6N A;  3C2H A;  4U5E E;  3S32 A;  1D0Z A;  4XON A;  3S3N A;  4E6K G;  1V55 C;  3N24 A;  2XF5 A;  2HU9 A;  4CSA C;  2PX0 A;  3E9V A;  4ZTJ A;  5HNH A;  3V42 A;  3S3M A;  3M8J A;  2KJG A;  3Q6M A;  3DEE A;  2IS6 A;  3NG1 A;  3UMI A;  2RRE A;  3WOD F;  2XF6 A;  4G6T B;  1WJD A;  4LAC B;  4AE4 B;  4XNF A;  3K4B A;  1QHH D;  2YEV A;  1MNE A;  3OYE A;  2ZXW C;  4OIO F;  3RIP A;  2CNW A;  2K3P A;  3IAM 2;  1ZHZ A;  1MMA A;  2GOX B;  4C3B A;  2JSP A;  5LFA A;  3HKZ A;  4DIQ A;  1QHG A;  2OUM A;  2CS3 A;  3H5A A;  2DJI A;  4KC9 A;  2M7B A;  3JYH A;  3FBI B;  5TGT A;  2DT6 A;  3E70 C;  4Y3O A;  3FVY A;  3PNY A;  2R7Q A;  4AE4 A;  2XXA A;  3RPU D;  2WA0 A;  2MWQ A;  3A1Y A;  4ZC3 A;  3L0I A;  4HFF B;  3EUA A;  4IJJ A;  3GAN A;  2W4B A;  3ABL C;  4CUG A;  3IEE A;  4QPO A;  5KYX A;  2RQQ A;  3DJN B;  2NOJ B;  4O79 A;  4CBE A;  3EQL F;  2IXS A;  3CMM A;  4NNJ A;  2E5N A;  4O6M A;  1SF8 A;  2PJR B;  4CS8 A;  2E60 A;  4B48 A;  4C2U A;  2J0W A;  4NY3 A;  5B3S C;  1W2W A;  2W9Y A;  1N77 A;  4RM2 A;  4CH7 A;  4G0H A;  2WY8 Q;  4LG3 A;  5CQE A;  1J09 A;  4IQ4 A;  2WAQ A;  3EG9 A;  2HNH A;  2NUT B;  3LSM A;  4C3D A;  2W1O A;  2X85 A;  2BW3 B;  4B43 A;  4BE0 A;  3HOS A;  4GYT A;  1LS1 A;  3QOD A;  3D5S C;  3ZCO A;  2KRC A;  4E7Z A;  1M56 C;  5KCM A;  1X4O A;  2J7P D;  3DLA A;  4ZDO A;  2Z15 A;  2IS2 A;  3E1S A;  1VYI A;  2EIJ C;  3DJU B;  4YT5 A;  2H7V C;  3O39 A;  3EUH C;  4C7O A;  3ECS A;  3BLY A;  4KNV A;  3U21 A;  3K66 A;  4I1M A;  3HOT A;  2G62 A;  4XLH A;  2PF4 E;  4P6I C;  2LSE A;  1J8Y F;  2E1M C;  2Z16 A;  4J01 A;  4RLF A;  4BE2 A;  5DQT A;  1X1A A;  4HG2 A;  2R7O A;  4YEL A;  1MW7 A;  4B3X A;  1YE9 A;  1V5G A;  2I8B A;  4U87 A;  1ST6 A;  3K6B A;  1ZHX A;  4IAO A;  4JCH A;  3JT1 A;  3FDQ A;  4KIT B;  4XQF A;  5EGY A;  4CS9 A;  3FKJ A;  1NU9 C;  3W2V A;  2VAS A;  2UWM A;  4XOP A;  4DBR A;  4QDL A;  3T6B A;  2HPI A;  3PNV A;  2V26 A;  2ZXH A;  3K4J A;  4RBN A;  3TMO A;  2O9X A;  2Y3D A;  4X0R A;  3UMH A;  2NUT A;  4I3M A;  3OYN A;  1NG6 A;  1T0F C;  2FUG 2;  3OOU A;  4YWQ A;  3F9K A;  2HDW A;  3KKB A;  4CZC A;  2HPM A;  4XLF A;  2LG4 A;  3ABM C;  3QZC A;  3CF2 A;  4NUB A;  3OYK A;  2H7O A;  3MKY B;  2WZF A;  3LLK A;  3FBN B;  4NQW B;  2WAE A;  3CSK A;  5HNF A;  3QMK A;  4JZA A;  2FFH A;  2VKD A;  4II3 A;  3BG7 A;  3HG9 A;  2A68 F;  2UV1 A;  2Y3H A;  4DVY P;  2UUZ A;  4BE1 A;  2WVQ A;  2Q9A A;  4AX2 A;  5D92 A;  3VYU B;  3MKZ A;  3K33 A;  4JJG A;  4Q7C A;  3MMY B;  4CCN A;  1UEL B;  4BJ6 A;  4K7B A;  3IP4 B;  2CGE A;  1FTS A;  4U5D E;  4LER A;  2GOM A;  3CJR B;  2XSJ C;  3PNT A;  4E7L A;  3S3O A;  1Z3X A;  3UGP A;  3DKY A;  3GOD A;  4YT4 A;  1JI8 A;  4C7O B;  3M1C A;  2OV7 A;  1ERD A;  5HVQ C;  3NDB B;  2D5R B;  4E7I A;  4XLE A;  1QLE C;  2XDV A;  3B0V C;  3PSF A;  4AU7 A;  4HEA 2;  1Z5Z A;  4BDY A;  3H5R A;  3L2V A;  4G7O F;  3OYA A;  5KYN A;  4HFK B;  3EHN A;  3MLG A;  4QPQ A;  2VB6 A;  3ZSU A;  1U0J A;  1RJ9 A;  3DZA A;  3I5Q A;  5FCL A;  3ZR8 X;  4KJZ A;  4BS9 A;  3L2W A;  2M4K A;  4JW1 A;  2AQF A;  2R4G A;  3CP2 A;  2BE5 F;  4Q5S F;  3K7D A;  3HPG A;  2WL8 A;  4MLO A;  3LL7 A;  4XKB A;  1DP3 A;  4BJT A;  4QI0 A;  4XLA A;  5LD2 C;  4CCM A;  2EIK C;  3VYW A;  1DGR M;  2W82 A;  2Q9B A;  3SDB A;  2X1C A;  1RJ9 B;  1TWH A;  1G8X A;  1Z6A A;  3DAF A;  3F47 A;  4XLN F;  1HA8 A;  3SEO A;  4IRU A;  2L5Q A;  4CSA A;  3I3L A;  3X1O A;  2J9U A;  4B44 A;  4OIR F;  5HLT A;  2JVG A;  3S8P A;  4BAC A;  2IXN A;  3H9G A;  2VQL A;  3RQ4 A;  2PJR A;  3AL0 C;  2IS4 A;  1O87 A;  3DPU A;  3KX2 A;  4C9Y A;  2DYS C;  4E7S A;  2J9W A;  1W36 D;  5DLJ A;  2A5W A;  4CCK A;  3DKX A;  3WG7 C;  2W4M A;  3VAY A;  2EIN C;  4F93 B;  2Q3T A;  3KMI A;  1LVK A;  2X1E A;  2OC6 A;  4BQO A;  1OCR C;  2IYL D;  3Q6N A;  1X1C A;  2G3V A;  5F5F A;  5B1B C;  2L9N A;  1PJR A;  4KIS A;  3ZVR A;  3OYB A;  2V9K A;  4CIH A;  3MKW B;  2K5C A;  3K70 D;  1FFT C;  3DAG A;  2XXA B;  2F5V A;  2LBF A;  4F92 B;  1YX3 A;  4MND A;  4ITV A;  2K9L A;  3ZGK A;  2IGO A;  4AYB A;  3OYI A;  1NG1 A;  4E4H A;  2CV2 A;  5CQG A;  3Q7L A;  1WJ5 A;  3OS2 A;  2HVQ A;  4RLQ A;  3H0D A;  1KU2 A;  2KHM A;  2KP6 A;  1DQU A;  3H5N A;  4XR6 A;  4F55 A;  1M2V A;  3FHD A;  1J8M F;  4LIT A;  2IXM A;  5CI8 A;  3BCA A;  2NUP B;  2J0X A;  2XRH A;  1NU7 D;  3C2G A;  4O7G A;  1Z7L A;  3LFU A;  1N78 A;  2FGY A;  2V7F A;  2KQR A;  2KQ9 A;  3OMY A;  4F52 A;  3A2K A;  2ZPA A;  3SNH A;  2CUZ A;  2WZG A;  5CPR B;  3VSK A;  5E3C A;  3RTR A;  2Y69 C;  3K1H A;  2LOO A;  4F91 B;  4B47 A;  1D0Y A;  2X6X A;  5JHF A;  1Y56 A;  4CCO A;  4OAY A;  2J7P A;  4DJA A;  3DXJ F;  2VQH A;  2CH0 A;  3ONQ A;  5KYW B;  2HQA A;  3NKD A;  3TD7 A;  3Q7G A;  1QZX A;  3W8I A;  2LRD A;  2VL8 A;  3AG1 C;  3B9Q A;  1WJF A;  2A6H F;  4I44 A;  3KYL A;  3H65 A;  1S9H A;  3UGO A;  3L2U A;  4BJ5 A;  4XOR A;  3EHM A;  2P0W A;  4MQ9 F;  2IXO A;  3CZ6 A;  5HOO A;  2KMU A;  3LSI A;  1LDK B;  3K4M A;  4XTK A;  3W8H A;  2CV0 A;  1OR7 C;  2V1N A;  2VJ4 A;  1FMW A;  2X51 A;  3PL8 A;  4N4O B;  3RSN A;  3VYT B;  5T3W A;  4PUS A;  2BVL A;  4C30 A;  1T95 A;  3EPZ A;  1WGW A;  3M1C B;  5DVW A;  1TZL A;  2IGM A;  4IX7 A;  4N4N B;  3K4C A;  1OCC C;  2CNW D;  2F6C A;  4U5B E;  4BXF A;  4C3E A;  4G7Z F;  2IXP A;  4A2N B;  4XLP F;  1PD1 A;  4IKF A;  2IS1 A;  1M2O A;  3UMK A;  3SEQ A;  4CS8 C;  4BQN A;  2XL4 A;  5KYU A;  1VK5 A;  5FRO A;  1YX5 A;  1WJB A;  3JRT A;  3PMR A;  4ULW A;  4W8K A;  3V7O A;  2E1M B;  3FHN A;  4FAS D;  3CJQ B;  4RMN A;  2V4J C;  2A69 F;  3LJB A;  4Y4R A;  2ZFU A;  3QYB A;  1M57 C;  3HXL A;  2VXZ A;  2VJJ A;  2WVO A;  5KHD A;  4HEA J;  2ZXR A;  4LLC A;  5F5H A;  4BJ1 A;  5D91 A;  2W00 A;  2WB7 A;  3PUB A;  4D9J A;  4HST A;  3LSK A;  3NWS A;  3QYF A;  3I4U A;  2Q1Z B;  2Y3B A;  2JVH A;  4U5F E;  4XWJ A;  2KPM A;  4J32 B;  3DU5 A;  3BG6 A;  1V5E A;  1EA3 A;  4YT2 A;  1X1D A;  1Z21 A;  2XC7 A;  2R7X A;  1TR2 A;  2P6V A;  2G3K A;  3K6G A;  3OYD A;  2RNG A;  2H7B A;  3I5P A;  4Q4Z F;  3VSL A;  4RD9 A;  4E7J A;  3HUG B;  1PD0 A;  3EH1 A;  4YEJ A;  3OS0 A;  3RH3 A;  3J7A Y;  2HVS A;  3OA1 A;  2Z2S B;  2ZSI B;  4OD4 A;  2VXD A;  2JA2 A;  2ZXI A;  5DS5 A;  3NKE A;  2R7U A;  4XL9 A;  4WJ0 A;  1ZYR F;  3W2A A;  3MD2 A;  5IY5 C;  5B1A C;  1N75 A;  4XKC A;  4XLC A;  2K9M A;  4YN0 B;  2XAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...