4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RAP1-INTERACTING FACTOR 2
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
3K6GA 4BJ6C 4BJ5C 3CZ6A 4BJTA 3OWTA
chains in the Genus database with same CATH superfamily
3RCOA 4UUVA 2RD9A 4O6YA 3T9OA 3I59B 5KYXB 4MNDA 2EFNA 1TFKB 5HDKA 2PMZA 2XC7A 3S0XA 2QSFX 4CDVA 4KISA 3T0YA 2QSGX 4O6JA 3FXKA 4HEAJ 2DTZA 3CCVI 5L0FA 4I76A 1YJGA 4KICA 2YQYA 4F4BA 4ASNA 1YA9A 1TTYA 3F72A 4OU0A 2HQRA 1Z77A 4XQFA 1LVKA 3OMYA 3RIRA 4XIDA 1Z63A 1ZZPA 2FEZA 5TJJA 1VTMP 4L5JA 2L9NA 2W24A 5IT3A 3FF5A 2QY9A 3RW0A 1QHGA 4WGYA 1GXQA 4L9TA 3BR6A 2J9BA 3ABKC 3T8RA 2V4JC 3K0LA 2JSCA 3X2QH 4XLCA 4LLEA 4F7ZA 3S1MJ 4PACA 1OFCX 1ZHXA 5B3IA 3V7SA 3GFMA 4II3A 4BHBA 3ABTA 4HFFB 2PG4A 5B1BH 4DYCA 1TW3A 3Q9VA 3QW0A 3REOA 1Z6TA 2G7HA 4TV7A 3PQKA 3FM5A 3ZQFA 2IXSA 4Y7NJ 1B72A 1ULYA 4M9ZA 4BEHA 1Z21A 4HX4A 4PUSA 2MABA 4IRGA 4AYBN 5BQGA 2ZCWA 1MBJA 3FM3A 4XN0A 4DW6A 5J1YA 4XONA 5K7FA 1BOBA 3C2BA 3C2HA 1SMYF 1OYWA 4M71A 4UUTA 1QVTA 5DM7F 2XS1A 3DTKA 3H36A 2EV5A 1BL0A 4DXWA 3H3UA 5F6FA 3BLYA 1U2WA 2A6EF 2UWMA 1UHWA 1LDJA 5CKTA 3LA7A 2Q1ZB 2L7MP 3ZMSA 3E5QA 2A69F 1K78B 2JD3A 3ZWIA 2CFXA 2H27A 2R93J 5EEHA 4O6MA 1KTMA 3DU5A 1IN8A 1NZEA 2XM4A 1R23A 3E9VA 2DMNA 3A0HC 1TQMA 1FMWA 4N0BA 4BY7J 3EUHA 3L0IA 1CQTA 2HMZA 3LEVA 1W7PA 4NQWA 1SFOJ 2TRTA 4C7OB 5HLGA 2ELJA 2CJJA 3DXJF 5LHIA 2L01A 4M3GA 3AGTA 5EK0A 3HGGA 4HF1A 1XDSA 1NLXA 2QKLB 3JYYA 1WN0A 3FDYA 3KYDB 2STWA 5KCMA 3GANA 5EZGA 2NRAC 2XLHA 3OOPA 4IAOA 2IP2A 2J5PA 3H5AA 2A05A 2BHZA 4P6IC 3TULA 1X4OA 5F0HA 2VBZA 2ICWG 1OJLA 1OR7A 4DNCA 3AAFA 2FOKA 2NXNB 1L7CA 3FXRA 3V8LA 1E17A 1MKMA 3C8GD 3Q3SA 4A4AA 1AEPA 4CS8A 4XR6A 3S14J 3NMIA 3M4BA 5E2QA 1QHHD 2ZPAA 5KYUA 1M6TA 1RETA 2D2WA 3RKOF 5IOYA 3FXJA 3DTIA 5E1WA 1KA8A 2BE5F 4G12A 2HNHA 1YX5A 5EZHA 3VEPA 3V4GA 4PZJA 1C02A 4JJFA 1MGTA 4ZZLA 1TFOB 1G3SA 3IUOA 2B9SA 2WZFA 1G3WA 2EIMH 3DFGA 2NVQJ 4A6DA 3UMIA 3S28A 1WVRA 2NSGA 2PX0A 1Y6IA 1OCOH 3FVYA 2A07F 2EIJC 3S17J 3ATPA 3AG4C 4HSTA 1FTSA 1WTYA 1WJFA 2ESNA 4G0HA 1Z6AA 4MIMA 3FDQA 4LLGF 2E1MC 2K85A 2VJ4A 3S16J 4A3MJ 2NS0A 1FJLA 1R00A 2XL8A 2XB5A 3SZGA 4YIFA 3LAJA 4FWVA 2J5OA 2FSWA 5TRDA 1UG2A 2EILH 2CU7A 4FETA 4XL9A 2IPQX 3BJAA 1AHDP 1ZHYA 3RVYA 2ZNZA 4C3IJ 1YW8A 3GO5A 2ZFWA 3WTZA 1VF9A 2E2IJ 2B0LA 4WF2A 2KIFA 3AL0C 1W1WE 1OXKA 2HZ8A 4BS9A 2ZXOA 3S32A 4CSAA 3RPUD 1XCVA 4HBLA 4XRSG 3LNRA 4AUXA 3DM5A 1L3LA 1J75A 4UNOA 1OW7A 2KYHA 4A3CJ 1MIJA 2E71A 4DZPA 2LMDA 1JHHA 1U9OA 3DEEA 3W6KB 4ZJZA 3ASOC 2DOEA 2R7TA 2NVXJ 3S15J 5HS7A 2PMUA 4HX7A 1HDPA 3RQIA 2NUTB 4RDAA 3UGOA 1JUSA 3KZIC 1DDNA 1BC7C 2DDAA 3GZ6A 1UJ8A 1IV6A 4RLFA 3IQTA 1AVOB 4CDAA 1VQPI 1FZPB 3SHFA 3GWNA 4C3BA 2OQGA 2CQNA 2L54A 3K70D 1X19A 2BEOA 3OSGA 1QLEC 4P9UA 1WH7A 2GXGA 3ABKH 3PNYA 1M57C 2OU2A 5L3BA 3DU6A 2HJ3A 4ESFA 1R4NB 1GV5A 2K5CA 3HXLA 2M4EA 3S27A 2L9SA 2DO7A 4ZDPA 5GAGJ 2IOQA 4GEHA 2OAZA 5JFRA 3ZC4A 5DM6F 3UR3C 4X1EA 3PO3J 2OTLI 5E17F 2TCTA 1QA6A 3F23A 5C44J 4E7JA 3IHUA 1RJ9B 4BKXA 3CCLI 3C1DA 3ZDLA 3J81Z 4Z2YA 1ZGJA 1HCRA 4PFPA 1P92A 5K5QA 1NSGB 1V74B 1DP3A 3OYNA 4RM2A 3M8FA 3VYRB 5J47A 2R7SA 2WB1N 1D8KA 4I01A 2NS8A 2GQQA 3NDBB 1Z1DA 4BJ5C 1Z0XA 1XC5A 4QTRA 3RYRA 1OCRC 1XSXA 3JAMZ 3LA3A 1B9NA 5F27A 3GTPJ 2I5UA 3V7RA 5CJ9A 1Y4CA 1ODDA 5FKLA 2QQBA 1LEBA 2RDPA 3N24A 4U5BE 1U0JA 2W82A 3FZVA 2K4BA 4OINF 4EJTA 2G9WA 3AOUA 2X0CA 2WBMA 3UMKA 1UAAA 3QMKA 1NBBA 4XWJA 2L7ZA 1TQIA 2M7BA 3V7CA 3NKDA 4XRFA 3DLAA 1SFEA 2X51A 3DM9B 4Q4ZF 2YL1A 1EI7A 3ESWB 1ZLJA 2ID3A 1IXSB 1T33A 1HXDA 2R5ZA 1PV3A 3TJ5A 3HJEA 3F8MA 1DU6A 4HF0A 4P96A 2ETHA 3VPRA 2J7PA 3A11A 1R9TJ 3K1NA 2R0QC 2H1LA 2KJCA 1YLFA 4PK4A 2H1KA 4Z9JA 2QBYA 1Q1HA 1QVXA 2LY1A 3CDIA 4IL6C 3V5YA 2ZXHA 2DBBA 1MNMC 3FK7A 3QQAA 5J1RA 2NNYA 1MDMA 4AE4A 2LYCA 5LD2C 2M45A 2K9MA 4YT2A 2JA5J 1HQCA 3V42A 5JLWA 3UKGA 1H89C 3J7AY 4UV8A 3P9KA 4XPWA 3T5XA 1PP7U 2DYRC 1XPXA 2IS1A 2XROA 3TO9A 1BR4A 2BW3B 2VXZA 1YE9A 5IT9K 3EYIA 1YOVB 3ABMH 4KC9A 4WABA 1WRJA 3I4UA 4YELA 5LHHA 5D8KB 3JR9A 3F6OA 4YFNF 4J19A 2GDCA 2FOWA 4LK1F 3R4KA 5CLSA 4YL0A 1I4ZA 1AUEA 1OYYA 2F5EA 1D1AA 4IZZA 2AWYA 1W36C 5DQZA 2PMZN 4S0HB 1XD7A 4XKVA 2UUHA 4NUBA 4HLXA 3WODF 2YKZA 3FOOA 3ZTMA 4QWQA 1VLSA 2LY9A 3SNHA 1K6OA 3TP0A 1RRJA 1HE1A 4BXFA 3EDPA 2B0JA 2KMUA 4XM3A 5K7HA 1OR3A 3KKBA 2FX0A 3U3FA 5AONA 2H8WA 3K4CA 4W1UA 2JN6A 3ZP5A 3H2UA 5LGTA 2XKOA 1CGME 2TMVP 2OCCC 4UVCA 4DIQA 3F3XA 3JT1A 2OQRA 5C3EJ 2XASA 3SZTA 4BE1A 3GODA 1Z7LA 1U6HA 4CYDA 4EVIA 3K1IC 2OKUA 1ENHA 2EH3A 3I53A 4BJ6A 1T6IA 2DYSH 4C3EA 2F48A 4EJUA 4U88A 1CF7A 3QPTA 2LG4A 5EGOA 4B8XA 3EG9A 3WTSC 1I39A 4U0YA 3RZOJ 2CGPA 2PBEA 5IY5C 4I44A 4NQFA 4GO1A 4PSXA 1T38A 4BBSJ 1BI2A 5DCMA 3M1CA 1SD4A 4KMFA 2HV6A 1B4AA 3MEXA 3SXYA 3LSIA 4A0ZA 4BEJA 1R4MB 4KBLA 1YIOA 5F04A 1Z91A 4FHTA 5M3FJ 2HI3A 1H0MA 4KMUX 1IUYA 2V1XA 4MNUA 1XB4A 3WE3A 2XUBA 2CCYA 2QVOA 1W5TA 4NTFA 4V2GA 4H0EA 3WG7H 2UZKA 1LDDA 4PGHA 3IP4B 1RUOA 5CQEA 4NY3A 1RCPA 2RN7A 3HTUA 4PFOA 3Q6MA 3L2RA 3SEQA 3TKYA 3EH1A 1X3UA 2LOOA 2V7FA 4CJGA 3O6BB 3I54A 2ZD9A 3GW2A 4A3DJ 3EGXA 2B0HA 1UCRA 1ZRFA 3BR1A 3AQCA 1WASA 2BGCA 3ZMZA 3DAFA 3JRDA 2VC0A 2QLZA 1JAFA 2P0NA 1S6LA 2MFZA 2IS4A 3HC7A 2H8AA 2QZ8A 3W6VA 4EBKA 2WAEA 3EG9B 4I1MA 2ADUA 2COBA 2X9DA 3OOUA 3B0VC 3PNVA 5E20A 3DAGA 4JTDB 1T9KA 3ITFA 1VQ9I 1ZLKA 1W7PB 5DD8A 1JOGA 2CYDA 3C8GA 2F2EA 5TISC 4RGSA 2VE8A 3GTKJ 5EGYA 2UXNA 4UY8I 1IW7F 3K4NA 4BXUA 4KITB 4MTGA 2XAUA 3AG3C 1W0TA 4Z9IA 2IEKA 1TNTA 3U9JA 2P4WA 2BC5A 2X6XA 4CDGA 3KYCB 1HSJA 5FD6A 2P6TA 1G3YA 3MLGA 4UUSA 2VB6A 3JRFA 2Y3DA 2H6BA 3GTOJ 2DB4A 4J7YA 3LLIA 4NC3A 2BXYA 2F5VA 3I3LA 4G8XA 1AU7A 5HODA 4EV0A 4CXFA 4A93J 1SVMA 1B8IA 4JZAA 4BAYA 1PDNC 1KNYA 1MBHA 2DOAA 2Z99A 4Z9HA 4ZLCA 3OA1A 1S5LC 2HTJA 1UHMA 4KN4X 4L5IA 5ICGA 3IL2A 2XGXA 2Y2ZA 3HG9A 3JSEO 4DVZA 1U78A 3KL4A 3KLNA 1EH6A 2CRGA 1R7JA 3M1EA 3CCUI 5AGFA 3JW4A 2QTVA 2MD5A 4NNJA 1RKEA 3ZQHA 4YFXF 4II2A 4U5HA 2JWTA 1AKHB 4XNFA 4WXDA 4ETSA 5L3EA 1HY5A 3D5SC 1JKOC 2HXIA 4AL1A 3AG1H 3JRTA 3CZ6A 1NFOA 1Y8RB 2L02A 3DEUA 5FROA 2CYYA 2LREA 3LOCA 4I09A 1TKNA 4AD9A 2O6GE 4F93B 4E7KA 2VN2A 2ZJ2A 3ABMC 5EEGA 1KYZA 3LAPA 2O5RA 3CMYA 4QI2A 1Z3XA 1FY7A 2RVCA 5E3MA 4GQHA 1X58A 2EV0A 4G6DA 5DUKA 2GAQA 4C7OA 2WAQA 3T6JA 2Y39A 1W2WA 2O8KA 4A69C 1FOYA 5HLHA 3KFWX 4AIDA 1A35A 3DPUA 4FX4A 2F22A 5GTIC 2MA3A 2EFQA 2EIKH 3TMOA 1KU3A 4IO9F 3WGIA 4MEXF 3GTQJ 1LM3B 3WTTC 3NYLA 1BC8C 4HFKB 1K7AA 2CUJA 5EF6A 1I3AA 2E60A 1D3YA 3FAPB 5JS5A 1K6YA 5FCLA 1K40A 4IX7A 5KAIC 4B09A 3JAMK 2HFHA 1OCTC 3U8PA 1ZR2A 1SZIA 3OS0A 1Z05A 3HGYA 2IXNA 1CF7B 3QYEA 4H4KC 1P6RA 4ZLDA 1IJWC 3RFYA 4AIJA 2HJMA 1LI5A 1D1BA 2R03A 1LEAA 3HSFA 4P9FA 4LB6B 2G3VA 5E8GA 1KU2A 4L6RA 3A2KA 2KZVA 3I55I 2LBFA 2CQQA 1XX5A 2Q8KA 1QSPA 2XAGA 5FKKA 2VJJA 1HKQA 1FYKA 2Q4FA 1QPMA 1AKHA 3WTYC 1W4MA 3BG9A 1RC9A 1KYWA 2JQ7A 1P9QC 1S8NA 3KMIA 1PUFA 3LQRA 4YT5A 3MAJA 3LQQA 4AU7A 4CA0A 5CIVA 5AIPA 1SFKA 3W3CA 4F91B 2VH3A 2IBDA 5J3LA 2W4MA 2WVOA 2ISYA 1HSTA 2ZJQF 2Z15A 2M3AA 3CCSI 3H3ZA 4PJJA 1JI8A 1GQAA 3BZKA 4M9XA 4JOMA 5KYWA 2HOAA 1OQYA 2ZXPA 1XSDA 2IXPA 1N25A 2M2EA 1LE4A 1OCZC 3K6BA 4A2NB 5HOOA 1FBUA 4EKWA 3HRUA 3GBGA 2Z16A 1EF4A 3AG1C 2RKHA 3DTEA 1UB9A 1QRYA 1TWFJ 4HV5A 5K5OA 3K4JA 1MMSA 2ZC2A 4K0DA 2HQ5A 1FBQA 5E3OA 3CF5F 1YRNB 1PD0A 2Y9YA 3MKLA 2EB7A 4D4XA 1P2FA 4MQVA 1QZXA 4Q5SF 4LERA 1BDJB 3LFUA 2YPRA 3NRVA 2IA1A 3T1BA 3PHF2 2LSEA 3SQNA 1O87A 1ZARA 3S2WA 4CZZA 2JMWA 4IRUA 2FA5A 5LRSA 1XGSA 3VYTB 1L3PA 5FLMJ 1YJ9I 4EBJA 2CQKA 2WZGA 3E3VA 3T8TA 2PFDA 5CI9A 3T6BA 1IN4A 4A3KJ 3J7YJ 5JR3A 3OYKA 3ZN1A 4BL0B 1DUXC 2HZDA 4G7ZF 3K4KA 2ZXIA 2LKXA 1YYXA 1VTNC 3WG9A 4F55A 3I58A 3DWWA 3OIOA 1V54H 2OJED 4A0XA 4UVBA 1MDMB 3H0GJ 1S3JA 4G7HF 2XF5A 4JTCB 5KK1A 1E3HA 1QQIA 5E1ZB 4ZYGA 3GEHA 2YLDA 2VI6A 2DT7B 3FWEA 2J0WA 4UDVA 4UB6C 3JTGA 5T1DB 2A0UA 4EATA 3S93A 1O3RA 2KFDA 2L7KA 5B66C 3Q0UA 4E6KG 3QYFA 3HOTA 3EGDA 4WGZA 5D92A 256BA 2K86A 4M6YA 1YIJI 4B43A 3DE9A 4DJ9A 3AQBA 1NU9C 5F5FA 2P7VB 2J9WA 4Y3OA 3G6EI 4ZDLA 1HOMA 1JHFA 1XS9A 2CW7A 4PJLA 1JR8A 4KT5C 2L81A 5ICFA 2VXDA 3LNQA 3G50A 4JE9A 3RF3A 1OCPA 4YRVA 5A6JA 3J7AO 3LSKA 1OXBA 3O6XA 1OCCC 2EIKC 4LLCA 2X6YA 3EHMA 4XEFA 2FE3A 3O8GA 1WI9A 2K9QA 4EM2A 3BP8A 1ZELA 4BJ6C 1MJAA 4BE2A 1Z9CA 1GHCA 1D5YA 3K4MA 4OIRF 3GCMA 2ETSA 3A01B 2YRFA 2N8GA 2K3PA 1ETYA 5DCMB 4BJ1A 2HV7A 4AYBA 5D5UB 3EUKL 2KK1A 5GPGB 1V4RA 2JZYA 3KP6A 2OEVA 2A6HF 2GZWA 5IYCJ 4N4WA 3VM6A 2H94A 4M3EA 2PFBA 3OV8A 4JKVA 3MBGA 4A12A 1AOYA 3U5SA 1SANA 1MH3A 2E34A 3BY6A 2F5DA 2KIUA 5FRNA 3PL8A 4Y33A 3OEOA 3Q0WA 2I8BA 2M8GX 3DJUB 4ENMA 1WHUA 3CCMI 5DVWA 3ISPA 2XLVA 1YS6A 2VBYA 3ULQB 2JPUA 4MFEA 2XL6A 2XGDA 1K83J 1QZEA 3WU1B 1ZKGA 2O0YA 4E70A 1ZG3A 4FASD 4YL3A 3K9TA 3TOLA 4IGGA 3F21A 1UMQA 3U8VA 1OCOC 2E36A 1WCMJ 3O8HA 3VSKA 1E85A 3U9GA 1H88C 2VQHA 4JYKA 4JEAA 1EA3A 3OYFA 3O3KA 2E2JJ 1Q0MA 4A5NA 1HLVA 4LB5A 2JA6J 5L0IA 2Q2EA 2MLGA 6PAXA 1DPUA 1WPKA 5C4JJ 1EH7A 2ZFUA 3G4SI 2FXAA 2W25A 5J4YA 1FFTC 4W97A 2M4KA 4CCLA 2DOFA 2O9LA 2DMUA 1LS1A 3IKVA 3BROA 3H92A 2KQRA 3LS0A 3K69A 3HSRA 1HDDC 4MO7A 3HNJA 3HKZN 1JKRC 4IOAF 2MHRA 2EZLA 3QAHA 1RIOH 3BPVA 5T3WA 2G0EA 4EJWA 5KYUB 1IRGA 1APCA 2EQRA 3LL7A 1OCZH 1LE2A 2O03A 3L09A 3OR1C 2IW5A 1H6GA 4MVRA 5F28E 3OIQA 1PUEE 2WWYA 5H6RA 3JRAA 3CC7I 2VL8A 4N6CA 2LKPA 3CJQB 5COFA 2MSYA 5GP9A 3ECHA 1LFUP 3RKYA 2K9SA 1TW2A 2R7FA 3SFZA 1FT9A 4J7TA 2HU9A 5J40A 4IOCF 4DYRA 2P5LC 1GXPA 3KEOA 2O9XA 2L9JA 3A9CA 4E0HA 1C0WA 1YO5C 1IG7A 2CQXA 2EZKA 3LESA 4JCHA 2WV1A 4GYGA 3IQ6A 1TNSA 2NVUB 3VYSB 1WWXA 4BDZA 2AXLA 4XOTA 1YA7O 3IAM2 1C03A 1NU7D 2W4BA 2DFHA 2ECCA 3I0TA 1MJ9A 2X85A 2YSRA 5CVVA 3A03A 3S8PA 2R4GA 4AWXB 4CYCB 3OS2A 4MTOA 2PBIA 2DA3A 2L9RA 3JYHA 2EIJH 4ULVA 1A7DA 2DXIA 4NC6A 1E83A 2LC2A 2R3SA 3FXQA 5LRRA 3N97A 3B9QA 4UXNA 3DPTA 3OYAA 4A3IJ 2R25A 3I71A 1YITI 1Z7Qc 2EIMC 3ZCOA 3OYIA 2DJNA 2W85A 3ML6A 4JJGA 5J8FA 3U2RA 4GYTA 1G2HA 2PP4A 3IRQA 2CUFA 4PCQA 2D45A 1RUNA 2KJBA 1YYVA 3ZVRA 3JRHA 1WATA 4C3JJ 1JPNA 4KDPA 2Q7RA 4XBFA 1QNTA 3FMQA 2NVTJ 1HMDA 3MX3A 3K7AJ 2L7FP 2LR8A 1USTA 5DLJA 2D4UA 3MYIA 3P9CA 3N4MA 3IH3A 2A1DD 1XMXA 2J0XA 1RESA 4CIHA 4IPAA 2ZSIB 3TW7A 3ERMA 2A6TA 3PCVA 4HDUA 5L0HA 1P4WA 1TQGA 1WH5A 1LKXA 4HW0A 3TQOA 1I27A 1KU9A 3IH2A 4MTEA 5LHGA 2VKVA 2AQEA 1GM5A 2IGKA 2NOJB 1FAPB 3KP2A 4PJMA 3DKXA 4RDUA 3NEUA 3L2VA 2J8WA 2DFEA 3SEZA 3VF0A 2BV6A 3KP7A 2IVMA 3SYNA 3ABLC 3WU0A 1IRXA 2VASA 3L9FA 3EGXB 4CCOA 2V1UA 4Q48A 3U3BA 4QDLA 3LEOA 1YARO 1T56A 4RAZA 4BUPA 4AE4B 1A7EA 2ZXJA 1G5ZA 3SZPA 2YL3A 2F4MB 3W2WA 3HOWJ 2GWRA 1FP1D 4BEHB 3CCYA 3LS1A 1OR2A 5EG0A 3KEYA 1KGSA 3DEWA 1F1ZA 3NQOA 2E1NA 4OIQF 4QI0A 2XV4S 3F8FA 3M9AA 1BR2A 4KYWA 2W48A 3L7WA 3U2LA 4ZYAA 1VQLI 1SC7A 1XTAA 3EH2A 3B0UX 2M5WA 1A7VA 3ECOA 2GXAA 4IWBA 2YHSA 3S29A 2VCBA 4ZYEA 1T98A 1JKQC 1K78A 1XWJA 2LRDA 2QWWA 1SYQA 3HUGA 3OL4A 1ZGWA 4ON0A 2YX4A 2QKMB 3G1LA 5ILUA 1BIAA 3H0DA 1T2KA 1LI7A 4O7GA 2IA0A 5A2QZ 2EILC 2MGQA 2HOEA 1K4TA 2K3FA 1V54C 4IEJA 1ORKA 3HTSB 2DMQA 3H1CA 1XG1A 1U6GA 2KJGA 2XHKA 2XLMA 3ECSA 1JT6A 3ASNC 3V7OA 1DPRA 2LIGA 1TBXA 4J00A 2DW4A 2X0LA 3HBLA 4I7HA 2WB7A 1U5TC 2G62A 2JVGA 2LNBA 3LJBA 1YYJA 3KYJA 2YS9A 1MQVA 4EUKB 3S3NA 5BPIA 3BT9A 1VI0A 1X3WB 1LPQA 3SEOA 2LD5A 4GYIA 3MFNA 1XMAA 5LEJA 2DYSC 5EEAA 3RQGA 1IZ1A 2EINC 2ZXRA 2MC4A 3LSGA 2ZMEB 3BTIA 2DCEA 2RREA 1VOMA 2Q3TA 3EUAA 1UFMA 4LGWA 2E5ZA 3M8JA 1FMVA 4RB3C 4A3GJ 4X0GA 3KYIA 2B63J 1Z7UA 1FTTA 3EGDB 4YJWA 2YR2A 2BXZA 4XQ1A 2DGJA 1UG7A 1F43A 5COGA 1VQ7I 2NUPB 2KQ9A 3R0AA 2DPDA 2PNOA 1RZ4A 2HYGD 1MSEC 2XLOA 1JTXA 3GF2A 3EYYA 4NTBA 2R5YA 2HYJA 4XTKA 5E18F 1P7JA 1ZGAA 3QP5A 3VFZA 2GA2A 1IUFA 4HA8A 5GPCA 5M5YJ 3CTAA 1NG7A 3TDZC 3GORA 4EQQA 2Y69H 4S05A 1BA5A 2DFFA 1BBHA 2P1AA 4FAPB 3UGPA 3GTJJ 2CH0A 2R9RB 5B1AH 5LEKA 2HTSA 2NNNA 3NRHA 4I02A 4Y4RA 1K79A 1ERDA 2J7PD 2VKDA 2FBIA 1TT5B 4AC0A 2YL0A 4EHPA 3CJRB 3RKQA 2R92J 1ETQA 3PIPF 3CLQA 4P1WA 4NCQA 3BPXA 1WJ5A 4JTAB 2M1BA 4IQ4A 3CDHA 4HLYA 2DYRH 1WJBA 2L4MA 2I8DA 1P4AA 5B3SH 1E2XA 3KCCA 4PJ0C 4Q7CA 2VOPA 3LSHA 2A5WA 2VJIA 3VAYA 3ELKA 2XXAB 1A5JA 1S7EA 3G2BA 4MTDA 2LCHA 4B6IA 3RI4A 1FOKA 3BQZA 2XKPA 1S7AA 4CCMA 3CMAI 3Q6NA 2QCOA 3I4PA 4A2UA 4CBEA 4YIIA 1BI3A 1IN7A 1EH8A 1A04A 3PFYA 2X1EA 3AFHA 2OD5A 5F0CA 4IARA 3HNIA 2P6SA 1FX7A 3C3WA 2LDUA 3VODA 4W8PA 4M72A 3TO7A 2CV2A 4G7OF 3VSLA 3HUGB 3TJ6A 1LE8A 1NHAA 3VDXA 4HYEA 1ZAOA 1XGNA 2A3SA 4XRMA 4CICA 2KNHA 3QTHA 3RYPA 2L7AA 4MVMA 2LVSA 2H7BA 4IHXA 4MQ9F 4XMYA 3C62A 3FXHA 1OISA 1VYIA 2JA2A 2F5CA 4L0ZB 2XAJA 3NYMA 3S1NJ 2JJ7A 1IRZA 3B0PA 1G3TA 1MMDA 4P5OA 3US6A 4XRSA 3BQYA 2CW8A 4C3DA 5JUAA 2AS5F 2E5NA 5CPRB 1ZRCA 3LSJA 2QENA 3CC4I 2GLOA 2L9VA 2V6CA 3ABLH 3S3MA 2LY2A 2GIVA 1JGGA 4E7SA 4LD5A 1BM9A 3WG7C 4WXHA 1OPCA 1G4DA 1Y8QB 1Z67A 3J80Z 2P8TA 1IXCA 3BTLA 2XGEA 1SEUA 1XMKA 2VBWA 5KYNA 5HSWA 3OYCA 1GV2A 3HNLA 5JHFA 2LK2A 3LSPA 3JCUC 3TO6A 1ETKA 1I6XA 3WGGA 1FYMA 3ZQQA 3MN2A 5J4VA 1Q0DA 4I0BA 4GXOA 2WV0A 2HKXA 2QNLA 2V3CC 1XCBA 2K9NA 4R8HA 1T6UA 2XL4A 5M5XJ 1FSHA 3F47A 1XGMA 2DT5A 3F9KA 4DBQA 4F52A 4LIUA 2XIGA 3FK6A 2ZB9A 2X1DA 4E17A 2CGEA 2FNAA 1Q0KA 2LD6A 1PP8F 4L18B 2EA2A 3DQVC 2KLOA 4I99C 2XLWA 5D4RA 4FE4A 1D0YA 2KC3A 4CSAC 5ERIA 2QEXI 4DZJA 1DGWY 1WJEA 3RJPA 1PD1A 3MZ8A 3EHNA 1ITYA 2R7VA 2FF4A 4ZTFA 2HKVA 2J45A 1W36D 1V4AA 2XB0X 3H9GA 3OY9A 4BGDA 1VQMI 3TOMA 2CSOA 2F4IA 1DOVA 3GM2A 2HZTA 4ANJA 3K66A 2NVYJ 3CCJI 2Q9AA 3SXZA 1ORJA 2DT6A 5J6XA 1EA8A 2IGNA 5HV9A 1XN7A 3ASNH 4CHUA 3HDDA 1FWZA 4CIPA 1HKTA 4CYCA 3F8CA 5M5WJ 4E7LA 5DTDA 3DZAA 3H35A 4K7BA 4J01A 1YFHA 5IY5H 1R49A 4D0PA 4RLQA 3WE2A 1BR1A 1FPQA 3ERED 1FOXA 3GWLA 3M15A 2JPCA 4AX2A 3DD7A 1YVIA 2BL2A 4IHYA 2L5QA 1JUPA 2BY1A 3U2MA 3FMSA 3BG3A 2UUIA 3I4MJ 3NWTA 2V79A 4NC7A 1Y39A 3BZ6A 2V6EA 2LFFA 1ORYA 3CQZA 5GPAA 2AHQA 4ZTJA 3BCAA 4OAZA 1HW1A 2JUCA 2MD0A 1J5YA 4U9DA 5EYRA 4EMSA 4RGRA 2FBKA 5CVUA 2M34A 4U0VA 2WAQN 3E5UA 4B47A 4CS9C 4IQJA 3GVAA 3PUFA 2MWQA 3CCQI 2OCEA 3G1OA 4XLPF 2D5RB 4JCZA 2HEOA 5AC4A 2HXOA 1FIAA 4G94A 2DU9A 4C30A 3TK0A 4AVZA 4NTAA 4W8KA 1OW6A 3BRJA 1TC3C 1K61A 2O61A 5GADJ 4C2MJ 1IC8A 3POVA 3O2PE 1LPEA 5KYWB 4V2FA 4CCNA 3BG6A 4EGZA 3FXLA 2OEXA 3S84A 4M73A 5EJCA 2RAEA 1FNNA 1ZQ3P 2OQMA 2QQ8A 4NBQA 3IKTA 3MZYA 2R7DA 2IYLD 3L34A 2EFPA 3HPGA 3EUHC 1BW5A 5JLIA 1MSFC 4AM3A 3E1SA 2Y48A 3R61A 4OD5A 2XDVA 1J0RA 4LG0A 2X6WA 2R7XA 1RKWA 3HM5A 3TGNA 2Q9CA 2W00A 4HG2A 4B48A 4NDLA 2RGVA 3QU6A 2DPUA 1FIPA 1YLMA 4BACA 3ZQIA 2Y3HA 4ENJA 4ZC3A 3I4NJ 1UG0A 2ACJA 4R32A 2STTA 4RMNA 2NSFA 1ZYRF 3R60A 5LGNA 3JSZA 4O5VA 1SVOA 2EK5A 2VLAA 5CQGA 4XEKA 2IA2A 4MS2A 3N0TA 1H7IA 4JURI 2R7WA 5F08A 5DS9A 1G59A 5IOZA 2R05A 4CS9A 3LSRA 1LVAA 4XPXA 3H9JA 4FT8A 1J9IA 2J9VA 3HHHA 5FO5A 3W4YA 2CUEA 2HQNA 3FHZA 2DJIA 1ZW2A 4GCVA 3P5JA 1VB5A 1USSA 3CD6I 3IH4A 1YW9A 5JLXA 5FKOA 3CUOA 3EPVA 1QU3A 3I59A 4G6TB 5KYXA 1J2XA 1O7FA 2A68F 2KHMA 1HMOA 1T6SA 1X1CA 1T08B 1QGPA 2WADA 3GEEA 5E79C 1LNWA 4RAGA 1QPUA 4RS8A 3CLOA 3W2AA 1SVLA 2GBYA 5IP9J 5D5VB 5EG0B 3KE2A 3MVPA 1TR2A 5HNHA 1BZ4A 3MKYB 4ESJA 1G4US 1A6IA 4U5DE 4ZYHA 3F22A 2RNGA 3IRRA 3E6CC 1MBFA 3CUQC 2JRTA 1GLNA 3OYLA 2JA7J 4N4NB 5HS8A 2AXTC 3CAXA 3SP1A 5BUOA 2LKSA 2M30A 1VQKI 3HOZJ 1GVJA 3EZIA 3U1KA 3B29A 3K4LA 3WTWC 3ZXSA 5JSLA 3K1MA 3GTLJ 2L6FA 3G1MA 1E84A 2A5YB 2DMPA 3WTVC 1GDTA 3C7JA 3CMMA 2V9PA 4A6EA 1S72I 2VQLA 4FQGA 4AIKA 2VC9A 3Q7LA 1TWCJ 2ZMEA 2DFIA 4I98B 4MW3A 5BQIA 4ENKA 1X1AA 4BQAA 5FLXK 4NQWB 5F0FA 4JQFA 2QBYB 3M4OJ 2KDOA 4X0RA 3JREA 4AK9A 4QIWN 3P7NA 2JSPA 4XSXF 2GOXB 4ABZA 9ANTA 1OCCH 3TL4X 4QLCU 2VJ5A 1V3FA 2FUG2 4KNYA 3J06A 4OIPF 3D0SA 4MTFA 3TDUC 4BPMA 1EQ1A 1J8MF 2YX7A 1T39A 2JRMA 3CC2I 2M8EA 3HIFA 3ZMUA 2Y69C 2LP0A 2XXAA 1JE8A 3GFIA 4JX6A 4XN3A 4Y17A 4FTHA 1GT0C 1WI3A 4CZCA 3C63A 2P6VA 3V5ZA 4JBAA 1POGA 3A1YA 4BH9A 2L3DA 2FFHA 3K33A 5KYYA 4L9NA 2IAIA 3D5LA 3IWFA 4JX4A 5A2QK 2W57A 5BMZA 4XLFA 2E7WA 4MVUA 3COAC 4XOPA 5IT9Z 3DKWA 4M74A 2QUFA 4S04A 3T4RA 4XLNF 4BU2A 4WXCA 5D8LB 3ZR8X 5F1JA 2XF6A 3IAS2 4LFUA 3S90A 1STZA 2OU6A 1PJRA 4HF2A 3PDMP 2W9YA 5E3CA 2FQ4A 3CUQA 2NAZA 2EZIA 4LK0F 1K05A 2VONA 3A4CA 4RAYA 3D1NI 3JTLO 5L0GA 2X6OA 4CUGA 2LF8A 3QYBA 2XGCA 1ACIA 4EWCA 4IJJA 5EHHA 3DWLE 4N06A 2KPMA 4EIYA 2NUPA 4L9VA 2MH9A 4FCYA 3CP2A 3U0CA 1OLTA 3PSFA 3LWFA 3KIOA 3ROUA 2R5YB 2VQGA 2X1CA 1J09A 2XRNA 1J8YF 4LITA 3ZQLA 4C3HJ 3BOQA 1B9MA 1O3SA 3BEHA 3OYBA 2IS6A 5L3FA 3DMDA 4DVYP 2XM0A 2DK5A 4B4CA 2OV7A 4BDYA 3E7LA 3K2ZA 2LFDA 2L2OA 2DA1A 5FD5A 3LMMA 1LIHA 2HPIA 4EBBA 3S9OA 1X4PA 2M87A 2HMQA 2WA0A 2J46A 4XKBA 2QQ9A 3E0JB 1FNTc 4IF4A 1X1DA 1B68A 2XPWA 4NC8A 1AWCA 1YDIA 4E7IA 3SDBA 1MMAA 4EJOA 4RBNA 3OYJA 1YRNA 2EV6A 2E87A 1LE8B 2LF7A 3EZHA 3HJCA 2OCCH 5L3VA 1LS4A 5IYBJ 1REPC 1YW7A 3NYJA 2GA1A 4MVOA 2IRFG 2RV8A 4A0YA 5TGTA 1R36A 2ZBKA 1YG2A 2WC2A 4EM0B 2F4OB 3NAUA 3C8ZA 2P5KA 4D5FA 3BG7A 4KIGA 2KRCA 2OBPA 3BR2A 3BG5A 5ILSA 3GTMJ 4KIFA 4HRIA 2JA8J 3ZQCA 1WKMA 1S05A 4O6NA 3IV5A 3QOEA 2V1DA 2WTEA 1Y0UA 2VODA 3DLLF 4YWQA 3FXOA 3DKAA 3ONQA 3SYTA 2Y0SN 5FZTA 2V9VA 3G73A 4LIVA 5H6QA 1QBJA 1FTZA 2JPBA 2HSQA 3ZMVA 4DRHB 5K5RA 4E18A 1O3QA 5L3GA 3EJNA 4KUMA 1M2VA 2HQAA 2C6YA 2EBIA 1X3ZB 2YZSA 4MHGA 3VB2A 2VKHA 2WB1A 3ZQYA 3QRFF 2KIMA 1AA7A 2H8RA 1I5ZA 3T6GB 1NH3A 3GEZA 1VQ5I 3RQEA 1WWPA 4XLHA 1R5ID 2OUMA 2MC3A 2DDBA 2R5ZB 3UMHA 2G7UA 2HVSA 3BDDA 4CCJA 2FMLA 1CGOA 5KNLA 2XAQA 4B3XA 3ZPLA 2HWVA 2BVMA 2JTVA 5FKMA 3PUBA 5DV5A 4XEVA 2XAFA 3NARA 1X1PA 2L4AA 3M3YJ 1P4XA 2QLAA 4XKCA 2EPNA 4KI2A 4YL1A 1SD7A 1NG6A 3DPLC 4LMYA 4Q47A 2G3KA 4RBOA 1B59A 2M7AA 1ZHZA 3O39A 4HSRA 2AQFA 2ZSHB 1BW6A 4BHCA 2DA7A 3N05A 2VOOA 3DI5A 3P9IA 2M4GA 5DYMA 3W2VA 4LG0B 2PLYA 1DOWA 3RQFA 2DAOA 4CO8A 4XK4A 3GLXA 4D9JA 3AG3H 1TWGJ 3BR5A 4KNVA 4BQNA 4OIOF 4WK8F 1LQ1A 1HW5A 3V8KA 1V55H 3LA2A 4D7NA 2KP6A 1PUFB 2KT0A 1SF8A 3R2PA 1JTYA 4XICA 4OOIA 5BNGA 1APLC 1Z5ZA 5FKNA 2YVKA 2DA6A 2GOMA 2Y0MA 2MBFA 2OPTA 2CNWD 5JRAA 1ZRDA 1XZQA 3BTJA 3DKYA 1VQNI 4YN0B 1XDUA 1OQCA 4DQ2A 5C4XJ 3NMJA 3I5PA 5K0IA 1W5CC 1R1TA 3B6CA 2AU5A 1F36A 3GFLA 3E5XA 1F4KA 5HVQC 1EKEA 3CMEI 1ON2A 4YFKF 1P7IA 5IPAA 3EPZA 4XLAA 5EDNA 4MVSA 3FBIB 3FKIJ 3CJNA 1X2MA 2LSOA 3V5XA 2FD5A 1MBGA 3JTHA 3WGHA 4BHPA 4F92B 1IRFA 4AVPA 3HRTA 5FLVA 3C8GB 2CQ7A 4WX9A 4M63A 4HQEA 3ZQGA 2ME0A 3PM1A 4HNTA 2FAPB 1ETOA 3IPMO 3GWZA 2L0KA 5D6EA 3Q5FA 5HS9A 1U8BA 1A31A 3AGUA 2FRHA 2CNWA 4U7BA 3CQZJ 1N78A 5KVRA 2R7OA 5DQTA 4IHWA 4BQOA 2F6CA 2LTPA 3A02A 3ZGKA 2I10A 4CDYA 1D8JA 2XLDA 2UV1A 1LUJB 1G6NA 2ZXWH 1UHSA 2YEVA 4UV9A 4EGYA 4HDVA 2XAHA 2Y9ZA 2EPKX 3HKKA 3M1CB 2OC6A 3HOUJ 3K1IA 1V5FA 5L0JA 3HL2A 5J1UA 1ST6A 1IAWA 1RXQA 2TDXA 4U0WA 3DBHB 1KZHA 4J32B 2HUJA 2BY0A 5L0DA 5DCFA 2QGUA 1WGXA 3WTUC 4V19K 3AG2C 2DMTA 1YHQI 5B1AC 2XRLA 4IJAA 3CJTB 2KDZA 3SXMA 3WAQA 3K4BA 2ASRA 2OOCA 5A6KA 2YWAA 2E1MB 2Y30A 1IDYA 1YI2I 1ZW3A 3LUTB 1TWAA 2FQ3A 4MFDA 5KHDA 4LDRA 4O3MA 5JT4A 3QU3A 1CPQA 1ETVA 3QOPA 3I5QA 4C2TA 3RQ4A 1FSEA 1R58A 3X2QC 3QVZA 2E19A 4JC7A 4LOCA 2ISZA 3HPHA 3JRGA 1BOAA 2QUPA 2K40A 2Z5UA 5GTHC 4HNUA 4HV6A 1LDKB 5FJ8J 3CP8A 1HBXG 1UELB 3WHBA 3HYIA 3ZTZA 2CUZA 1KQ8A 1BBYA 2NG1A 2WY8Q 3OYHA 1I6HJ 1YAUO 4WCGA 2EINH 3FISA 3QZCA 1E86A 2OG2A 2Y0SA 2PX3A 2ZKZA 5D5WB 5A6BD 1MNEA 3TOBA 4CX9A 1JRAA 3LLKA 2DN0A 5COMA 2DK8A 3S1QJ 4ZYDA 3EFOB 1TLHB 2O3FA 3K6GA 3E6MA 3PQJA 4AIHA 1XSVA 3H5NA 2IT0A 2XVCA 3TOAA 2L6GA 4JEBA 4BY1J 3LSMA 5AC5A 4DOZA 2DA4A 5GAEJ 1VQ8I 4YEJA 3NWSA 1VQ6I 1I5NA 1QZZA 2NUTA 1R1VA 1HF0A 1HW2A 2MH2A 1JKPC 3U9MA 3QP6A 2HVQA 2RSEB 4LJZF 3HSEA 1WQ2A 3HOYJ 2VC1A 3TP3A 2HKOA 4BE0A 3KP3A 2R7ZJ 2QYOA 3E6DA 5E1XA 2XF7A 4RGXA 2PF4E 1RR7A 5EGOB 4MVZA 3ABUA 3JRIA 4G9YA 4U87A 4NHJA 3VYUB 3PIOF 3FXMA 4M3DA 3CEXA 3RH3A 1RNLA 3F6VA 4U5FE 3DP7A 4L0YB 1TZLA 2Z3YA 5LGUA 4C9YA 1ZN2A 2ZJPF 3EFOA 1S29A 4N6HA 4R1HA 3BJOA 4JVSA 3EETA 2KW3C 3W8IA 5KYYB 2KSFA 1YQAA 2DA5A 4J30B 3BWGA 4BEMJ 3ZOBA 3ZRGA 1ZTRA 5B3SC 2Z9OA 3BR0A 1W0UA 1VLTA 4PSWA 2FNPA 3H65A 2DQRA 1ETWA 2R7QA 1JMWA 2QQAA 3WU2C 3L2WA 3CUQB 3RKWA 2HDWA 4FISA 5IYDJ 1BI1A 1FOWA 3V8JA 3SJMA 3RPUA 2HOSA 3JZ0A 4FESA 1FYLA 4BQQA 5JVEA 2HOTA 1IXRC 3U21A 4GDFA 4IHSA 3HRSA 2WVNA 2KGOA 1F9NA 3OWTA 1I4YA 1Z3IX 4B1RA 1WSUA 5L3QA 1J7KA 3F8NA 2BVLA 2HS5A 2K4JA 3GLLA 4ENNA 3GM3A 1ZHWA 3OYDA 5A6AA 4D4NA 3W8HA 3QPSA 1JUMA 2BHYA 1NK2P 4JW1A 4IRIA 1T8IA 2O8XA 2WVQA 1H9GA 4DBRA 1I50J 3FOPA 1QO0D 2NYXA 3K1HA 2HFIA 2CG4A 2H09A 3M8EA 2X48A 1O3TA 2ZMEC 2ZNYA 2CO5A 5DUIA 2OTJI 1MNDA 2ELHA 3AL0B 3DF8A 4HAMA 5F64A 3GYHX 2Y31A 2XS8A 4M3FA 2PJPA 3H2VA 5DS4A 5JI6A 1TT0A 5D5XB 2FGYA 1W5SA 4UHTA 2VKEA 5CVIA 3ZMTA 4M3BA 1WJDA 3I5UA 1Y1VJ 3M4CA 4I2OA 1T0FA 4PR9A 5K7ZA 1T0FC 4M6VA 2ZXWC 2D1VA 2FBHA 1R1UA 1MW7A 4UVAA 4LDKA 1GUUA 2K27A 3GTGJ 3HNKA 5ILVA 2WL8A 4A3FJ 1FR0A 4E7HA 1Q1VA 3O10A 4RB1A 2P61A 2HR3A 3VOEA 3JRMO 4PJNA 1O7LA 1F5TA 1U0BB 4KT6A 1ZR4A 5DEQA 1U3EM 3KLOA 2IXMA 3ZMDA 2IGMA 2VBXA 5BQHA 5IP7J 2GFHA 2P81A 1U8RA 4E4HA 2Q2EB 3HZJA 1QVUA 1MZBA 3H5RA 3VYWA 1ON1A 2HYFA 1DGRM 1MH4A 3GZNB 3BCBA 3SFIA 1HC8A 1WFXA 1D5VA 1A0BA 1PCXA 2LH9A 4K1OA 5E33A 4RA2A 3N2ZB 2WAFA 5CVJA 3WTXC 1OKKD 3R7CA 2IS2A 2PEXA 3L00A 2XPVA 2EWNA 3WHNA 1YJWI 5DS5A 2VT2A 3SDGA 3OR2C 3G71I 1TWCA 2HGCA 4CGZA 2VPRA 4R79A 5L3CA 1EKYA 2H6CA 1OR7C 1OYIA 1WJAA 2NOGA 4X6AJ 3C18A 3GMEA 3L2QA 2HDCA 3FBNB 1NK3P 2O7OA 2ESHA 2EPOA 1CGNA 2PI0A 3GZ5A 3MKWB 2HVRA 2IBFA 2GAUA 3H9QA 3AG2H 1UFBA 1YZCA 4FX5A 1GVDA 3QODA 1SMTA 3G4ZA 3H3VK 4QSHA 1JXSA 5FB2A 4DRIB 2DODA 5JVTA 3LAYA 4HEA2 1E3PA 1GGQA 3E97A 2UXXA 3MFKA 2XRHA 4A3BJ 4ONSA 5HLTA 1RPWA 4D7MA 3MWMA 3IC7A 5FGMA 3CCEI 2ID6A 3CDLA 3MD2A 4Z6YA 1HA8A 1ORSC 4ULWA 1N1CA 2XSDC 2LLKA 4U7DA 1LB2A 1WZ2A 1O3UA 2P7VA 2BY3A 3AG4H 1T01A 5A69A 4FX0A 4ZDOA 2BBYA 4XPYA 1XZPA 3KYLA 4K2EA 3HTKC 1T5OA 1KQ0A 2NPUA 2QF7A 3F46A 2LBFB 3A0BC 1U9NA 1B8IB 2VCAA 3IQCA 2K7LA 4QPQA 3OYGA 2KKOA 1C17M 5K1YA 1N75A 2CWEA 2ME6A 2GXBA 3ZSUA 3A01A 2QSHX 4UUSB 5JHUA 1MJBA 1IV8A 2LQGA 4XORA 3NMKA 2RQPA 1S7OA 3NKEA 3CO6C 5J8CA 5ICEA 2CMPA 3MQ0A 2LP4A 2VCCA 3RTRA 3CESA 3PFIA 4UB8C 2HSBA 5GAHJ 3HOSA 3PMRA 1OKRA 3SXKA 3QVYA 3DBRB 2M0CA 3I64A 3LFKA 1G4WR 1OMIA 3S3OA 2YU9J 1U89A 2M64A 2K02A 1RI7A 1SD6A 2UUZA 4YK5A 2KL4A 3K1PA 2BOLA 2XSJC 2RNJA 1S9HA 2D1HA 4GRIA 2YL7A 1TQPA 1SD5A 5IP6A 3AKZA 2OZ6A 1H9TA 3AJMA 5KAFC 1Y6DA 3FMRA 4IB4A 1IDZA 4E0IA 2Y75A 4BJTA 2DQLA 2Z2SB 1ZH5A 3OYEA 4OD4A 2OF7A 1MBEA 3KP5A 1MMGA 2OA4A 5D91A 3CSKA 1SAUA 3B73A 2GIZA 2VE9A 1OW8A 4U5CE 1CPRA 3DBLB 4IHVA 4I1OB 1LFBA 3S2DJ 4YIRX 1A41A 2EPMX 2GM4A 1PVEA 2ELKA 1L0OC 1FFHA 1QKRA 2E2HJ 4A5MA 1WGWA 1VFCA 5LBQA 2P0WA 1V5EA 1IZMA 1FLIA 1Z3YA 1ZU5A 4AL0A 3OL3A 4KA4A 4QPOA 5ICCA 1YX3A 1PYVA 4KN7X 3L1PA 5DDGA 3F0CA 3F8BA 2M0MA 2K9LA 3S1RJ 2WZLA 3KEQA 3BTCA 2MYSA 2MLKA 4DYQA 1OCRH 2E35A 4EM1A 3JRCA 1F1MA 3RVZA 4MW8A 4YG2F 3CF2A 5D4SA 2Z33A 2J9UA 3HB9A 1SFXA 4ZH4F 1QZYA 1Y56A 4LDQA 1Z23A 4P55A 2V26A 2Y3GA 5DD4A 1FEXA 2A0BA 3KETA 4NB5A 1DU0A 4RM3A 2A61A 1YTYA 2Y3BA 1KONA 4B44A 3ZQ7A 2AVKA 2ECBA 2H7OA 3KP4A 1RMVA 4U5GA 4JX5A 4HQMA 3TQNA 1D1CA 2R02A 4RD9A 5FRMA 4G78A 3MCZA 1R5GA 3Q0VA 4B3AA 1KU7A 2HDDA 1K04A 5F1RA 3HRMA 4IXAA 4BBRJ 3GUDA 1HKSA 4G6QA 4FE7A 1D0ZA 4BXXJ 1A36A 2V9KA 2VUMJ 2EPFA 4JIOA 3PJRA 2JT1A 2EFWA 2DI3A 2OZUA 2VIXA 1VQOI 4YT4A 3IQ5A 3JCUQ 2BYVE 1TWAJ 3L2UA 2QE9A 2FJ1A 2X4HA 3D5RC 2EZHA 3QWLA 4JP0A 4HOBA 1ZHFA 3FHNA 1KQ9A 2ZO4A 4HNVA 4CS7A 4DRJB 2W1OA 3J81K 3CCRI 1W7PD 1FC3A 3MYFA 4IVNA 2PMHA 3R0JA 4LLLA 3J7ZI 3HKZA 1DP7P 1RKEB 4N4OB 3K70C 3MZHA 2F5FA 2W7NA 3O55A 3JSPA 2LK4A 1I1GA 1K4SA 2EPLX 2IXOA 4M6XA 1J59A 1NTCA 1LFPA 4D5CA 3CO7C 3DV8A 3TBIA 4A3LJ 5JP7A 5DS6A 5B1BC 2IJLA 2D5VA 1U5TB 4Y15A 5BPDA 2RQQA 3LNMB 3HEFA 3I9V2 1ZG5A 4ESBA 3RSNA 1GS9A 2CFOA 5D6FA 4CH7A 1NG1A 4RGUA 3M79A 5L3DA 3TD7A 2AP3A 3QPLA 1TL8A 1V5GA 1BN5A 2PQ8A 4CJOA 3E70C 3QW1A 1D0XA 1G8XA 4I3MA 2EJRA 4A3EJ 1A6QA 1BJAA 1Y0NA 2ZJRF 4BG0A 3E6BA 2MW8A 3GXOA 1O57A 1M56C 1JJ8C 2BZTA 3WHCA 2FU4A 5H20A 2W84A 2B7EA 2QM3A 2COMA 3QPHA 1B72B 2DA2A 4IKFA 3LSTA 3OIPA 4RB0A 1RR8C 3G4XA 4O79A 1MMNA 3BC8A 1ETXA 2CS3A 2HPMA 1XGOA 4E7ZA 4ZZDA 4LLNA 5BS6A 4HE8D 2KZGA 4WJ0A 2MG4A 1IN6A 4OMYA 4EEFG 1FP2A 5E3NA 4IRHA 5CYVA 3R6SA 3RZDJ 1NFNA 3L8IA 2WY7Q 4XLEA 2M9HA 1UZCA 1R4TA 1ONVA 4RB2C 1H8AC 3KPHA 2AO9A 3BJ6A 3ASOH 4ITVA 1ZK8A 3GEIA 2CDQA 1CGPA 1N77A 1MBKA 1U5TA 3HOXJ 1I1SA 3PSIA 3S2HJ 4U5EE 4U9EA 4ER9A 1TWGA 3SZRA 3ZN0A 4OWRB 4HPQA 1Z6RA 2CV1A 2XLEA 3DE8A 5M3MJ 2JUGA 4N9IA 3ZIBA 1M1EB 5B5EC 4BNCA 3RDIA 4IHTA 2R7UA 1VNDA 3OSFA 3J80K 3BZCA 4EJVA 1OKKA 4I6ZA 1V55C 1WJCA 1VMAA 3EQLF 2PJRA 3L2CA 1VZ0A 3OYMA 5E3LA 4PGGA 3X1OA 2VT3A 2GWWA 5L0CA 2OJQA 4KNWA 2IGOA 2PJRB 3PO2J 1DQUA 2P5VA 2RC4A 4MEYF 3RKXA 4DGWB 2P7CB 1R6RA 2Z1DA 5ED4A 4MLOA 1BIBA 2XSEA 3K10A 1IO2A 1X1BA 5F5HA 4DJAA 5HDGA 2JX0A 2KRHA 5FFXA 4YT8A 2E1OA 3FKJA 3FHDA 3RIPA 1R22A 5HDNA 1M2OA 4LACB 5HNFA 1Q0GA 2Q00A 4C2UA 2E7XA 4KFCA 1RJ9A 1RKCA 3RPQA 3KX2A 4BJ5A 2VPLA 1RKTA 1VK5A 3M07A 1M2VB 4RAFA 4OAYA 3DCFA 3M7GA 4MGRA 3G3ZA 4MVQA 3FAJA 3K2AA 1BJZA 3B71A 1Q0FA 1YJNI 3K7DA 4A3JJ 4Y13A 3Q9SA 5E8IA 1O4XA 2CV0A 4GFBA 2H7VC 4D1QA 1S7ZA 4HZFA 3OS1A 5FLXZ 1BI0A 4Y52J 1SFUA 1HE9A 5E3AA 3JRBA 2JK3A 4XKWA 2NS7A 1O5HA 3NG1A 4JRZA 1E3OC 3IWZA 5TJ5E 1ZVZA 1JT0A 4P9TA 1T6QA 5H2FC 2FMYA 5BOXA 1MD0A 5T3TA 4CSWA 1IN5A 5JVGF 2AWCA 3MMYB 4LG3A 2I15A 1SR2A 3L8JA 2DTRA 4CCKA 3B02A 2EA4A 1ZU4A 4H54A 1IGNA 4PDKA 3TEDA 2C03A 4IAQA 4HX8A 2KRFA 2YU3A 3KZZA 1R71A 2KIQA 2LFBA 1JGSA 1TP4A 4I0AA 2R7RA 4M9SA 1I3QJ 3KZYA 1VYKA 2JVHA 2CW0F 4F3QA 2W45A 4WWCA 3KH2A 3GX4X 3HLZA 1TWHJ 3GFJA 5LFAA 1YS7A 1VQ4I 5FFZA 1IF1A 3ZG1A 2KISA 1ZG1A 1QQ3A 2YLIA 3DJNB 5CI8A 1SAXA 3PNTA 1TWHA 2YUSA 2IM8A 4KJZA 1ZHTA 4GGGA 2YLGA 3Q7GA 3U1DA 3ZQVA 3GM1A 3BR3A 4N9HA 1B1BA 4BYYA 4KIBA 2EFOA 3HHGA 3I56I 1JPJA 4L5EA 2C04A 2XPUA 5A6BA 2DLLA 1FBSA 1LJ9A 1EV7A 3B6AA 2L6HA 3TW6A 1YZAA 1B6AA 3IEEA 2Q0OA 3W6JB 5LLQA 1R5HA 5BQTA 1T95A 4CS8C 2W4SA 2E1CA 4L9JA 4OMZA 3RYLA 3VRCA 4JK1X 2V1NA 1Y1WJ 1ZREA 2PX9A 2QA4I 3MKZA 1JJ6C 3HOVJ 1E0EA 3VWBA 2Q9BA 1X2NA 2BW3A 3FIWA 4XSZF 1EJ9A 3L1MA 1WOLA 2BY2A 2VQCA 2PN6A 3C2GA 5AIQA 5HLIA 3UNGC 3FX3A 5CVRA 3JSOA 1QPIA 2GA0A 3FXUA
chains in the Genus database with same CATH topology
3RCOA 1P9QC 4J01A 3KMIA 2KW3C 4YT5A 3W8IA 5KYYB 4O6YA 5KYXB 4AU7A 4CA0A 4RLQA 1BR1A 1SFKA 3W3CA 4F91B 2VH3A 4J30B 2XC7A 2PMZA 4MNDA 4AX2A 3S0XA 3DD7A 2W4MA 4KISA 2WVOA 3ZRGA 2L5QA 5B3SC 2Z15A 2M3AA 4HEAJ 4PJJA 4PSWA 1JI8A 3NWTA 3H65A 4NC7A 4F4BA 2V6EA 2R7QA 4JOMA 3CQZA 5KYWA 3L2WA 4ZTJA 3BCAA 2ZXPA 4OAZA 4GEHA 2HDWA 2MD0A 1LVKA 3OMYA 4XQFA 2IXPA 1Z63A 3K6BA 1OCZC 4A2NB 4FESA 5HOOA 3DZAA 4BQQA 2L9NA 3GBGA 2QY9A 2Z16A 4B47A 4CS9C 1QHGA 3AG1C 4IQJA 3U21A 3DTEA 2IXNA 2MWQA 2V4JC 2KGOA 3OWTA 2WVNA 3K4JA 2D5RB 3ABKC 4K0DA 1Z3IX 4XLCA 4XLPF 4LLEA 5L3QA 1PD0A 1ZHXA 2BVLA 4C30A 4II3A 1ZHWA 4HFFB 4AVZA 3OYDA 4W8KA 1QZXA 3W8HA 4Q5SF 4JW1A 4LERA 3POVA 3LFUA 5KYWB 2IXSA 4CCNA 3BG6A 2WVQA 4BEHA 4DBRA 1Z21A 4PUSA 2MABA 3K1HA 4XN0A 3PHF2 2LSEA 4XONA 1BOBA 1O87A 1MNDA 3C2HA 3AL0B 1SMYF 4IRUA 5KYXA 2IYLD 5DS4A 3L34A 3VYTB 3DTKA 1TT0A 3HPGA 2FGYA 3BLYA 3EUHC 2A6EF 3E1SA 2UWMA 4OD5A 5CKTA 2Q1ZB 1WJDA 2XDVA 2WZGA 5CI9A 2PFDA 3T6BA 2X6WA 2JD3A 2A69F 1T0FC 2ZXWC 2R7XA 1MW7A 3OYKA 4O6MA 2Q9CA 3DU5A 2W00A 4BL0B 1NZEA 5DS5A 4HG2A 3E9VA 4B48A 2HZDA 4G7ZF 3K4KA 1FMWA 2WL8A 3L0IA 4E7HA 2ZXIA 4BACA 2Y3HA 3LEVA 4ZC3A 4F55A 4YN0B 1UG0A 4PJNA 4C7OB 2ELJA 3DXJF 4RMNA 1ZYRF 4KT6A 4G7HF 2XF5A 3JSZA 2VLAA 2IXMA 2IGMA 5CQGA 2GFHA 3N0TA 4JURI 2QKLB 2R7WA 2DT7B 4E4HA 2Q2EB 3VYWA 2J0WA 3H5RA 1G59A 3FDYA 1DGRM 3GANA 5KCMA 3BCBA 5T1DB 4CS9A 4EATA 4IAOA 1WFXA 3H5AA 3H9JA 3S93A 1PCXA 2L7KA 2LH9A 2J9VA 4P6IC 5E33A 1X4OA 4E6KG 3QYFA 3HOTA 3EGDA 2DJIA 3N2ZB 2WAFA 5D92A 1OKKD 4CS8A 2IS2A 4B43A 4XR6A 3AQBA 3EPVA 5E2QA 1NU9C 1QHHD 2ZPAA 1QU3A 2J9WA 5KYUA 4G6TB 4Y3OA 3RKOF 3OR2C 4ZDLA 2KHMA 1TWCA 2A68F 2CW7A 4PJLA 1X1CA 2WADA 4R79A 3DTIA 2L81A 2BE5F 2HNHA 1YX5A 4JJFA 2VXDA 1OR7C 1WJAA 4YRVA 3W2AA 3LSKA 3IUOA 3O6XA 1OCCC 2EIKC 2WZFA 4LLCA 2X6YA 3L2QA 3EHMA 3UMIA 3S28A 1TR2A 3FBNB 5HNHA 3MKYB 1ZELA 1Y6IA 4BJ6C 4BE2A 2PX0A 3FVYA 4U5DE 3K4MA 3MKWB 2HVRA 2EIJC 2RNGA 3H9QA 4FX5A 4OIRF 3AG4C 3QODA 2K3PA 1GLNA 4HSTA 1WJFA 3OYLA 1FTSA 1Z6AA 4G0HA 4N4NB 2HV7A 4BJ1A 2E1MC 3FDQA 4AYBA 3SP1A 2VJ4A 3EUKL 5BUOA 2A6HF 3EZIA 3LAYA 4HEA2 3K4LA 3SZGA 4OINF 2XRHA 3ZXSA 5HLTA 4FWVA 5FRNA 3PL8A 4Y33A 3OEOA 3DJUB 2I8BA 3CMMA 3S27A 5DVWA 4FETA 2VQLA 4XL9A 3Q7LA 1HA8A 1ZHYA 3MD2A 4ULWA 1N1CA 2P7VA 1X1AA 4FASD 4NQWB 3AL0C 4ZDOA 4BS9A 2ZXOA 3S32A 4CSAA 3RPUD 4JQFA 3KYLA 1OCOC 3HTKC 2KDOA 3VSKA 3LNRA 4X0RA 3DM5A 4AK9A 2JSPA 2VQHA 2GOXB 3F46A 2LBFB 3TL4X 1EA3A 3OYFA 2VJ5A 4ZJZA 3DEEA 4QPQA 3OYGA 3ASOC 2FUG2 2R7TA 1N75A 4OIPF 3ZSUA 2ZFUA 4RDAA 3UGOA 2NUTB 1J8MF 2XXAA 2Y69C 1FFTC 2M4KA 4XORA 4CCLA 3NKEA 4RLFA 1LS1A 4XN3A 2CMPA 2KQRA 3LS0A 4CZCA 3RTRA 3CESA 2P6VA 4C3BA 3HOSA 3PMRA 3A1YA 1X19A 3K70D 2FFHA 1QLEC 3K33A 5KYYA 3D5LA 3PNYA 1M57C 3DU6A 4XLFA 5T3WA 3S3OA 5KYUB 4XOPA 3LL7A 2K5CA 3HXLA 2M4EA 3T4RA 2UUZA 4BU2A 4XLNF 2L9SA 2KL4A 3OR1C 3IAS2 2XF6A 2BOLA 2XSJC 4ZDPA 3ZR8X 2IOQA 1S9HA 3ZC4A 1PJRA 4GRIA 3UR3C 2W9YA 5E3CA 3OIQA 3A4CA 3AKZA 2VL8A 4CUGA 3CJQB 3QYBA 4E7JA 1RJ9B 4IJJA 4EWCA 5EHHA 3DWLE 4N06A 4BJTA 2Z2SB 4PFPA 2KPMA 3OYEA 2NUPA 4OD4A 1DP3A 3OYNA 4RM2A 3CP2A 1OLTA 1MMGA 2HU9A 3PSFA 3VYRB 2R7SA 5D91A 1J8YF 2VQGA 2X1CA 1J09A 3CSKA 4LITA 2L9JA 1SAUA 2O9XA 3NDBB 4U5CE 3OYBA 3LESA 4JCHA 4BJ5C 2IS6A 3DMDA 4I1OB 4DVYP 3VYSB 4BDZA 2OV7A 1OCRC 1FFHA 4BDYA 4XOTA 2L2OA 3IAM2 1NU7D 2W4BA 3S8PA 2X85A 3LMMA 1WGWA 2R4GA 2HPIA 3OS2A 4U5BE 3N24A 4EBBA 1U0JA 1V5EA 1X4PA 2P0WA 2W82A 1IZMA 1Z3YA 2WA0A 4XKBA 1ZU5A 3E0JB 3OL3A 2DXIA 2WBMA 1X1DA 2LC2A 3UMKA 4NC8A 3UMHA 4QPOA 1UAAA 3B9QA 3QMKA 3DPTA 1PYVA 1YX3A 3OYAA 4E7IA 3SDBA 1MMAA 2M7BA 2EIMC 4RBNA 3OYJA 3ZCOA 3OYIA 2E87A 3NKDA 4JJGA 3DLAA 4GYTA 3EZHA 2M0MA 2K9LA 2X51A 2WZLA 2PP4A 3DM9B 3HJCA 4Q4ZF 5L3VA 2MYSA 3NYJA 3ZVRA 1JPNA 3CF2A 2J7PA 3MX3A 5DLJA 2J9UA 4PK4A 2A1DD 5TGTA 1Y56A 2LY1A 2J0XA 1Z23A 4CIHA 2V26A 2ZSIB 2ZXHA 4AE4A 2Y3GA 3BG7A 2KRCA 2LYCA 2A6TA 5LD2C 2K9MA 4HRIA 4YT2A 3V42A 4RM3A 3J7AY 1LKXA 2Y3BA 4O6NA 1KONA 3QOEA 4B44A 2H7OA 2DYRC 2AQEA 2IS1A 4U5GA 2IGKA 2NOJB 4YWQA 1D1CA 4PJMA 3DKXA 1BR4A 4RD9A 3ONQA 3SYTA 3L2VA 2BW3B 5FRMA 2VXZA 1YE9A 4LIVA 3SEZA 4KC9A 3SYNA 3I4UA 3ABLC 4YELA 1IRXA 2VASA 3EJNA 1M2VA 3EGXB 4CCOA 1D0ZA 2HQAA 4QDLA 2YZSA 1D1AA 2V9KA 2VKHA 2WB1A 4BUPA 4IZZA 1W36C 3PJRA 4AE4B 5DQZA 1AA7A 4XKVA 4NUBA 3WODF 2VIXA 3SNHA 3W2WA 4YT4A 3JCUQ 4BXFA 4BEHB 3L2UA 4XLHA 3D5RC 2B0JA 2KMUA 2OUMA 4XM3A 3KKBA 3LS1A 4CS7A 3FHNA 3KEYA 2W1OA 3K4CA 2HVSA 4CCJA 2OCCC 5KNLA 4QI0A 4DIQA 4B3XA 4OIQF 1BR2A 2BVMA 3JT1A 3HKZA 3PUBA 4ZYAA 4N4OB 3K70C 2XXAB 2W7NA 4BE1A 3EH2A 3GODA 1Z7LA 3B0UX 2IXOA 3K1IC 4XKCA 4KI2A 1LFPA 3S29A 4IWBA 1NG6A 3DPLC 2G3KA 2YHSA 4BJ6A 3TBIA 5DS6A 2M7AA 4C3EA 1ZHZA 5B1BC 2LRDA 3O39A 2LG4A 3OL4A 4HSRA 2AQFA 2QKMB 2ZSHB 4O7GA 2RQQA 3N05A 3H0DA 3I9V2 3EG9A 2M4GA 3RSNA 2CFOA 4CH7A 1NG1A 3W2VA 2EILC 3TD7A 5IY5C 4I44A 1V54C 4PSXA 1V5GA 3M1CA 2KJGA 4D9JA 3E70C 1D0XA 2HV6A 1G8XA 3ECSA 3ASNC 4I3MA 3V7OA 3LSIA 4BEJA 4BG0A 4J00A 4BQNA 4KBLA 4KNVA 4OIOF 2WB7A 1M56C 2G62A 2JVGA 3LJBA 2KP6A 3S3NA 1SF8A 3SEOA 1Z5ZA 2DYSC 4IKFA 4O79A 3OIPA 2GOMA 2EINC 2MC4A 3LSGA 1MMNA 3BC8A 2CNWD 2ZXRA 2CS3A 3IP4B 2HPMA 3DKYA 2DCEA 2RREA 5CQEA 1VOMA 4NY3A 2Q3TA 4XWJA 3EUAA 4E7ZA 4PFOA 2E5ZA 3M8JA 1FMVA 3I5PA 3Q6MA 3L2RA 3SEQA 4X0GA 4HE8D 4WJ0A 3EH1A 3EGDB 2LOOA 2V7FA 4YJWA 2DGJA 2WY7Q 2NUPB 4XLEA 5HVQC 2KQ9A 3EGXA 4ITVA 3AQCA 3EPZA 4XTKA 4XLAA 2CDQA 3DAFA 1N77A 4U5EE 1NG7A 3FBIB 3PSIA 2MFZA 2IS4A 3HC7A 1TWGA 2WAEA 3SZRA 4OWRB 4F92B 3EG9B 4I1MA 4HPQA 3UGPA 2CV1A 2CH0A 3B0VC 2JUGA 3OOUA 3PNVA 3DAGA 3ZIBA 3NRHA 4Y4RA 1ERDA 2J7PD 3ITFA 2VKDA 4M63A 2R7UA 4HNTA 3CJRB 1OKKA 1V55C 5EGYA 4P1WA 1WJCA 1VMAA 3K4NA 4KITB 1WJ5A 2PJRA 1IW7F 1VZ0A 3OYMA 2XAUA 4IQ4A 2CNWA 3AG3C 3X1OA 4U7BA 1N78A 2R7OA 1WJBA 4KNWA 2IGOA 2PJRB 2I8DA 5DQTA 4BQOA 1DQUA 4DGWB 2F6CA 2X6XA 1R6RA 2Z1DA 4Q7CA 3LSHA 3ZGKA 4MLOA 3MLGA 2A5WA 2VJIA 3K10A 2XSEA 1X1BA 2VB6A 3VAYA 5F5HA 2UV1A 3G2BA 4DJAA 2Y3DA 4B6IA 2KRHA 4YT8A 3FKJA 3FHDA 3RIPA 1M2OA 4LACB 2YEVA 5HNFA 3LLIA 3M1CB 4C2UA 4CCMA 3Q6NA 2OC6A 2F5VA 1RJ9A 3I3LA 1V5FA 3KX2A 4CBEA 3HL2A 1ST6A 4JZAA 4BJ5A 3PFYA 2X1EA 3AFHA 2VPLA 1VK5A 5F5FA 1M2VB 4J32B 2DOAA 4OAYA 4ZLCA 3OA1A 3FAJA 2CV2A 4G7OF 3VSLA 3HUGB 4DVZA 3AG2C 3VDXA 3HG9A 3K7DA 5B1AC 2CV0A 3KL4A 2H7VC 4D1QA 1S7ZA 3K4BA 3OS1A 2KNHA 2E1MB 2QTVA 2J46A 4NNJA 1TWAA 4II2A 5KHDA 2H7BA 5E3AA 4U5HA 4XKWA 4XMYA 4XNFA 1O5HA 3NG1A 4MQ9F 1VYIA 2JA2A 3I5QA 3NYMA 4C2TA 3D5SC 3RQ4A 3B0PA 1MMDA 4P5OA 3X2QC 2CW8A 4C3DA 5T3TA 3JRTA 4CSWA 3CZ6A 3HPHA 2E5NA 3MMYB 4LG3A 5CPRB 5FROA 3JYHA 2LREA 4CCKA 4HNUA 3S3MA 1LDKB 1TKNA 3CP8A 1UELB 2LY2A 4F93B 4E7KA 2CUZA 1ZU4A 3ABMC 2NG1A 2WY8Q 4QI2A 2O5RA 4E7SA 1Z3XA 3OYHA 3QZCA 2C03A 3WG7C 4C7OA 2WAQA 2Y0SA 2OG2A 2PX3A 2Y39A 3T6JA 1MNEA 2R7RA 1W2WA 5KYNA 5HSWA 1VYKA 3LLKA 2JVHA 3OYCA 4F3QA 5JHFA 2CW0F 2W45A 3EFOB 3KH2A 3DPUA 3K6GA 3HLZA 5LFAA 3ZQQA 3ZG1A 3H5NA 3TMOA 3DJNB 5CI8A 3NYLA 3LSMA 3EQLF 4DOZA 4HFKB 3PNTA 2V3CC 1TWHA 4YEJA 3NWSA 2CUJA 4KJZA 1ZHTA 2XL4A 3F47A 2E60A 3Q7GA 3F9KA 4DBQA 1K6YA 2NUTA 4F52A 4LIUA 1JPJA 2X1DA 5FCLA 2C04A 2CGEA 4IX7A 2HVQA 3DQVC 1SZIA 2KLOA 3OS0A 4BE0A 3IEEA 1D0YA 4CSAC 3QYEA 2XF7A 4H4KC 1T95A 2PF4E 4CS8C 1DGWY 4ZLDA 1WJEA 2W4SA 1PD1A 3EHNA 3RFYA 3RYLA 1D1BA 2V1NA 4ZTFA 2R7VA 2J45A 4U87A 1W36D 2G3VA 3OY9A 3H9GA 3VYUB 4BGDA 1KU2A 2F4IA 3MKZA 4ANJA 3A2KA 2KZVA 2Q9AA 2LBFA 3K66A 4U5FE 3RH3A 1E0EA 3VWBA 2Q9BA 2BW3A 1TZLA 2DT6A 2IGNA 2VJJA 4C9YA 2VQCA 3UNGC 3C2GA 3EFOA 4JVSA 4E7LA 4K7BA 3H35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJ6 C;  4BJ5 C;  3CZ6 A;  4BJT A;  3OWT A; 
#chains in the Genus database with same CATH topology
 3RCO A;  4UUV A;  2RD9 A;  4O6Y A;  3T9O A;  3I59 B;  5KYX B;  4MND A;  2EFN A;  1TFK B;  5HDK A;  2PMZ A;  2XC7 A;  3S0X A;  2QSF X;  4CDV A;  4KIS A;  3T0Y A;  2QSG X;  4O6J A;  3FXK A;  4HEA J;  2DTZ A;  3CCV I;  5L0F A;  4I76 A;  1YJG A;  4KIC A;  2YQY A;  4F4B A;  4ASN A;  1YA9 A;  1TTY A;  3F72 A;  4OU0 A;  2HQR A;  1Z77 A;  4XQF A;  1LVK A;  3OMY A;  3RIR A;  4XID A;  1Z63 A;  1ZZP A;  2FEZ A;  5TJJ A;  1VTM P;  4L5J A;  2L9N A;  2W24 A;  5IT3 A;  3FF5 A;  2QY9 A;  3RW0 A;  1QHG A;  4WGY A;  1GXQ A;  4L9T A;  3BR6 A;  2J9B A;  3ABK C;  3T8R A;  2V4J C;  3K0L A;  2JSC A;  3X2Q H;  4XLC A;  4LLE A;  4F7Z A;  3S1M J;  4PAC A;  1OFC X;  1ZHX A;  5B3I A;  3V7S A;  3GFM A;  4II3 A;  4BHB A;  3ABT A;  4HFF B;  2PG4 A;  5B1B H;  4DYC A;  1TW3 A;  3Q9V A;  3QW0 A;  3REO A;  1Z6T A;  2G7H A;  4TV7 A;  3PQK A;  3FM5 A;  3ZQF A;  2IXS A;  4Y7N J;  1B72 A;  1ULY A;  4M9Z A;  4BEH A;  1Z21 A;  4HX4 A;  4PUS A;  2MAB A;  4IRG A;  4AYB N;  5BQG A;  2ZCW A;  1MBJ A;  3FM3 A;  4XN0 A;  4DW6 A;  5J1Y A;  4XON A;  5K7F A;  1BOB A;  3C2B A;  3C2H A;  1SMY F;  1OYW A;  4M71 A;  4UUT A;  1QVT A;  5DM7 F;  2XS1 A;  3DTK A;  3H36 A;  2EV5 A;  1BL0 A;  4DXW A;  3H3U A;  5F6F A;  3BLY A;  1U2W A;  2A6E F;  2UWM A;  1UHW A;  1LDJ A;  5CKT A;  3LA7 A;  2Q1Z B;  2L7M P;  3ZMS A;  3E5Q A;  2A69 F;  1K78 B;  2JD3 A;  3ZWI A;  2CFX A;  2H27 A;  2R93 J;  5EEH A;  4O6M A;  1KTM A;  3DU5 A;  1IN8 A;  1NZE A;  2XM4 A;  1R23 A;  3E9V A;  2DMN A;  3A0H C;  1TQM A;  1FMW A;  4N0B A;  4BY7 J;  3EUH A;  3L0I A;  1CQT A;  2HMZ A;  3LEV A;  1W7P A;  4NQW A;  1SFO J;  2TRT A;  4C7O B;  5HLG A;  2ELJ A;  2CJJ A;  3DXJ F;  5LHI A;  2L01 A;  4M3G A;  3AGT A;  5EK0 A;  3HGG A;  4HF1 A;  1XDS A;  1NLX A;  2QKL B;  3JYY A;  1WN0 A;  3FDY A;  3KYD B;  2STW A;  5KCM A;  3GAN A;  5EZG A;  2NRA C;  2XLH A;  3OOP A;  4IAO A;  2IP2 A;  2J5P A;  3H5A A;  2A05 A;  2BHZ A;  4P6I C;  3TUL A;  1X4O A;  5F0H A;  2VBZ A;  2ICW G;  1OJL A;  1OR7 A;  4DNC A;  3AAF A;  2FOK A;  2NXN B;  1L7C A;  3FXR A;  3V8L A;  1E17 A;  1MKM A;  3C8G D;  3Q3S A;  4A4A A;  1AEP A;  4CS8 A;  4XR6 A;  3S14 J;  3NMI A;  3M4B A;  5E2Q A;  1QHH D;  2ZPA A;  5KYU A;  1M6T A;  1RET A;  2D2W A;  3RKO F;  5IOY A;  3FXJ A;  3DTI A;  5E1W A;  1KA8 A;  2BE5 F;  4G12 A;  2HNH A;  1YX5 A;  5EZH A;  3VEP A;  3V4G A;  4PZJ A;  1C02 A;  4JJF A;  1MGT A;  4ZZL A;  1TFO B;  1G3S A;  3IUO A;  2B9S A;  2WZF A;  1G3W A;  2EIM H;  3DFG A;  2NVQ J;  4A6D A;  3UMI A;  3S28 A;  1WVR A;  2NSG A;  2PX0 A;  1Y6I A;  1OCO H;  3FVY A;  2A07 F;  2EIJ C;  3S17 J;  3ATP A;  3AG4 C;  4HST A;  1FTS A;  1WTY A;  1WJF A;  2ESN A;  4G0H A;  1Z6A A;  4MIM A;  3FDQ A;  4LLG F;  2E1M C;  2K85 A;  2VJ4 A;  3S16 J;  4A3M J;  2NS0 A;  1FJL A;  1R00 A;  2XL8 A;  2XB5 A;  3SZG A;  4YIF A;  3LAJ A;  4FWV A;  2J5O A;  2FSW A;  5TRD A;  1UG2 A;  2EIL H;  2CU7 A;  4FET A;  4XL9 A;  2IPQ X;  3BJA A;  1AHD P;  1ZHY A;  3RVY A;  2ZNZ A;  4C3I J;  1YW8 A;  3GO5 A;  2ZFW A;  3WTZ A;  1VF9 A;  2E2I J;  2B0L A;  4WF2 A;  2KIF A;  3AL0 C;  1W1W E;  1OXK A;  2HZ8 A;  4BS9 A;  2ZXO A;  3S32 A;  4CSA A;  3RPU D;  1XCV A;  4HBL A;  4XRS G;  3LNR A;  4AUX A;  3DM5 A;  1L3L A;  1J75 A;  4UNO A;  1OW7 A;  2KYH A;  4A3C J;  1MIJ A;  2E71 A;  4DZP A;  2LMD A;  1JHH A;  1U9O A;  3DEE A;  3W6K B;  4ZJZ A;  3ASO C;  2DOE A;  2R7T A;  2NVX J;  3S15 J;  5HS7 A;  2PMU A;  4HX7 A;  1HDP A;  3RQI A;  2NUT B;  4RDA A;  3UGO A;  1JUS A;  3KZI C;  1DDN A;  1BC7 C;  2DDA A;  3GZ6 A;  1UJ8 A;  1IV6 A;  4RLF A;  3IQT A;  1AVO B;  4CDA A;  1VQP I;  1FZP B;  3SHF A;  3GWN A;  4C3B A;  2OQG A;  2CQN A;  2L54 A;  3K70 D;  1X19 A;  2BEO A;  3OSG A;  1QLE C;  4P9U A;  1WH7 A;  2GXG A;  3ABK H;  3PNY A;  1M57 C;  2OU2 A;  5L3B A;  3DU6 A;  2HJ3 A;  4ESF A;  1R4N B;  1GV5 A;  2K5C A;  3HXL A;  2M4E A;  3S27 A;  2L9S A;  2DO7 A;  4ZDP A;  5GAG J;  2IOQ A;  4GEH A;  2OAZ A;  5JFR A;  3ZC4 A;  5DM6 F;  3UR3 C;  4X1E A;  3PO3 J;  2OTL I;  5E17 F;  2TCT A;  1QA6 A;  3F23 A;  5C44 J;  4E7J A;  3IHU A;  1RJ9 B;  4BKX A;  3CCL I;  3C1D A;  3ZDL A;  3J81 Z;  4Z2Y A;  1ZGJ A;  1HCR A;  4PFP A;  1P92 A;  5K5Q A;  1NSG B;  1V74 B;  1DP3 A;  3OYN A;  4RM2 A;  3M8F A;  3VYR B;  5J47 A;  2R7S A;  2WB1 N;  1D8K A;  4I01 A;  2NS8 A;  2GQQ A;  3NDB B;  1Z1D A;  4BJ5 C;  1Z0X A;  1XC5 A;  4QTR A;  3RYR A;  1OCR C;  1XSX A;  3JAM Z;  3LA3 A;  1B9N A;  5F27 A;  3GTP J;  2I5U A;  3V7R A;  5CJ9 A;  1Y4C A;  1ODD A;  5FKL A;  2QQB A;  1LEB A;  2RDP A;  3N24 A;  4U5B E;  1U0J A;  2W82 A;  3FZV A;  2K4B A;  4OIN F;  4EJT A;  2G9W A;  3AOU A;  2X0C A;  2WBM A;  3UMK A;  1UAA A;  3QMK A;  1NBB A;  4XWJ A;  2L7Z A;  1TQI A;  2M7B A;  3V7C A;  3NKD A;  4XRF A;  3DLA A;  1SFE A;  2X51 A;  3DM9 B;  4Q4Z F;  2YL1 A;  1EI7 A;  3ESW B;  1ZLJ A;  2ID3 A;  1IXS B;  1T33 A;  1HXD A;  2R5Z A;  1PV3 A;  3TJ5 A;  3HJE A;  3F8M A;  1DU6 A;  4HF0 A;  4P96 A;  2ETH A;  3VPR A;  2J7P A;  3A11 A;  1R9T J;  3K1N A;  2R0Q C;  2H1L A;  2KJC A;  1YLF A;  4PK4 A;  2H1K A;  4Z9J A;  2QBY A;  1Q1H A;  1QVX A;  2LY1 A;  3CDI A;  4IL6 C;  3V5Y A;  2ZXH A;  2DBB A;  1MNM C;  3FK7 A;  3QQA A;  5J1R A;  2NNY A;  1MDM A;  4AE4 A;  2LYC A;  5LD2 C;  2M45 A;  2K9M A;  4YT2 A;  2JA5 J;  1HQC A;  3V42 A;  5JLW A;  3UKG A;  1H89 C;  3J7A Y;  4UV8 A;  3P9K A;  4XPW A;  3T5X A;  1PP7 U;  2DYR C;  1XPX A;  2IS1 A;  2XRO A;  3TO9 A;  1BR4 A;  2BW3 B;  2VXZ A;  1YE9 A;  5IT9 K;  3EYI A;  1YOV B;  3ABM H;  4KC9 A;  4WAB A;  1WRJ A;  3I4U A;  4YEL A;  5LHH A;  5D8K B;  3JR9 A;  3F6O A;  4YFN F;  4J19 A;  2GDC A;  2FOW A;  4LK1 F;  3R4K A;  5CLS A;  4YL0 A;  1I4Z A;  1AUE A;  1OYY A;  2F5E A;  1D1A A;  4IZZ A;  2AWY A;  1W36 C;  5DQZ A;  2PMZ N;  4S0H B;  1XD7 A;  4XKV A;  2UUH A;  4NUB A;  4HLX A;  3WOD F;  2YKZ A;  3FOO A;  3ZTM A;  4QWQ A;  1VLS A;  2LY9 A;  3SNH A;  1K6O A;  3TP0 A;  1RRJ A;  1HE1 A;  4BXF A;  3EDP A;  2B0J A;  2KMU A;  4XM3 A;  5K7H A;  1OR3 A;  3KKB A;  2FX0 A;  3U3F A;  5AON A;  2H8W A;  3K4C A;  4W1U A;  2JN6 A;  3ZP5 A;  3H2U A;  5LGT A;  2XKO A;  1CGM E;  2TMV P;  2OCC C;  4UVC A;  4DIQ A;  3F3X A;  3JT1 A;  2OQR A;  5C3E J;  2XAS A;  3SZT A;  4BE1 A;  3GOD A;  1Z7L A;  1U6H A;  4CYD A;  4EVI A;  3K1I C;  2OKU A;  1ENH A;  2EH3 A;  3I53 A;  4BJ6 A;  1T6I A;  2DYS H;  4C3E A;  2F48 A;  4EJU A;  4U88 A;  1CF7 A;  3QPT A;  2LG4 A;  5EGO A;  4B8X A;  3EG9 A;  3WTS C;  1I39 A;  4U0Y A;  3RZO J;  2CGP A;  2PBE A;  5IY5 C;  4I44 A;  4NQF A;  4GO1 A;  4PSX A;  1T38 A;  4BBS J;  1BI2 A;  5DCM A;  3M1C A;  1SD4 A;  4KMF A;  2HV6 A;  1B4A A;  3MEX A;  3SXY A;  3LSI A;  4A0Z A;  4BEJ A;  1R4M B;  4KBL A;  1YIO A;  5F04 A;  1Z91 A;  4FHT A;  5M3F J;  2HI3 A;  1H0M A;  4KMU X;  1IUY A;  2V1X A;  4MNU A;  1XB4 A;  3WE3 A;  2XUB A;  2CCY A;  2QVO A;  1W5T A;  4NTF A;  4V2G A;  4H0E A;  3WG7 H;  2UZK A;  1LDD A;  4PGH A;  3IP4 B;  1RUO A;  5CQE A;  4NY3 A;  1RCP A;  2RN7 A;  3HTU A;  4PFO A;  3Q6M A;  3L2R A;  3SEQ A;  3TKY A;  3EH1 A;  1X3U A;  2LOO A;  2V7F A;  4CJG A;  3O6B B;  3I54 A;  2ZD9 A;  3GW2 A;  4A3D J;  3EGX A;  2B0H A;  1UCR A;  1ZRF A;  3BR1 A;  3AQC A;  1WAS A;  2BGC A;  3ZMZ A;  3DAF A;  3JRD A;  2VC0 A;  2QLZ A;  1JAF A;  2P0N A;  1S6L A;  2MFZ A;  2IS4 A;  3HC7 A;  2H8A A;  2QZ8 A;  3W6V A;  4EBK A;  2WAE A;  3EG9 B;  4I1M A;  2ADU A;  2COB A;  2X9D A;  3OOU A;  3B0V C;  3PNV A;  5E20 A;  3DAG A;  4JTD B;  1T9K A;  3ITF A;  1VQ9 I;  1ZLK A;  1W7P B;  5DD8 A;  1JOG A;  2CYD A;  3C8G A;  2F2E A;  5TIS C;  4RGS A;  2VE8 A;  3GTK J;  5EGY A;  2UXN A;  4UY8 I;  1IW7 F;  3K4N A;  4BXU A;  4KIT B;  4MTG A;  2XAU A;  3AG3 C;  1W0T A;  4Z9I A;  2IEK A;  1TNT A;  3U9J A;  2P4W A;  2BC5 A;  2X6X A;  4CDG A;  3KYC B;  1HSJ A;  5FD6 A;  2P6T A;  1G3Y A;  3MLG A;  4UUS A;  2VB6 A;  3JRF A;  2Y3D A;  2H6B A;  3GTO J;  2DB4 A;  4J7Y A;  3LLI A;  4NC3 A;  2BXY A;  2F5V A;  3I3L A;  4G8X A;  1AU7 A;  5HOD A;  4EV0 A;  4CXF A;  4A93 J;  1SVM A;  1B8I A;  4JZA A;  4BAY A;  1PDN C;  1KNY A;  1MBH A;  2DOA A;  2Z99 A;  4Z9H A;  4ZLC A;  3OA1 A;  1S5L C;  2HTJ A;  1UHM A;  4KN4 X;  4L5I A;  5ICG A;  3IL2 A;  2XGX A;  2Y2Z A;  3HG9 A;  3JSE O;  4DVZ A;  1U78 A;  3KL4 A;  3KLN A;  1EH6 A;  2CRG A;  1R7J A;  3M1E A;  3CCU I;  5AGF A;  3JW4 A;  2QTV A;  2MD5 A;  4NNJ A;  1RKE A;  3ZQH A;  4YFX F;  4II2 A;  4U5H A;  2JWT A;  1AKH B;  4XNF A;  4WXD A;  4ETS A;  5L3E A;  1HY5 A;  3D5S C;  1JKO C;  2HXI A;  4AL1 A;  3AG1 H;  3JRT A;  3CZ6 A;  1NFO A;  1Y8R B;  2L02 A;  3DEU A;  5FRO A;  2CYY A;  2LRE A;  3LOC A;  4I09 A;  1TKN A;  4AD9 A;  2O6G E;  4F93 B;  4E7K A;  2VN2 A;  2ZJ2 A;  3ABM C;  5EEG A;  1KYZ A;  3LAP A;  2O5R A;  3CMY A;  4QI2 A;  1Z3X A;  1FY7 A;  2RVC A;  5E3M A;  4GQH A;  1X58 A;  2EV0 A;  4G6D A;  5DUK A;  2GAQ A;  4C7O A;  2WAQ A;  3T6J A;  2Y39 A;  1W2W A;  2O8K A;  4A69 C;  1FOY A;  5HLH A;  3KFW X;  4AID A;  1A35 A;  3DPU A;  4FX4 A;  2F22 A;  5GTI C;  2MA3 A;  2EFQ A;  2EIK H;  3TMO A;  1KU3 A;  4IO9 F;  3WGI A;  4MEX F;  3GTQ J;  1LM3 B;  3WTT C;  3NYL A;  1BC8 C;  4HFK B;  1K7A A;  2CUJ A;  5EF6 A;  1I3A A;  2E60 A;  1D3Y A;  3FAP B;  5JS5 A;  1K6Y A;  5FCL A;  1K40 A;  4IX7 A;  5KAI C;  4B09 A;  3JAM K;  2HFH A;  1OCT C;  3U8P A;  1ZR2 A;  1SZI A;  3OS0 A;  1Z05 A;  3HGY A;  2IXN A;  1CF7 B;  3QYE A;  4H4K C;  1P6R A;  4ZLD A;  1IJW C;  3RFY A;  4AIJ A;  2HJM A;  1LI5 A;  1D1B A;  2R03 A;  1LEA A;  3HSF A;  4P9F A;  4LB6 B;  2G3V A;  5E8G A;  1KU2 A;  4L6R A;  3A2K A;  2KZV A;  3I55 I;  2LBF A;  2CQQ A;  1XX5 A;  2Q8K A;  1QSP A;  2XAG A;  5FKK A;  2VJJ A;  1HKQ A;  1FYK A;  2Q4F A;  1QPM A;  1AKH A;  3WTY C;  1W4M A;  3BG9 A;  1RC9 A;  1KYW A;  2JQ7 A;  1P9Q C;  1S8N A;  3KMI A;  1PUF A;  3LQR A;  4YT5 A;  3MAJ A;  3LQQ A;  4AU7 A;  4CA0 A;  5CIV A;  5AIP A;  1SFK A;  3W3C A;  4F91 B;  2VH3 A;  2IBD A;  5J3L A;  2W4M A;  2WVO A;  2ISY A;  1HST A;  2ZJQ F;  2Z15 A;  2M3A A;  3CCS I;  3H3Z A;  4PJJ A;  1JI8 A;  1GQA A;  3BZK A;  4M9X A;  4JOM A;  5KYW A;  2HOA A;  1OQY A;  2ZXP A;  1XSD A;  2IXP A;  1N25 A;  2M2E A;  1LE4 A;  1OCZ C;  3K6B A;  4A2N B;  5HOO A;  1FBU A;  4EKW A;  3HRU A;  3GBG A;  2Z16 A;  1EF4 A;  3AG1 C;  2RKH A;  3DTE A;  1UB9 A;  1QRY A;  1TWF J;  4HV5 A;  5K5O A;  3K4J A;  1MMS A;  2ZC2 A;  4K0D A;  2HQ5 A;  1FBQ A;  5E3O A;  3CF5 F;  1YRN B;  1PD0 A;  2Y9Y A;  3MKL A;  2EB7 A;  4D4X A;  1P2F A;  4MQV A;  1QZX A;  4Q5S F;  4LER A;  1BDJ B;  3LFU A;  2YPR A;  3NRV A;  2IA1 A;  3T1B A;  3PHF 2;  2LSE A;  3SQN A;  1O87 A;  1ZAR A;  3S2W A;  4CZZ A;  2JMW A;  4IRU A;  2FA5 A;  5LRS A;  1XGS A;  3VYT B;  1L3P A;  5FLM J;  1YJ9 I;  4EBJ A;  2CQK A;  2WZG A;  3E3V A;  3T8T A;  2PFD A;  5CI9 A;  3T6B A;  1IN4 A;  4A3K J;  3J7Y J;  5JR3 A;  3OYK A;  3ZN1 A;  4BL0 B;  1DUX C;  2HZD A;  4G7Z F;  3K4K A;  2ZXI A;  2LKX A;  1YYX A;  1VTN C;  3WG9 A;  4F55 A;  3I58 A;  3DWW A;  3OIO A;  1V54 H;  2OJE D;  4A0X A;  4UVB A;  1MDM B;  3H0G J;  1S3J A;  4G7H F;  2XF5 A;  4JTC B;  5KK1 A;  1E3H A;  1QQI A;  5E1Z B;  4ZYG A;  3GEH A;  2YLD A;  2VI6 A;  2DT7 B;  3FWE A;  2J0W A;  4UDV A;  4UB6 C;  3JTG A;  5T1D B;  2A0U A;  4EAT A;  3S93 A;  1O3R A;  2KFD A;  2L7K A;  5B66 C;  3Q0U A;  4E6K G;  3QYF A;  3HOT A;  3EGD A;  4WGZ A;  5D92 A;  256B A;  2K86 A;  4M6Y A;  1YIJ I;  4B43 A;  3DE9 A;  4DJ9 A;  3AQB A;  1NU9 C;  5F5F A;  2P7V B;  2J9W A;  4Y3O A;  3G6E I;  4ZDL A;  1HOM A;  1JHF A;  1XS9 A;  2CW7 A;  4PJL A;  1JR8 A;  4KT5 C;  2L81 A;  5ICF A;  2VXD A;  3LNQ A;  3G50 A;  4JE9 A;  3RF3 A;  1OCP A;  4YRV A;  5A6J A;  3J7A O;  3LSK A;  1OXB A;  3O6X A;  1OCC C;  2EIK C;  4LLC A;  2X6Y A;  3EHM A;  4XEF A;  2FE3 A;  3O8G A;  1WI9 A;  2K9Q A;  4EM2 A;  3BP8 A;  1ZEL A;  4BJ6 C;  1MJA A;  4BE2 A;  1Z9C A;  1GHC A;  1D5Y A;  3K4M A;  4OIR F;  3GCM A;  2ETS A;  3A01 B;  2YRF A;  2N8G A;  2K3P A;  1ETY A;  5DCM B;  4BJ1 A;  2HV7 A;  4AYB A;  5D5U B;  3EUK L;  2KK1 A;  5GPG B;  1V4R A;  2JZY A;  3KP6 A;  2OEV A;  2A6H F;  2GZW A;  5IYC J;  4N4W A;  3VM6 A;  2H94 A;  4M3E A;  2PFB A;  3OV8 A;  4JKV A;  3MBG A;  4A12 A;  1AOY A;  3U5S A;  1SAN A;  1MH3 A;  2E34 A;  3BY6 A;  2F5D A;  2KIU A;  5FRN A;  3PL8 A;  4Y33 A;  3OEO A;  3Q0W A;  2I8B A;  2M8G X;  3DJU B;  4ENM A;  1WHU A;  3CCM I;  5DVW A;  3ISP A;  2XLV A;  1YS6 A;  2VBY A;  3ULQ B;  2JPU A;  4MFE A;  2XL6 A;  2XGD A;  1K83 J;  1QZE A;  3WU1 B;  1ZKG A;  2O0Y A;  4E70 A;  1ZG3 A;  4FAS D;  4YL3 A;  3K9T A;  3TOL A;  4IGG A;  3F21 A;  1UMQ A;  3U8V A;  1OCO C;  2E36 A;  1WCM J;  3O8H A;  3VSK A;  1E85 A;  3U9G A;  1H88 C;  2VQH A;  4JYK A;  4JEA A;  1EA3 A;  3OYF A;  3O3K A;  2E2J J;  1Q0M A;  4A5N A;  1HLV A;  4LB5 A;  2JA6 J;  5L0I A;  2Q2E A;  2MLG A;  6PAX A;  1DPU A;  1WPK A;  5C4J J;  1EH7 A;  2ZFU A;  3G4S I;  2FXA A;  2W25 A;  5J4Y A;  1FFT C;  4W97 A;  2M4K A;  4CCL A;  2DOF A;  2O9L A;  2DMU A;  1LS1 A;  3IKV A;  3BRO A;  3H92 A;  2KQR A;  3LS0 A;  3K69 A;  3HSR A;  1HDD C;  4MO7 A;  3HNJ A;  3HKZ N;  1JKR C;  4IOA F;  2MHR A;  2EZL A;  3QAH A;  1RIO H;  3BPV A;  5T3W A;  2G0E A;  4EJW A;  5KYU B;  1IRG A;  1APC A;  2EQR A;  3LL7 A;  1OCZ H;  1LE2 A;  2O03 A;  3L09 A;  3OR1 C;  2IW5 A;  1H6G A;  4MVR A;  5F28 E;  3OIQ A;  1PUE E;  2WWY A;  5H6R A;  3JRA A;  3CC7 I;  2VL8 A;  4N6C A;  2LKP A;  3CJQ B;  5COF A;  2MSY A;  5GP9 A;  3ECH A;  1LFU P;  3RKY A;  2K9S A;  1TW2 A;  2R7F A;  3SFZ A;  1FT9 A;  4J7T A;  2HU9 A;  5J40 A;  4IOC F;  4DYR A;  2P5L C;  1GXP A;  3KEO A;  2O9X A;  2L9J A;  3A9C A;  4E0H A;  1C0W A;  1YO5 C;  1IG7 A;  2CQX A;  2EZK A;  3LES A;  4JCH A;  2WV1 A;  4GYG A;  3IQ6 A;  1TNS A;  2NVU B;  3VYS B;  1WWX A;  4BDZ A;  2AXL A;  4XOT A;  1YA7 O;  3IAM 2;  1C03 A;  1NU7 D;  2W4B A;  2DFH A;  2ECC A;  3I0T A;  1MJ9 A;  2X85 A;  2YSR A;  5CVV A;  3A03 A;  3S8P A;  2R4G A;  4AWX B;  4CYC B;  3OS2 A;  4MTO A;  2PBI A;  2DA3 A;  2L9R A;  3JYH A;  2EIJ H;  4ULV A;  1A7D A;  2DXI A;  4NC6 A;  1E83 A;  2LC2 A;  2R3S A;  3FXQ A;  5LRR A;  3N97 A;  3B9Q A;  4UXN A;  3DPT A;  3OYA A;  4A3I J;  2R25 A;  3I71 A;  1YIT I;  1Z7Q c;  2EIM C;  3ZCO A;  3OYI A;  2DJN A;  2W85 A;  3ML6 A;  4JJG A;  5J8F A;  3U2R A;  4GYT A;  1G2H A;  2PP4 A;  3IRQ A;  2CUF A;  4PCQ A;  2D45 A;  1RUN A;  2KJB A;  1YYV A;  3ZVR A;  3JRH A;  1WAT A;  4C3J J;  1JPN A;  4KDP A;  2Q7R A;  4XBF A;  1QNT A;  3FMQ A;  2NVT J;  1HMD A;  3MX3 A;  3K7A J;  2L7F P;  2LR8 A;  1UST A;  5DLJ A;  2D4U A;  3MYI A;  3P9C A;  3N4M A;  3IH3 A;  2A1D D;  1XMX A;  2J0X A;  1RES A;  4CIH A;  4IPA A;  2ZSI B;  3TW7 A;  3ERM A;  2A6T A;  3PCV A;  4HDU A;  5L0H A;  1P4W A;  1TQG A;  1WH5 A;  1LKX A;  4HW0 A;  3TQO A;  1I27 A;  1KU9 A;  3IH2 A;  4MTE A;  5LHG A;  2VKV A;  2AQE A;  1GM5 A;  2IGK A;  2NOJ B;  1FAP B;  3KP2 A;  4PJM A;  3DKX A;  4RDU A;  3NEU A;  3L2V A;  2J8W A;  2DFE A;  3SEZ A;  3VF0 A;  2BV6 A;  3KP7 A;  2IVM A;  3SYN A;  3ABL C;  3WU0 A;  1IRX A;  2VAS A;  3L9F A;  3EGX B;  4CCO A;  2V1U A;  4Q48 A;  3U3B A;  4QDL A;  3LEO A;  1YAR O;  1T56 A;  4RAZ A;  4BUP A;  4AE4 B;  1A7E A;  2ZXJ A;  1G5Z A;  3SZP A;  2YL3 A;  2F4M B;  3W2W A;  3HOW J;  2GWR A;  1FP1 D;  4BEH B;  3CCY A;  3LS1 A;  1OR2 A;  5EG0 A;  3KEY A;  1KGS A;  3DEW A;  1F1Z A;  3NQO A;  2E1N A;  4OIQ F;  4QI0 A;  2XV4 S;  3F8F A;  3M9A A;  1BR2 A;  4KYW A;  2W48 A;  3L7W A;  3U2L A;  4ZYA A;  1VQL I;  1SC7 A;  1XTA A;  3EH2 A;  3B0U X;  2M5W A;  1A7V A;  3ECO A;  2GXA A;  4IWB A;  2YHS A;  3S29 A;  2VCB A;  4ZYE A;  1T98 A;  1JKQ C;  1K78 A;  1XWJ A;  2LRD A;  2QWW A;  1SYQ A;  3HUG A;  3OL4 A;  1ZGW A;  4ON0 A;  2YX4 A;  2QKM B;  3G1L A;  5ILU A;  1BIA A;  3H0D A;  1T2K A;  1LI7 A;  4O7G A;  2IA0 A;  5A2Q Z;  2EIL C;  2MGQ A;  2HOE A;  1K4T A;  2K3F A;  1V54 C;  4IEJ A;  1ORK A;  3HTS B;  2DMQ A;  3H1C A;  1XG1 A;  1U6G A;  2KJG A;  2XHK A;  2XLM A;  3ECS A;  1JT6 A;  3ASN C;  3V7O A;  1DPR A;  2LIG A;  1TBX A;  4J00 A;  2DW4 A;  2X0L A;  3HBL A;  4I7H A;  2WB7 A;  1U5T C;  2G62 A;  2JVG A;  2LNB A;  3LJB A;  1YYJ A;  3KYJ A;  2YS9 A;  1MQV A;  4EUK B;  3S3N A;  5BPI A;  3BT9 A;  1VI0 A;  1X3W B;  1LPQ A;  3SEO A;  2LD5 A;  4GYI A;  3MFN A;  1XMA A;  5LEJ A;  2DYS C;  5EEA A;  3RQG A;  1IZ1 A;  2EIN C;  2ZXR A;  2MC4 A;  3LSG A;  2ZME B;  3BTI A;  2DCE A;  2RRE A;  1VOM A;  2Q3T A;  3EUA A;  1UFM A;  4LGW A;  2E5Z A;  3M8J A;  1FMV A;  4RB3 C;  4A3G J;  4X0G A;  3KYI A;  2B63 J;  1Z7U A;  1FTT A;  3EGD B;  4YJW A;  2YR2 A;  2BXZ A;  4XQ1 A;  2DGJ A;  1UG7 A;  1F43 A;  5COG A;  1VQ7 I;  2NUP B;  2KQ9 A;  3R0A A;  2DPD A;  2PNO A;  1RZ4 A;  2HYG D;  1MSE C;  2XLO A;  1JTX A;  3GF2 A;  3EYY A;  4NTB A;  2R5Y A;  2HYJ A;  4XTK A;  5E18 F;  1P7J A;  1ZGA A;  3QP5 A;  3VFZ A;  2GA2 A;  1IUF A;  4HA8 A;  5GPC A;  5M5Y J;  3CTA A;  1NG7 A;  3TDZ C;  3GOR A;  4EQQ A;  2Y69 H;  4S05 A;  1BA5 A;  2DFF A;  1BBH A;  2P1A A;  4FAP B;  3UGP A;  3GTJ J;  2CH0 A;  2R9R B;  5B1A H;  5LEK A;  2HTS A;  2NNN A;  3NRH A;  4I02 A;  4Y4R A;  1K79 A;  1ERD A;  2J7P D;  2VKD A;  2FBI A;  1TT5 B;  4AC0 A;  2YL0 A;  4EHP A;  3CJR B;  3RKQ A;  2R92 J;  1ETQ A;  3PIP F;  3CLQ A;  4P1W A;  4NCQ A;  3BPX A;  1WJ5 A;  4JTA B;  2M1B A;  4IQ4 A;  3CDH A;  4HLY A;  2DYR H;  1WJB A;  2L4M A;  2I8D A;  1P4A A;  5B3S H;  1E2X A;  3KCC A;  4PJ0 C;  4Q7C A;  2VOP A;  3LSH A;  2A5W A;  2VJI A;  3VAY A;  3ELK A;  2XXA B;  1A5J A;  1S7E A;  3G2B A;  4MTD A;  2LCH A;  4B6I A;  3RI4 A;  1FOK A;  3BQZ A;  2XKP A;  1S7A A;  4CCM A;  3CMA I;  3Q6N A;  2QCO A;  3I4P A;  4A2U A;  4CBE A;  4YII A;  1BI3 A;  1IN7 A;  1EH8 A;  1A04 A;  3PFY A;  2X1E A;  3AFH A;  2OD5 A;  5F0C A;  4IAR A;  3HNI A;  2P6S A;  1FX7 A;  3C3W A;  2LDU A;  3VOD A;  4W8P A;  4M72 A;  3TO7 A;  2CV2 A;  4G7O F;  3VSL A;  3HUG B;  3TJ6 A;  1LE8 A;  1NHA A;  3VDX A;  4HYE A;  1ZAO A;  1XGN A;  2A3S A;  4XRM A;  4CIC A;  2KNH A;  3QTH A;  3RYP A;  2L7A A;  4MVM A;  2LVS A;  2H7B A;  4IHX A;  4MQ9 F;  4XMY A;  3C62 A;  3FXH A;  1OIS A;  1VYI A;  2JA2 A;  2F5C A;  4L0Z B;  2XAJ A;  3NYM A;  3S1N J;  2JJ7 A;  1IRZ A;  3B0P A;  1G3T A;  1MMD A;  4P5O A;  3US6 A;  4XRS A;  3BQY A;  2CW8 A;  4C3D A;  5JUA A;  2AS5 F;  2E5N A;  5CPR B;  1ZRC A;  3LSJ A;  2QEN A;  3CC4 I;  2GLO A;  2L9V A;  2V6C A;  3ABL H;  3S3M A;  2LY2 A;  2GIV A;  1JGG A;  4E7S A;  4LD5 A;  1BM9 A;  3WG7 C;  4WXH A;  1OPC A;  1G4D A;  1Y8Q B;  1Z67 A;  3J80 Z;  2P8T A;  1IXC A;  3BTL A;  2XGE A;  1SEU A;  1XMK A;  2VBW A;  5KYN A;  5HSW A;  3OYC A;  1GV2 A;  3HNL A;  5JHF A;  2LK2 A;  3LSP A;  3JCU C;  3TO6 A;  1ETK A;  1I6X A;  3WGG A;  1FYM A;  3ZQQ A;  3MN2 A;  5J4V A;  1Q0D A;  4I0B A;  4GXO A;  2WV0 A;  2HKX A;  2QNL A;  2V3C C;  1XCB A;  2K9N A;  4R8H A;  1T6U A;  2XL4 A;  5M5X J;  1FSH A;  3F47 A;  1XGM A;  2DT5 A;  3F9K A;  4DBQ A;  4F52 A;  4LIU A;  2XIG A;  3FK6 A;  2ZB9 A;  2X1D A;  4E17 A;  2CGE A;  2FNA A;  1Q0K A;  2LD6 A;  1PP8 F;  4L18 B;  2EA2 A;  3DQV C;  2KLO A;  4I99 C;  2XLW A;  5D4R A;  4FE4 A;  1D0Y A;  2KC3 A;  4CSA C;  5ERI A;  2QEX I;  4DZJ A;  1DGW Y;  1WJE A;  3RJP A;  1PD1 A;  3MZ8 A;  3EHN A;  1ITY A;  2R7V A;  2FF4 A;  4ZTF A;  2HKV A;  2J45 A;  1W36 D;  1V4A A;  2XB0 X;  3H9G A;  3OY9 A;  4BGD A;  1VQM I;  3TOM A;  2CSO A;  2F4I A;  1DOV A;  3GM2 A;  2HZT A;  4ANJ A;  3K66 A;  2NVY J;  3CCJ I;  2Q9A A;  3SXZ A;  1ORJ A;  2DT6 A;  5J6X A;  1EA8 A;  2IGN A;  5HV9 A;  1XN7 A;  3ASN H;  4CHU A;  3HDD A;  1FWZ A;  4CIP A;  1HKT A;  4CYC A;  3F8C A;  5M5W J;  4E7L A;  5DTD A;  3DZA A;  3H35 A;  4K7B A;  4J01 A;  1YFH A;  5IY5 H;  1R49 A;  4D0P A;  4RLQ A;  3WE2 A;  1BR1 A;  1FPQ A;  3ERE D;  1FOX A;  3GWL A;  3M15 A;  2JPC A;  4AX2 A;  3DD7 A;  1YVI A;  2BL2 A;  4IHY A;  2L5Q A;  1JUP A;  2BY1 A;  3U2M A;  3FMS A;  3BG3 A;  2UUI A;  3I4M J;  3NWT A;  2V79 A;  4NC7 A;  1Y39 A;  3BZ6 A;  2V6E A;  2LFF A;  1ORY A;  3CQZ A;  5GPA A;  2AHQ A;  4ZTJ A;  3BCA A;  4OAZ A;  1HW1 A;  2JUC A;  2MD0 A;  1J5Y A;  4U9D A;  5EYR A;  4EMS A;  4RGR A;  2FBK A;  5CVU A;  2M34 A;  4U0V A;  2WAQ N;  3E5U A;  4B47 A;  4CS9 C;  4IQJ A;  3GVA A;  3PUF A;  2MWQ A;  3CCQ I;  2OCE A;  3G1O A;  4XLP F;  2D5R B;  4JCZ A;  2HEO A;  5AC4 A;  2HXO A;  1FIA A;  4G94 A;  2DU9 A;  4C30 A;  3TK0 A;  4AVZ A;  4NTA A;  4W8K A;  1OW6 A;  3BRJ A;  1TC3 C;  1K61 A;  2O61 A;  5GAD J;  4C2M J;  1IC8 A;  3POV A;  3O2P E;  1LPE A;  5KYW B;  4V2F A;  4CCN A;  3BG6 A;  4EGZ A;  3FXL A;  2OEX A;  3S84 A;  4M73 A;  5EJC A;  2RAE A;  1FNN A;  1ZQ3 P;  2OQM A;  2QQ8 A;  4NBQ A;  3IKT A;  3MZY A;  2R7D A;  2IYL D;  3L34 A;  2EFP A;  3HPG A;  3EUH C;  1BW5 A;  5JLI A;  1MSF C;  4AM3 A;  3E1S A;  2Y48 A;  3R61 A;  4OD5 A;  2XDV A;  1J0R A;  4LG0 A;  2X6W A;  2R7X A;  1RKW A;  3HM5 A;  3TGN A;  2Q9C A;  2W00 A;  4HG2 A;  4B48 A;  4NDL A;  2RGV A;  3QU6 A;  2DPU A;  1FIP A;  1YLM A;  4BAC A;  3ZQI A;  2Y3H A;  4ENJ A;  4ZC3 A;  3I4N J;  1UG0 A;  2ACJ A;  4R32 A;  2STT A;  4RMN A;  2NSF A;  1ZYR F;  3R60 A;  5LGN A;  3JSZ A;  4O5V A;  1SVO A;  2EK5 A;  2VLA A;  5CQG A;  4XEK A;  2IA2 A;  4MS2 A;  3N0T A;  1H7I A;  4JUR I;  2R7W A;  5F08 A;  5DS9 A;  1G59 A;  5IOZ A;  2R05 A;  4CS9 A;  3LSR A;  1LVA A;  4XPX A;  3H9J A;  4FT8 A;  1J9I A;  2J9V A;  3HHH A;  5FO5 A;  3W4Y A;  2CUE A;  2HQN A;  3FHZ A;  2DJI A;  1ZW2 A;  4GCV A;  3P5J A;  1VB5 A;  1USS A;  3CD6 I;  3IH4 A;  1YW9 A;  5JLX A;  5FKO A;  3CUO A;  3EPV A;  1QU3 A;  3I59 A;  4G6T B;  5KYX A;  1J2X A;  1O7F A;  2A68 F;  2KHM A;  1HMO A;  1T6S A;  1X1C A;  1T08 B;  1QGP A;  2WAD A;  3GEE A;  5E79 C;  1LNW A;  4RAG A;  1QPU A;  4RS8 A;  3CLO A;  3W2A A;  1SVL A;  2GBY A;  5IP9 J;  5D5V B;  5EG0 B;  3KE2 A;  3MVP A;  1TR2 A;  5HNH A;  1BZ4 A;  3MKY B;  4ESJ A;  1G4U S;  1A6I A;  4U5D E;  4ZYH A;  3F22 A;  2RNG A;  3IRR A;  3E6C C;  1MBF A;  3CUQ C;  2JRT A;  1GLN A;  3OYL A;  2JA7 J;  4N4N B;  5HS8 A;  2AXT C;  3CAX A;  3SP1 A;  5BUO A;  2LKS A;  2M30 A;  1VQK I;  3HOZ J;  1GVJ A;  3EZI A;  3U1K A;  3B29 A;  3K4L A;  3WTW C;  3ZXS A;  5JSL A;  3K1M A;  3GTL J;  2L6F A;  3G1M A;  1E84 A;  2A5Y B;  2DMP A;  3WTV C;  1GDT A;  3C7J A;  3CMM A;  2V9P A;  4A6E A;  1S72 I;  2VQL A;  4FQG A;  4AIK A;  2VC9 A;  3Q7L A;  1TWC J;  2ZME A;  2DFI A;  4I98 B;  4MW3 A;  5BQI A;  4ENK A;  1X1A A;  4BQA A;  5FLX K;  4NQW B;  5F0F A;  4JQF A;  2QBY B;  3M4O J;  2KDO A;  4X0R A;  3JRE A;  4AK9 A;  4QIW N;  3P7N A;  2JSP A;  4XSX F;  2GOX B;  4ABZ A;  9ANT A;  1OCC H;  3TL4 X;  4QLC U;  2VJ5 A;  1V3F A;  2FUG 2;  4KNY A;  3J06 A;  4OIP F;  3D0S A;  4MTF A;  3TDU C;  4BPM A;  1EQ1 A;  1J8M F;  2YX7 A;  1T39 A;  2JRM A;  3CC2 I;  2M8E A;  3HIF A;  3ZMU A;  2Y69 C;  2LP0 A;  2XXA A;  1JE8 A;  3GFI A;  4JX6 A;  4XN3 A;  4Y17 A;  4FTH A;  1GT0 C;  1WI3 A;  4CZC A;  3C63 A;  2P6V A;  3V5Z A;  4JBA A;  1POG A;  3A1Y A;  4BH9 A;  2L3D A;  2FFH A;  3K33 A;  5KYY A;  4L9N A;  2IAI A;  3D5L A;  3IWF A;  4JX4 A;  5A2Q K;  2W57 A;  5BMZ A;  4XLF A;  2E7W A;  4MVU A;  3COA C;  4XOP A;  5IT9 Z;  3DKW A;  4M74 A;  2QUF A;  4S04 A;  3T4R A;  4XLN F;  4BU2 A;  4WXC A;  5D8L B;  3ZR8 X;  5F1J A;  2XF6 A;  3IAS 2;  4LFU A;  3S90 A;  1STZ A;  2OU6 A;  1PJR A;  4HF2 A;  3PDM P;  2W9Y A;  5E3C A;  2FQ4 A;  3CUQ A;  2NAZ A;  2EZI A;  4LK0 F;  1K05 A;  2VON A;  3A4C A;  4RAY A;  3D1N I;  3JTL O;  5L0G A;  2X6O A;  4CUG A;  2LF8 A;  3QYB A;  2XGC A;  1ACI A;  4EWC A;  4IJJ A;  5EHH A;  3DWL E;  4N06 A;  2KPM A;  4EIY A;  2NUP A;  4L9V A;  2MH9 A;  4FCY A;  3CP2 A;  3U0C A;  1OLT A;  3PSF A;  3LWF A;  3KIO A;  3ROU A;  2R5Y B;  2VQG A;  2X1C A;  1J09 A;  2XRN A;  1J8Y F;  4LIT A;  3ZQL A;  4C3H J;  3BOQ A;  1B9M A;  1O3S A;  3BEH A;  3OYB A;  2IS6 A;  5L3F A;  3DMD A;  4DVY P;  2XM0 A;  2DK5 A;  4B4C A;  2OV7 A;  4BDY A;  3E7L A;  3K2Z A;  2LFD A;  2L2O A;  2DA1 A;  5FD5 A;  3LMM A;  1LIH A;  2HPI A;  4EBB A;  3S9O A;  1X4P A;  2M87 A;  2HMQ A;  2WA0 A;  2J46 A;  4XKB A;  2QQ9 A;  3E0J B;  1FNT c;  4IF4 A;  1X1D A;  1B68 A;  2XPW A;  4NC8 A;  1AWC A;  1YDI A;  4E7I A;  3SDB A;  1MMA A;  4EJO A;  4RBN A;  3OYJ A;  1YRN A;  2EV6 A;  2E87 A;  1LE8 B;  2LF7 A;  3EZH A;  3HJC A;  2OCC H;  5L3V A;  1LS4 A;  5IYB J;  1REP C;  1YW7 A;  3NYJ A;  2GA1 A;  4MVO A;  2IRF G;  2RV8 A;  4A0Y A;  5TGT A;  1R36 A;  2ZBK A;  1YG2 A;  2WC2 A;  4EM0 B;  2F4O B;  3NAU A;  3C8Z A;  2P5K A;  4D5F A;  3BG7 A;  4KIG A;  2KRC A;  2OBP A;  3BR2 A;  3BG5 A;  5ILS A;  3GTM J;  4KIF A;  4HRI A;  2JA8 J;  3ZQC A;  1WKM A;  1S05 A;  4O6N A;  3IV5 A;  3QOE A;  2V1D A;  2WTE A;  1Y0U A;  2VOD A;  3DLL F;  4YWQ A;  3FXO A;  3DKA A;  3ONQ A;  3SYT A;  2Y0S N;  5FZT A;  2V9V A;  3G73 A;  4LIV A;  5H6Q A;  1QBJ A;  1FTZ A;  2JPB A;  2HSQ A;  3ZMV A;  4DRH B;  5K5R A;  4E18 A;  1O3Q A;  5L3G A;  3EJN A;  4KUM A;  1M2V A;  2HQA A;  2C6Y A;  2EBI A;  1X3Z B;  2YZS A;  4MHG A;  3VB2 A;  2VKH A;  2WB1 A;  3ZQY A;  3QRF F;  2KIM A;  1AA7 A;  2H8R A;  1I5Z A;  3T6G B;  1NH3 A;  3GEZ A;  1VQ5 I;  3RQE A;  1WWP A;  4XLH A;  1R5I D;  2OUM A;  2MC3 A;  2DDB A;  2R5Z B;  3UMH A;  2G7U A;  2HVS A;  3BDD A;  4CCJ A;  2FML A;  1CGO A;  5KNL A;  2XAQ A;  4B3X A;  3ZPL A;  2HWV A;  2BVM A;  2JTV A;  5FKM A;  3PUB A;  5DV5 A;  4XEV A;  2XAF A;  3NAR A;  1X1P A;  2L4A A;  3M3Y J;  1P4X A;  2QLA A;  4XKC A;  2EPN A;  4KI2 A;  4YL1 A;  1SD7 A;  1NG6 A;  3DPL C;  4LMY A;  4Q47 A;  2G3K A;  4RBO A;  1B59 A;  2M7A A;  1ZHZ A;  3O39 A;  4HSR A;  2AQF A;  2ZSH B;  1BW6 A;  4BHC A;  2DA7 A;  3N05 A;  2VOO A;  3DI5 A;  3P9I A;  2M4G A;  5DYM A;  3W2V A;  4LG0 B;  2PLY A;  1DOW A;  3RQF A;  2DAO A;  4CO8 A;  4XK4 A;  3GLX A;  4D9J A;  3AG3 H;  1TWG J;  3BR5 A;  4KNV A;  4BQN A;  4OIO F;  4WK8 F;  1LQ1 A;  1HW5 A;  3V8K A;  1V55 H;  3LA2 A;  4D7N A;  2KP6 A;  1PUF B;  2KT0 A;  1SF8 A;  3R2P A;  1JTY A;  4XIC A;  4OOI A;  5BNG A;  1APL C;  1Z5Z A;  5FKN A;  2YVK A;  2DA6 A;  2GOM A;  2Y0M A;  2MBF A;  2OPT A;  2CNW D;  5JRA A;  1ZRD A;  1XZQ A;  3BTJ A;  3DKY A;  1VQN I;  4YN0 B;  1XDU A;  1OQC A;  4DQ2 A;  5C4X J;  3NMJ A;  3I5P A;  5K0I A;  1W5C C;  1R1T A;  3B6C A;  2AU5 A;  1F36 A;  3GFL A;  3E5X A;  1F4K A;  5HVQ C;  1EKE A;  3CME I;  1ON2 A;  4YFK F;  1P7I A;  5IPA A;  3EPZ A;  4XLA A;  5EDN A;  4MVS A;  3FBI B;  3FKI J;  3CJN A;  1X2M A;  2LSO A;  3V5X A;  2FD5 A;  1MBG A;  3JTH A;  3WGH A;  4BHP A;  4F92 B;  1IRF A;  4AVP A;  3HRT A;  5FLV A;  3C8G B;  2CQ7 A;  4WX9 A;  4M63 A;  4HQE A;  3ZQG A;  2ME0 A;  3PM1 A;  4HNT A;  2FAP B;  1ETO A;  3IPM O;  3GWZ A;  2L0K A;  5D6E A;  3Q5F A;  5HS9 A;  1U8B A;  1A31 A;  3AGU A;  2FRH A;  2CNW A;  4U7B A;  3CQZ J;  1N78 A;  5KVR A;  2R7O A;  5DQT A;  4IHW A;  4BQO A;  2F6C A;  2LTP A;  3A02 A;  3ZGK A;  2I10 A;  4CDY A;  1D8J A;  2XLD A;  2UV1 A;  1LUJ B;  1G6N A;  2ZXW H;  1UHS A;  2YEV A;  4UV9 A;  4EGY A;  4HDV A;  2XAH A;  2Y9Z A;  2EPK X;  3HKK A;  3M1C B;  2OC6 A;  3HOU J;  3K1I A;  1V5F A;  5L0J A;  3HL2 A;  5J1U A;  1ST6 A;  1IAW A;  1RXQ A;  2TDX A;  4U0W A;  3DBH B;  1KZH A;  4J32 B;  2HUJ A;  2BY0 A;  5L0D A;  5DCF A;  2QGU A;  1WGX A;  3WTU C;  4V19 K;  3AG2 C;  2DMT A;  1YHQ I;  5B1A C;  2XRL A;  4IJA A;  3CJT B;  2KDZ A;  3SXM A;  3WAQ A;  3K4B A;  2ASR A;  2OOC A;  5A6K A;  2YWA A;  2E1M B;  2Y30 A;  1IDY A;  1YI2 I;  1ZW3 A;  3LUT B;  1TWA A;  2FQ3 A;  4MFD A;  5KHD A;  4LDR A;  4O3M A;  5JT4 A;  3QU3 A;  1CPQ A;  1ETV A;  3QOP A;  3I5Q A;  4C2T A;  3RQ4 A;  1FSE A;  1R58 A;  3X2Q C;  3QVZ A;  2E19 A;  4JC7 A;  4LOC A;  2ISZ A;  3HPH A;  3JRG A;  1BOA A;  2QUP A;  2K40 A;  2Z5U A;  5GTH C;  4HNU A;  4HV6 A;  1LDK B;  5FJ8 J;  3CP8 A;  1HBX G;  1UEL B;  3WHB A;  3HYI A;  3ZTZ A;  2CUZ A;  1KQ8 A;  1BBY A;  2NG1 A;  2WY8 Q;  3OYH A;  1I6H J;  1YAU O;  4WCG A;  2EIN H;  3FIS A;  3QZC A;  1E86 A;  2OG2 A;  2Y0S A;  2PX3 A;  2ZKZ A;  5D5W B;  5A6B D;  1MNE A;  3TOB A;  4CX9 A;  1JRA A;  3LLK A;  2DN0 A;  5COM A;  2DK8 A;  3S1Q J;  4ZYD A;  3EFO B;  1TLH B;  2O3F A;  3K6G A;  3E6M A;  3PQJ A;  4AIH A;  1XSV A;  3H5N A;  2IT0 A;  2XVC A;  3TOA A;  2L6G A;  4JEB A;  4BY1 J;  3LSM A;  5AC5 A;  4DOZ A;  2DA4 A;  5GAE J;  1VQ8 I;  4YEJ A;  3NWS A;  1VQ6 I;  1I5N A;  1QZZ A;  2NUT A;  1R1V A;  1HF0 A;  1HW2 A;  2MH2 A;  1JKP C;  3U9M A;  3QP6 A;  2HVQ A;  2RSE B;  4LJZ F;  3HSE A;  1WQ2 A;  3HOY J;  2VC1 A;  3TP3 A;  2HKO A;  4BE0 A;  3KP3 A;  2R7Z J;  2QYO A;  3E6D A;  5E1X A;  2XF7 A;  4RGX A;  2PF4 E;  1RR7 A;  5EGO B;  4MVZ A;  3ABU A;  3JRI A;  4G9Y A;  4U87 A;  4NHJ A;  3VYU B;  3PIO F;  3FXM A;  4M3D A;  3CEX A;  3RH3 A;  1RNL A;  3F6V A;  4U5F E;  3DP7 A;  4L0Y B;  1TZL A;  2Z3Y A;  5LGU A;  4C9Y A;  1ZN2 A;  2ZJP F;  3EFO A;  1S29 A;  4N6H A;  4R1H A;  3BJO A;  4JVS A;  3EET A;  2KW3 C;  3W8I A;  5KYY B;  2KSF A;  1YQA A;  2DA5 A;  4J30 B;  3BWG A;  4BEM J;  3ZOB A;  3ZRG A;  1ZTR A;  5B3S C;  2Z9O A;  3BR0 A;  1W0U A;  1VLT A;  4PSW A;  2FNP A;  3H65 A;  2DQR A;  1ETW A;  2R7Q A;  1JMW A;  2QQA A;  3WU2 C;  3L2W A;  3CUQ B;  3RKW A;  2HDW A;  4FIS A;  5IYD J;  1BI1 A;  1FOW A;  3V8J A;  3SJM A;  3RPU A;  2HOS A;  3JZ0 A;  4FES A;  1FYL A;  4BQQ A;  5JVE A;  2HOT A;  1IXR C;  3U21 A;  4GDF A;  4IHS A;  3HRS A;  2WVN A;  2KGO A;  1F9N A;  3OWT A;  1I4Y A;  1Z3I X;  4B1R A;  1WSU A;  5L3Q A;  1J7K A;  3F8N A;  2BVL A;  2HS5 A;  2K4J A;  3GLL A;  4ENN A;  3GM3 A;  1ZHW A;  3OYD A;  5A6A A;  4D4N A;  3W8H A;  3QPS A;  1JUM A;  2BHY A;  1NK2 P;  4JW1 A;  4IRI A;  1T8I A;  2O8X A;  2WVQ A;  1H9G A;  4DBR A;  1I50 J;  3FOP A;  1QO0 D;  2NYX A;  3K1H A;  2HFI A;  2CG4 A;  2H09 A;  3M8E A;  2X48 A;  1O3T A;  2ZME C;  2ZNY A;  2CO5 A;  5DUI A;  2OTJ I;  1MND A;  2ELH A;  3AL0 B;  3DF8 A;  4HAM A;  5F64 A;  3GYH X;  2Y31 A;  2XS8 A;  4M3F A;  2PJP A;  3H2V A;  5DS4 A;  5JI6 A;  1TT0 A;  5D5X B;  2FGY A;  1W5S A;  4UHT A;  2VKE A;  5CVI A;  3ZMT A;  4M3B A;  1WJD A;  3I5U A;  1Y1V J;  3M4C A;  4I2O A;  1T0F A;  4PR9 A;  5K7Z A;  1T0F C;  4M6V A;  2ZXW C;  2D1V A;  2FBH A;  1R1U A;  1MW7 A;  4UVA A;  4LDK A;  1GUU A;  2K27 A;  3GTG J;  3HNK A;  5ILV A;  2WL8 A;  4A3F J;  1FR0 A;  4E7H A;  1Q1V A;  3O10 A;  4RB1 A;  2P61 A;  2HR3 A;  3VOE A;  3JRM O;  4PJN A;  1O7L A;  1F5T A;  1U0B B;  4KT6 A;  1ZR4 A;  5DEQ A;  1U3E M;  3KLO A;  2IXM A;  3ZMD A;  2IGM A;  2VBX A;  5BQH A;  5IP7 J;  2GFH A;  2P81 A;  1U8R A;  4E4H A;  2Q2E B;  3HZJ A;  1QVU A;  1MZB A;  3H5R A;  3VYW A;  1ON1 A;  2HYF A;  1DGR M;  1MH4 A;  3GZN B;  3BCB A;  3SFI A;  1HC8 A;  1WFX A;  1D5V A;  1A0B A;  1PCX A;  2LH9 A;  4K1O A;  5E33 A;  4RA2 A;  3N2Z B;  2WAF A;  5CVJ A;  3WTX C;  1OKK D;  3R7C A;  2IS2 A;  2PEX A;  3L00 A;  2XPV A;  2EWN A;  3WHN A;  1YJW I;  5DS5 A;  2VT2 A;  3SDG A;  3OR2 C;  3G71 I;  1TWC A;  2HGC A;  4CGZ A;  2VPR A;  4R79 A;  5L3C A;  1EKY A;  2H6C A;  1OR7 C;  1OYI A;  1WJA A;  2NOG A;  4X6A J;  3C18 A;  3GME A;  3L2Q A;  2HDC A;  3FBN B;  1NK3 P;  2O7O A;  2ESH A;  2EPO A;  1CGN A;  2PI0 A;  3GZ5 A;  3MKW B;  2HVR A;  2IBF A;  2GAU A;  3H9Q A;  3AG2 H;  1UFB A;  1YZC A;  4FX5 A;  1GVD A;  3QOD A;  1SMT A;  3G4Z A;  3H3V K;  4QSH A;  1JXS A;  5FB2 A;  4DRI B;  2DOD A;  5JVT A;  3LAY A;  4HEA 2;  1E3P A;  1GGQ A;  3E97 A;  2UXX A;  3MFK A;  2XRH A;  4A3B J;  4ONS A;  5HLT A;  1RPW A;  4D7M A;  3MWM A;  3IC7 A;  5FGM A;  3CCE I;  2ID6 A;  3CDL A;  3MD2 A;  4Z6Y A;  1HA8 A;  1ORS C;  4ULW A;  1N1C A;  2XSD C;  2LLK A;  4U7D A;  1LB2 A;  1WZ2 A;  1O3U A;  2P7V A;  2BY3 A;  3AG4 H;  1T01 A;  5A69 A;  4FX0 A;  4ZDO A;  2BBY A;  4XPY A;  1XZP A;  3KYL A;  4K2E A;  3HTK C;  1T5O A;  1KQ0 A;  2NPU A;  2QF7 A;  3F46 A;  2LBF B;  3A0B C;  1U9N A;  1B8I B;  2VCA A;  3IQC A;  2K7L A;  4QPQ A;  3OYG A;  2KKO A;  1C17 M;  5K1Y A;  1N75 A;  2CWE A;  2ME6 A;  2GXB A;  3ZSU A;  3A01 A;  2QSH X;  4UUS B;  5JHU A;  1MJB A;  1IV8 A;  2LQG A;  4XOR A;  3NMK A;  2RQP A;  1S7O A;  3NKE A;  3CO6 C;  5J8C A;  5ICE A;  2CMP A;  3MQ0 A;  2LP4 A;  2VCC A;  3RTR A;  3CES A;  3PFI A;  4UB8 C;  2HSB A;  5GAH J;  3HOS A;  3PMR A;  1OKR A;  3SXK A;  3QVY A;  3DBR B;  2M0C A;  3I64 A;  3LFK A;  1G4W R;  1OMI A;  3S3O A;  2YU9 J;  1U89 A;  2M64 A;  2K02 A;  1RI7 A;  1SD6 A;  2UUZ A;  4YK5 A;  2KL4 A;  3K1P A;  2BOL A;  2XSJ C;  2RNJ A;  1S9H A;  2D1H A;  4GRI A;  2YL7 A;  1TQP A;  1SD5 A;  5IP6 A;  3AKZ A;  2OZ6 A;  1H9T A;  3AJM A;  5KAF C;  1Y6D A;  3FMR A;  4IB4 A;  1IDZ A;  4E0I A;  2Y75 A;  4BJT A;  2DQL A;  2Z2S B;  1ZH5 A;  3OYE A;  4OD4 A;  2OF7 A;  1MBE A;  3KP5 A;  1MMG A;  2OA4 A;  5D91 A;  3CSK A;  1SAU A;  3B73 A;  2GIZ A;  2VE9 A;  1OW8 A;  4U5C E;  1CPR A;  3DBL B;  4IHV A;  4I1O B;  1LFB A;  3S2D J;  4YIR X;  1A41 A;  2EPM X;  2GM4 A;  1PVE A;  2ELK A;  1L0O C;  1FFH A;  1QKR A;  2E2H J;  4A5M A;  1WGW A;  1VFC A;  5LBQ A;  2P0W A;  1V5E A;  1IZM A;  1FLI A;  1Z3Y A;  1ZU5 A;  4AL0 A;  3OL3 A;  4KA4 A;  4QPO A;  5ICC A;  1YX3 A;  1PYV A;  4KN7 X;  3L1P A;  5DDG A;  3F0C A;  3F8B A;  2M0M A;  2K9L A;  3S1R J;  2WZL A;  3KEQ A;  3BTC A;  2MYS A;  2MLK A;  4DYQ A;  1OCR H;  2E35 A;  4EM1 A;  3JRC A;  1F1M A;  3RVZ A;  4MW8 A;  4YG2 F;  3CF2 A;  5D4S A;  2Z33 A;  2J9U A;  3HB9 A;  1SFX A;  4ZH4 F;  1QZY A;  1Y56 A;  4LDQ A;  1Z23 A;  4P55 A;  2V26 A;  2Y3G A;  5DD4 A;  1FEX A;  2A0B A;  3KET A;  4NB5 A;  1DU0 A;  4RM3 A;  2A61 A;  1YTY A;  2Y3B A;  1KON A;  4B44 A;  3ZQ7 A;  2AVK A;  2ECB A;  2H7O A;  3KP4 A;  1RMV A;  4U5G A;  4JX5 A;  4HQM A;  3TQN A;  1D1C A;  2R02 A;  4RD9 A;  5FRM A;  4G78 A;  3MCZ A;  1R5G A;  3Q0V A;  4B3A A;  1KU7 A;  2HDD A;  1K04 A;  5F1R A;  3HRM A;  4IXA A;  4BBR J;  3GUD A;  1HKS A;  4G6Q A;  4FE7 A;  1D0Z A;  4BXX J;  1A36 A;  2V9K A;  2VUM J;  2EPF A;  4JIO A;  3PJR A;  2JT1 A;  2EFW A;  2DI3 A;  2OZU A;  2VIX A;  1VQO I;  4YT4 A;  3IQ5 A;  3JCU Q;  2BYV E;  1TWA J;  3L2U A;  2QE9 A;  2FJ1 A;  2X4H A;  3D5R C;  2EZH A;  3QWL A;  4JP0 A;  4HOB A;  1ZHF A;  3FHN A;  1KQ9 A;  2ZO4 A;  4HNV A;  4CS7 A;  4DRJ B;  2W1O A;  3J81 K;  3CCR I;  1W7P D;  1FC3 A;  3MYF A;  4IVN A;  2PMH A;  3R0J A;  4LLL A;  3J7Z I;  3HKZ A;  1DP7 P;  1RKE B;  4N4O B;  3K70 C;  3MZH A;  2F5F A;  2W7N A;  3O55 A;  3JSP A;  2LK4 A;  1I1G A;  1K4S A;  2EPL X;  2IXO A;  4M6X A;  1J59 A;  1NTC A;  1LFP A;  4D5C A;  3CO7 C;  3DV8 A;  3TBI A;  4A3L J;  5JP7 A;  5DS6 A;  5B1B C;  2IJL A;  2D5V A;  1U5T B;  4Y15 A;  5BPD A;  2RQQ A;  3LNM B;  3HEF A;  3I9V 2;  1ZG5 A;  4ESB A;  3RSN A;  1GS9 A;  2CFO A;  5D6F A;  4CH7 A;  1NG1 A;  4RGU A;  3M79 A;  5L3D A;  3TD7 A;  2AP3 A;  3QPL A;  1TL8 A;  1V5G A;  1BN5 A;  2PQ8 A;  4CJO A;  3E70 C;  3QW1 A;  1D0X A;  1G8X A;  4I3M A;  2EJR A;  4A3E J;  1A6Q A;  1BJA A;  1Y0N A;  2ZJR F;  4BG0 A;  3E6B A;  2MW8 A;  3GXO A;  1O57 A;  1M56 C;  1JJ8 C;  2BZT A;  3WHC A;  2FU4 A;  5H20 A;  2W84 A;  2B7E A;  2QM3 A;  2COM A;  3QPH A;  1B72 B;  2DA2 A;  4IKF A;  3LST A;  3OIP A;  4RB0 A;  1RR8 C;  3G4X A;  4O79 A;  1MMN A;  3BC8 A;  1ETX A;  2CS3 A;  2HPM A;  1XGO A;  4E7Z A;  4ZZD A;  4LLN A;  5BS6 A;  4HE8 D;  2KZG A;  4WJ0 A;  2MG4 A;  1IN6 A;  4OMY A;  4EEF G;  1FP2 A;  5E3N A;  4IRH A;  5CYV A;  3R6S A;  3RZD J;  1NFN A;  3L8I A;  2WY7 Q;  4XLE A;  2M9H A;  1UZC A;  1R4T A;  1ONV A;  4RB2 C;  1H8A C;  3KPH A;  2AO9 A;  3BJ6 A;  3ASO H;  4ITV A;  1ZK8 A;  3GEI A;  2CDQ A;  1CGP A;  1N77 A;  1MBK A;  1U5T A;  3HOX J;  1I1S A;  3PSI A;  3S2H J;  4U5E E;  4U9E A;  4ER9 A;  1TWG A;  3SZR A;  3ZN0 A;  4OWR B;  4HPQ A;  1Z6R A;  2CV1 A;  2XLE A;  3DE8 A;  5M3M J;  2JUG A;  4N9I A;  3ZIB A;  1M1E B;  5B5E C;  4BNC A;  3RDI A;  4IHT A;  2R7U A;  1VND A;  3OSF A;  3J80 K;  3BZC A;  4EJV A;  1OKK A;  4I6Z A;  1V55 C;  1WJC A;  1VMA A;  3EQL F;  2PJR A;  3L2C A;  1VZ0 A;  3OYM A;  5E3L A;  4PGG A;  3X1O A;  2VT3 A;  2GWW A;  5L0C A;  2OJQ A;  4KNW A;  2IGO A;  2PJR B;  3PO2 J;  1DQU A;  2P5V A;  2RC4 A;  4MEY F;  3RKX A;  4DGW B;  2P7C B;  1R6R A;  2Z1D A;  5ED4 A;  4MLO A;  1BIB A;  2XSE A;  3K10 A;  1IO2 A;  1X1B A;  5F5H A;  4DJA A;  5HDG A;  2JX0 A;  2KRH A;  5FFX A;  4YT8 A;  2E1O A;  3FKJ A;  3FHD A;  3RIP A;  1R22 A;  5HDN A;  1M2O A;  4LAC B;  5HNF A;  1Q0G A;  2Q00 A;  4C2U A;  2E7X A;  4KFC A;  1RJ9 A;  1RKC A;  3RPQ A;  3KX2 A;  4BJ5 A;  2VPL A;  1RKT A;  1VK5 A;  3M07 A;  1M2V B;  4RAF A;  4OAY A;  3DCF A;  3M7G A;  4MGR A;  3G3Z A;  4MVQ A;  3FAJ A;  3K2A A;  1BJZ A;  3B71 A;  1Q0F A;  1YJN I;  3K7D A;  4A3J J;  4Y13 A;  3Q9S A;  5E8I A;  1O4X A;  2CV0 A;  4GFB A;  2H7V C;  4D1Q A;  1S7Z A;  4HZF A;  3OS1 A;  5FLX Z;  1BI0 A;  4Y52 J;  1SFU A;  1HE9 A;  5E3A A;  3JRB A;  2JK3 A;  4XKW A;  2NS7 A;  1O5H A;  3NG1 A;  4JRZ A;  1E3O C;  3IWZ A;  5TJ5 E;  1ZVZ A;  1JT0 A;  4P9T A;  1T6Q A;  5H2F C;  2FMY A;  5BOX A;  1MD0 A;  5T3T A;  4CSW A;  1IN5 A;  5JVG F;  2AWC A;  3MMY B;  4LG3 A;  2I15 A;  1SR2 A;  3L8J A;  2DTR A;  4CCK A;  3B02 A;  2EA4 A;  1ZU4 A;  4H54 A;  1IGN A;  4PDK A;  3TED A;  2C03 A;  4IAQ A;  4HX8 A;  2KRF A;  2YU3 A;  3KZZ A;  1R71 A;  2KIQ A;  2LFB A;  1JGS A;  1TP4 A;  4I0A A;  2R7R A;  4M9S A;  1I3Q J;  3KZY A;  1VYK A;  2JVH A;  2CW0 F;  4F3Q A;  2W45 A;  4WWC A;  3KH2 A;  3GX4 X;  3HLZ A;  1TWH J;  3GFJ A;  5LFA A;  1YS7 A;  1VQ4 I;  5FFZ A;  1IF1 A;  3ZG1 A;  2KIS A;  1ZG1 A;  1QQ3 A;  2YLI A;  3DJN B;  5CI8 A;  1SAX A;  3PNT A;  1TWH A;  2YUS A;  2IM8 A;  4KJZ A;  1ZHT A;  4GGG A;  2YLG A;  3Q7G A;  3U1D A;  3ZQV A;  3GM1 A;  3BR3 A;  4N9H A;  1B1B A;  4BYY A;  4KIB A;  2EFO A;  3HHG A;  3I56 I;  1JPJ A;  4L5E A;  2C04 A;  2XPU A;  5A6B A;  2DLL A;  1FBS A;  1LJ9 A;  1EV7 A;  3B6A A;  2L6H A;  3TW6 A;  1YZA A;  1B6A A;  3IEE A;  2Q0O A;  3W6J B;  5LLQ A;  1R5H A;  5BQT A;  1T95 A;  4CS8 C;  2W4S A;  2E1C A;  4L9J A;  4OMZ A;  3RYL A;  3VRC A;  4JK1 X;  2V1N A;  1Y1W J;  1ZRE A;  2PX9 A;  2QA4 I;  3MKZ A;  1JJ6 C;  3HOV J;  1E0E A;  3VWB A;  2Q9B A;  1X2N A;  2BW3 A;  3FIW A;  4XSZ F;  1EJ9 A;  3L1M A;  1WOL A;  2BY2 A;  2VQC A;  2PN6 A;  3C2G A;  5AIQ A;  5HLI A;  3UNG C;  3FX3 A;  5CVR A;  3JSO A;  1QPI A;  2GA0 A;  3FXU A; 
#chains in the Genus database with same CATH homology
 3RCO A;  1P9Q C;  4J01 A;  3KMI A;  2KW3 C;  4YT5 A;  3W8I A;  5KYY B;  4O6Y A;  5KYX B;  4AU7 A;  4CA0 A;  4RLQ A;  1BR1 A;  1SFK A;  3W3C A;  4F91 B;  2VH3 A;  4J30 B;  2XC7 A;  2PMZ A;  4MND A;  4AX2 A;  3S0X A;  3DD7 A;  2W4M A;  4KIS A;  2WVO A;  3ZRG A;  2L5Q A;  5B3S C;  2Z15 A;  2M3A A;  4HEA J;  4PJJ A;  4PSW A;  1JI8 A;  3NWT A;  3H65 A;  4NC7 A;  4F4B A;  2V6E A;  2R7Q A;  4JOM A;  3CQZ A;  5KYW A;  3L2W A;  4ZTJ A;  3BCA A;  2ZXP A;  4OAZ A;  4GEH A;  2HDW A;  2MD0 A;  1LVK A;  3OMY A;  4XQF A;  2IXP A;  1Z63 A;  3K6B A;  1OCZ C;  4A2N B;  4FES A;  5HOO A;  3DZA A;  4BQQ A;  2L9N A;  3GBG A;  2QY9 A;  2Z16 A;  4B47 A;  4CS9 C;  1QHG A;  3AG1 C;  4IQJ A;  3U21 A;  3DTE A;  2IXN A;  2MWQ A;  2V4J C;  2KGO A;  3OWT A;  2WVN A;  3K4J A;  2D5R B;  3ABK C;  4K0D A;  1Z3I X;  4XLC A;  4XLP F;  4LLE A;  5L3Q A;  1PD0 A;  1ZHX A;  2BVL A;  4C30 A;  4II3 A;  1ZHW A;  4HFF B;  4AVZ A;  3OYD A;  4W8K A;  1QZX A;  3W8H A;  4Q5S F;  4JW1 A;  4LER A;  3POV A;  3LFU A;  5KYW B;  2IXS A;  4CCN A;  3BG6 A;  2WVQ A;  4BEH A;  4DBR A;  1Z21 A;  4PUS A;  2MAB A;  3K1H A;  4XN0 A;  3PHF 2;  2LSE A;  4XON A;  1BOB A;  1O87 A;  1MND A;  3C2H A;  3AL0 B;  1SMY F;  4IRU A;  5KYX A;  2IYL D;  5DS4 A;  3L34 A;  3VYT B;  3DTK A;  1TT0 A;  3HPG A;  2FGY A;  3BLY A;  3EUH C;  2A6E F;  3E1S A;  2UWM A;  4OD5 A;  5CKT A;  2Q1Z B;  1WJD A;  2XDV A;  2WZG A;  5CI9 A;  2PFD A;  3T6B A;  2X6W A;  2JD3 A;  2A69 F;  1T0F C;  2ZXW C;  2R7X A;  1MW7 A;  3OYK A;  4O6M A;  2Q9C A;  3DU5 A;  2W00 A;  4BL0 B;  1NZE A;  5DS5 A;  4HG2 A;  3E9V A;  4B48 A;  2HZD A;  4G7Z F;  3K4K A;  1FMW A;  2WL8 A;  3L0I A;  4E7H A;  2ZXI A;  4BAC A;  2Y3H A;  3LEV A;  4ZC3 A;  4F55 A;  4YN0 B;  1UG0 A;  4PJN A;  4C7O B;  2ELJ A;  3DXJ F;  4RMN A;  1ZYR F;  4KT6 A;  4G7H F;  2XF5 A;  3JSZ A;  2VLA A;  2IXM A;  2IGM A;  5CQG A;  2GFH A;  3N0T A;  4JUR I;  2QKL B;  2R7W A;  2DT7 B;  4E4H A;  2Q2E B;  3VYW A;  2J0W A;  3H5R A;  1G59 A;  3FDY A;  1DGR M;  3GAN A;  5KCM A;  3BCB A;  5T1D B;  4CS9 A;  4EAT A;  4IAO A;  1WFX A;  3H5A A;  3H9J A;  3S93 A;  1PCX A;  2L7K A;  2LH9 A;  2J9V A;  4P6I C;  5E33 A;  1X4O A;  4E6K G;  3QYF A;  3HOT A;  3EGD A;  2DJI A;  3N2Z B;  2WAF A;  5D92 A;  1OKK D;  4CS8 A;  2IS2 A;  4B43 A;  4XR6 A;  3AQB A;  3EPV A;  5E2Q A;  1NU9 C;  1QHH D;  2ZPA A;  1QU3 A;  2J9W A;  5KYU A;  4G6T B;  4Y3O A;  3RKO F;  3OR2 C;  4ZDL A;  2KHM A;  1TWC A;  2A68 F;  2CW7 A;  4PJL A;  1X1C A;  2WAD A;  4R79 A;  3DTI A;  2L81 A;  2BE5 F;  2HNH A;  1YX5 A;  4JJF A;  2VXD A;  1OR7 C;  1WJA A;  4YRV A;  3W2A A;  3LSK A;  3IUO A;  3O6X A;  1OCC C;  2EIK C;  2WZF A;  4LLC A;  2X6Y A;  3L2Q A;  3EHM A;  3UMI A;  3S28 A;  1TR2 A;  3FBN B;  5HNH A;  3MKY B;  1ZEL A;  1Y6I A;  4BJ6 C;  4BE2 A;  2PX0 A;  3FVY A;  4U5D E;  3K4M A;  3MKW B;  2HVR A;  2EIJ C;  2RNG A;  3H9Q A;  4FX5 A;  4OIR F;  3AG4 C;  3QOD A;  2K3P A;  1GLN A;  4HST A;  1WJF A;  3OYL A;  1FTS A;  1Z6A A;  4G0H A;  4N4N B;  2HV7 A;  4BJ1 A;  2E1M C;  3FDQ A;  4AYB A;  3SP1 A;  2VJ4 A;  3EUK L;  5BUO A;  2A6H F;  3EZI A;  3LAY A;  4HEA 2;  3K4L A;  3SZG A;  4OIN F;  2XRH A;  3ZXS A;  5HLT A;  4FWV A;  5FRN A;  3PL8 A;  4Y33 A;  3OEO A;  3DJU B;  2I8B A;  3CMM A;  3S27 A;  5DVW A;  4FET A;  2VQL A;  4XL9 A;  3Q7L A;  1HA8 A;  1ZHY A;  3MD2 A;  4ULW A;  1N1C A;  2P7V A;  1X1A A;  4FAS D;  4NQW B;  3AL0 C;  4ZDO A;  4BS9 A;  2ZXO A;  3S32 A;  4CSA A;  3RPU D;  4JQF A;  3KYL A;  1OCO C;  3HTK C;  2KDO A;  3VSK A;  3LNR A;  4X0R A;  3DM5 A;  4AK9 A;  2JSP A;  2VQH A;  2GOX B;  3F46 A;  2LBF B;  3TL4 X;  1EA3 A;  3OYF A;  2VJ5 A;  4ZJZ A;  3DEE A;  4QPQ A;  3OYG A;  3ASO C;  2FUG 2;  2R7T A;  1N75 A;  4OIP F;  3ZSU A;  2ZFU A;  4RDA A;  3UGO A;  2NUT B;  1J8M F;  2XXA A;  2Y69 C;  1FFT C;  2M4K A;  4XOR A;  4CCL A;  3NKE A;  4RLF A;  1LS1 A;  4XN3 A;  2CMP A;  2KQR A;  3LS0 A;  4CZC A;  3RTR A;  3CES A;  2P6V A;  4C3B A;  3HOS A;  3PMR A;  3A1Y A;  1X19 A;  3K70 D;  2FFH A;  1QLE C;  3K33 A;  5KYY A;  3D5L A;  3PNY A;  1M57 C;  3DU6 A;  4XLF A;  5T3W A;  3S3O A;  5KYU B;  4XOP A;  3LL7 A;  2K5C A;  3HXL A;  2M4E A;  3T4R A;  2UUZ A;  4BU2 A;  4XLN F;  2L9S A;  2KL4 A;  3OR1 C;  3IAS 2;  2XF6 A;  2BOL A;  2XSJ C;  4ZDP A;  3ZR8 X;  2IOQ A;  1S9H A;  3ZC4 A;  1PJR A;  4GRI A;  3UR3 C;  2W9Y A;  5E3C A;  3OIQ A;  3A4C A;  3AKZ A;  2VL8 A;  4CUG A;  3CJQ B;  3QYB A;  4E7J A;  1RJ9 B;  4IJJ A;  4EWC A;  5EHH A;  3DWL E;  4N06 A;  4BJT A;  2Z2S B;  4PFP A;  2KPM A;  3OYE A;  2NUP A;  4OD4 A;  1DP3 A;  3OYN A;  4RM2 A;  3CP2 A;  1OLT A;  1MMG A;  2HU9 A;  3PSF A;  3VYR B;  2R7S A;  5D91 A;  1J8Y F;  2VQG A;  2X1C A;  1J09 A;  3CSK A;  4LIT A;  2L9J A;  1SAU A;  2O9X A;  3NDB B;  4U5C E;  3OYB A;  3LES A;  4JCH A;  4BJ5 C;  2IS6 A;  3DMD A;  4I1O B;  4DVY P;  3VYS B;  4BDZ A;  2OV7 A;  1OCR C;  1FFH A;  4BDY A;  4XOT A;  2L2O A;  3IAM 2;  1NU7 D;  2W4B A;  3S8P A;  2X85 A;  3LMM A;  1WGW A;  2R4G A;  2HPI A;  3OS2 A;  4U5B E;  3N24 A;  4EBB A;  1U0J A;  1V5E A;  1X4P A;  2P0W A;  2W82 A;  1IZM A;  1Z3Y A;  2WA0 A;  4XKB A;  1ZU5 A;  3E0J B;  3OL3 A;  2DXI A;  2WBM A;  1X1D A;  2LC2 A;  3UMK A;  4NC8 A;  3UMH A;  4QPO A;  1UAA A;  3B9Q A;  3QMK A;  3DPT A;  1PYV A;  1YX3 A;  3OYA A;  4E7I A;  3SDB A;  1MMA A;  2M7B A;  2EIM C;  4RBN A;  3OYJ A;  3ZCO A;  3OYI A;  2E87 A;  3NKD A;  4JJG A;  3DLA A;  4GYT A;  3EZH A;  2M0M A;  2K9L A;  2X51 A;  2WZL A;  2PP4 A;  3DM9 B;  3HJC A;  4Q4Z F;  5L3V A;  2MYS A;  3NYJ A;  3ZVR A;  1JPN A;  3CF2 A;  2J7P A;  3MX3 A;  5DLJ A;  2J9U A;  4PK4 A;  2A1D D;  5TGT A;  1Y56 A;  2LY1 A;  2J0X A;  1Z23 A;  4CIH A;  2V26 A;  2ZSI B;  2ZXH A;  4AE4 A;  2Y3G A;  3BG7 A;  2KRC A;  2LYC A;  2A6T A;  5LD2 C;  2K9M A;  4HRI A;  4YT2 A;  3V42 A;  4RM3 A;  3J7A Y;  1LKX A;  2Y3B A;  4O6N A;  1KON A;  3QOE A;  4B44 A;  2H7O A;  2DYR C;  2AQE A;  2IS1 A;  4U5G A;  2IGK A;  2NOJ B;  4YWQ A;  1D1C A;  4PJM A;  3DKX A;  1BR4 A;  4RD9 A;  3ONQ A;  3SYT A;  3L2V A;  2BW3 B;  5FRM A;  2VXZ A;  1YE9 A;  4LIV A;  3SEZ A;  4KC9 A;  3SYN A;  3I4U A;  3ABL C;  4YEL A;  1IRX A;  2VAS A;  3EJN A;  1M2V A;  3EGX B;  4CCO A;  1D0Z A;  2HQA A;  4QDL A;  2YZS A;  1D1A A;  2V9K A;  2VKH A;  2WB1 A;  4BUP A;  4IZZ A;  1W36 C;  3PJR A;  4AE4 B;  5DQZ A;  1AA7 A;  4XKV A;  4NUB A;  3WOD F;  2VIX A;  3SNH A;  3W2W A;  4YT4 A;  3JCU Q;  4BXF A;  4BEH B;  3L2U A;  4XLH A;  3D5R C;  2B0J A;  2KMU A;  2OUM A;  4XM3 A;  3KKB A;  3LS1 A;  4CS7 A;  3FHN A;  3KEY A;  2W1O A;  3K4C A;  2HVS A;  4CCJ A;  2OCC C;  5KNL A;  4QI0 A;  4DIQ A;  4B3X A;  4OIQ F;  1BR2 A;  2BVM A;  3JT1 A;  3HKZ A;  3PUB A;  4ZYA A;  4N4O B;  3K70 C;  2XXA B;  2W7N A;  4BE1 A;  3EH2 A;  3GOD A;  1Z7L A;  3B0U X;  2IXO A;  3K1I C;  4XKC A;  4KI2 A;  1LFP A;  3S29 A;  4IWB A;  1NG6 A;  3DPL C;  2G3K A;  2YHS A;  4BJ6 A;  3TBI A;  5DS6 A;  2M7A A;  4C3E A;  1ZHZ A;  5B1B C;  2LRD A;  3O39 A;  2LG4 A;  3OL4 A;  4HSR A;  2AQF A;  2QKM B;  2ZSH B;  4O7G A;  2RQQ A;  3N05 A;  3H0D A;  3I9V 2;  3EG9 A;  2M4G A;  3RSN A;  2CFO A;  4CH7 A;  1NG1 A;  3W2V A;  2EIL C;  3TD7 A;  5IY5 C;  4I44 A;  1V54 C;  4PSX A;  1V5G A;  3M1C A;  2KJG A;  4D9J A;  3E70 C;  1D0X A;  2HV6 A;  1G8X A;  3ECS A;  3ASN C;  4I3M A;  3V7O A;  3LSI A;  4BEJ A;  4BG0 A;  4J00 A;  4BQN A;  4KBL A;  4KNV A;  4OIO F;  2WB7 A;  1M56 C;  2G62 A;  2JVG A;  3LJB A;  2KP6 A;  3S3N A;  1SF8 A;  3SEO A;  1Z5Z A;  2DYS C;  4IKF A;  4O79 A;  3OIP A;  2GOM A;  2EIN C;  2MC4 A;  3LSG A;  1MMN A;  3BC8 A;  2CNW D;  2ZXR A;  2CS3 A;  3IP4 B;  2HPM A;  3DKY A;  2DCE A;  2RRE A;  5CQE A;  1VOM A;  4NY3 A;  2Q3T A;  4XWJ A;  3EUA A;  4E7Z A;  4PFO A;  2E5Z A;  3M8J A;  1FMV A;  3I5P A;  3Q6M A;  3L2R A;  3SEQ A;  4X0G A;  4HE8 D;  4WJ0 A;  3EH1 A;  3EGD B;  2LOO A;  2V7F A;  4YJW A;  2DGJ A;  2WY7 Q;  2NUP B;  4XLE A;  5HVQ C;  2KQ9 A;  3EGX A;  4ITV A;  3AQC A;  3EPZ A;  4XTK A;  4XLA A;  2CDQ A;  3DAF A;  1N77 A;  4U5E E;  1NG7 A;  3FBI B;  3PSI A;  2MFZ A;  2IS4 A;  3HC7 A;  1TWG A;  2WAE A;  3SZR A;  4OWR B;  4F92 B;  3EG9 B;  4I1M A;  4HPQ A;  3UGP A;  2CV1 A;  2CH0 A;  3B0V C;  2JUG A;  3OOU A;  3PNV A;  3DAG A;  3ZIB A;  3NRH A;  4Y4R A;  1ERD A;  2J7P D;  3ITF A;  2VKD A;  4M63 A;  2R7U A;  4HNT A;  3CJR B;  1OKK A;  1V55 C;  5EGY A;  4P1W A;  1WJC A;  1VMA A;  3K4N A;  4KIT B;  1WJ5 A;  2PJR A;  1IW7 F;  1VZ0 A;  3OYM A;  2XAU A;  4IQ4 A;  2CNW A;  3AG3 C;  3X1O A;  4U7B A;  1N78 A;  2R7O A;  1WJB A;  4KNW A;  2IGO A;  2PJR B;  2I8D A;  5DQT A;  4BQO A;  1DQU A;  4DGW B;  2F6C A;  2X6X A;  1R6R A;  2Z1D A;  4Q7C A;  3LSH A;  3ZGK A;  4MLO A;  3MLG A;  2A5W A;  2VJI A;  3K10 A;  2XSE A;  1X1B A;  2VB6 A;  3VAY A;  5F5H A;  2UV1 A;  3G2B A;  4DJA A;  2Y3D A;  4B6I A;  2KRH A;  4YT8 A;  3FKJ A;  3FHD A;  3RIP A;  1M2O A;  4LAC B;  2YEV A;  5HNF A;  3LLI A;  3M1C B;  4C2U A;  4CCM A;  3Q6N A;  2OC6 A;  2F5V A;  1RJ9 A;  3I3L A;  1V5F A;  3KX2 A;  4CBE A;  3HL2 A;  1ST6 A;  4JZA A;  4BJ5 A;  3PFY A;  2X1E A;  3AFH A;  2VPL A;  1VK5 A;  5F5F A;  1M2V B;  4J32 B;  2DOA A;  4OAY A;  4ZLC A;  3OA1 A;  3FAJ A;  2CV2 A;  4G7O F;  3VSL A;  3HUG B;  4DVZ A;  3AG2 C;  3VDX A;  3HG9 A;  3K7D A;  5B1A C;  2CV0 A;  3KL4 A;  2H7V C;  4D1Q A;  1S7Z A;  3K4B A;  3OS1 A;  2KNH A;  2E1M B;  2QTV A;  2J46 A;  4NNJ A;  1TWA A;  4II2 A;  5KHD A;  2H7B A;  5E3A A;  4U5H A;  4XKW A;  4XMY A;  4XNF A;  1O5H A;  3NG1 A;  4MQ9 F;  1VYI A;  2JA2 A;  3I5Q A;  3NYM A;  4C2T A;  3D5S C;  3RQ4 A;  3B0P A;  1MMD A;  4P5O A;  3X2Q C;  2CW8 A;  4C3D A;  5T3T A;  3JRT A;  4CSW A;  3CZ6 A;  3HPH A;  2E5N A;  3MMY B;  4LG3 A;  5CPR B;  5FRO A;  3JYH A;  2LRE A;  4CCK A;  4HNU A;  3S3M A;  1LDK B;  1TKN A;  3CP8 A;  1UEL B;  2LY2 A;  4F93 B;  4E7K A;  2CUZ A;  1ZU4 A;  3ABM C;  2NG1 A;  2WY8 Q;  4QI2 A;  2O5R A;  4E7S A;  1Z3X A;  3OYH A;  3QZC A;  2C03 A;  3WG7 C;  4C7O A;  2WAQ A;  2Y0S A;  2OG2 A;  2PX3 A;  2Y39 A;  3T6J A;  1MNE A;  2R7R A;  1W2W A;  5KYN A;  5HSW A;  1VYK A;  3LLK A;  2JVH A;  3OYC A;  4F3Q A;  5JHF A;  2CW0 F;  2W45 A;  3EFO B;  3KH2 A;  3DPU A;  3K6G A;  3HLZ A;  5LFA A;  3ZQQ A;  3ZG1 A;  3H5N A;  3TMO A;  3DJN B;  5CI8 A;  3NYL A;  3LSM A;  3EQL F;  4DOZ A;  4HFK B;  3PNT A;  2V3C C;  1TWH A;  4YEJ A;  3NWS A;  2CUJ A;  4KJZ A;  1ZHT A;  2XL4 A;  3F47 A;  2E60 A;  3Q7G A;  3F9K A;  4DBQ A;  1K6Y A;  2NUT A;  4F52 A;  4LIU A;  1JPJ A;  2X1D A;  5FCL A;  2C04 A;  2CGE A;  4IX7 A;  2HVQ A;  3DQV C;  1SZI A;  2KLO A;  3OS0 A;  4BE0 A;  3IEE A;  1D0Y A;  4CSA C;  3QYE A;  2XF7 A;  4H4K C;  1T95 A;  2PF4 E;  4CS8 C;  1DGW Y;  4ZLD A;  1WJE A;  2W4S A;  1PD1 A;  3EHN A;  3RFY A;  3RYL A;  1D1B A;  2V1N A;  4ZTF A;  2R7V A;  2J45 A;  4U87 A;  1W36 D;  2G3V A;  3OY9 A;  3H9G A;  3VYU B;  4BGD A;  1KU2 A;  2F4I A;  3MKZ A;  4ANJ A;  3A2K A;  2KZV A;  2Q9A A;  2LBF A;  3K66 A;  4U5F E;  3RH3 A;  1E0E A;  3VWB A;  2Q9B A;  2BW3 A;  1TZL A;  2DT6 A;  2IGN A;  2VJJ A;  4C9Y A;  2VQC A;  3UNG C;  3C2G A;  3EFO A;  4JVS A;  4E7L A;  4K7B A;  3H35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...