4BJ6C

Crystal structure rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
151
Chain Sequence
SDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP1-INTERACTING FACTOR 2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 53
structure length 151
sequence length 151
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bj6C02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj6C01
4BJTA 4BJ6C 3K6GA 4BJ5C 3OWTA 3CZ6A
chains in the Genus database with same CATH superfamily
2Y69C 3F8FA 4P5OA 3H0GJ 3HKZN 1IXSB 2FBHA 4BXFA 2LF8A 2YU9J 3WHBA 1E3HA 4AU7A 3IQ6A 4GYTA 3OIQA 1S3JA 2NS7A 4DW6A 1ZRFA 4JZAA 3PFIA 1A04A 4BHBA 4NCQA 4RB3C 4WGYA 3CLOA 1G8XA 4BE1A 3M3YJ 1IZMA 1P6RA 3JTGA 3NYLA 1MMDA 1V4RA 4AWXB 3MVPA 2W82A 1J9IA 2P0NA 5JFRA 3BR0A 1MNDA 1R71A 2ASRA 2EINC 5FKLA 2CQNA 1WRJA 1IJWC 1FP1D 2XB5A 3RQFA 4PFOA 2FBIA 4KT5C 2NNNA 3WTZA 2HSBA 2L7ZA 3FMSA 2ISYA 4YEJA 1I39A 2IPQX 3J80K 2VKDA 4RDAA 1BL0A 4DGWB 2F48A 2K3PA 3V7SA 5JSLA 2K7LA 2XASA 2VKEA 3D1NI 4FCYA 4IHTA 5DV5A 1TWAJ 3JSEO 1F36A 1QZEA 4B3AA 2LLKA 1AU7A 2JA8J 4E7LA 2IS4A 1IN8A 3BLYA 2E2IJ 1C03A 2JUCA 2O3FA 4LFUA 2VC0A 3NQOA 4KFCA 4UUTA 3WGHA 3I56I 2HOSA 2B9SA 3W4YA 1O3QA 3S90A 3BC8A 2PJRB 5JP7A 4HA8A 3KYJA 3M7GA 3H2UA 5L0CA 2ACJA 2RKHA 3GUDA 2VJ5A 4KIFA 4OIPF 1F1MA 4U5DE 4OINF 1R5ID 1LUJB 3PUFA 3LESA 2IGMA 2LFFA 4N9IA 3K4NA 2GFHA 1OLTA 3EGXB 1GT0C 2MABA 2W00A 1YOVB 5KK1A 2J7PD 1R1TA 4N4WA 4PACA 2OZ6A 4M72A 3TP0A 4ZYGA 3JAMZ 2LTPA 1JGGA 1TQGA 4CDGA 3ZPLA 4KIBA 2C03A 2P4WA 4RB2C 3K2ZA 4AIJA 2Q9CA 3ZP5A 1XMXA 1ZGJA 3Q0WA 5BQIA 3ZQYA 2OU2A 3I53A 1AHDP 3MX3A 4A0YA 2J0WA 1YYXA 2A0BA 3CMYA 1HXDA 4L9NA 4HSTA 5H20A 2BGCA 2LSEA 2Y3HA 1SFKA 1VQNI 5JVEA 3PQKA 3CEXA 1V5EA 5EK0A 1FJLA 2EB7A 2L5QA 3IQ5A 3JRTA 3S2HJ 1XZQA 3VM6A 1NFNA 3KYLA 4CX9A 3C2GA 4XKWA 2PJRA 5D5UB 2F6CA 1Y4CA 3ZQVA 3KYDB 4PFPA 2XAGA 1VF9A 3LNMB 3G6EI 5DEQA 3IP4B 2ZJRF 2IBFA 1OJLA 1WOLA 3C62A 1KU2A 2DTRA 3HG9A 1G5ZA 4O5VA 3ZTZA 5IY5H 2A6EF 3MN2A 5E1ZB 3ZOBA 3OYHA 4U0VA 2YEVA 1UJ8A 4N6HA 3OYCA 3RIPA 1FMVA 1KU3A 2BHZA 3CDHA 1B8IB 1HE1A 3K4JA 4HYEA 2R4GA 1HA8A 1HY5A 3JCUC 2R3SA 4LERA 5LGUA 1RKWA 4F3QA 4YG2F 3RJPA 1AKHB 1E3PA 3FHNA 4CSWA 2ISZA 3FKJA 4UNOA 2O0YA 1X2MA 2ZBKA 1OXKA 1IN6A 1ETQA 3ZN1A 4XLAA 5IT9Z 1R1VA 2ZJ2A 3RIRA 3RKXA 4P9TA 4L5IA 1RCPA 4IRGA 1A31A 1T5OA 2DYSC 3RFYA 4CS8A 3MLGA 2LP4A 3JSOA 1O7LA 3Q0UA 3JRGA 4ZYDA 3KP3A 4A2NB 5IP7J 4NTFA 2HQ5A 2QCOA 1G3SA 3E0JB 4ANJA 3I5UA 3ROUA 1K6OA 3F3XA 5D91A 1OR2A 1IN5A 2V1NA 5FGMA 3DAGA 5LD2C 1RUOA 4UY8I 3NMIA 1SD4A 5J8FA 4U0YA 2I5UA 1B8IA 1K78A 2PX3A 3IHUA 3FISA 4RLFA 3GZ5A 4CXFA 1UFBA 1KYWA 5A6AA 3KP4A 4LDRA 3I5PA 4BY1J 5BPIA 3J81K 1TQIA 3ABUA 2PF4E 4V2GA 1ZHFA 2ZMEB 3F6OA 4CJOA 1SR2A 2RAEA 1ZH5A 2HMQA 4OMYA 1XS9A 4UB6C 2HDWA 3OS1A 3OY9A 5M3FJ 2AXTC 2GOMA 4W1UA 5LFAA 4DVYP 2FJ1A 5EHHA 5CVUA 5J47A 2ZXPA 1TQPA 4EMSA 3E5XA 3SHFA 2F4IA 5E1WA 2D1VA 4A12A 4P9UA 4MNUA 4AE4B 1GV5A 2CO5A 2QKMB 1BJZA 4A3LJ 1Z63A 1POGA 2IEKA 2FNPA 4RGRA 3SQNA 1KGSA 5COMA 5L3DA 2E1MB 1D0YA 2MC3A 3KPHA 2W4SA 4AIKA 2HR3A 3T6GB 2H7OA 2I8DA 1DDNA 2EILC 2XM0A 2BVMA 2P1AA 2J9WA 1NBBA 5E79C 3FK7A 2WAFA 2E1CA 3E5UA 3B0PA 1PCXA 2WA0A 2DA3A 3RF3A 3ABLC 1HQCA 2W45A 4YELA 2ZMEA 1ZR4A 1RC9A 3JYHA 2M8EA 6PAXA 1IW7F 3BG5A 3S2WA 5FB2A 4RB1A 4MTDA 2CQKA 1QPIA 3HSRA 4CUGA 2ADUA 2Z33A 1S7ZA 3IPMO 1YYJA 2RNGA 1E83A 1WATA 2BXYA 2FF4A 4BPMA 1GM5A 4PJLA 2VUMJ 3DEWA 2X1DA 4XONA 1P4XA 4C3HJ 2HJ3A 3TK0A 1KU7A 2YQYA 4BJ6A 2R9RB 3HRMA 3KH2A 4DJ9A 2K9QA 4O6MA 1JHHA 2FSWA 4AE4A 1U0JA 4CDVA 1OMIA 1Q0GA 3SDGA 2HOTA 1LM3B 4NTAA 1W0TA 3KP2A 1QKRA 2CS3A 3MCZA 1BI2A 2ELKA 5LGTA 1GXQA 2LBFA 1SF8A 4LK0F 1CGME 3BR6A 2O9XA 2XXAA 1R58A 2MGQA 4IHYA 2A61A 5GPGB 2HQAA 4CCJA 2R7VA 3O8HA 5D6EA 3CC4I 3TD7A 2XF6A 4QI2A 3TULA 4L5EA 4YFNF 3S3OA 2MLGA 2A68F 2O6GE 3JTLO 2G3VA 2JSCA 4KI2A 2KW3C 2DYRH 3CCSI 1TWCA 3ASNH 4ABZA 1Z0XA 4BBRJ 5K5QA 1QGPA 3WTUC 4U5GA 5KYYA 3K1PA 3BPXA 2VOOA 3FXJA 4I3MA 4QPQA 4A3FJ 1B6AA 2IYLD 5L3QA 5D5WB 2M64A 1WJDA 1WWXA 1APLC 3U21A 5HVQC 1U9NA 1YTYA 2HU9A 1AUEA 4LACB 2A05A 2BYVE 2MWQA 1OFCX 2R7SA 1IUFA 3M1CB 2QUFA 1NZEA 3QP5A 3R0AA 2OEXA 2ZKZA 3GEHA 4OIRF 3VSKA 2AHQA 1NK3P 1OCRC 2OEVA 3OOUA 1EA8A 3ZMDA 2GDCA 4H0EA 2A07F 1LKXA 5LEKA 4J30B 2K5CA 4U5BE 4HLXA 4CCKA 1E86A 3RDIA 1R4TA 1R49A 2XAUA 4XQ1A 2F5EA 3J7AY 1SMYF 2QE9A 3EH2A 2COMA 2KZVA 2IA1A 5CLSA 4ZYHA 1I5NA 1BR2A 3K7DA 2YX7A 2KJCA 4CA0A 2XGEA 2QSHX 2DI3A 3DWWA 2BY2A 1DUXC 3U2RA 1EF4A 2DA4A 4WWCA 2E34A 1IG7A 4XKCA 4JKVA 1SANA 2WWYA 4HF1A 2M4GA 4HG2A 3H0DA 5E3MA 5A6BD 3GXOA 1OQCA 3G1OA 3KMIA 3NMKA 2KDZA 3I64A 3L2WA 3PFYA 3PL8A 1OQYA 2DA5A 2M0CA 3ABTA 2EIJH 3B6AA 3FBNB 2NVQJ 4FAPB 4ZYEA 2OQMA 4FX5A 2GOXB 3WTSC 1X2NA 3A1YA 1YRNB 2X6YA 4IRIA 3DBRB 3FWEA 3TDUC 3GFLA 2VJ4A 5KYXB 3TOBA 3GORA 2DODA 4WXHA 3V8LA 2GA0A 3H5NA 4B4CA 4CS8C 4XRFA 2V6EA 1KNYA 2PMHA 4EGYA 2HWVA 3MFKA 1ZN2A 1ZQ3P 3DPUA 3N4MA 1MBEA 1Z05A 2QENA 1JE8A 5FZTA 4RBOA 2HI3A 1A6IA 2G62A 2XRLA 5F28E 4B6IA 1D8KA 2X6OA 5F64A 1VQLI 3P9IA 1J75A 1CGOA 3E70C 1YVIA 1TQMA 1X1BA 1R7JA 1SZIA 2ECBA 1NK2P 2KFDA 3ZQIA 3ZMTA 3BT9A 3PIOF 5AIPA 1S8NA 1X1CA 4KUMA 4FHTA 1UHWA 5A6KA 1U78A 2M7BA 4YN0B 3EUAA 2YLDA 2M9HA 2WZGA 5LHHA 3VYRB 4LLEA 1B72B 2L4MA 2QGUA 1ZZPA 1YRNA 2V1DA 3A11A 3RVYA 3K69A 2HOEA 2W48A 1GV2A 2Y39A 2VQCA 3HBLA 4CIPA 3X2QH 4Z6YA 4ON0A 3GCMA 4A5MA 4C3IJ 3HJEA 4JEBA 3CP8A 3IWZA 2DA2A 4GEHA 2JN6A 2KL4A 3EYYA 1ZW2A 5HOOA 1H88C 1QPMA 2ME0A 2XAJA 2HXOA 3W2WA 1NFOA 3QRFF 2VASA 1VQ4I 3RPUA 3H65A 1PUFB 4JCHA 2PNOA 3V7CA 3HNLA 2R7FA 4XPXA 5T3TA 4EATA 2FU4A 5KCMA 2NUPB 3MD2A 2JD3A 2XB0X 2DT7B 1T8IA 4A3DJ 2PEXA 4XEKA 5IOZA 1VK5A 4JTAB 1HBXG 4F55A 3E1SA 3F8CA 2IOQA 3EZIA 3T6BA 3CESA 2ZXIA 1B72A 2ZMEC 4EV0A 3O6BB 4BQAA 2FQ4A 4Q5SF 5BS6A 2EPMX 1LDJA 1BI1A 1LJ9A 2Q3TA 3DWLE 4HW0A 2DJNA 4HAMA 3LSPA 4ZYAA 4CCOA 3E97A 2LIGA 2JVHA 2OUMA 1FY7A 5EG0B 4CH7A 3RYRA 4EUKB 3RQEA 4BJ6C 5EGOB 256BA 3QWLA 2WVQA 3H9JA 2MD5A 2ZXJA 2NS8A 4MEXF 1M56C 2L9VA 2PMZA 4LLGF 2OPTA 3K4LA 4N9HA 3B71A 3U9MA 4B09A 1SFUA 1Q1VA 3BROA 4MVZA 2E1MC 4EJOA 3CMAI 4F92B 3EG9B 4BUPA 2KIQA 1Z9CA 4EJWA 1R36A 3O39A 2A69F 2VLAA 4F4BA 2OCCH 4BDZA 4MLOA 1YFHA 3JSZA 1GGQA 3DP7A 1T38A 1HOMA 2R7OA 3B02A 4P55A 2XLMA 2LFDA 5AONA 3ZMVA 4DYQA 3KFWX 2IS1A 2J9UA 5KAFC 1T33A 2LH9A 2X1CA 1K04A 4U5FE 2X0LA 2EFOA 3F6VA 3GEEA 3RYLA 1LDKB 1TWAA 3K66A 1FTSA 1IDYA 1VYIA 4AYBN 4Z2YA 2GLOA 3T8TA 2OD5A 1OKKD 5GAGJ 2L7MP 4KMUX 5EG0A 3GZ6A 2EFWA 3RI4A 3EHNA 1TW3A 1RKTA 3BRJA 3FKIJ 4GYIA 5B1BH 5B3SH 1CGNA 2VL8A 1EA3A 2XPWA 5F08A 5LBQA 4DBRA 3GF2A 2Y0SN 3DU6A 1MGTA 2XKPA 1FNTc 3T0YA 4EJTA 3GANA 3F8BA 4B44A 5ILUA 2J8WA 1W5TA 2QZ8A 5DS5A 2VT2A 2QSFX 5DCMB 3AG3H 3ZMUA 5L0IA 1UFMA 2STTA 3EG9A 3OYNA 4D5FA 2VOPA 2BW3A 3TL4X 2M45A 1A0BA 2IP2A 1R9TJ 4DNCA 1Q0FA 3S17J 4RAZA 4D9JA 3W8HA 3TO9A 3FMQA 3GVAA 4NQWA 3ABMH 2K9NA 3EYIA 4IHWA 4I6ZA 1JPJA 1BR1A 4BBSJ 2WTEA 4D4NA 1ZU5A 2OKUA 4RAYA 4IHSA 4BH9A 2BY3A 1R5GA 3FHDA 3ABKC 3SNHA 4PZJA 4BQQA 2P7CB 1UG7A 2OTJI 3NKEA 3IWFA 3A9CA 2PBEA 2JTVA 4BJ1A 1SVLA 5LRSA 1Z21A 3L8JA 2ZNYA 4IKFA 1T6UA 2OOCA 2LG4A 1Z6TA 2DA1A 3O3KA 1RUNA 3KEQA 3GTOJ 3M79A 5KNLA 2H8WA 3P9KA 3AAFA 2UXXA 2Q9AA 4RS8A 1YW7A 1FOYA 4HE8D 3C8GB 3B0UX 1DU0A 3I4NJ 3QPHA 4OWRB 3M8JA 3HJCA 2IW5A 1MIJA 1FZPB 1YW9A 2K85A 4F52A 5CIVA 4DZJA 2AS5F 3DKYA 3W3CA 3GEIA 2HFHA 3HOWJ 5E17F 3ZWIA 4M9ZA 5FO5A 1FOKA 3AG1H 2YUSA 2MG4A 5D92A 4JBAA 1HKTA 2Y9ZA 1V54H 3QYEA 2DA6A 4E0IA 1D8JA 1L7CA 4CGZA 1WPKA 1QA6A 4A4AA 2GA1A 3DI5A 1FSEA 1G3WA 3F0CA 3FZVA 2ZC2A 1H9GA 3LNRA 4FASD 4BACA 2DDAA 3TP3A 3N2ZB 4MTFA 3NYJA 3O55A 4I76A 4BXUA 2VCAA 2P61A 5J1UA 2J9VA 2K40A 2DMTA 3GLXA 1OW8A 3PHF2 4Y33A 2C6YA 2Z15A 2KPMA 2K3FA 1YX5A 3KZIC 1U3EM 2CV0A 1MBKA 2NOGA 3BPVA 1AA7A 5CQGA 1MKMA 3I55I 5COFA 2XHKA 2LP0A 2V7FA 1XPXA 1GDTA 1A7DA 2EPLX 1TWFJ 2YHSA 1FC3A 4DRIB 3KP7A 4JE9A 2FBKA 4Y4RA 1Z23A 3COAC 5CPRB 2MYSA 3LSKA 2R5ZA 2ZXRA 1I3AA 3ZN0A 1G59A 2VBYA 2EPOA 4A6EA 2BC5A 3OL4A 5HV9A 2XUBA 1LFPA 1E3OC 1KA8A 4Y13A 4H4KC 3HTSB 1ORYA 1MW7A 2JUGA 3CCYA 2DGJA 3LOCA 3H5AA 4FETA 1HDPA 4I01A 4IOAF 1H6GA 1U6HA 4HLYA 4LLCA 3OS2A 4IL6C 2XL8A 4ETSA 4ENNA 3H9GA 5DM6F 2K86A 4JW1A 2VXDA 4YL1A 1NHAA 3SP1A 2CSOA 1BOAA 1W1WE 4P9FA 4UXNA 3FAPB 2DMUA 2W4MA 3LEOA 1FBQA 1D1AA 2AU5A 5FFZA 5D4RA 2VC9A 4AK9A 5E1XA 2RDPA 2Z1DA 2XIGA 1GQAA 3LA3A 3WTTC 2CQ7A 3ZQFA 3QVYA 3UGOA 3QYBA 4U7DA 3K1IA 5D5XB 2WAEA 4XBFA 4M3DA 4A3KJ 2L7KA 2BVLA 5CVJA 2Y3BA 4JIOA 4I0AA 5HDGA 3TDZC 5JHUA 1UHMA 2L4AA 3LSGA 3K7AJ 1QSPA 1J0RA 3AQCA 2XL4A 3GZNB 3UMIA 4HV5A 3QPSA 1XCBA 2EK5A 3M1EA 2WV1A 3L09A 1YA7O 4MVMA 3QYFA 1OXBA 5BOXA 5K1YA 1LS1A 4C3BA 5JRAA 2QQ9A 1OYWA 2HUJA 4XRSA 1IAWA 3GBGA 1QVTA 4UHTA 1JKPC 1W36D 3LSJA 3H3ZA 1O3RA 2AQEA 2EFPA 3KETA 1A5JA 2YL3A 3AL0B 3NG1A 3WHNA 2P0WA 2Z16A 4F91B 3GWLA 1L3LA 3U2LA 4PGGA 3TMOA 2DFFA 2P8TA 4QWQA 2LREA 1U8BA 2CFOA 3W6VA 3FXQA 3LMMA 4MVQA 4L9JA 2IJLA 2Q8KA 4UDVA 3AG4H 5HDNA 4DBQA 2DT6A 5T3WA 2RREA 1W36C 2CUZA 1ETOA 1HW5A 2CW0F 5ILSA 1FOWA 1XGOA 3E6CC 5KYWA 1YZCA 3L0IA 2ZCWA 4PSWA 4A3GJ 1ZVZA 4IZZA 2CNWA 4W8KA 3ZCOA 4IOCF 3QOPA 3Q7GA 5T1DB 2W1OA 2KJGA 1QZXA 1OCPA 2H6CA 2Q7RA 2B0HA 4U9DA 3CZ6A 3AFHA 1USSA 2G9WA 4NQFA 4HRIA 1A7VA 4ZC3A 2WAQA 2JA7J 3TO7A 4ZLCA 3QU6A 2HPIA 4DYRA 4OU0A 2DT5A 3CC7I 1QRYA 3LSHA 3PNYA 4UUSA 4IHVA 2Y31A 1MH4A 4QLCU 5GTIC 1K4TA 3CUOA 5J4YA 2Y3GA 5AC5A 3KE2A 1ZHTA 2GIZA 2XC7A 1MMAA 2M87A 2EZLA 2CG4A 2EZIA 3CCJI 1WI9A 1G4WR 5F1RA 3DM9B 2HVQA 3RH3A 2NPUA 4KDPA 2ZSIB 4XPYA 3WHCA 2IS6A 2CH0A 1TW2A 3BCBA 4LG3A 2BV6A 4NDLA 3GWZA 2KYHA 3P9CA 4F93B 5DM7F 2R25A 4A3CJ 3TJ6A 3GODA 4M6YA 3S1RJ 1OISA 5EZGA 1BN5A 3C8GD 4CS9A 5L0JA 1M57C 1Z91A 2HS5A 3O2PE 2XL6A 2EV0A 2XLDA 1LFBA 1WGXA 5LLQA 1ERDA 1FTZA 3BCAA 1O4XA 4KNVA 1OW7A 3TW6A 1XDUA 3PNVA 3MZHA 4JJGA 3IRRA 3CDLA 2YPRA 1G2HA 2DJIA 1X3UA 4Y3OA 3QAHA 2PX9A 2X4HA 3PJRA 3TBIA 1SD6A 3NYMA 4OMZA 2LDUA 1ZU4A 2BBYA 4QSHA 3EUKL 2KRCA 4MO7A 1EKEA 2NSFA 4CDAA 1E84A 3BTIA 4YFXF 4MQVA 1WSUA 1U6GA 2MA3A 1VQ7I 3OEOA 1F4KA 3H36A 4ER9A 1OCTC 4CCMA 1RRJA 3ZC4A 1HKQA 1MJBA 4I2OA 4HBLA 3ZDLA 4BHCA 2V6CA 3QPLA 1IC8A 4A5NA 4LITA 1OW6A 3ECOA 1PUEE 3PSIA 2JT1A 3OYDA 4C3DA 4CO8A 2IXNA 5TRDA 1HW1A 3BDDA 5E3LA 2ICWG 3VPRA 4EHPA 2W57A 1YIJI 1AWCA 1HDDC 3VOEA 1ZKGA 2FEZA 2E2JJ 4H54A 3TOLA 2VPLA 4JOMA 5CJ9A 2OV7A 3K10A 2KC3A 4KNWA 2F5DA 4RBNA 1Q0MA 3PDMP 3BQYA 3ELKA 3CCMI 4JRZA 5GP9A 2VQHA 3GFMA 4RMNA 1JTYA 2KDOA 2J46A 4WX9A 4BE0A 3S2DJ 3HKKA 2XRNA 4U5EE 4Q47A 2K4JA 5L0DA 3HM5A 3DKWA 1SFXA 1JOGA 5HSWA 2ZXWC 2O5RA 2STWA 1RKCA 1W5SA 5FRMA 2HQRA 3KP5A 4BQNA 1K78B 2GAUA 1LE2A 5E2QA 4C2UA 1I4ZA 3IH2A 9ANTA 2CDQA 1Z6RA 3UR3C 2DMPA 2L6GA 1I6HJ 1JUPA 3ISPA 4PCQA 4YFKF 5GTHC 5DD4A 3K1IC 3CAXA 3SYNA 3JTHA 2P6SA 3FHZA 3BJ6A 4Q48A 1YYVA 4KC9A 1VI0A 2DYRC 2RNJA 3KYCB 3JRCA 3ASNC 1FIPA 4MW8A 3OYJA 2A6HF 4JURI 1A36A 2P6TA 2WY7Q 3IRQA 3P5JA 3E3VA 2ETHA 4O6NA 3SXZA 1M2VA 3F22A 3SEQA 5DS9A 1SVMA 1YHQI 5FLXZ 3UKGA 1JT6A 3LEVA 2Y69H 3EZHA 3F72A 1ETYA 1WJEA 4E70A 2V4JC 4PR9A 5DDGA 1FWZA 4EJVA 3PNTA 2OAZA 3L34A 2L7FP 2JWTA 5K7ZA 3V8JA 1KQ8A 5IPAA 2QNLA 2BOLA 5DQZA 1YJGA 1ZW3A 1MDMA 4YIRX 5A2QK 3FM3A 2LMDA 3WGGA 2EZKA 4GDFA 3ERED 2CNWD 2XVCA 1SVOA 2AP3A 2MD0A 1I6XA 1TNSA 2HZTA 5J3LA 5L3EA 3T5XA 3POVA 2V9VA 4IEJA 2HOAA 3MMYB 4HV6A 3KZZA 4M6VA 2XPVA 4XK4A 3DEUA 2EIMH 3HL2A 2AWYA 2YL7A 4DRHB 2R7WA 3CJRB 4IQ4A 5HLGA 3FBIB 3R0JA 1U9OA 3JSPA 2P5KA 2Z99A 3CO7C 1BR4A 3GTJJ 4UVBA 1XN7A 3K4CA 3ATPA 2IRFG 2L9JA 1K05A 4AM3A 2GM4A 4BXXJ 3LS1A 3MKWB 2WY8Q 1FYMA 1YQAA 2E36A 1BIBA 2IGKA 3HUGB 1ITYA 2MBFA 5H6QA 5M3MJ 3G4ZA 1S7OA 2BL2A 3NAUA 2LBFB 4DQ2A 1F43A 2ECCA 3VB2A 4J7YA 3N24A 2HVSA 3MEXA 2XXAB 1RESA 1VTMP 5IT3A 3AL0C 3M8FA 4A3IJ 2H7VC 3V5ZA 3VF0A 5K7FA 1OCCC 3GFIA 5L3FA 2LD6A 2EIKC 1WASA 3BZ6A 3HYIA 3WG9A 5KYYB 5GAHJ 2DB4A 3QODA 2CW7A 4PSXA 3S1QJ 4NB5A 2QSGX 4JX5A 3EH1A 3W6JB 3Q3SA 2WL8A 4CS7A 2F5VA 4Y17A 3VFZA 1W0UA 4PDKA 3GM1A 4DRJB 2KQRA 3DLLF 4N6CA 5JVGF 1ZHZA 3KX2A 4CZCA 3ZTMA 3ASOH 1J8MF 3B0VC 3DKAA 2VQGA 1Q1HA 3G71I 3VAYA 1WI3A 3TGNA 4IVNA 1D5VA 3B9QA 4CS9C 3JREA 3HKZA 2RV8A 1PD1A 3HUGA 2G3KA 1EKYA 4ZTJA 3EJNA 1X3ZB 1UMQA 1QNTA 4A0XA 2HYGD 1IUYA 3HOUJ 4FISA 3W6KB 4S04A 1G6NA 4XKBA 1H89C 2HFIA 3FAJA 4NC6A 2DPDA 4I0BA 3K1NA 1AEPA 3ZQQA 1F1ZA 4C7OA 3GTGJ 4G7HF 2HKXA 2NXNB 1ZREA 2LSOA 2R5YB 2O8KA 5J8CA 3BTCA 4GFBA 1Y8RB 4XMYA 2VE9A 3IQTA 3M4OJ 1JTXA 3VDXA 3MQ0A 4YRVA 3WGIA 2FE3A 1WVRA 3E6BA 1IXRC 3RKYA 2PLYA 2DN0A 1YJWI 2EWNA 5C4XJ 2XS8A 4BEJA 2MW8A 3RKWA 3WTXC 1BOBA 1I27A 5JLWA 3ZSUA 2ME6A 5JVTA 5C4JJ 2ZXOA 1ETVA 5EYRA 2W84A 1FYKA 2JRMA 3DQVC 2JK3A 2XF7A 3JAMK 2XS1A 3A4CA 4XLNF 3CQZJ 3EFOA 5DYMA 3ITFA 4Q4ZF 1HLVA 4WF2A 1BA5A 2VH3A 2ELJA 3QP6A 1FNNA 2L9RA 2UUHA 2Q1ZB 3DU5A 4ITVA 3A03A 4W97A 2XSDC 1FFTC 3HNKA 4YL3A 2LFBA 4YIIA 1OCZC 4G7ZF 1N1CA 2NOJB 2CQQA 3OYKA 1DP3A 3U8VA 1YX3A 4NHJA 5F04A 5CVRA 4J19A 3QU3A 4N0BA 5IP9J 2R5YA 1SC7A 1M2OA 1QHHD 3HGGA 2COBA 1JJ6C 3HDDA 4LB6B 3MAJA 1FBSA 1LS4A 2H1LA 3LNQA 2WVNA 2XAQA 4RAFA 4MHGA 1TBXA 3PSFA 4NBQA 3SFIA 3CCLI 5ICFA 1H9TA 3RZOJ 3AOUA 3N0TA 3HOVJ 5J6XA 2YX4A 2NUTA 1Y0NA 3SZGA 1TLHB 3IQCA 1OCOC 1TR2A 2OCCC 2XLVA 2HV6A 3KEYA 4C30A 4YIFA 1YJ9I 1LVAA 1JR8A 2DFIA 4X6AJ 4AUXA 2OCEA 4OD5A 1HSJA 1NU9C 3HOXJ 1RMVA 2CUEA 1X19A 1I3QJ 1ETKA 1CGPA 4MIMA 1MH3A 2D2WA 4MEYF 2IXSA 2DK8A 3GLLA 2WADA 4L5JA 1Z3XA 2DBBA 1O5HA 4IO9F 2L81A 3L2QA 1U2WA 3H92A 3SEOA 5KYUB 3L7WA 2NG1A 2FAPB 4CJGA 3UNGC 1NSGB 5IT9K 1EI7A 1LFUP 1SAUA 1JPNA 3V7RA 3HSEA 2E2HJ 2Y9YA 4DJAA 1TC3C 4HNVA 2LRDA 4LDQA 1REPC 4LIUA 5E18F 2ZB9A 2UV1A 1CF7A 1V55H 1IO2A 2ZO4A 4BU2A 4C3EA 3M8EA 2EILH 3DBLB 1WKMA 2QQAA 3MWMA 3R60A 4CZZA 3HHHA 4XSXF 2QUPA 5E3AA 4XNFA 3AQBA 4XEFA 2K9MA 5TGTA 2GXAA 3ABLH 2H27A 4Y15A 1SFEA 2X48A 5E8IA 4J01A 1LPQA 4JEAA 3ABMC 3ZQGA 1YE9A 2DTZA 3G50A 3Q6NA 3DTIA 2GA2A 2GZWA 5FKKA 3A2KA 1JKQC 2CYYA 3EHMA 1GVJA 4BYYA 2CCYA 3KIOA 4M71A 1V3FA 2FQ3A 1A7EA 4KA4A 4C3JJ 1IN7A 2DPUA 1MBHA 1YW8A 2EQRA 2W24A 4XORA 3GTLJ 2EZHA 5KYUA 1YJNI 2YR2A 2QQ8A 1VLTA 3F8NA 2X6WA 3MYFA 3N05A 2DMNA 3LSRA 2O61A 2AVKA 1NG7A 4YT4A 3QW1A 4A3BJ 2CMPA 1ETXA 2QA4I 1VQ9I 1VOMA 3Q7LA 2Y48A 2B0JA 3S93A 2DO7A 4F7ZA 2JA5J 3DTKA 3RQGA 4EIYA 2I10A 5CKTA 3AKZA 3AG1C 2JQ7A 1JJ8C 2JA2A 1ST6A 5L3VA 1P4AA 1FIAA 2QM3A 3NEUA 4NUBA 3A01B 4CDYA 2P5VA 1U5TB 2LY9A 2E60A 3ONQA 2LKPA 4II3A 3WE2A 2Y2ZA 3KL4A 4RDUA 3K2AA 2PFBA 4R1HA 3DPLC 4XOPA 3IAS2 3SJMA 2FRHA 1WJAA 1IGNA 3NRVA 1C02A 1ZHXA 2JPUA 2EPNA 4JTCB 4HX8A 2DA7A 3UMHA 1I50J 2M2EA 4AIDA 2B63J 4HX4A 1W2WA 1C17M 1HW2A 1YZAA 2O8XA 1IRXA 2OF7A 1YLMA 3WE3A 2ZJQF 3FX3A 1VTNC 4JQFA 5CYVA 4I98B 4XKVA 4KYWA 2HTJA 1IDZA 4MTGA 4HDUA 2TMVP 1J8YF 3CMEI 1H0MA 2R03A 2DCEA 5JI6A 3OYFA 3HOYJ 5F5HA 2YZSA 1ZG3A 1MSEC 1Z67A 1TFOB 5L0GA 4RB0A 3JRFA 1DOWA 4O79A 2E35A 4LLLA 2BW3B 2MC4A 3OMYA 3H5RA 3PM1A 4GYGA 5M5WJ 3WODF 2F22A 2Q4FA 5B1AH 1EH8A 2CJJA 4NQWB 2WVOA 1VQ5I 3QOEA 5GADJ 1Y1WJ 3A01A 4LB5A 1FOXA 4Z9HA 2CV1A 5FROA 4HQMA 1U5TA 4EM1A 2J5PA 4L18B 2LD5A 4GQHA 5A6JA 2EFQA 4EM2A 3L2VA 5ICCA 4GXOA 5COGA 2AQFA 3LFKA 4YWQA 1B59A 4ULWA 4YT8A 4K7BA 3BG3A 5F27A 2ZD9A 4HFKB 3CF5F 3GFJA 2R7QA 2VONA 3HLZA 4IAOA 3K9TA 1E0EA 2VCCA 4E18A 5J1YA 2HVRA 3DF8A 3EGDA 3F46A 3EPZA 1D0ZA 1FMWA 1T95A 1SFOJ 2VQLA 1USTA 1T39A 4WK8F 1QQIA 3AJMA 1U8RA 3CSKA 3IKVA 4M63A 4IXAA 4XEVA 2V1XA 3FF5A 5KHDA 2DQLA 4LDKA 2NSGA 3LAJA 5F0FA 3FOOA 1BM9A 4BE2A 4KN7X 1SYQA 3CCRI 3LAYA 4JCZA 2ZFUA 4U87A 3DAFA 4G8XA 4PJMA 5H6RA 5CQEA 3V5XA 1IZ1A 2IVMA 5EDNA 1XG1A 4OIQF 2BY1A 1N25A 2IA2A 4AX2A 4IPAA 4E7KA 4V2FA 1TT5B 2OC6A 4D1QA 2WZLA 3F9KA 4RM3A 2DAOA 2VPRA 3VRCA 3BG9A 1NH3A 2F5CA 1JT0A 3MFNA 3QW0A 4KBLA 1V5GA 4RLQA 4ENMA 1T08B 4MQ9F 3RZDJ 5BQTA 2Z9OA 1DP7P 2L7AA 1PJRA 2ZXHA 3CJTB 3KP6A 4QDLA 1T0FA 3K70D 3CCEI 3FDYA 1JGSA 4I44A 2O03A 3HOZJ 4MVSA 3J80Z 3LWFA 4EJUA 2F4MB 2PP4A 4IQJA 3SYTA 1UB9A 4XN3A 2P5LC 3DEEA 2QYOA 4D7NA 1VQ6I 5DUIA 2P81A 3CCQI 2R5ZB 4WGZA 1R5HA 4BQOA 1WN0A 1A41A 3LSMA 5JLIA 1S7EA 2NVUB 2IT0A 3FXHA 3LA2A 3QTHA 2JZYA 2M7AA 5FLMJ 3SZTA 2L0KA 1Z77A 1ORSC 3K6BA 4I09A 4AVPA 1K4SA 2KRFA 1K40A 3G4XA 1RPWA 2YLIA 5EGYA 3RCOA 3J7ZI 1SD5A 3K70C 3OIPA 5M5YJ 4FX4A 3GMEA 3BJOA 3WU1B 3OL3A 3CLQA 3RPUD 1J09A 2QLZA 3CJQB 4ENJA 1QQ3A 2YWAA 3GM2A 3TOMA 4A3MJ 1KQ9A 2HXIA 1O3SA 3KLNA 1TP4A 2L54A 3HOTA 3JYYA 2XGCA 3R4KA 4XN0A 3ZMZA 2XV4S 2LKSA 3C1DA 2M34A 2E5NA 3GYHX 1P2FA 2VKHA 3LA7A 4JX6A 4MNDA 4UVAA 3J7AO 5C44J 4L0ZB 2KGOA 5LHIA 3L8IA 3LS0A 4KIGA 1X1PA 2XLWA 1MBGA 2QBYB 4MW3A 2E19A 2QVOA 4NNJA 2KSFA 3DJUB 1WHUA 1OPCA 2R7ZJ 1I5ZA 5HNFA 2ID6A 2LR8A 4GO1A 5B3IA 5IP6A 1DU6A 2V1UA 1Z6AA 3UMKA 2M0MA 2HV7A 1N78A 1IF1A 4IAQA 2ZSHB 1QPUA 4RD9A 3RQIA 3GO5A 1Z1DA 4G78A 1OR7A 3DE9A 3I59A 3SZRA 1TFKB 4FE4A 2CUFA 1LQ1A 3K4KA 3ESWB 1M6TA 4ULVA 3K0LA 4XLEA 1WFXA 4GCVA 4E7ZA 2HJMA 1WCMJ 4B43A 2BY0A 1JMWA 2I15A 3BEHA 2V9PA 2Y30A 3BR1A 3VYSB 1J7KA 3V42A 1MBFA 2J7PA 2OQGA 1P9QC 4ZDLA 2RN7A 3Q6MA 3QZCA 1P7IA 1XGMA 1VQPI 2QBYA 2CUJA 5H2FC 2QEXI 3Q5FA 1ORJA 5E3CA 5EZHA 2CU7A 3ZGKA 3LUTB 3W8IA 2R05A 3JZ0A 1L0OC 4NC3A 4ZZLA 4G7OF 3L9FA 4IF4A 1X4PA 1MMNA 2IGOA 3M4CA 3JRAA 4BL0B 4IB4A 3MZ8A 4AD9A 2KRHA 3TJ5A 4MVUA 2BZTA 5KYWB 4E4HA 4DZPA 2PFDA 2VJIA 3AGUA 4OOIA 3LJBA 3U1DA 1XD7A 3AG2H 4HZFA 3C7JA 4A69C 5AGFA 3U8PA 1W4MA 3MKLA 1GLNA 1Y6DA 2HYFA 3J7YJ 1E85A 3Q9VA 5HS7A 3DE8A 3NARA 1S5LC 3TW7A 1U5TC 1ZHYA 2DOEA 3CTAA 1RKEB 3S1NJ 3ABKH 1RNLA 2CGPA 3V5YA 3HTUA 2HDCA 4MGRA 4BHPA 2OQRA 3I4PA 5EEGA 4UUSB 2KMUA 1W7PB 1VQMI 4ZJZA 2CYDA 4HFFB 4EEFG 1XMKA 3WU0A 2GXBA 2UUZA 1UAAA 2FUG2 3I9V2 1JAFA 4IHXA 2X6XA 3ZRGA 1ZARA 4P6IC 2BXZA 3S29A 1QVUA 2J9BA 1ACIA 5FKNA 2IBDA 3HXLA 3I3LA 1O7FA 2XROA 4HNUA 1VYKA 5IY5C 5JS5A 1HSTA 3H3UA 2AO9A 1CQTA 2OTLI 2UWMA 4PJJA 2NNYA 1HF0A 4B3XA 5E33A 3H3VK 3VWBA 1XGSA 4FWVA 2HTSA 4WXCA 5L3GA 2RGVA 5TISC 3WG7H 4YK5A 5CVVA 3H9QA 1T6QA 4JVSA 1HMDA 2OBPA 4XICA 1ZRCA 1IRFA 3FOPA 4A3EJ 2B0LA 2Z2SB 2G7HA 3HSFA 3IAM2 5J1RA 4L0YB 2L01A 1E17A 1RKEA 3W2VA 2QKLB 3DBHB 1K79A 2R7UA 2QTVA 3RYPA 3F8MA 5KYNA 5FRNA 1N75A 1W7PA 4MFEA 2R0QC 1VQKI 2JVGA 1SD7A 4LG0A 2ESNA 4AYBA 5K7HA 4EGZA 2PJPA 3V7OA 3JRBA 3QMKA 1DGWY 1BC7C 4LIVA 1XGNA 2I8BA 2TRTA 3CQZA 1T0FC 2QF7A 4WABA 4EWCA 2TDXA 3CDIA 4MFDA 2ID3A 2P6VA 1C0WA 1XWJA 4IWBA 3DTEA 2Y0SA 3R7CA 3S16J 1T98A 3M4BA 2H94A 4G0HA 1APCA 4PJNA 3RQ4A 4EQQA 2FGYA 3QVZA 4M74A 4BJ5A 4C2TA 2M4EA 2ZPAA 1OR3A 1YITI 4IRUA 2P7VB 1S05A 2IXOA 2EIMC 5ILVA 3S32A 1CPQA 1TT0A 2YRFA 2PN6A 4QIWN 4KNYA 5DQTA 1ENHA 4WCGA 2A3SA 2CFXA 4IRHA 4BDYA 3J06A 4JX4A 2ZFWA 3C2HA 2QLAA 3TQOA 3PUBA 5FJ8J 4KMFA 2CW8A 5HLIA 2TCTA 3DCFA 3GTKJ 3OA1A 4ONSA 5AC4A 5AIQA 1NU7D 3BG6A 1VQ8I 3HPGA 5FFXA 1KYZA 3SXMA 2DW4A 2VC1A 1BZ4A 2WBMA 1LVKA 1B68A 1DPRA 1R22A 2XGXA 3EDPA 2KIUA 5F6FA 3R6SA 1GXPA 1XSDA 4HX7A 2QQBA 2PG4A 4A6DA 4N4OB 4B1RA 1ZGAA 3JR9A 2QWWA 4CSAA 3HOSA 1S72I 2OG2A 2XDVA 1UG2A 2VJJA 1WWPA 1T6SA 4BJTA 3GWNA 1B1BA 1Y0UA 3DFGA 2VE8A 3JW4A 3LFUA 1MSFC 4UV8A 3CUQB 3C8ZA 3B73A 2HPMA 2P7VA 4A93J 1M2VB 1T9KA 1M1EB 3OYLA 2WZFA 3U3FA 5FCLA 3U0CA 4E7HA 3L2UA 2R93J 2A1DD 3CJNA 2PX0A 3UGPA 1J2XA 1EV7A 3E7LA 2XF5A 5IYCJ 1OR7C 4QPOA 4XOTA 5J40A 2H8AA 3K6GA 3ASOC 1QO0D 3S9OA 5IYDJ 2HZDA 4I1OB 4LJZF 5IOYA 2G0EA 3L2CA 4J7TA 4YT2A 2VT3A 3HEFA 2MLKA 3FMRA 3E5QA 3KLOA 4PUSA 1MDMB 2EBIA 5FKOA 3WTWC 4RGUA 1YA9A 1WJCA 3BG7A 3AGTA 3F21A 4TV7A 4C2MJ 1O57A 5CVIA 3SXYA 1LI5A 1XB4A 1WJBA 3FXKA 4L9TA 1XCVA 5DUKA 2L02A 3TKYA 4E7JA 5CI9A 1XC5A 4ZDPA 3Q9SA 1Z7UA 3OOPA 3OSFA 2VBWA 4DVZA 4QTRA 1JUSA 1S7AA 3FVYA 2Q0OA 3EGXA 3D5RC 2IGNA 3HB9A 3CUQA 5EEHA 4D5CA 2LY2A 1IRGA 3F47A 2HQNA 1J5YA 2RQQA 4BG0A 1WH5A 4P96A 1U89A 1BIAA 1A35A 3VODA 4XQFA 2VIXA 4FT8A 3NKDA 2KP6A 3SXKA 4AL1A 1OKRA 1KZHA 3B29A 1HKSA 4U5CE 5JT4A 5FLVA 4UVCA 4AL0A 1U0BB 1R4MB 3OYBA 2UZKA 3BY6A 2R7DA 1D1BA 1BI0A 2J5OA 4E17A 4RM2A 3S8PA 3VSLA 2EA2A 1EQ1A 5EF6A 2Y75A 5C3EJ 1I1GA 1TNTA 3V4GA 4UV9A 5BUOA 1VNDA 1G4US 4XPWA 2LF7A 4B8XA 2KIFA 1WQ2A 1WJFA 4KISA 4K0DA 5A6BA 2EINH 4YJWA 5GPAA 1Z7LA 2E71A 4LGWA 3JRDA 1PYVA 3OV8A 5JUAA 2IM8A 5L0FA 1UHSA 4ZLDA 2MH9A 4EVIA 3KZYA 1ULYA 5LEJA 1H7IA 5M5XJ 3A02A 2VN2A 4KT6A 1LB2A 3JCUQ 2RC4A 3S84A 4ZTFA 3LQRA 1QZZA 4JYKA 2CV2A 3EQLF 3H1CA 1XZPA 3MZYA 1W7PD 3LL7A 2HZ8A 2VKVA 3CP2A 5HLHA 2NRAC 1QU3A 3DKXA 1X3WB 4O6YA 3SZPA 5EEAA 4QI0A 1FBUA 2QY9A 1JHFA 4XR6A 3JRIA 4X1EA 1AKHA 3PO2J 1LEBA 1LI7A 2EIJC 1YG2A 3RVZA 3WAQA 3PIPF 2JX0A 5LRRA 4CICA 3OYEA 2XM4A 2DOAA 4I99C 1VMAA 1ODDA 3ML6A 2LK2A 4RAGA 3G73A 5E3NA 1Q0KA 2H7BA 3GM3A 1RI7A 4U7BA 1DQUA 2R7XA 1IXCA 4HEAJ 4O3MA 1R4NB 4Y52J 4C7OB 3BWGA 3U5SA 3VEPA 3ECSA 2A0UA 1K7AA 2WV0A 3C18A 5EJCA 2FD5A 3DZAA 4MTOA 2PMZN 5D5VB 1TWGJ 3CD6I 3TO6A 5L3CA 3BR2A 1XMAA 3O10A 1YS7A 1MMGA 4PJ0C 1DPUA 4EBJA 3EUHA 1RZ4A 3REOA 2D45A 1W5CC 4XRSG 4B48A 1V55C 1R23A 1MNEA 4DYCA 3ZQCA 3D5SC 4BS9A 4BJ5C 3A0BC 4OIOF 4J00A 3ERMA 1D5YA 1JKRC 1H8AC 3S1MJ 5GPCA 2CQXA 2XRHA 1LIHA 3EFOB 5E20A 5K5OA 3G1LA 1IRZA 2JRTA 4U5HA 1E2XA 2X51A 1TL8A 2AWCA 4X0RA 3X2QC 1BDJB 2DFEA 2FMLA 4GGGA 4LOCA 3ZQ7A 5FD5A 2M4KA 3BR5A 5DD8A 3E6MA 3HZJA 2V3CC 2L9NA 5CI8A 3LLKA 3IC7A 4CBEA 5TJJA 2JA6J 3HNIA 3GTPJ 2BEOA 1IN4A 1TWHJ 3RKOF 1QZYA 1ZELA 3NWSA 2ZXWH 5D6FA 3U9JA 1XSVA 3TOAA 2HGCA 2KLOA 1VZ0A 2YSRA 4M6XA 3SEZA 1CPRA 2DK5A 2Y0MA 3TQNA 2NUTB 3LSTA 2DFHA 2NVYJ 5FKMA 4CSAC 1YDIA 3S0XA 1YIOA 2ZNZA 2KQ9A 2L9SA 3GEZA 2D5RB 2X1EA 1G3TA 2ESHA 2G7UA 3HIFA 2KKOA 3BTJA 5LGNA 4S0HB 4Y7NJ 2YVKA 2HMZA 1B9NA 2DYSH 3BR3A 4ASNA 3FXRA 3HPHA 2RD9A 3OYGA 1PV3A 1T2KA 3BQZA 2A5WA 4MVOA 2CWEA 3ZMSA 2LY1A 3I58A 1PD0A 1ZRDA 2PQ8A 3HGYA 4MVRA 1ZK8A 3U9GA 4FX0A 5F1JA 1D3YA 1QVXA 3NMJA 2K9SA 4XLHA 1FTTA 3S14J 1Y6IA 2ELHA 1FEXA 2L6HA 1EH6A 4HOBA 3BZCA 4S05A 2IS2A 1Y8QB 5KAIC 1CF7B 4E7SA 3PO3J 2RQPA 4Z9JA 1ZAOA 5DTDA 5J4VA 2L3DA 3PCVA 3FXUA 3IEEA 4CYCB 2VODA 1YS6A 4EKWA 1J59A 3BOQA 3OIOA 2YU3A 4ZH4F 1FFHA 5BNGA 5B1AC 1V4AA 3LQQA 4PK4A 1OKKA 2V9KA 5LHGA 3CUQC 4XRMA 5ICEA 1FP2A 3JRHA 4OD4A 4O7GA 2LQGA 1V74B 3D0SA 2MFZA 3ECHA 4MTEA 2YS9A 1EH7A 1QHGA 2W4BA 3N97A 3ZQLA 2PI0A 4JJFA 2K9LA 2NYXA 3K4MA 1F9NA 4R32A 4JK1X 3EPVA 3GTMJ 3KKBA 3FK6A 1T01A 1LE4A 2WC2A 2Z5UA 3M1CA 3D5LA 5E8GA 1ZG1A 1Z3YA 2KZGA 3G2BA 4M73A 2E87A 5B1BC 1Z3IX 5B3SC 4FTHA 1HMOA 1R00A 3IKTA 3T6JA 4BKXA 4CCNA 3HRSA 2JSPA 3G1MA 5FLXK 1R6RA 1WGWA 1JRAA 4AC0A 3AG3C 1DOVA 2HEOA 1T6IA 4CYCA 3O8GA 4KN4X 1QLEC 1OCCH 2EIKH 2NAZA 4GRIA 2H09A 3G4SI 1MNMC 2OU6A 3W2AA 2IXMA 4KICA 1WTYA 1K83J 1WH7A 2K4BA 2XPUA 1SAXA 2XLHA 3FXLA 4II2A 2OZUA 1FPQA 2XAFA 1LE8B 3FXMA 3C2BA 4NC8A 4A0ZA 2BHYA 4XIDA 1ZGWA 2YL0A 2DQRA 1ON1A 2M30A 1LEAA 2OJQA 1XDSA 1DGRM 1LPEA 1SEUA 3OR2C 3DXJF 2HNHA 4L6RA 4CYDA 4U0WA 1A6QA 2XKOA 5A69A 1GUUA 2H6BA 2IA0A 2WB1N 4M9SA 2MHRA 5KYXA 5B5EC 2M1BA 3KEOA 3C3WA 1AVOB 3M9AA 4BY7J 1ZHWA 3WTYC 1MBJA 1STZA 2O7OA 3T1BA 2V79A 5F0HA 1V54C 2Y3DA 4L9VA 3FXOA 2KJBA 2X9DA 3IH4A 4D0PA 4BNCA 4D7MA 3I4UA 4LMYA 2FXAA 5HNHA 3TEDA 4HNTA 1P7JA 1OYIA 2R7RA 1LE8A 2IXPA 1PVEA 1S9HA 3MKZA 2RVCA 1Q0DA 4ESBA 3MKYB 3RPQA 3ZQHA 4C9YA 1FLIA 5JHFA 3EUHC 1JKOC 2EA4A 4FE7A 3CMMA 3ZVRA 4BEHB 2F4OB 2LYCA 4M9XA 1F5TA 1FR0A 3OYAA 3RTRA 1ORKA 3EGDB 1OCRH 4E7IA 1G3YA 2ZJPF 1Y39A 4XLPF 4XTKA 3IV5A 3ZG1A 1AOYA 1BJAA 3GTQJ 2J45A 2JPBA 3S15J 3U3BA 3G3ZA 3GX4X 3HRTA 4RA2A 4UUVA 4LD5A 2F5FA 1OCZH 1Z7Qc 5JLXA 1I4YA 2M8GX 3K1MA 3E6DA 4A2UA 2HDDA 2GIVA 3L1PA 2HKOA 5HODA 1PUFA 1D1CA 4CHUA 3OWTA 3HC7A 4G12A 1GHCA 4XLCA 2J0XA 1MZBA 2XLEA 3IH3A 3V8KA 1RETA 4IJAA 3I0TA 4IX7A 2LK4A 1UG0A 2H1KA 3VYTB 2GAQA 3U1KA 2W7NA 3VYWA 4RGSA 2FNAA 2LNBA 3B6CA 4I02A 2JMWA 2VBXA 5DCFA 2MH2A 2NUPA 3L1MA 5K0IA 4BEHA 3SDBA 1ZTRA 2EPKX 3U2MA 1OCOH 2PBIA 3RSNA 2V26A 2DDBA 1PDNC 2NVTJ 3S28A 1X1DA 2KT0A 4M3EA 1TZLA 1ZR2A 1PP7U 4ZDOA 5BQGA 3FDQA 3ZXSA 2WAQN 3HNJA 3R61A 2E5ZA 3K33A 2LVSA 2A6TA 3OS0A 3BZKA 4DXWA 3O6XA 2CRGA 2X0CA 5D8KB 1R1UA 1K61A 4IGGA 3KCCA 1O3UA 3FIWA 1Z5ZA 1FAPB 3T8RA 1BW5A 1FYLA 2Q2EB 4RGXA 1D0XA 2GBYA 5EGOA 2FFHA 4JC7A 2DXIA 2D1HA 2KK1A 3E9VA 1RR8C 2DU9A 4AIHA 2VI6A 4WXDA 4XSZF 2W85A 3OSGA 3K1HA 2A5YB 3BJAA 2XSJC 4G6QA 2R02A 3JRMO 3T9OA 4M3BA 5JR3A 4YL0A 3FM5A 1ONVA 3CF2A 3CC2I 1RJ9B 2LKXA 3ZR8X 3H35A 4JP0A 5HLTA 4DIQA 4IARA 3WU2C 3AG2C 2W25A 1BBHA 1JI8A 4U88A 1YAUO 2D5VA 1B9MA 1UELB 1HC8A 4O6JA 3S3MA 5GAEJ 5D8LB 2FOKA 4CCLA 2Q00A 4PGHA 2NS0A 3PQJA 3R2PA 4N06A 4G94A 2DLLA 3SFZA 4W8PA 2JPCA 2XSEA 1FX7A 4HEA2 1KONA 4R8HA 4E6KG 2OJED 4BGDA 3PMRA 3MYIA 5K5RA 3VYUB 3Q0VA 4A3JJ 1I1SA 4DOZA 2VB6A 2W9YA 1KU9A 3S3NA 3BP8A 2ETSA 2Q2EA 5F0CA 1ON2A 4Z9IA 1TWCJ 1MJAA 1WJ5A 2E1OA 2EV5A 2DOFA 2XAHA 2YL1A 4BEMJ 1RR7A 3AG4C 4D4XA 1RIOH 4ESFA 1GVDA 5L3BA 1QBJA 4NY3A 3X1OA 3DD7A 1X58A 2DMQA 3I59B 4HSRA 2HYJA 2XGDA 5HDKA 3T4RA 3LSIA 5DCMA 1FSHA 5HS9A 1RJ9A 2R7TA 4G6TB 4Q7CA 4IJJA 3WG7C 4OAZA 2EPFA 1ETWA 3I54A 3L00A 2FMYA 2R92J 4E0HA 5HS8A 2E7XA 4G6DA 1IV8A 1VQOI 1X4OA 4N4NB 4YT5A 4CIHA 2IAIA 1OYYA 2EJRA 2RSEB 5F5FA 3K4BA 3DMDA 4XLFA 2KIMA 3OR1C 2JJ7A 3NWTA 4EM0B 1NG1A 2UXNA 2Q9BA 5TJ5E 4AVZA 2UUIA 3M07A 5BQHA 2F2EA 2EV6A 1YI2I 1V5FA 5BPDA 3I5QA 3M15A 3EETA 3DPTA 5BMZA 2VBZA 4G9YA 1HE9A 3HRUA 3ZIBA 2M5WA 1HCRA 3C8GA 3RKQA 2E7WA 2VCBA 3QQAA 4FQGA 2M3AA 4UB8C 3LAPA 3HTKC 3P7NA 2HSQA 3IL2A 5DS4A 2VXZA 4XM3A 4NC7A 1ZYRF 2NVXJ 4J32B 1Y56A 2PMUA 1LNWA 5KVRA 3I71A 3I4MJ 2EH3A 1VFCA 2N8GA 1ZG5A 5ICGA 1B4AA 1BC8C 3DV8A 2LC2A 4KITB 1K6YA 1Y1VJ 1VB5A 3CO6C 1YO5C 1GS9A 2OA4A 1KTMA 3MBGA 3NDBB 1L3PA 5D4SA 4FESA 3QPTA 4BAYA 4HPQA 1FT9A 1ZLJA 4U9EA 4WJ0A 3NRHA 4M3FA 1ZLKA 1WZ2A 3CCUI 4ENKA 3RW0A 1S6LA 4OAYA 1BBYA 1NTCA 5ED4A 4X0GA 3DM5A 1NG6A 1O3TA 2WB1A 4R79A 2L2OA 3ULQB 3OYIA 3F23A 1N77A 2LCHA 3BTLA 2KISA 3HHGA 3DLAA 1UZCA 4ZZDA 2HKVA 1S29A 1XX5A 1TTYA 1TWGA 1JXSA 1RXQA 1MD0A 3OYMA 4I7HA 3C63A 3KYIA 1EJ9A 2CGEA 3A0HC 4P1WA 1JUMA 4V19K 1IV6A 3S27A 5A2QZ 1G4DA 2Z3YA 4K1OA 2GXGA 1MMSA 2BE5F 5DVWA 2D4UA 2GWRA 4LG0B 2K27A 2L6FA 1MQVA 5FD6A 2E1NA 2C04A 1KQ0A 2AXLA 4ESJA 1MJ9A 3JT1A 1BW6A 3J81Z 3LLIA 1TKNA 4EBKA 4HDVA 2X85A 1BI3A 2KNHA 1SMTA 3IUOA 5ERIA 4HF0A 2FX0A 2K02A 2GQQA 4XL9A 4K2EA 5IYBJ 2YKZA 3CCVI 4JTDB 2LOOA 1T56A 3GW2A 2WB7A 4MS2A 2GWWA 2MSYA 1UCRA 4KJZA 1VLSA 4HQEA 2H8RA 4NTBA 4XWJA 2XLOA 2FA5A 1PP8F 3DJNB 1XTAA 2O9LA 2YLGA 4M3GA 1P4WA 1YARO 5DS6A 1XSXA 1TWHA 2EFNA 4HF2A 5E3OA 3WTVC 1O87A 3L2RA 4LLNA 2B7EA 4B47A 3US6A 5DLJA 3H2VA 4EBBA 5B66C 1LDDA 1P92A 4LK1F 5L0HA 1YLFA 1NLXA 4I1MA 2KHMA 1X1AA 2FOWA
chains in the Genus database with same CATH topology
2Y69C 3LL7A 4P5OA 4DJAA 3CP2A 1QU3A 4HE8D 3DKXA 4BXFA 2LRDA 3B0UX 4AU7A 4O6YA 4GYTA 4LIUA 3OIQA 4OWRB 2UV1A 3M8JA 3HJCA 2QY9A 4JZAA 4XR6A 4BU2A 4F52A 2EIJC 4C3EA 3DKYA 3W3CA 1G8XA 4BE1A 1IZMA 3NYLA 1MMDA 5E3AA 4XNFA 3OYEA 3AQBA 2K9MA 2W82A 5TGTA 2DOAA 1VMAA 4J01A 5D92A 2H7BA 3ABMC 3QYEA 4U7BA 1MNDA 1YE9A 2EINC 3Q6NA 1DQUA 3DTIA 2R7XA 3A2KA 4HEAJ 4PFOA 4C7OB 3EHMA 3ECSA 3LNRA 4FASD 4BACA 4RDAA 4YEJA 3N2ZB 2VKDA 3DZAA 3NYJA 4XORA 4DGWB 2J9VA 2K3PA 5KYUA 3PHF2 4Y33A 2X6WA 2Z15A 2KPMA 1YX5A 3N05A 1MMGA 2CV0A 1NG7A 4YT4A 1AA7A 4E7LA 5CQGA 2CMPA 4B48A 2IS4A 1V55C 1VOMA 1MNEA 2V7FA 3BLYA 3D5SC 2B0JA 4BS9A 3Q7LA 4BJ5C 3S93A 4J00A 4OIOF 2YHSA 3DTKA 2XRHA 4Y4RA 5CKTA 3AKZA 1Z23A 3EFOB 3AG1C 5CPRB 2MYSA 2JA2A 3LSKA 1ST6A 3BC8A 4NUBA 2PJRB 2X51A 1G59A 2ZXRA 5L3VA 4X0RA 2E60A 2VJ5A 3OL4A 3ONQA 4II3A 3KL4A 4U5DE 3X2QC 1LFPA 4OINF 4OIPF 3LESA 4XOPA 2IGMA 3DPLC 3IAS2 4H4KC 2M4KA 1WJAA 1MW7A 2JUGA 3K4NA 1ZHXA 2DGJA 1OLTA 3H5AA 4FETA 2GFHA 3EGXB 2MABA 3UMHA 2W00A 2J7PD 2V3CC 2L9NA 1W2WA 5CI8A 3LLKA 4CBEA 4LLCA 3OS2A 1IRXA 3RKOF 1ZELA 3NWSA 2C03A 4JQFA 3H9GA 4XKVA 2KLOA 1VZ0A 2Q9CA 4JW1A 3SEZA 2VXDA 1J8YF 5F5HA 2DCEA 3SP1A 3OYFA 3MX3A 2NUTB 2YZSA 2J0WA 2W4MA 4CSAC 4HSTA 3S0XA 4O79A 1D1AA 2LSEA 2BW3B 2MC4A 2Z1DA 3OMYA 2KQ9A 1SFKA 2L9SA 2Y3HA 4AK9A 3H5RA 2X1EA 2D5RB 1V5EA 3WODF 2L5QA 3JRTA 3UGOA 3QYBA 4NQWB 2WVOA 3EH2A 3KYLA 3QOEA 5FCLA 3C2GA 2WAEA 3HPHA 4XKWA 2PJRA 3OYGA 2CV1A 2F6CA 5FROA 2L7KA 2A5WA 2BVLA 4PFPA 2LY1A 2Y3BA 1PD0A 3IP4B 3L2VA 2AQFA 3LSGA 1KU2A 4YWQA 3HG9A 4ULWA 4YT8A 4K7BA 3AQCA 4HFKB 2XL4A 2R7QA 2A6EF 3HLZA 4IAOA 3OYHA 2YEVA 3UMIA 4XLHA 3OYCA 1E0EA 3RIPA 1FMVA 1Y6IA 3QYFA 2HVRA 4LERA 3K4JA 1HA8A 2R4GA 3EGDA 3F46A 1LS1A 3EPZA 2IS2A 1D0ZA 4C3BA 4E7SA 1FMWA 1T95A 4F3QA 2VQLA 3FHNA 3IEEA 4CSWA 4F4BA 3GBGA 1W36D 3FKJA 3CSKA 4M63A 2AQEA 3JSZA 1FFHA 5B1AC 5KHDA 4XLAA 3AL0B 3NG1A 2P0WA 2Z16A 4PK4A 4F91B 1OKKA 2V9KA 2DYSC 3RFYA 4CS8A 4BE2A 3TMOA 3MLGA 3LAYA 4OD4A 4O7GA 2ZFUA 2LREA 4U87A 3DAFA 2CFOA 4A2NB 2MFZA 3LMMA 4PJMA 5CQEA 3E0JB 4ANJA 4OIQF 1QHGA 2W4BA 5D91A 4AX2A 4JJFA 2K9LA 3K4MA 4E7KA 2V1NA 2DT6A 2OC6A 4DBQA 3DAGA 3EPVA 4D1QA 5LD2C 3KKBA 2WZLA 2RREA 3F9KA 4RM3A 2CUZA 1W36C 5T3WA 3M1CA 3D5LA 2CW0F 1Z3YA 3G2BA 2E87A 4KBLA 5B1BC 5B3SC 1Z3IX 1V5GA 5KYWA 4RLQA 3L0IA 4MQ9F 3T6JA 1PJRA 4RLFA 2ZXHA 2PX3A 4PSWA 4CCNA 4W8KA 4IZZA 2CNWA 4QDLA 3ZCOA 3K70D 2JSPA 3FDYA 4I44A 4U5EE 3Q7GA 1R6RA 1WGWA 3I5PA 5T1DB 2W1OA 3AG3C 2PP4A 4IQJA 3SYTA 4XN3A 1QZXA 2KJGA 3DEEA 3CZ6A 3AFHA 1QLEC 2PF4E 4GRIA 4HRIA 4ZC3A 2WAQA 4BQOA 4ZLCA 3W2AA 4G7OF 2IXMA 3LSMA 2HPIA 2M7AA 3LSHA 3PNYA 2HDWA 4II2A 3OS1A 3OY9A 3K6BA 2GOMA 5LFAA 4DVYP 4NC8A 5EHHA 5EGYA 3RCOA 2Y3GA 2ZXPA 1ZHTA 3K70C 3OIPA 2F4IA 2XC7A 4AE4B 1MMAA 1DGRM 2QKMB 3OL3A 3RPUD 1J09A 3CJQB 3OR2C 3DM9B 1Z63A 2HVQA 3DXJF 2HNHA 3RH3A 2ZSIB 2IS6A 2CH0A 3BCBA 4LG3A 3HOTA 2E1MB 1D0YA 4XN0A 4F93B 2Q9AA 2W4SA 2E5NA 3GODA 2VKHA 2H7OA 5KYXA 2I8DA 4MNDA 2EILC 2BVMA 4CS9A 2KGOA 1M57C 2J9WA 2WAFA 3B0PA 1PCXA 1ZHWA 3LS0A 2WA0A 1ERDA 3BCAA 3ABLC 4KNVA 2W45A 4YELA 1V54C 2Y3DA 3JYHA 3PNVA 4NNJA 1IW7F 3I4UA 4JJGA 3DJUB 4CUGA 1S7ZA 5HNHA 2DJIA 4Y3OA 4HNTA 2RNGA 3PJRA 2R7RA 5HNFA 3TBIA 1S9HA 4PJLA 2IXPA 2X1DA 3MKZA 3NYMA 4XONA 3MKYB 4DVZA 4C9YA 1ZU4A 5JHFA 3EUKL 3EUHC 2KRCA 2M0MA 1Z6AA 2HV7A 3UMKA 3KH2A 1N78A 4BJ6A 3CMMA 3ZVRA 4BEHB 2LYCA 2ZSHB 4O6MA 4RD9A 3OYAA 3RTRA 4AE4A 3OEOA 1U0JA 3EGDB 4E7IA 3SZRA 4CCMA 4XLPF 4XTKA 3ZC4A 2CS3A 3K4KA 3ZG1A 2LBFA 1SF8A 2J45A 2O9XA 4XLEA 2XXAA 1WFXA 4LITA 4E7ZA 2HQAA 4B43A 4CCJA 3PSIA 2R7VA 4QI2A 3OYDA 3TD7A 2XF6A 4C3DA 2IXNA 3VYSB 3S3OA 2A69F 2A68F 3V42A 2J7PA 2G3VA 4KI2A 1P9QC 4ZDLA 2KW3C 1TWCA 3Q6MA 3QZCA 4U5GA 5KYYA 2VPLA 2CUJA 5E3CA 4JOMA 4KNWA 2OV7A 3K10A 4I3MA 3ZGKA 4QPQA 4RBNA 2IYLD 1D1CA 3W8IA 4QI0A 5L3QA 3OWTA 3HC7A 2J0XA 1WJDA 4XLCA 2VQHA 4RMNA 2KDOA 3U21A 5HVQC 2J46A 4BE0A 2HU9A 1X4PA 1MMNA 1UG0A 2IGOA 4IX7A 4LACB 3VYTB 4BL0B 2W7NA 3VYWA 2MWQA 2R7SA 2NUPA 3M1CB 2KRHA 1NZEA 3NKEA 5HSWA 2ZXWC 4OIRF 2O5RA 3VSKA 4BEHA 1OCRC 3SDBA 3OOUA 4E4HA 5FRMA 2PFDA 5KYWB 4BQNA 2VJIA 1LKXA 3RSNA 2V26A 3LJBA 4C2UA 5E2QA 3S28A 4J30B 1X1DA 2K5CA 4U5BE 4ZDOA 4CCKA 1TZLA 2CDQA 1GLNA 3FDQA 3ZXSA 3UR3C 3K1IC 2XAUA 2E5ZA 3K33A 3SYNA 3J7AY 2A6TA 3OS0A 1SMYF 1ZHYA 3O6XA 4KC9A 2KZVA 2DYRC 3ASNC 1BR2A 3K7DA 4CA0A 3OYJA 2A6HF 4JURI 2WY7Q 1Z5ZA 4O6NA 2KMUA 1M2VA 4ZJZA 3SEQA 2Q2EB 4HFFB 1D0XA 2FFHA 4XKCA 2UUZA 2DXIA 1UAAA 2M4GA 4HG2A 2FUG2 3I9V2 3H0DA 3E9VA 3LEVA 2X6XA 3ZRGA 3EZHA 3KMIA 4P6IC 3S29A 1WJEA 3L2WA 2V4JC 3PFYA 3K1HA 3I3LA 3HXLA 3PL8A 2XSJC 1VYKA 3PNTA 4HNUA 5IY5C 2UWMA 3L34A 3FBNB 3CF2A 4PJJA 1RJ9B 3ZR8X 3H35A 5HLTA 4FX5A 4DIQA 2BOLA 4B3XA 5E33A 5DQZA 2GOXB 3A1YA 3VWBA 3AG2C 2X6YA 4FWVA 2VJ4A 1JI8A 5KYXB 1UELB 3S3MA 3H9QA 3H5NA 2CNWD 4CS8C 2V6EA 4CCLA 2MD0A 4JVSA 4N06A 4U5HA 3POVA 3DPUA 2XSEA 2Z2SB 3IAM2 3MMYB 1KONA 4HEA2 3HL2A 4E6KG 4BGDA 3W2VA 2QKLB 2G62A 3PMRA 2R7WA 2R7UA 3CJRB 4IQ4A 3VYUB 3FBIB 2QTVA 4B6IA 4DOZA 2VB6A 5FRNA 1N75A 2W9YA 5KYNA 3S3NA 1BR4A 3E70C 1X1BA 3K4CA 1SZIA 2JVGA 4AYBA 3V7OA 1WJ5A 2L9JA 3QMKA 1DGWY 3AG4C 4LIVA 3LS1A 3MKWB 2I8BA 2WY8Q 3CQZA 4NY3A 1T0FC 3X1OA 4EWCA 1X1CA 2IGKA 3DD7A 4HSRA 2M7BA 3HUGB 2P6VA 4YN0B 3EUAA 4IWBA 3DTEA 2WZGA 3LSIA 2Y0SA 3T4RA 1RJ9A 2R7TA 4G6TB 4Q7CA 2LBFB 3VYRB 4LLEA 4IJJA 3WG7C 4OAZA 3N24A 2HVSA 2XXAB 4G0HA 3AL0C 4BJ5A 4PJNA 2VQCA 3RQ4A 2FGYA 2Y39A 4C2TA 2H7VC 2M4EA 1OCCC 2ZPAA 1X4OA 3CP8A 4N4NB 2EIKC 4GEHA 3W8HA 2KL4A 5KYYB 4IRUA 5HOOA 4YT5A 2IXOA 4CIHA 3QODA 2CW7A 4PSXA 3W2WA 2EIMC 3S32A 3EH1A 5F5FA 3K4BA 2WL8A 4CS7A 3DMDA 2VASA 1TT0A 4XLFA 3H65A 3OR1C 2F5VA 5DQTA 3NWTA 1NG1A 2Q9BA 4JCHA 4AVZA 2KQRA 4BDYA 1ZHZA 3C2HA 3KX2A 4CZCA 3PUBA 1V5FA 3I5QA 2CW8A 4EATA 1J8MF 5T3TA 3DPTA 3B0VC 5KCMA 3ZIBA 2NUPB 3MD2A 2JD3A 3OA1A 2VQGA 2DT7B 3VAYA 1NU7D 3BG6A 3HPGA 3B9QA 1VK5A 4CS9C 2M3AA 3E1SA 3HKZA 4F55A 1PD1A 2G3KA 3HTKC 4ZTJA 2WBMA 1LVKA 2IOQA 5DS4A 3EJNA 3EZIA 3T6BA 2VXZA 3CESA 4NC7A 4XM3A 2ZXIA 1ZYRF 1Y56A 4J32B 4N4OB 4CSAA 3HOSA 2OG2A 4XKBA 3FAJA 2XDVA 4Q5SF 2VJJA 2LC2A 4BJTA 4KITB 1K6YA 2Q3TA 3LFUA 3DWLE 3ZQQA 4C7OA 4ZYAA 4CCOA 4G7HF 2HPMA 2JVHA 2OUMA 2P7VA 1M2VB 4CH7A 4BJ6C 3OYLA 2WZFA 4XMYA 3NDBB 2WVQA 3H9JA 4E7HA 3L2UA 2A1DD 4FESA 3VDXA 2PX0A 3UGPA 4HPQA 1M56C 4YRVA 2XF5A 4WJ0A 1OR7C 4QPOA 4XOTA 2PMZA 3ASOC 3K6GA 3K4LA 3NRHA 2HZDA 4I1OB 4BEJA 4YT2A 3ZSUA 1BOBA 2E1MC 4F92B 3EG9B 4BUPA 2ZXOA 4OAYA 4PUSA 3O39A 4X0GA 3DM5A 1NG6A 2VLAA 1WJCA 2WB1A 3BG7A 2L2OA 2XF7A 3DQVC 4MLOA 4R79A 3A4CA 3OYIA 4BDZA 1N77A 2R7OA 3DLAA 3EFOA 3ITFA 4XLNF 2VH3A 4Q4ZF 1WJBA 2ELJA 2Q1ZB 5CI9A 1TWGA 4E7JA 3DU5A 4ITVA 4ZDPA 5KNLA 2LH9A 2X1CA 3OYMA 2IS1A 1FFTC 2J9UA 4U5FE 1OCZC 4G7ZF 3RYLA 1LDKB 2NOJB 1N1CA 4P1WA 3OYKA 1TWAA 1FTSA 1DP3A 2CGEA 1VYIA 3EGXA 3FVYA 3K66A 3D5RC 2IGNA 1YX3A 3F47A 3S27A 2LY2A 1OKKD 1M2OA 2BE5F 3EHNA 5DVWA 1QHHD 2RQQA 4BG0A 3NKDA 4XQFA 2VIXA 2KP6A 3JT1A 2C04A 3LLIA 2WVNA 2VL8A 1EA3A 4DBRA 1TKNA 3DU6A 3PSFA 4U5CE 3N0TA 2X85A 3GANA 3OYBA 4B44A 5DS5A 2KNHA 2NUTA 1D1BA 3IUOA 3SZGA 4XL9A 1OCOC 1TR2A 3EG9A 4RM2A 3S8PA 3OYNA 2OCCC 2BW3A 3TL4X 3VSLA 2HV6A 2LOOA 3KEYA 4C30A 2WB7A 4KJZA 4XWJA 4D9JA 5BUOA 4KISA 1WJFA 4OD5A 3DJNB 1NU9C 4K0DA 1JPJA 1BR1A 4YJWA 5DS6A 1Z7LA 1X19A 1TWHA 1ZU5A 1PYVA 3FHDA 3SNHA 3ABKC 4BQQA 1O87A 3L2RA 2IXSA 4ZLDA 2WADA 1Z3XA 1O5HA 4BJ1A 4KT6A 2L81A 1Z21A 4B47A 5DLJA 4EBBA 3JCUQ 4IKFA 4ZTFA 3L2QA 5KYUB 3SEOA 2LG4A 2NG1A 2CV2A 3UNGC 4I1MA 2KHMA 1X1AA 3EQLF 1SAUA 1JPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJT A;  4BJ6 C;  3K6G A;  4BJ5 C;  3OWT A;  3CZ6 A; 
#chains in the Genus database with same CATH topology
 2Y69 C;  3F8F A;  4P5O A;  3H0G J;  3HKZ N;  1IXS B;  2FBH A;  4BXF A;  2LF8 A;  2YU9 J;  3WHB A;  1E3H A;  4AU7 A;  3IQ6 A;  4GYT A;  3OIQ A;  1S3J A;  2NS7 A;  4DW6 A;  1ZRF A;  4JZA A;  3PFI A;  1A04 A;  4BHB A;  4NCQ A;  4RB3 C;  4WGY A;  3CLO A;  1G8X A;  4BE1 A;  3M3Y J;  1IZM A;  1P6R A;  3JTG A;  3NYL A;  1MMD A;  1V4R A;  4AWX B;  3MVP A;  2W82 A;  1J9I A;  2P0N A;  5JFR A;  3BR0 A;  1MND A;  1R71 A;  2ASR A;  2EIN C;  5FKL A;  2CQN A;  1WRJ A;  1IJW C;  1FP1 D;  2XB5 A;  3RQF A;  4PFO A;  2FBI A;  4KT5 C;  2NNN A;  3WTZ A;  2HSB A;  2L7Z A;  3FMS A;  2ISY A;  4YEJ A;  1I39 A;  2IPQ X;  3J80 K;  2VKD A;  4RDA A;  1BL0 A;  4DGW B;  2F48 A;  2K3P A;  3V7S A;  5JSL A;  2K7L A;  2XAS A;  2VKE A;  3D1N I;  4FCY A;  4IHT A;  5DV5 A;  1TWA J;  3JSE O;  1F36 A;  1QZE A;  4B3A A;  2LLK A;  1AU7 A;  2JA8 J;  4E7L A;  2IS4 A;  1IN8 A;  3BLY A;  2E2I J;  1C03 A;  2JUC A;  2O3F A;  4LFU A;  2VC0 A;  3NQO A;  4KFC A;  4UUT A;  3WGH A;  3I56 I;  2HOS A;  2B9S A;  3W4Y A;  1O3Q A;  3S90 A;  3BC8 A;  2PJR B;  5JP7 A;  4HA8 A;  3KYJ A;  3M7G A;  3H2U A;  5L0C A;  2ACJ A;  2RKH A;  3GUD A;  2VJ5 A;  4KIF A;  4OIP F;  1F1M A;  4U5D E;  4OIN F;  1R5I D;  1LUJ B;  3PUF A;  3LES A;  2IGM A;  2LFF A;  4N9I A;  3K4N A;  2GFH A;  1OLT A;  3EGX B;  1GT0 C;  2MAB A;  2W00 A;  1YOV B;  5KK1 A;  2J7P D;  1R1T A;  4N4W A;  4PAC A;  2OZ6 A;  4M72 A;  3TP0 A;  4ZYG A;  3JAM Z;  2LTP A;  1JGG A;  1TQG A;  4CDG A;  3ZPL A;  4KIB A;  2C03 A;  2P4W A;  4RB2 C;  3K2Z A;  4AIJ A;  2Q9C A;  3ZP5 A;  1XMX A;  1ZGJ A;  3Q0W A;  5BQI A;  3ZQY A;  2OU2 A;  3I53 A;  1AHD P;  3MX3 A;  4A0Y A;  2J0W A;  1YYX A;  2A0B A;  3CMY A;  1HXD A;  4L9N A;  4HST A;  5H20 A;  2BGC A;  2LSE A;  2Y3H A;  1SFK A;  1VQN I;  5JVE A;  3PQK A;  3CEX A;  1V5E A;  5EK0 A;  1FJL A;  2EB7 A;  2L5Q A;  3IQ5 A;  3JRT A;  3S2H J;  1XZQ A;  3VM6 A;  1NFN A;  3KYL A;  4CX9 A;  3C2G A;  4XKW A;  2PJR A;  5D5U B;  2F6C A;  1Y4C A;  3ZQV A;  3KYD B;  4PFP A;  2XAG A;  1VF9 A;  3LNM B;  3G6E I;  5DEQ A;  3IP4 B;  2ZJR F;  2IBF A;  1OJL A;  1WOL A;  3C62 A;  1KU2 A;  2DTR A;  3HG9 A;  1G5Z A;  4O5V A;  3ZTZ A;  5IY5 H;  2A6E F;  3MN2 A;  5E1Z B;  3ZOB A;  3OYH A;  4U0V A;  2YEV A;  1UJ8 A;  4N6H A;  3OYC A;  3RIP A;  1FMV A;  1KU3 A;  2BHZ A;  3CDH A;  1B8I B;  1HE1 A;  3K4J A;  4HYE A;  2R4G A;  1HA8 A;  1HY5 A;  3JCU C;  2R3S A;  4LER A;  5LGU A;  1RKW A;  4F3Q A;  4YG2 F;  3RJP A;  1AKH B;  1E3P A;  3FHN A;  4CSW A;  2ISZ A;  3FKJ A;  4UNO A;  2O0Y A;  1X2M A;  2ZBK A;  1OXK A;  1IN6 A;  1ETQ A;  3ZN1 A;  4XLA A;  5IT9 Z;  1R1V A;  2ZJ2 A;  3RIR A;  3RKX A;  4P9T A;  4L5I A;  1RCP A;  4IRG A;  1A31 A;  1T5O A;  2DYS C;  3RFY A;  4CS8 A;  3MLG A;  2LP4 A;  3JSO A;  1O7L A;  3Q0U A;  3JRG A;  4ZYD A;  3KP3 A;  4A2N B;  5IP7 J;  4NTF A;  2HQ5 A;  2QCO A;  1G3S A;  3E0J B;  4ANJ A;  3I5U A;  3ROU A;  1K6O A;  3F3X A;  5D91 A;  1OR2 A;  1IN5 A;  2V1N A;  5FGM A;  3DAG A;  5LD2 C;  1RUO A;  4UY8 I;  3NMI A;  1SD4 A;  5J8F A;  4U0Y A;  2I5U A;  1B8I A;  1K78 A;  2PX3 A;  3IHU A;  3FIS A;  4RLF A;  3GZ5 A;  4CXF A;  1UFB A;  1KYW A;  5A6A A;  3KP4 A;  4LDR A;  3I5P A;  4BY1 J;  5BPI A;  3J81 K;  1TQI A;  3ABU A;  2PF4 E;  4V2G A;  1ZHF A;  2ZME B;  3F6O A;  4CJO A;  1SR2 A;  2RAE A;  1ZH5 A;  2HMQ A;  4OMY A;  1XS9 A;  4UB6 C;  2HDW A;  3OS1 A;  3OY9 A;  5M3F J;  2AXT C;  2GOM A;  4W1U A;  5LFA A;  4DVY P;  2FJ1 A;  5EHH A;  5CVU A;  5J47 A;  2ZXP A;  1TQP A;  4EMS A;  3E5X A;  3SHF A;  2F4I A;  5E1W A;  2D1V A;  4A12 A;  4P9U A;  4MNU A;  4AE4 B;  1GV5 A;  2CO5 A;  2QKM B;  1BJZ A;  4A3L J;  1Z63 A;  1POG A;  2IEK A;  2FNP A;  4RGR A;  3SQN A;  1KGS A;  5COM A;  5L3D A;  2E1M B;  1D0Y A;  2MC3 A;  3KPH A;  2W4S A;  4AIK A;  2HR3 A;  3T6G B;  2H7O A;  2I8D A;  1DDN A;  2EIL C;  2XM0 A;  2BVM A;  2P1A A;  2J9W A;  1NBB A;  5E79 C;  3FK7 A;  2WAF A;  2E1C A;  3E5U A;  3B0P A;  1PCX A;  2WA0 A;  2DA3 A;  3RF3 A;  3ABL C;  1HQC A;  2W45 A;  4YEL A;  2ZME A;  1ZR4 A;  1RC9 A;  3JYH A;  2M8E A;  6PAX A;  1IW7 F;  3BG5 A;  3S2W A;  5FB2 A;  4RB1 A;  4MTD A;  2CQK A;  1QPI A;  3HSR A;  4CUG A;  2ADU A;  2Z33 A;  1S7Z A;  3IPM O;  1YYJ A;  2RNG A;  1E83 A;  1WAT A;  2BXY A;  2FF4 A;  4BPM A;  1GM5 A;  4PJL A;  2VUM J;  3DEW A;  2X1D A;  4XON A;  1P4X A;  4C3H J;  2HJ3 A;  3TK0 A;  1KU7 A;  2YQY A;  4BJ6 A;  2R9R B;  3HRM A;  3KH2 A;  4DJ9 A;  2K9Q A;  4O6M A;  1JHH A;  2FSW A;  4AE4 A;  1U0J A;  4CDV A;  1OMI A;  1Q0G A;  3SDG A;  2HOT A;  1LM3 B;  4NTA A;  1W0T A;  3KP2 A;  1QKR A;  2CS3 A;  3MCZ A;  1BI2 A;  2ELK A;  5LGT A;  1GXQ A;  2LBF A;  1SF8 A;  4LK0 F;  1CGM E;  3BR6 A;  2O9X A;  2XXA A;  1R58 A;  2MGQ A;  4IHY A;  2A61 A;  5GPG B;  2HQA A;  4CCJ A;  2R7V A;  3O8H A;  5D6E A;  3CC4 I;  3TD7 A;  2XF6 A;  4QI2 A;  3TUL A;  4L5E A;  4YFN F;  3S3O A;  2MLG A;  2A68 F;  2O6G E;  3JTL O;  2G3V A;  2JSC A;  4KI2 A;  2KW3 C;  2DYR H;  3CCS I;  1TWC A;  3ASN H;  4ABZ A;  1Z0X A;  4BBR J;  5K5Q A;  1QGP A;  3WTU C;  4U5G A;  5KYY A;  3K1P A;  3BPX A;  2VOO A;  3FXJ A;  4I3M A;  4QPQ A;  4A3F J;  1B6A A;  2IYL D;  5L3Q A;  5D5W B;  2M64 A;  1WJD A;  1WWX A;  1APL C;  3U21 A;  5HVQ C;  1U9N A;  1YTY A;  2HU9 A;  1AUE A;  4LAC B;  2A05 A;  2BYV E;  2MWQ A;  1OFC X;  2R7S A;  1IUF A;  3M1C B;  2QUF A;  1NZE A;  3QP5 A;  3R0A A;  2OEX A;  2ZKZ A;  3GEH A;  4OIR F;  3VSK A;  2AHQ A;  1NK3 P;  1OCR C;  2OEV A;  3OOU A;  1EA8 A;  3ZMD A;  2GDC A;  4H0E A;  2A07 F;  1LKX A;  5LEK A;  4J30 B;  2K5C A;  4U5B E;  4HLX A;  4CCK A;  1E86 A;  3RDI A;  1R4T A;  1R49 A;  2XAU A;  4XQ1 A;  2F5E A;  3J7A Y;  1SMY F;  2QE9 A;  3EH2 A;  2COM A;  2KZV A;  2IA1 A;  5CLS A;  4ZYH A;  1I5N A;  1BR2 A;  3K7D A;  2YX7 A;  2KJC A;  4CA0 A;  2XGE A;  2QSH X;  2DI3 A;  3DWW A;  2BY2 A;  1DUX C;  3U2R A;  1EF4 A;  2DA4 A;  4WWC A;  2E34 A;  1IG7 A;  4XKC A;  4JKV A;  1SAN A;  2WWY A;  4HF1 A;  2M4G A;  4HG2 A;  3H0D A;  5E3M A;  5A6B D;  3GXO A;  1OQC A;  3G1O A;  3KMI A;  3NMK A;  2KDZ A;  3I64 A;  3L2W A;  3PFY A;  3PL8 A;  1OQY A;  2DA5 A;  2M0C A;  3ABT A;  2EIJ H;  3B6A A;  3FBN B;  2NVQ J;  4FAP B;  4ZYE A;  2OQM A;  4FX5 A;  2GOX B;  3WTS C;  1X2N A;  3A1Y A;  1YRN B;  2X6Y A;  4IRI A;  3DBR B;  3FWE A;  3TDU C;  3GFL A;  2VJ4 A;  5KYX B;  3TOB A;  3GOR A;  2DOD A;  4WXH A;  3V8L A;  2GA0 A;  3H5N A;  4B4C A;  4CS8 C;  4XRF A;  2V6E A;  1KNY A;  2PMH A;  4EGY A;  2HWV A;  3MFK A;  1ZN2 A;  1ZQ3 P;  3DPU A;  3N4M A;  1MBE A;  1Z05 A;  2QEN A;  1JE8 A;  5FZT A;  4RBO A;  2HI3 A;  1A6I A;  2G62 A;  2XRL A;  5F28 E;  4B6I A;  1D8K A;  2X6O A;  5F64 A;  1VQL I;  3P9I A;  1J75 A;  1CGO A;  3E70 C;  1YVI A;  1TQM A;  1X1B A;  1R7J A;  1SZI A;  2ECB A;  1NK2 P;  2KFD A;  3ZQI A;  3ZMT A;  3BT9 A;  3PIO F;  5AIP A;  1S8N A;  1X1C A;  4KUM A;  4FHT A;  1UHW A;  5A6K A;  1U78 A;  2M7B A;  4YN0 B;  3EUA A;  2YLD A;  2M9H A;  2WZG A;  5LHH A;  3VYR B;  4LLE A;  1B72 B;  2L4M A;  2QGU A;  1ZZP A;  1YRN A;  2V1D A;  3A11 A;  3RVY A;  3K69 A;  2HOE A;  2W48 A;  1GV2 A;  2Y39 A;  2VQC A;  3HBL A;  4CIP A;  3X2Q H;  4Z6Y A;  4ON0 A;  3GCM A;  4A5M A;  4C3I J;  3HJE A;  4JEB A;  3CP8 A;  3IWZ A;  2DA2 A;  4GEH A;  2JN6 A;  2KL4 A;  3EYY A;  1ZW2 A;  5HOO A;  1H88 C;  1QPM A;  2ME0 A;  2XAJ A;  2HXO A;  3W2W A;  1NFO A;  3QRF F;  2VAS A;  1VQ4 I;  3RPU A;  3H65 A;  1PUF B;  4JCH A;  2PNO A;  3V7C A;  3HNL A;  2R7F A;  4XPX A;  5T3T A;  4EAT A;  2FU4 A;  5KCM A;  2NUP B;  3MD2 A;  2JD3 A;  2XB0 X;  2DT7 B;  1T8I A;  4A3D J;  2PEX A;  4XEK A;  5IOZ A;  1VK5 A;  4JTA B;  1HBX G;  4F55 A;  3E1S A;  3F8C A;  2IOQ A;  3EZI A;  3T6B A;  3CES A;  2ZXI A;  1B72 A;  2ZME C;  4EV0 A;  3O6B B;  4BQA A;  2FQ4 A;  4Q5S F;  5BS6 A;  2EPM X;  1LDJ A;  1BI1 A;  1LJ9 A;  2Q3T A;  3DWL E;  4HW0 A;  2DJN A;  4HAM A;  3LSP A;  4ZYA A;  4CCO A;  3E97 A;  2LIG A;  2JVH A;  2OUM A;  1FY7 A;  5EG0 B;  4CH7 A;  3RYR A;  4EUK B;  3RQE A;  4BJ6 C;  5EGO B;  256B A;  3QWL A;  2WVQ A;  3H9J A;  2MD5 A;  2ZXJ A;  2NS8 A;  4MEX F;  1M56 C;  2L9V A;  2PMZ A;  4LLG F;  2OPT A;  3K4L A;  4N9H A;  3B71 A;  3U9M A;  4B09 A;  1SFU A;  1Q1V A;  3BRO A;  4MVZ A;  2E1M C;  4EJO A;  3CMA I;  4F92 B;  3EG9 B;  4BUP A;  2KIQ A;  1Z9C A;  4EJW A;  1R36 A;  3O39 A;  2A69 F;  2VLA A;  4F4B A;  2OCC H;  4BDZ A;  4MLO A;  1YFH A;  3JSZ A;  1GGQ A;  3DP7 A;  1T38 A;  1HOM A;  2R7O A;  3B02 A;  4P55 A;  2XLM A;  2LFD A;  5AON A;  3ZMV A;  4DYQ A;  3KFW X;  2IS1 A;  2J9U A;  5KAF C;  1T33 A;  2LH9 A;  2X1C A;  1K04 A;  4U5F E;  2X0L A;  2EFO A;  3F6V A;  3GEE A;  3RYL A;  1LDK B;  1TWA A;  3K66 A;  1FTS A;  1IDY A;  1VYI A;  4AYB N;  4Z2Y A;  2GLO A;  3T8T A;  2OD5 A;  1OKK D;  5GAG J;  2L7M P;  4KMU X;  5EG0 A;  3GZ6 A;  2EFW A;  3RI4 A;  3EHN A;  1TW3 A;  1RKT A;  3BRJ A;  3FKI J;  4GYI A;  5B1B H;  5B3S H;  1CGN A;  2VL8 A;  1EA3 A;  2XPW A;  5F08 A;  5LBQ A;  4DBR A;  3GF2 A;  2Y0S N;  3DU6 A;  1MGT A;  2XKP A;  1FNT c;  3T0Y A;  4EJT A;  3GAN A;  3F8B A;  4B44 A;  5ILU A;  2J8W A;  1W5T A;  2QZ8 A;  5DS5 A;  2VT2 A;  2QSF X;  5DCM B;  3AG3 H;  3ZMU A;  5L0I A;  1UFM A;  2STT A;  3EG9 A;  3OYN A;  4D5F A;  2VOP A;  2BW3 A;  3TL4 X;  2M45 A;  1A0B A;  2IP2 A;  1R9T J;  4DNC A;  1Q0F A;  3S17 J;  4RAZ A;  4D9J A;  3W8H A;  3TO9 A;  3FMQ A;  3GVA A;  4NQW A;  3ABM H;  2K9N A;  3EYI A;  4IHW A;  4I6Z A;  1JPJ A;  1BR1 A;  4BBS J;  2WTE A;  4D4N A;  1ZU5 A;  2OKU A;  4RAY A;  4IHS A;  4BH9 A;  2BY3 A;  1R5G A;  3FHD A;  3ABK C;  3SNH A;  4PZJ A;  4BQQ A;  2P7C B;  1UG7 A;  2OTJ I;  3NKE A;  3IWF A;  3A9C A;  2PBE A;  2JTV A;  4BJ1 A;  1SVL A;  5LRS A;  1Z21 A;  3L8J A;  2ZNY A;  4IKF A;  1T6U A;  2OOC A;  2LG4 A;  1Z6T A;  2DA1 A;  3O3K A;  1RUN A;  3KEQ A;  3GTO J;  3M79 A;  5KNL A;  2H8W A;  3P9K A;  3AAF A;  2UXX A;  2Q9A A;  4RS8 A;  1YW7 A;  1FOY A;  4HE8 D;  3C8G B;  3B0U X;  1DU0 A;  3I4N J;  3QPH A;  4OWR B;  3M8J A;  3HJC A;  2IW5 A;  1MIJ A;  1FZP B;  1YW9 A;  2K85 A;  4F52 A;  5CIV A;  4DZJ A;  2AS5 F;  3DKY A;  3W3C A;  3GEI A;  2HFH A;  3HOW J;  5E17 F;  3ZWI A;  4M9Z A;  5FO5 A;  1FOK A;  3AG1 H;  2YUS A;  2MG4 A;  5D92 A;  4JBA A;  1HKT A;  2Y9Z A;  1V54 H;  3QYE A;  2DA6 A;  4E0I A;  1D8J A;  1L7C A;  4CGZ A;  1WPK A;  1QA6 A;  4A4A A;  2GA1 A;  3DI5 A;  1FSE A;  1G3W A;  3F0C A;  3FZV A;  2ZC2 A;  1H9G A;  3LNR A;  4FAS D;  4BAC A;  2DDA A;  3TP3 A;  3N2Z B;  4MTF A;  3NYJ A;  3O55 A;  4I76 A;  4BXU A;  2VCA A;  2P61 A;  5J1U A;  2J9V A;  2K40 A;  2DMT A;  3GLX A;  1OW8 A;  3PHF 2;  4Y33 A;  2C6Y A;  2Z15 A;  2KPM A;  2K3F A;  1YX5 A;  3KZI C;  1U3E M;  2CV0 A;  1MBK A;  2NOG A;  3BPV A;  1AA7 A;  5CQG A;  1MKM A;  3I55 I;  5COF A;  2XHK A;  2LP0 A;  2V7F A;  1XPX A;  1GDT A;  1A7D A;  2EPL X;  1TWF J;  2YHS A;  1FC3 A;  4DRI B;  3KP7 A;  4JE9 A;  2FBK A;  4Y4R A;  1Z23 A;  3COA C;  5CPR B;  2MYS A;  3LSK A;  2R5Z A;  2ZXR A;  1I3A A;  3ZN0 A;  1G59 A;  2VBY A;  2EPO A;  4A6E A;  2BC5 A;  3OL4 A;  5HV9 A;  2XUB A;  1LFP A;  1E3O C;  1KA8 A;  4Y13 A;  4H4K C;  3HTS B;  1ORY A;  1MW7 A;  2JUG A;  3CCY A;  2DGJ A;  3LOC A;  3H5A A;  4FET A;  1HDP A;  4I01 A;  4IOA F;  1H6G A;  1U6H A;  4HLY A;  4LLC A;  3OS2 A;  4IL6 C;  2XL8 A;  4ETS A;  4ENN A;  3H9G A;  5DM6 F;  2K86 A;  4JW1 A;  2VXD A;  4YL1 A;  1NHA A;  3SP1 A;  2CSO A;  1BOA A;  1W1W E;  4P9F A;  4UXN A;  3FAP B;  2DMU A;  2W4M A;  3LEO A;  1FBQ A;  1D1A A;  2AU5 A;  5FFZ A;  5D4R A;  2VC9 A;  4AK9 A;  5E1X A;  2RDP A;  2Z1D A;  2XIG A;  1GQA A;  3LA3 A;  3WTT C;  2CQ7 A;  3ZQF A;  3QVY A;  3UGO A;  3QYB A;  4U7D A;  3K1I A;  5D5X B;  2WAE A;  4XBF A;  4M3D A;  4A3K J;  2L7K A;  2BVL A;  5CVJ A;  2Y3B A;  4JIO A;  4I0A A;  5HDG A;  3TDZ C;  5JHU A;  1UHM A;  2L4A A;  3LSG A;  3K7A J;  1QSP A;  1J0R A;  3AQC A;  2XL4 A;  3GZN B;  3UMI A;  4HV5 A;  3QPS A;  1XCB A;  2EK5 A;  3M1E A;  2WV1 A;  3L09 A;  1YA7 O;  4MVM A;  3QYF A;  1OXB A;  5BOX A;  5K1Y A;  1LS1 A;  4C3B A;  5JRA A;  2QQ9 A;  1OYW A;  2HUJ A;  4XRS A;  1IAW A;  3GBG A;  1QVT A;  4UHT A;  1JKP C;  1W36 D;  3LSJ A;  3H3Z A;  1O3R A;  2AQE A;  2EFP A;  3KET A;  1A5J A;  2YL3 A;  3AL0 B;  3NG1 A;  3WHN A;  2P0W A;  2Z16 A;  4F91 B;  3GWL A;  1L3L A;  3U2L A;  4PGG A;  3TMO A;  2DFF A;  2P8T A;  4QWQ A;  2LRE A;  1U8B A;  2CFO A;  3W6V A;  3FXQ A;  3LMM A;  4MVQ A;  4L9J A;  2IJL A;  2Q8K A;  4UDV A;  3AG4 H;  5HDN A;  4DBQ A;  2DT6 A;  5T3W A;  2RRE A;  1W36 C;  2CUZ A;  1ETO A;  1HW5 A;  2CW0 F;  5ILS A;  1FOW A;  1XGO A;  3E6C C;  5KYW A;  1YZC A;  3L0I A;  2ZCW A;  4PSW A;  4A3G J;  1ZVZ A;  4IZZ A;  2CNW A;  4W8K A;  3ZCO A;  4IOC F;  3QOP A;  3Q7G A;  5T1D B;  2W1O A;  2KJG A;  1QZX A;  1OCP A;  2H6C A;  2Q7R A;  2B0H A;  4U9D A;  3CZ6 A;  3AFH A;  1USS A;  2G9W A;  4NQF A;  4HRI A;  1A7V A;  4ZC3 A;  2WAQ A;  2JA7 J;  3TO7 A;  4ZLC A;  3QU6 A;  2HPI A;  4DYR A;  4OU0 A;  2DT5 A;  3CC7 I;  1QRY A;  3LSH A;  3PNY A;  4UUS A;  4IHV A;  2Y31 A;  1MH4 A;  4QLC U;  5GTI C;  1K4T A;  3CUO A;  5J4Y A;  2Y3G A;  5AC5 A;  3KE2 A;  1ZHT A;  2GIZ A;  2XC7 A;  1MMA A;  2M87 A;  2EZL A;  2CG4 A;  2EZI A;  3CCJ I;  1WI9 A;  1G4W R;  5F1R A;  3DM9 B;  2HVQ A;  3RH3 A;  2NPU A;  4KDP A;  2ZSI B;  4XPY A;  3WHC A;  2IS6 A;  2CH0 A;  1TW2 A;  3BCB A;  4LG3 A;  2BV6 A;  4NDL A;  3GWZ A;  2KYH A;  3P9C A;  4F93 B;  5DM7 F;  2R25 A;  4A3C J;  3TJ6 A;  3GOD A;  4M6Y A;  3S1R J;  1OIS A;  5EZG A;  1BN5 A;  3C8G D;  4CS9 A;  5L0J A;  1M57 C;  1Z91 A;  2HS5 A;  3O2P E;  2XL6 A;  2EV0 A;  2XLD A;  1LFB A;  1WGX A;  5LLQ A;  1ERD A;  1FTZ A;  3BCA A;  1O4X A;  4KNV A;  1OW7 A;  3TW6 A;  1XDU A;  3PNV A;  3MZH A;  4JJG A;  3IRR A;  3CDL A;  2YPR A;  1G2H A;  2DJI A;  1X3U A;  4Y3O A;  3QAH A;  2PX9 A;  2X4H A;  3PJR A;  3TBI A;  1SD6 A;  3NYM A;  4OMZ A;  2LDU A;  1ZU4 A;  2BBY A;  4QSH A;  3EUK L;  2KRC A;  4MO7 A;  1EKE A;  2NSF A;  4CDA A;  1E84 A;  3BTI A;  4YFX F;  4MQV A;  1WSU A;  1U6G A;  2MA3 A;  1VQ7 I;  3OEO A;  1F4K A;  3H36 A;  4ER9 A;  1OCT C;  4CCM A;  1RRJ A;  3ZC4 A;  1HKQ A;  1MJB A;  4I2O A;  4HBL A;  3ZDL A;  4BHC A;  2V6C A;  3QPL A;  1IC8 A;  4A5N A;  4LIT A;  1OW6 A;  3ECO A;  1PUE E;  3PSI A;  2JT1 A;  3OYD A;  4C3D A;  4CO8 A;  2IXN A;  5TRD A;  1HW1 A;  3BDD A;  5E3L A;  2ICW G;  3VPR A;  4EHP A;  2W57 A;  1YIJ I;  1AWC A;  1HDD C;  3VOE A;  1ZKG A;  2FEZ A;  2E2J J;  4H54 A;  3TOL A;  2VPL A;  4JOM A;  5CJ9 A;  2OV7 A;  3K10 A;  2KC3 A;  4KNW A;  2F5D A;  4RBN A;  1Q0M A;  3PDM P;  3BQY A;  3ELK A;  3CCM I;  4JRZ A;  5GP9 A;  2VQH A;  3GFM A;  4RMN A;  1JTY A;  2KDO A;  2J46 A;  4WX9 A;  4BE0 A;  3S2D J;  3HKK A;  2XRN A;  4U5E E;  4Q47 A;  2K4J A;  5L0D A;  3HM5 A;  3DKW A;  1SFX A;  1JOG A;  5HSW A;  2ZXW C;  2O5R A;  2STW A;  1RKC A;  1W5S A;  5FRM A;  2HQR A;  3KP5 A;  4BQN A;  1K78 B;  2GAU A;  1LE2 A;  5E2Q A;  4C2U A;  1I4Z A;  3IH2 A;  9ANT A;  2CDQ A;  1Z6R A;  3UR3 C;  2DMP A;  2L6G A;  1I6H J;  1JUP A;  3ISP A;  4PCQ A;  4YFK F;  5GTH C;  5DD4 A;  3K1I C;  3CAX A;  3SYN A;  3JTH A;  2P6S A;  3FHZ A;  3BJ6 A;  4Q48 A;  1YYV A;  4KC9 A;  1VI0 A;  2DYR C;  2RNJ A;  3KYC B;  3JRC A;  3ASN C;  1FIP A;  4MW8 A;  3OYJ A;  2A6H F;  4JUR I;  1A36 A;  2P6T A;  2WY7 Q;  3IRQ A;  3P5J A;  3E3V A;  2ETH A;  4O6N A;  3SXZ A;  1M2V A;  3F22 A;  3SEQ A;  5DS9 A;  1SVM A;  1YHQ I;  5FLX Z;  3UKG A;  1JT6 A;  3LEV A;  2Y69 H;  3EZH A;  3F72 A;  1ETY A;  1WJE A;  4E70 A;  2V4J C;  4PR9 A;  5DDG A;  1FWZ A;  4EJV A;  3PNT A;  2OAZ A;  3L34 A;  2L7F P;  2JWT A;  5K7Z A;  3V8J A;  1KQ8 A;  5IPA A;  2QNL A;  2BOL A;  5DQZ A;  1YJG A;  1ZW3 A;  1MDM A;  4YIR X;  5A2Q K;  3FM3 A;  2LMD A;  3WGG A;  2EZK A;  4GDF A;  3ERE D;  2CNW D;  2XVC A;  1SVO A;  2AP3 A;  2MD0 A;  1I6X A;  1TNS A;  2HZT A;  5J3L A;  5L3E A;  3T5X A;  3POV A;  2V9V A;  4IEJ A;  2HOA A;  3MMY B;  4HV6 A;  3KZZ A;  4M6V A;  2XPV A;  4XK4 A;  3DEU A;  2EIM H;  3HL2 A;  2AWY A;  2YL7 A;  4DRH B;  2R7W A;  3CJR B;  4IQ4 A;  5HLG A;  3FBI B;  3R0J A;  1U9O A;  3JSP A;  2P5K A;  2Z99 A;  3CO7 C;  1BR4 A;  3GTJ J;  4UVB A;  1XN7 A;  3K4C A;  3ATP A;  2IRF G;  2L9J A;  1K05 A;  4AM3 A;  2GM4 A;  4BXX J;  3LS1 A;  3MKW B;  2WY8 Q;  1FYM A;  1YQA A;  2E36 A;  1BIB A;  2IGK A;  3HUG B;  1ITY A;  2MBF A;  5H6Q A;  5M3M J;  3G4Z A;  1S7O A;  2BL2 A;  3NAU A;  2LBF B;  4DQ2 A;  1F43 A;  2ECC A;  3VB2 A;  4J7Y A;  3N24 A;  2HVS A;  3MEX A;  2XXA B;  1RES A;  1VTM P;  5IT3 A;  3AL0 C;  3M8F A;  4A3I J;  2H7V C;  3V5Z A;  3VF0 A;  5K7F A;  1OCC C;  3GFI A;  5L3F A;  2LD6 A;  2EIK C;  1WAS A;  3BZ6 A;  3HYI A;  3WG9 A;  5KYY B;  5GAH J;  2DB4 A;  3QOD A;  2CW7 A;  4PSX A;  3S1Q J;  4NB5 A;  2QSG X;  4JX5 A;  3EH1 A;  3W6J B;  3Q3S A;  2WL8 A;  4CS7 A;  2F5V A;  4Y17 A;  3VFZ A;  1W0U A;  4PDK A;  3GM1 A;  4DRJ B;  2KQR A;  3DLL F;  4N6C A;  5JVG F;  1ZHZ A;  3KX2 A;  4CZC A;  3ZTM A;  3ASO H;  1J8M F;  3B0V C;  3DKA A;  2VQG A;  1Q1H A;  3G71 I;  3VAY A;  1WI3 A;  3TGN A;  4IVN A;  1D5V A;  3B9Q A;  4CS9 C;  3JRE A;  3HKZ A;  2RV8 A;  1PD1 A;  3HUG A;  2G3K A;  1EKY A;  4ZTJ A;  3EJN A;  1X3Z B;  1UMQ A;  1QNT A;  4A0X A;  2HYG D;  1IUY A;  3HOU J;  4FIS A;  3W6K B;  4S04 A;  1G6N A;  4XKB A;  1H89 C;  2HFI A;  3FAJ A;  4NC6 A;  2DPD A;  4I0B A;  3K1N A;  1AEP A;  3ZQQ A;  1F1Z A;  4C7O A;  3GTG J;  4G7H F;  2HKX A;  2NXN B;  1ZRE A;  2LSO A;  2R5Y B;  2O8K A;  5J8C A;  3BTC A;  4GFB A;  1Y8R B;  4XMY A;  2VE9 A;  3IQT A;  3M4O J;  1JTX A;  3VDX A;  3MQ0 A;  4YRV A;  3WGI A;  2FE3 A;  1WVR A;  3E6B A;  1IXR C;  3RKY A;  2PLY A;  2DN0 A;  1YJW I;  2EWN A;  5C4X J;  2XS8 A;  4BEJ A;  2MW8 A;  3RKW A;  3WTX C;  1BOB A;  1I27 A;  5JLW A;  3ZSU A;  2ME6 A;  5JVT A;  5C4J J;  2ZXO A;  1ETV A;  5EYR A;  2W84 A;  1FYK A;  2JRM A;  3DQV C;  2JK3 A;  2XF7 A;  3JAM K;  2XS1 A;  3A4C A;  4XLN F;  3CQZ J;  3EFO A;  5DYM A;  3ITF A;  4Q4Z F;  1HLV A;  4WF2 A;  1BA5 A;  2VH3 A;  2ELJ A;  3QP6 A;  1FNN A;  2L9R A;  2UUH A;  2Q1Z B;  3DU5 A;  4ITV A;  3A03 A;  4W97 A;  2XSD C;  1FFT C;  3HNK A;  4YL3 A;  2LFB A;  4YII A;  1OCZ C;  4G7Z F;  1N1C A;  2NOJ B;  2CQQ A;  3OYK A;  1DP3 A;  3U8V A;  1YX3 A;  4NHJ A;  5F04 A;  5CVR A;  4J19 A;  3QU3 A;  4N0B A;  5IP9 J;  2R5Y A;  1SC7 A;  1M2O A;  1QHH D;  3HGG A;  2COB A;  1JJ6 C;  3HDD A;  4LB6 B;  3MAJ A;  1FBS A;  1LS4 A;  2H1L A;  3LNQ A;  2WVN A;  2XAQ A;  4RAF A;  4MHG A;  1TBX A;  3PSF A;  4NBQ A;  3SFI A;  3CCL I;  5ICF A;  1H9T A;  3RZO J;  3AOU A;  3N0T A;  3HOV J;  5J6X A;  2YX4 A;  2NUT A;  1Y0N A;  3SZG A;  1TLH B;  3IQC A;  1OCO C;  1TR2 A;  2OCC C;  2XLV A;  2HV6 A;  3KEY A;  4C30 A;  4YIF A;  1YJ9 I;  1LVA A;  1JR8 A;  2DFI A;  4X6A J;  4AUX A;  2OCE A;  4OD5 A;  1HSJ A;  1NU9 C;  3HOX J;  1RMV A;  2CUE A;  1X19 A;  1I3Q J;  1ETK A;  1CGP A;  4MIM A;  1MH3 A;  2D2W A;  4MEY F;  2IXS A;  2DK8 A;  3GLL A;  2WAD A;  4L5J A;  1Z3X A;  2DBB A;  1O5H A;  4IO9 F;  2L81 A;  3L2Q A;  1U2W A;  3H92 A;  3SEO A;  5KYU B;  3L7W A;  2NG1 A;  2FAP B;  4CJG A;  3UNG C;  1NSG B;  5IT9 K;  1EI7 A;  1LFU P;  1SAU A;  1JPN A;  3V7R A;  3HSE A;  2E2H J;  2Y9Y A;  4DJA A;  1TC3 C;  4HNV A;  2LRD A;  4LDQ A;  1REP C;  4LIU A;  5E18 F;  2ZB9 A;  2UV1 A;  1CF7 A;  1V55 H;  1IO2 A;  2ZO4 A;  4BU2 A;  4C3E A;  3M8E A;  2EIL H;  3DBL B;  1WKM A;  2QQA A;  3MWM A;  3R60 A;  4CZZ A;  3HHH A;  4XSX F;  2QUP A;  5E3A A;  4XNF A;  3AQB A;  4XEF A;  2K9M A;  5TGT A;  2GXA A;  3ABL H;  2H27 A;  4Y15 A;  1SFE A;  2X48 A;  5E8I A;  4J01 A;  1LPQ A;  4JEA A;  3ABM C;  3ZQG A;  1YE9 A;  2DTZ A;  3G50 A;  3Q6N A;  3DTI A;  2GA2 A;  2GZW A;  5FKK A;  3A2K A;  1JKQ C;  2CYY A;  3EHM A;  1GVJ A;  4BYY A;  2CCY A;  3KIO A;  4M71 A;  1V3F A;  2FQ3 A;  1A7E A;  4KA4 A;  4C3J J;  1IN7 A;  2DPU A;  1MBH A;  1YW8 A;  2EQR A;  2W24 A;  4XOR A;  3GTL J;  2EZH A;  5KYU A;  1YJN I;  2YR2 A;  2QQ8 A;  1VLT A;  3F8N A;  2X6W A;  3MYF A;  3N05 A;  2DMN A;  3LSR A;  2O61 A;  2AVK A;  1NG7 A;  4YT4 A;  3QW1 A;  4A3B J;  2CMP A;  1ETX A;  2QA4 I;  1VQ9 I;  1VOM A;  3Q7L A;  2Y48 A;  2B0J A;  3S93 A;  2DO7 A;  4F7Z A;  2JA5 J;  3DTK A;  3RQG A;  4EIY A;  2I10 A;  5CKT A;  3AKZ A;  3AG1 C;  2JQ7 A;  1JJ8 C;  2JA2 A;  1ST6 A;  5L3V A;  1P4A A;  1FIA A;  2QM3 A;  3NEU A;  4NUB A;  3A01 B;  4CDY A;  2P5V A;  1U5T B;  2LY9 A;  2E60 A;  3ONQ A;  2LKP A;  4II3 A;  3WE2 A;  2Y2Z A;  3KL4 A;  4RDU A;  3K2A A;  2PFB A;  4R1H A;  3DPL C;  4XOP A;  3IAS 2;  3SJM A;  2FRH A;  1WJA A;  1IGN A;  3NRV A;  1C02 A;  1ZHX A;  2JPU A;  2EPN A;  4JTC B;  4HX8 A;  2DA7 A;  3UMH A;  1I50 J;  2M2E A;  4AID A;  2B63 J;  4HX4 A;  1W2W A;  1C17 M;  1HW2 A;  1YZA A;  2O8X A;  1IRX A;  2OF7 A;  1YLM A;  3WE3 A;  2ZJQ F;  3FX3 A;  1VTN C;  4JQF A;  5CYV A;  4I98 B;  4XKV A;  4KYW A;  2HTJ A;  1IDZ A;  4MTG A;  4HDU A;  2TMV P;  1J8Y F;  3CME I;  1H0M A;  2R03 A;  2DCE A;  5JI6 A;  3OYF A;  3HOY J;  5F5H A;  2YZS A;  1ZG3 A;  1MSE C;  1Z67 A;  1TFO B;  5L0G A;  4RB0 A;  3JRF A;  1DOW A;  4O79 A;  2E35 A;  4LLL A;  2BW3 B;  2MC4 A;  3OMY A;  3H5R A;  3PM1 A;  4GYG A;  5M5W J;  3WOD F;  2F22 A;  2Q4F A;  5B1A H;  1EH8 A;  2CJJ A;  4NQW B;  2WVO A;  1VQ5 I;  3QOE A;  5GAD J;  1Y1W J;  3A01 A;  4LB5 A;  1FOX A;  4Z9H A;  2CV1 A;  5FRO A;  4HQM A;  1U5T A;  4EM1 A;  2J5P A;  4L18 B;  2LD5 A;  4GQH A;  5A6J A;  2EFQ A;  4EM2 A;  3L2V A;  5ICC A;  4GXO A;  5COG A;  2AQF A;  3LFK A;  4YWQ A;  1B59 A;  4ULW A;  4YT8 A;  4K7B A;  3BG3 A;  5F27 A;  2ZD9 A;  4HFK B;  3CF5 F;  3GFJ A;  2R7Q A;  2VON A;  3HLZ A;  4IAO A;  3K9T A;  1E0E A;  2VCC A;  4E18 A;  5J1Y A;  2HVR A;  3DF8 A;  3EGD A;  3F46 A;  3EPZ A;  1D0Z A;  1FMW A;  1T95 A;  1SFO J;  2VQL A;  1UST A;  1T39 A;  4WK8 F;  1QQI A;  3AJM A;  1U8R A;  3CSK A;  3IKV A;  4M63 A;  4IXA A;  4XEV A;  2V1X A;  3FF5 A;  5KHD A;  2DQL A;  4LDK A;  2NSG A;  3LAJ A;  5F0F A;  3FOO A;  1BM9 A;  4BE2 A;  4KN7 X;  1SYQ A;  3CCR I;  3LAY A;  4JCZ A;  2ZFU A;  4U87 A;  3DAF A;  4G8X A;  4PJM A;  5H6R A;  5CQE A;  3V5X A;  1IZ1 A;  2IVM A;  5EDN A;  1XG1 A;  4OIQ F;  2BY1 A;  1N25 A;  2IA2 A;  4AX2 A;  4IPA A;  4E7K A;  4V2F A;  1TT5 B;  2OC6 A;  4D1Q A;  2WZL A;  3F9K A;  4RM3 A;  2DAO A;  2VPR A;  3VRC A;  3BG9 A;  1NH3 A;  2F5C A;  1JT0 A;  3MFN A;  3QW0 A;  4KBL A;  1V5G A;  4RLQ A;  4ENM A;  1T08 B;  4MQ9 F;  3RZD J;  5BQT A;  2Z9O A;  1DP7 P;  2L7A A;  1PJR A;  2ZXH A;  3CJT B;  3KP6 A;  4QDL A;  1T0F A;  3K70 D;  3CCE I;  3FDY A;  1JGS A;  4I44 A;  2O03 A;  3HOZ J;  4MVS A;  3J80 Z;  3LWF A;  4EJU A;  2F4M B;  2PP4 A;  4IQJ A;  3SYT A;  1UB9 A;  4XN3 A;  2P5L C;  3DEE A;  2QYO A;  4D7N A;  1VQ6 I;  5DUI A;  2P81 A;  3CCQ I;  2R5Z B;  4WGZ A;  1R5H A;  4BQO A;  1WN0 A;  1A41 A;  3LSM A;  5JLI A;  1S7E A;  2NVU B;  2IT0 A;  3FXH A;  3LA2 A;  3QTH A;  2JZY A;  2M7A A;  5FLM J;  3SZT A;  2L0K A;  1Z77 A;  1ORS C;  3K6B A;  4I09 A;  4AVP A;  1K4S A;  2KRF A;  1K40 A;  3G4X A;  1RPW A;  2YLI A;  5EGY A;  3RCO A;  3J7Z I;  1SD5 A;  3K70 C;  3OIP A;  5M5Y J;  4FX4 A;  3GME A;  3BJO A;  3WU1 B;  3OL3 A;  3CLQ A;  3RPU D;  1J09 A;  2QLZ A;  3CJQ B;  4ENJ A;  1QQ3 A;  2YWA A;  3GM2 A;  3TOM A;  4A3M J;  1KQ9 A;  2HXI A;  1O3S A;  3KLN A;  1TP4 A;  2L54 A;  3HOT A;  3JYY A;  2XGC A;  3R4K A;  4XN0 A;  3ZMZ A;  2XV4 S;  2LKS A;  3C1D A;  2M34 A;  2E5N A;  3GYH X;  1P2F A;  2VKH A;  3LA7 A;  4JX6 A;  4MND A;  4UVA A;  3J7A O;  5C44 J;  4L0Z B;  2KGO A;  5LHI A;  3L8I A;  3LS0 A;  4KIG A;  1X1P A;  2XLW A;  1MBG A;  2QBY B;  4MW3 A;  2E19 A;  2QVO A;  4NNJ A;  2KSF A;  3DJU B;  1WHU A;  1OPC A;  2R7Z J;  1I5Z A;  5HNF A;  2ID6 A;  2LR8 A;  4GO1 A;  5B3I A;  5IP6 A;  1DU6 A;  2V1U A;  1Z6A A;  3UMK A;  2M0M A;  2HV7 A;  1N78 A;  1IF1 A;  4IAQ A;  2ZSH B;  1QPU A;  4RD9 A;  3RQI A;  3GO5 A;  1Z1D A;  4G78 A;  1OR7 A;  3DE9 A;  3I59 A;  3SZR A;  1TFK B;  4FE4 A;  2CUF A;  1LQ1 A;  3K4K A;  3ESW B;  1M6T A;  4ULV A;  3K0L A;  4XLE A;  1WFX A;  4GCV A;  4E7Z A;  2HJM A;  1WCM J;  4B43 A;  2BY0 A;  1JMW A;  2I15 A;  3BEH A;  2V9P A;  2Y30 A;  3BR1 A;  3VYS B;  1J7K A;  3V42 A;  1MBF A;  2J7P A;  2OQG A;  1P9Q C;  4ZDL A;  2RN7 A;  3Q6M A;  3QZC A;  1P7I A;  1XGM A;  1VQP I;  2QBY A;  2CUJ A;  5H2F C;  2QEX I;  3Q5F A;  1ORJ A;  5E3C A;  5EZH A;  2CU7 A;  3ZGK A;  3LUT B;  3W8I A;  2R05 A;  3JZ0 A;  1L0O C;  4NC3 A;  4ZZL A;  4G7O F;  3L9F A;  4IF4 A;  1X4P A;  1MMN A;  2IGO A;  3M4C A;  3JRA A;  4BL0 B;  4IB4 A;  3MZ8 A;  4AD9 A;  2KRH A;  3TJ5 A;  4MVU A;  2BZT A;  5KYW B;  4E4H A;  4DZP A;  2PFD A;  2VJI A;  3AGU A;  4OOI A;  3LJB A;  3U1D A;  1XD7 A;  3AG2 H;  4HZF A;  3C7J A;  4A69 C;  5AGF A;  3U8P A;  1W4M A;  3MKL A;  1GLN A;  1Y6D A;  2HYF A;  3J7Y J;  1E85 A;  3Q9V A;  5HS7 A;  3DE8 A;  3NAR A;  1S5L C;  3TW7 A;  1U5T C;  1ZHY A;  2DOE A;  3CTA A;  1RKE B;  3S1N J;  3ABK H;  1RNL A;  2CGP A;  3V5Y A;  3HTU A;  2HDC A;  4MGR A;  4BHP A;  2OQR A;  3I4P A;  5EEG A;  4UUS B;  2KMU A;  1W7P B;  1VQM I;  4ZJZ A;  2CYD A;  4HFF B;  4EEF G;  1XMK A;  3WU0 A;  2GXB A;  2UUZ A;  1UAA A;  2FUG 2;  3I9V 2;  1JAF A;  4IHX A;  2X6X A;  3ZRG A;  1ZAR A;  4P6I C;  2BXZ A;  3S29 A;  1QVU A;  2J9B A;  1ACI A;  5FKN A;  2IBD A;  3HXL A;  3I3L A;  1O7F A;  2XRO A;  4HNU A;  1VYK A;  5IY5 C;  5JS5 A;  1HST A;  3H3U A;  2AO9 A;  1CQT A;  2OTL I;  2UWM A;  4PJJ A;  2NNY A;  1HF0 A;  4B3X A;  5E33 A;  3H3V K;  3VWB A;  1XGS A;  4FWV A;  2HTS A;  4WXC A;  5L3G A;  2RGV A;  5TIS C;  3WG7 H;  4YK5 A;  5CVV A;  3H9Q A;  1T6Q A;  4JVS A;  1HMD A;  2OBP A;  4XIC A;  1ZRC A;  1IRF A;  3FOP A;  4A3E J;  2B0L A;  2Z2S B;  2G7H A;  3HSF A;  3IAM 2;  5J1R A;  4L0Y B;  2L01 A;  1E17 A;  1RKE A;  3W2V A;  2QKL B;  3DBH B;  1K79 A;  2R7U A;  2QTV A;  3RYP A;  3F8M A;  5KYN A;  5FRN A;  1N75 A;  1W7P A;  4MFE A;  2R0Q C;  1VQK I;  2JVG A;  1SD7 A;  4LG0 A;  2ESN A;  4AYB A;  5K7H A;  4EGZ A;  2PJP A;  3V7O A;  3JRB A;  3QMK A;  1DGW Y;  1BC7 C;  4LIV A;  1XGN A;  2I8B A;  2TRT A;  3CQZ A;  1T0F C;  2QF7 A;  4WAB A;  4EWC A;  2TDX A;  3CDI A;  4MFD A;  2ID3 A;  2P6V A;  1C0W A;  1XWJ A;  4IWB A;  3DTE A;  2Y0S A;  3R7C A;  3S16 J;  1T98 A;  3M4B A;  2H94 A;  4G0H A;  1APC A;  4PJN A;  3RQ4 A;  4EQQ A;  2FGY A;  3QVZ A;  4M74 A;  4BJ5 A;  4C2T A;  2M4E A;  2ZPA A;  1OR3 A;  1YIT I;  4IRU A;  2P7V B;  1S05 A;  2IXO A;  2EIM C;  5ILV A;  3S32 A;  1CPQ A;  1TT0 A;  2YRF A;  2PN6 A;  4QIW N;  4KNY A;  5DQT A;  1ENH A;  4WCG A;  2A3S A;  2CFX A;  4IRH A;  4BDY A;  3J06 A;  4JX4 A;  2ZFW A;  3C2H A;  2QLA A;  3TQO A;  3PUB A;  5FJ8 J;  4KMF A;  2CW8 A;  5HLI A;  2TCT A;  3DCF A;  3GTK J;  3OA1 A;  4ONS A;  5AC4 A;  5AIQ A;  1NU7 D;  3BG6 A;  1VQ8 I;  3HPG A;  5FFX A;  1KYZ A;  3SXM A;  2DW4 A;  2VC1 A;  1BZ4 A;  2WBM A;  1LVK A;  1B68 A;  1DPR A;  1R22 A;  2XGX A;  3EDP A;  2KIU A;  5F6F A;  3R6S A;  1GXP A;  1XSD A;  4HX7 A;  2QQB A;  2PG4 A;  4A6D A;  4N4O B;  4B1R A;  1ZGA A;  3JR9 A;  2QWW A;  4CSA A;  3HOS A;  1S72 I;  2OG2 A;  2XDV A;  1UG2 A;  2VJJ A;  1WWP A;  1T6S A;  4BJT A;  3GWN A;  1B1B A;  1Y0U A;  3DFG A;  2VE8 A;  3JW4 A;  3LFU A;  1MSF C;  4UV8 A;  3CUQ B;  3C8Z A;  3B73 A;  2HPM A;  2P7V A;  4A93 J;  1M2V B;  1T9K A;  1M1E B;  3OYL A;  2WZF A;  3U3F A;  5FCL A;  3U0C A;  4E7H A;  3L2U A;  2R93 J;  2A1D D;  3CJN A;  2PX0 A;  3UGP A;  1J2X A;  1EV7 A;  3E7L A;  2XF5 A;  5IYC J;  1OR7 C;  4QPO A;  4XOT A;  5J40 A;  2H8A A;  3K6G A;  3ASO C;  1QO0 D;  3S9O A;  5IYD J;  2HZD A;  4I1O B;  4LJZ F;  5IOY A;  2G0E A;  3L2C A;  4J7T A;  4YT2 A;  2VT3 A;  3HEF A;  2MLK A;  3FMR A;  3E5Q A;  3KLO A;  4PUS A;  1MDM B;  2EBI A;  5FKO A;  3WTW C;  4RGU A;  1YA9 A;  1WJC A;  3BG7 A;  3AGT A;  3F21 A;  4TV7 A;  4C2M J;  1O57 A;  5CVI A;  3SXY A;  1LI5 A;  1XB4 A;  1WJB A;  3FXK A;  4L9T A;  1XCV A;  5DUK A;  2L02 A;  3TKY A;  4E7J A;  5CI9 A;  1XC5 A;  4ZDP A;  3Q9S A;  1Z7U A;  3OOP A;  3OSF A;  2VBW A;  4DVZ A;  4QTR A;  1JUS A;  1S7A A;  3FVY A;  2Q0O A;  3EGX A;  3D5R C;  2IGN A;  3HB9 A;  3CUQ A;  5EEH A;  4D5C A;  2LY2 A;  1IRG A;  3F47 A;  2HQN A;  1J5Y A;  2RQQ A;  4BG0 A;  1WH5 A;  4P96 A;  1U89 A;  1BIA A;  1A35 A;  3VOD A;  4XQF A;  2VIX A;  4FT8 A;  3NKD A;  2KP6 A;  3SXK A;  4AL1 A;  1OKR A;  1KZH A;  3B29 A;  1HKS A;  4U5C E;  5JT4 A;  5FLV A;  4UVC A;  4AL0 A;  1U0B B;  1R4M B;  3OYB A;  2UZK A;  3BY6 A;  2R7D A;  1D1B A;  1BI0 A;  2J5O A;  4E17 A;  4RM2 A;  3S8P A;  3VSL A;  2EA2 A;  1EQ1 A;  5EF6 A;  2Y75 A;  5C3E J;  1I1G A;  1TNT A;  3V4G A;  4UV9 A;  5BUO A;  1VND A;  1G4U S;  4XPW A;  2LF7 A;  4B8X A;  2KIF A;  1WQ2 A;  1WJF A;  4KIS A;  4K0D A;  5A6B A;  2EIN H;  4YJW A;  5GPA A;  1Z7L A;  2E71 A;  4LGW A;  3JRD A;  1PYV A;  3OV8 A;  5JUA A;  2IM8 A;  5L0F A;  1UHS A;  4ZLD A;  2MH9 A;  4EVI A;  3KZY A;  1ULY A;  5LEJ A;  1H7I A;  5M5X J;  3A02 A;  2VN2 A;  4KT6 A;  1LB2 A;  3JCU Q;  2RC4 A;  3S84 A;  4ZTF A;  3LQR A;  1QZZ A;  4JYK A;  2CV2 A;  3EQL F;  3H1C A;  1XZP A;  3MZY A;  1W7P D;  3LL7 A;  2HZ8 A;  2VKV A;  3CP2 A;  5HLH A;  2NRA C;  1QU3 A;  3DKX A;  1X3W B;  4O6Y A;  3SZP A;  5EEA A;  4QI0 A;  1FBU A;  2QY9 A;  1JHF A;  4XR6 A;  3JRI A;  4X1E A;  1AKH A;  3PO2 J;  1LEB A;  1LI7 A;  2EIJ C;  1YG2 A;  3RVZ A;  3WAQ A;  3PIP F;  2JX0 A;  5LRR A;  4CIC A;  3OYE A;  2XM4 A;  2DOA A;  4I99 C;  1VMA A;  1ODD A;  3ML6 A;  2LK2 A;  4RAG A;  3G73 A;  5E3N A;  1Q0K A;  2H7B A;  3GM3 A;  1RI7 A;  4U7B A;  1DQU A;  2R7X A;  1IXC A;  4HEA J;  4O3M A;  1R4N B;  4Y52 J;  4C7O B;  3BWG A;  3U5S A;  3VEP A;  3ECS A;  2A0U A;  1K7A A;  2WV0 A;  3C18 A;  5EJC A;  2FD5 A;  3DZA A;  4MTO A;  2PMZ N;  5D5V B;  1TWG J;  3CD6 I;  3TO6 A;  5L3C A;  3BR2 A;  1XMA A;  3O10 A;  1YS7 A;  1MMG A;  4PJ0 C;  1DPU A;  4EBJ A;  3EUH A;  1RZ4 A;  3REO A;  2D45 A;  1W5C C;  4XRS G;  4B48 A;  1V55 C;  1R23 A;  1MNE A;  4DYC A;  3ZQC A;  3D5S C;  4BS9 A;  4BJ5 C;  3A0B C;  4OIO F;  4J00 A;  3ERM A;  1D5Y A;  1JKR C;  1H8A C;  3S1M J;  5GPC A;  2CQX A;  2XRH A;  1LIH A;  3EFO B;  5E20 A;  5K5O A;  3G1L A;  1IRZ A;  2JRT A;  4U5H A;  1E2X A;  2X51 A;  1TL8 A;  2AWC A;  4X0R A;  3X2Q C;  1BDJ B;  2DFE A;  2FML A;  4GGG A;  4LOC A;  3ZQ7 A;  5FD5 A;  2M4K A;  3BR5 A;  5DD8 A;  3E6M A;  3HZJ A;  2V3C C;  2L9N A;  5CI8 A;  3LLK A;  3IC7 A;  4CBE A;  5TJJ A;  2JA6 J;  3HNI A;  3GTP J;  2BEO A;  1IN4 A;  1TWH J;  3RKO F;  1QZY A;  1ZEL A;  3NWS A;  2ZXW H;  5D6F A;  3U9J A;  1XSV A;  3TOA A;  2HGC A;  2KLO A;  1VZ0 A;  2YSR A;  4M6X A;  3SEZ A;  1CPR A;  2DK5 A;  2Y0M A;  3TQN A;  2NUT B;  3LST A;  2DFH A;  2NVY J;  5FKM A;  4CSA C;  1YDI A;  3S0X A;  1YIO A;  2ZNZ A;  2KQ9 A;  2L9S A;  3GEZ A;  2D5R B;  2X1E A;  1G3T A;  2ESH A;  2G7U A;  3HIF A;  2KKO A;  3BTJ A;  5LGN A;  4S0H B;  4Y7N J;  2YVK A;  2HMZ A;  1B9N A;  2DYS H;  3BR3 A;  4ASN A;  3FXR A;  3HPH A;  2RD9 A;  3OYG A;  1PV3 A;  1T2K A;  3BQZ A;  2A5W A;  4MVO A;  2CWE A;  3ZMS A;  2LY1 A;  3I58 A;  1PD0 A;  1ZRD A;  2PQ8 A;  3HGY A;  4MVR A;  1ZK8 A;  3U9G A;  4FX0 A;  5F1J A;  1D3Y A;  1QVX A;  3NMJ A;  2K9S A;  4XLH A;  1FTT A;  3S14 J;  1Y6I A;  2ELH A;  1FEX A;  2L6H A;  1EH6 A;  4HOB A;  3BZC A;  4S05 A;  2IS2 A;  1Y8Q B;  5KAI C;  1CF7 B;  4E7S A;  3PO3 J;  2RQP A;  4Z9J A;  1ZAO A;  5DTD A;  5J4V A;  2L3D A;  3PCV A;  3FXU A;  3IEE A;  4CYC B;  2VOD A;  1YS6 A;  4EKW A;  1J59 A;  3BOQ A;  3OIO A;  2YU3 A;  4ZH4 F;  1FFH A;  5BNG A;  5B1A C;  1V4A A;  3LQQ A;  4PK4 A;  1OKK A;  2V9K A;  5LHG A;  3CUQ C;  4XRM A;  5ICE A;  1FP2 A;  3JRH A;  4OD4 A;  4O7G A;  2LQG A;  1V74 B;  3D0S A;  2MFZ A;  3ECH A;  4MTE A;  2YS9 A;  1EH7 A;  1QHG A;  2W4B A;  3N97 A;  3ZQL A;  2PI0 A;  4JJF A;  2K9L A;  2NYX A;  3K4M A;  1F9N A;  4R32 A;  4JK1 X;  3EPV A;  3GTM J;  3KKB A;  3FK6 A;  1T01 A;  1LE4 A;  2WC2 A;  2Z5U A;  3M1C A;  3D5L A;  5E8G A;  1ZG1 A;  1Z3Y A;  2KZG A;  3G2B A;  4M73 A;  2E87 A;  5B1B C;  1Z3I X;  5B3S C;  4FTH A;  1HMO A;  1R00 A;  3IKT A;  3T6J A;  4BKX A;  4CCN A;  3HRS A;  2JSP A;  3G1M A;  5FLX K;  1R6R A;  1WGW A;  1JRA A;  4AC0 A;  3AG3 C;  1DOV A;  2HEO A;  1T6I A;  4CYC A;  3O8G A;  4KN4 X;  1QLE C;  1OCC H;  2EIK H;  2NAZ A;  4GRI A;  2H09 A;  3G4S I;  1MNM C;  2OU6 A;  3W2A A;  2IXM A;  4KIC A;  1WTY A;  1K83 J;  1WH7 A;  2K4B A;  2XPU A;  1SAX A;  2XLH A;  3FXL A;  4II2 A;  2OZU A;  1FPQ A;  2XAF A;  1LE8 B;  3FXM A;  3C2B A;  4NC8 A;  4A0Z A;  2BHY A;  4XID A;  1ZGW A;  2YL0 A;  2DQR A;  1ON1 A;  2M30 A;  1LEA A;  2OJQ A;  1XDS A;  1DGR M;  1LPE A;  1SEU A;  3OR2 C;  3DXJ F;  2HNH A;  4L6R A;  4CYD A;  4U0W A;  1A6Q A;  2XKO A;  5A69 A;  1GUU A;  2H6B A;  2IA0 A;  2WB1 N;  4M9S A;  2MHR A;  5KYX A;  5B5E C;  2M1B A;  3KEO A;  3C3W A;  1AVO B;  3M9A A;  4BY7 J;  1ZHW A;  3WTY C;  1MBJ A;  1STZ A;  2O7O A;  3T1B A;  2V79 A;  5F0H A;  1V54 C;  2Y3D A;  4L9V A;  3FXO A;  2KJB A;  2X9D A;  3IH4 A;  4D0P A;  4BNC A;  4D7M A;  3I4U A;  4LMY A;  2FXA A;  5HNH A;  3TED A;  4HNT A;  1P7J A;  1OYI A;  2R7R A;  1LE8 A;  2IXP A;  1PVE A;  1S9H A;  3MKZ A;  2RVC A;  1Q0D A;  4ESB A;  3MKY B;  3RPQ A;  3ZQH A;  4C9Y A;  1FLI A;  5JHF A;  3EUH C;  1JKO C;  2EA4 A;  4FE7 A;  3CMM A;  3ZVR A;  4BEH B;  2F4O B;  2LYC A;  4M9X A;  1F5T A;  1FR0 A;  3OYA A;  3RTR A;  1ORK A;  3EGD B;  1OCR H;  4E7I A;  1G3Y A;  2ZJP F;  1Y39 A;  4XLP F;  4XTK A;  3IV5 A;  3ZG1 A;  1AOY A;  1BJA A;  3GTQ J;  2J45 A;  2JPB A;  3S15 J;  3U3B A;  3G3Z A;  3GX4 X;  3HRT A;  4RA2 A;  4UUV A;  4LD5 A;  2F5F A;  1OCZ H;  1Z7Q c;  5JLX A;  1I4Y A;  2M8G X;  3K1M A;  3E6D A;  4A2U A;  2HDD A;  2GIV A;  3L1P A;  2HKO A;  5HOD A;  1PUF A;  1D1C A;  4CHU A;  3OWT A;  3HC7 A;  4G12 A;  1GHC A;  4XLC A;  2J0X A;  1MZB A;  2XLE A;  3IH3 A;  3V8K A;  1RET A;  4IJA A;  3I0T A;  4IX7 A;  2LK4 A;  1UG0 A;  2H1K A;  3VYT B;  2GAQ A;  3U1K A;  2W7N A;  3VYW A;  4RGS A;  2FNA A;  2LNB A;  3B6C A;  4I02 A;  2JMW A;  2VBX A;  5DCF A;  2MH2 A;  2NUP A;  3L1M A;  5K0I A;  4BEH A;  3SDB A;  1ZTR A;  2EPK X;  3U2M A;  1OCO H;  2PBI A;  3RSN A;  2V26 A;  2DDB A;  1PDN C;  2NVT J;  3S28 A;  1X1D A;  2KT0 A;  4M3E A;  1TZL A;  1ZR2 A;  1PP7 U;  4ZDO A;  5BQG A;  3FDQ A;  3ZXS A;  2WAQ N;  3HNJ A;  3R61 A;  2E5Z A;  3K33 A;  2LVS A;  2A6T A;  3OS0 A;  3BZK A;  4DXW A;  3O6X A;  2CRG A;  2X0C A;  5D8K B;  1R1U A;  1K61 A;  4IGG A;  3KCC A;  1O3U A;  3FIW A;  1Z5Z A;  1FAP B;  3T8R A;  1BW5 A;  1FYL A;  2Q2E B;  4RGX A;  1D0X A;  2GBY A;  5EGO A;  2FFH A;  4JC7 A;  2DXI A;  2D1H A;  2KK1 A;  3E9V A;  1RR8 C;  2DU9 A;  4AIH A;  2VI6 A;  4WXD A;  4XSZ F;  2W85 A;  3OSG A;  3K1H A;  2A5Y B;  3BJA A;  2XSJ C;  4G6Q A;  2R02 A;  3JRM O;  3T9O A;  4M3B A;  5JR3 A;  4YL0 A;  3FM5 A;  1ONV A;  3CF2 A;  3CC2 I;  1RJ9 B;  2LKX A;  3ZR8 X;  3H35 A;  4JP0 A;  5HLT A;  4DIQ A;  4IAR A;  3WU2 C;  3AG2 C;  2W25 A;  1BBH A;  1JI8 A;  4U88 A;  1YAU O;  2D5V A;  1B9M A;  1UEL B;  1HC8 A;  4O6J A;  3S3M A;  5GAE J;  5D8L B;  2FOK A;  4CCL A;  2Q00 A;  4PGH A;  2NS0 A;  3PQJ A;  3R2P A;  4N06 A;  4G94 A;  2DLL A;  3SFZ A;  4W8P A;  2JPC A;  2XSE A;  1FX7 A;  4HEA 2;  1KON A;  4R8H A;  4E6K G;  2OJE D;  4BGD A;  3PMR A;  3MYI A;  5K5R A;  3VYU B;  3Q0V A;  4A3J J;  1I1S A;  4DOZ A;  2VB6 A;  2W9Y A;  1KU9 A;  3S3N A;  3BP8 A;  2ETS A;  2Q2E A;  5F0C A;  1ON2 A;  4Z9I A;  1TWC J;  1MJA A;  1WJ5 A;  2E1O A;  2EV5 A;  2DOF A;  2XAH A;  2YL1 A;  4BEM J;  1RR7 A;  3AG4 C;  4D4X A;  1RIO H;  4ESF A;  1GVD A;  5L3B A;  1QBJ A;  4NY3 A;  3X1O A;  3DD7 A;  1X58 A;  2DMQ A;  3I59 B;  4HSR A;  2HYJ A;  2XGD A;  5HDK A;  3T4R A;  3LSI A;  5DCM A;  1FSH A;  5HS9 A;  1RJ9 A;  2R7T A;  4G6T B;  4Q7C A;  4IJJ A;  3WG7 C;  4OAZ A;  2EPF A;  1ETW A;  3I54 A;  3L00 A;  2FMY A;  2R92 J;  4E0H A;  5HS8 A;  2E7X A;  4G6D A;  1IV8 A;  1VQO I;  1X4O A;  4N4N B;  4YT5 A;  4CIH A;  2IAI A;  1OYY A;  2EJR A;  2RSE B;  5F5F A;  3K4B A;  3DMD A;  4XLF A;  2KIM A;  3OR1 C;  2JJ7 A;  3NWT A;  4EM0 B;  1NG1 A;  2UXN A;  2Q9B A;  5TJ5 E;  4AVZ A;  2UUI A;  3M07 A;  5BQH A;  2F2E A;  2EV6 A;  1YI2 I;  1V5F A;  5BPD A;  3I5Q A;  3M15 A;  3EET A;  3DPT A;  5BMZ A;  2VBZ A;  4G9Y A;  1HE9 A;  3HRU A;  3ZIB A;  2M5W A;  1HCR A;  3C8G A;  3RKQ A;  2E7W A;  2VCB A;  3QQA A;  4FQG A;  2M3A A;  4UB8 C;  3LAP A;  3HTK C;  3P7N A;  2HSQ A;  3IL2 A;  5DS4 A;  2VXZ A;  4XM3 A;  4NC7 A;  1ZYR F;  2NVX J;  4J32 B;  1Y56 A;  2PMU A;  1LNW A;  5KVR A;  3I71 A;  3I4M J;  2EH3 A;  1VFC A;  2N8G A;  1ZG5 A;  5ICG A;  1B4A A;  1BC8 C;  3DV8 A;  2LC2 A;  4KIT B;  1K6Y A;  1Y1V J;  1VB5 A;  3CO6 C;  1YO5 C;  1GS9 A;  2OA4 A;  1KTM A;  3MBG A;  3NDB B;  1L3P A;  5D4S A;  4FES A;  3QPT A;  4BAY A;  4HPQ A;  1FT9 A;  1ZLJ A;  4U9E A;  4WJ0 A;  3NRH A;  4M3F A;  1ZLK A;  1WZ2 A;  3CCU I;  4ENK A;  3RW0 A;  1S6L A;  4OAY A;  1BBY A;  1NTC A;  5ED4 A;  4X0G A;  3DM5 A;  1NG6 A;  1O3T A;  2WB1 A;  4R79 A;  2L2O A;  3ULQ B;  3OYI A;  3F23 A;  1N77 A;  2LCH A;  3BTL A;  2KIS A;  3HHG A;  3DLA A;  1UZC A;  4ZZD A;  2HKV A;  1S29 A;  1XX5 A;  1TTY A;  1TWG A;  1JXS A;  1RXQ A;  1MD0 A;  3OYM A;  4I7H A;  3C63 A;  3KYI A;  1EJ9 A;  2CGE A;  3A0H C;  4P1W A;  1JUM A;  4V19 K;  1IV6 A;  3S27 A;  5A2Q Z;  1G4D A;  2Z3Y A;  4K1O A;  2GXG A;  1MMS A;  2BE5 F;  5DVW A;  2D4U A;  2GWR A;  4LG0 B;  2K27 A;  2L6F A;  1MQV A;  5FD6 A;  2E1N A;  2C04 A;  1KQ0 A;  2AXL A;  4ESJ A;  1MJ9 A;  3JT1 A;  1BW6 A;  3J81 Z;  3LLI A;  1TKN A;  4EBK A;  4HDV A;  2X85 A;  1BI3 A;  2KNH A;  1SMT A;  3IUO A;  5ERI A;  4HF0 A;  2FX0 A;  2K02 A;  2GQQ A;  4XL9 A;  4K2E A;  5IYB J;  2YKZ A;  3CCV I;  4JTD B;  2LOO A;  1T56 A;  3GW2 A;  2WB7 A;  4MS2 A;  2GWW A;  2MSY A;  1UCR A;  4KJZ A;  1VLS A;  4HQE A;  2H8R A;  4NTB A;  4XWJ A;  2XLO A;  2FA5 A;  1PP8 F;  3DJN B;  1XTA A;  2O9L A;  2YLG A;  4M3G A;  1P4W A;  1YAR O;  5DS6 A;  1XSX A;  1TWH A;  2EFN A;  4HF2 A;  5E3O A;  3WTV C;  1O87 A;  3L2R A;  4LLN A;  2B7E A;  4B47 A;  3US6 A;  5DLJ A;  3H2V A;  4EBB A;  5B66 C;  1LDD A;  1P92 A;  4LK1 F;  5L0H A;  1YLF A;  1NLX A;  4I1M A;  2KHM A;  1X1A A;  2FOW A; 
#chains in the Genus database with same CATH homology
 2Y69 C;  3LL7 A;  4P5O A;  4DJA A;  3CP2 A;  1QU3 A;  4HE8 D;  3DKX A;  4BXF A;  2LRD A;  3B0U X;  4AU7 A;  4O6Y A;  4GYT A;  4LIU A;  3OIQ A;  4OWR B;  2UV1 A;  3M8J A;  3HJC A;  2QY9 A;  4JZA A;  4XR6 A;  4BU2 A;  4F52 A;  2EIJ C;  4C3E A;  3DKY A;  3W3C A;  1G8X A;  4BE1 A;  1IZM A;  3NYL A;  1MMD A;  5E3A A;  4XNF A;  3OYE A;  3AQB A;  2K9M A;  2W82 A;  5TGT A;  2DOA A;  1VMA A;  4J01 A;  5D92 A;  2H7B A;  3ABM C;  3QYE A;  4U7B A;  1MND A;  1YE9 A;  2EIN C;  3Q6N A;  1DQU A;  3DTI A;  2R7X A;  3A2K A;  4HEA J;  4PFO A;  4C7O B;  3EHM A;  3ECS A;  3LNR A;  4FAS D;  4BAC A;  4RDA A;  4YEJ A;  3N2Z B;  2VKD A;  3DZA A;  3NYJ A;  4XOR A;  4DGW B;  2J9V A;  2K3P A;  5KYU A;  3PHF 2;  4Y33 A;  2X6W A;  2Z15 A;  2KPM A;  1YX5 A;  3N05 A;  1MMG A;  2CV0 A;  1NG7 A;  4YT4 A;  1AA7 A;  4E7L A;  5CQG A;  2CMP A;  4B48 A;  2IS4 A;  1V55 C;  1VOM A;  1MNE A;  2V7F A;  3BLY A;  3D5S C;  2B0J A;  4BS9 A;  3Q7L A;  4BJ5 C;  3S93 A;  4J00 A;  4OIO F;  2YHS A;  3DTK A;  2XRH A;  4Y4R A;  5CKT A;  3AKZ A;  1Z23 A;  3EFO B;  3AG1 C;  5CPR B;  2MYS A;  2JA2 A;  3LSK A;  1ST6 A;  3BC8 A;  4NUB A;  2PJR B;  2X51 A;  1G59 A;  2ZXR A;  5L3V A;  4X0R A;  2E60 A;  2VJ5 A;  3OL4 A;  3ONQ A;  4II3 A;  3KL4 A;  4U5D E;  3X2Q C;  1LFP A;  4OIN F;  4OIP F;  3LES A;  4XOP A;  2IGM A;  3DPL C;  3IAS 2;  4H4K C;  2M4K A;  1WJA A;  1MW7 A;  2JUG A;  3K4N A;  1ZHX A;  2DGJ A;  1OLT A;  3H5A A;  4FET A;  2GFH A;  3EGX B;  2MAB A;  3UMH A;  2W00 A;  2J7P D;  2V3C C;  2L9N A;  1W2W A;  5CI8 A;  3LLK A;  4CBE A;  4LLC A;  3OS2 A;  1IRX A;  3RKO F;  1ZEL A;  3NWS A;  2C03 A;  4JQF A;  3H9G A;  4XKV A;  2KLO A;  1VZ0 A;  2Q9C A;  4JW1 A;  3SEZ A;  2VXD A;  1J8Y F;  5F5H A;  2DCE A;  3SP1 A;  3OYF A;  3MX3 A;  2NUT B;  2YZS A;  2J0W A;  2W4M A;  4CSA C;  4HST A;  3S0X A;  4O79 A;  1D1A A;  2LSE A;  2BW3 B;  2MC4 A;  2Z1D A;  3OMY A;  2KQ9 A;  1SFK A;  2L9S A;  2Y3H A;  4AK9 A;  3H5R A;  2X1E A;  2D5R B;  1V5E A;  3WOD F;  2L5Q A;  3JRT A;  3UGO A;  3QYB A;  4NQW B;  2WVO A;  3EH2 A;  3KYL A;  3QOE A;  5FCL A;  3C2G A;  2WAE A;  3HPH A;  4XKW A;  2PJR A;  3OYG A;  2CV1 A;  2F6C A;  5FRO A;  2L7K A;  2A5W A;  2BVL A;  4PFP A;  2LY1 A;  2Y3B A;  1PD0 A;  3IP4 B;  3L2V A;  2AQF A;  3LSG A;  1KU2 A;  4YWQ A;  3HG9 A;  4ULW A;  4YT8 A;  4K7B A;  3AQC A;  4HFK B;  2XL4 A;  2R7Q A;  2A6E F;  3HLZ A;  4IAO A;  3OYH A;  2YEV A;  3UMI A;  4XLH A;  3OYC A;  1E0E A;  3RIP A;  1FMV A;  1Y6I A;  3QYF A;  2HVR A;  4LER A;  3K4J A;  1HA8 A;  2R4G A;  3EGD A;  3F46 A;  1LS1 A;  3EPZ A;  2IS2 A;  1D0Z A;  4C3B A;  4E7S A;  1FMW A;  1T95 A;  4F3Q A;  2VQL A;  3FHN A;  3IEE A;  4CSW A;  4F4B A;  3GBG A;  1W36 D;  3FKJ A;  3CSK A;  4M63 A;  2AQE A;  3JSZ A;  1FFH A;  5B1A C;  5KHD A;  4XLA A;  3AL0 B;  3NG1 A;  2P0W A;  2Z16 A;  4PK4 A;  4F91 B;  1OKK A;  2V9K A;  2DYS C;  3RFY A;  4CS8 A;  4BE2 A;  3TMO A;  3MLG A;  3LAY A;  4OD4 A;  4O7G A;  2ZFU A;  2LRE A;  4U87 A;  3DAF A;  2CFO A;  4A2N B;  2MFZ A;  3LMM A;  4PJM A;  5CQE A;  3E0J B;  4ANJ A;  4OIQ F;  1QHG A;  2W4B A;  5D91 A;  4AX2 A;  4JJF A;  2K9L A;  3K4M A;  4E7K A;  2V1N A;  2DT6 A;  2OC6 A;  4DBQ A;  3DAG A;  3EPV A;  4D1Q A;  5LD2 C;  3KKB A;  2WZL A;  2RRE A;  3F9K A;  4RM3 A;  2CUZ A;  1W36 C;  5T3W A;  3M1C A;  3D5L A;  2CW0 F;  1Z3Y A;  3G2B A;  2E87 A;  4KBL A;  5B1B C;  5B3S C;  1Z3I X;  1V5G A;  5KYW A;  4RLQ A;  3L0I A;  4MQ9 F;  3T6J A;  1PJR A;  4RLF A;  2ZXH A;  2PX3 A;  4PSW A;  4CCN A;  4W8K A;  4IZZ A;  2CNW A;  4QDL A;  3ZCO A;  3K70 D;  2JSP A;  3FDY A;  4I44 A;  4U5E E;  3Q7G A;  1R6R A;  1WGW A;  3I5P A;  5T1D B;  2W1O A;  3AG3 C;  2PP4 A;  4IQJ A;  3SYT A;  4XN3 A;  1QZX A;  2KJG A;  3DEE A;  3CZ6 A;  3AFH A;  1QLE C;  2PF4 E;  4GRI A;  4HRI A;  4ZC3 A;  2WAQ A;  4BQO A;  4ZLC A;  3W2A A;  4G7O F;  2IXM A;  3LSM A;  2HPI A;  2M7A A;  3LSH A;  3PNY A;  2HDW A;  4II2 A;  3OS1 A;  3OY9 A;  3K6B A;  2GOM A;  5LFA A;  4DVY P;  4NC8 A;  5EHH A;  5EGY A;  3RCO A;  2Y3G A;  2ZXP A;  1ZHT A;  3K70 C;  3OIP A;  2F4I A;  2XC7 A;  4AE4 B;  1MMA A;  1DGR M;  2QKM B;  3OL3 A;  3RPU D;  1J09 A;  3CJQ B;  3OR2 C;  3DM9 B;  1Z63 A;  2HVQ A;  3DXJ F;  2HNH A;  3RH3 A;  2ZSI B;  2IS6 A;  2CH0 A;  3BCB A;  4LG3 A;  3HOT A;  2E1M B;  1D0Y A;  4XN0 A;  4F93 B;  2Q9A A;  2W4S A;  2E5N A;  3GOD A;  2VKH A;  2H7O A;  5KYX A;  2I8D A;  4MND A;  2EIL C;  2BVM A;  4CS9 A;  2KGO A;  1M57 C;  2J9W A;  2WAF A;  3B0P A;  1PCX A;  1ZHW A;  3LS0 A;  2WA0 A;  1ERD A;  3BCA A;  3ABL C;  4KNV A;  2W45 A;  4YEL A;  1V54 C;  2Y3D A;  3JYH A;  3PNV A;  4NNJ A;  1IW7 F;  3I4U A;  4JJG A;  3DJU B;  4CUG A;  1S7Z A;  5HNH A;  2DJI A;  4Y3O A;  4HNT A;  2RNG A;  3PJR A;  2R7R A;  5HNF A;  3TBI A;  1S9H A;  4PJL A;  2IXP A;  2X1D A;  3MKZ A;  3NYM A;  4XON A;  3MKY B;  4DVZ A;  4C9Y A;  1ZU4 A;  5JHF A;  3EUK L;  3EUH C;  2KRC A;  2M0M A;  1Z6A A;  2HV7 A;  3UMK A;  3KH2 A;  1N78 A;  4BJ6 A;  3CMM A;  3ZVR A;  4BEH B;  2LYC A;  2ZSH B;  4O6M A;  4RD9 A;  3OYA A;  3RTR A;  4AE4 A;  3OEO A;  1U0J A;  3EGD B;  4E7I A;  3SZR A;  4CCM A;  4XLP F;  4XTK A;  3ZC4 A;  2CS3 A;  3K4K A;  3ZG1 A;  2LBF A;  1SF8 A;  2J45 A;  2O9X A;  4XLE A;  2XXA A;  1WFX A;  4LIT A;  4E7Z A;  2HQA A;  4B43 A;  4CCJ A;  3PSI A;  2R7V A;  4QI2 A;  3OYD A;  3TD7 A;  2XF6 A;  4C3D A;  2IXN A;  3VYS B;  3S3O A;  2A69 F;  2A68 F;  3V42 A;  2J7P A;  2G3V A;  4KI2 A;  1P9Q C;  4ZDL A;  2KW3 C;  1TWC A;  3Q6M A;  3QZC A;  4U5G A;  5KYY A;  2VPL A;  2CUJ A;  5E3C A;  4JOM A;  4KNW A;  2OV7 A;  3K10 A;  4I3M A;  3ZGK A;  4QPQ A;  4RBN A;  2IYL D;  1D1C A;  3W8I A;  4QI0 A;  5L3Q A;  3OWT A;  3HC7 A;  2J0X A;  1WJD A;  4XLC A;  2VQH A;  4RMN A;  2KDO A;  3U21 A;  5HVQ C;  2J46 A;  4BE0 A;  2HU9 A;  1X4P A;  1MMN A;  1UG0 A;  2IGO A;  4IX7 A;  4LAC B;  3VYT B;  4BL0 B;  2W7N A;  3VYW A;  2MWQ A;  2R7S A;  2NUP A;  3M1C B;  2KRH A;  1NZE A;  3NKE A;  5HSW A;  2ZXW C;  4OIR F;  2O5R A;  3VSK A;  4BEH A;  1OCR C;  3SDB A;  3OOU A;  4E4H A;  5FRM A;  2PFD A;  5KYW B;  4BQN A;  2VJI A;  1LKX A;  3RSN A;  2V26 A;  3LJB A;  4C2U A;  5E2Q A;  3S28 A;  4J30 B;  1X1D A;  2K5C A;  4U5B E;  4ZDO A;  4CCK A;  1TZL A;  2CDQ A;  1GLN A;  3FDQ A;  3ZXS A;  3UR3 C;  3K1I C;  2XAU A;  2E5Z A;  3K33 A;  3SYN A;  3J7A Y;  2A6T A;  3OS0 A;  1SMY F;  1ZHY A;  3O6X A;  4KC9 A;  2KZV A;  2DYR C;  3ASN C;  1BR2 A;  3K7D A;  4CA0 A;  3OYJ A;  2A6H F;  4JUR I;  2WY7 Q;  1Z5Z A;  4O6N A;  2KMU A;  1M2V A;  4ZJZ A;  3SEQ A;  2Q2E B;  4HFF B;  1D0X A;  2FFH A;  4XKC A;  2UUZ A;  2DXI A;  1UAA A;  2M4G A;  4HG2 A;  2FUG 2;  3I9V 2;  3H0D A;  3E9V A;  3LEV A;  2X6X A;  3ZRG A;  3EZH A;  3KMI A;  4P6I C;  3S29 A;  1WJE A;  3L2W A;  2V4J C;  3PFY A;  3K1H A;  3I3L A;  3HXL A;  3PL8 A;  2XSJ C;  1VYK A;  3PNT A;  4HNU A;  5IY5 C;  2UWM A;  3L34 A;  3FBN B;  3CF2 A;  4PJJ A;  1RJ9 B;  3ZR8 X;  3H35 A;  5HLT A;  4FX5 A;  4DIQ A;  2BOL A;  4B3X A;  5E33 A;  5DQZ A;  2GOX B;  3A1Y A;  3VWB A;  3AG2 C;  2X6Y A;  4FWV A;  2VJ4 A;  1JI8 A;  5KYX B;  1UEL B;  3S3M A;  3H9Q A;  3H5N A;  2CNW D;  4CS8 C;  2V6E A;  4CCL A;  2MD0 A;  4JVS A;  4N06 A;  4U5H A;  3POV A;  3DPU A;  2XSE A;  2Z2S B;  3IAM 2;  3MMY B;  1KON A;  4HEA 2;  3HL2 A;  4E6K G;  4BGD A;  3W2V A;  2QKL B;  2G62 A;  3PMR A;  2R7W A;  2R7U A;  3CJR B;  4IQ4 A;  3VYU B;  3FBI B;  2QTV A;  4B6I A;  4DOZ A;  2VB6 A;  5FRN A;  1N75 A;  2W9Y A;  5KYN A;  3S3N A;  1BR4 A;  3E70 C;  1X1B A;  3K4C A;  1SZI A;  2JVG A;  4AYB A;  3V7O A;  1WJ5 A;  2L9J A;  3QMK A;  1DGW Y;  3AG4 C;  4LIV A;  3LS1 A;  3MKW B;  2I8B A;  2WY8 Q;  3CQZ A;  4NY3 A;  1T0F C;  3X1O A;  4EWC A;  1X1C A;  2IGK A;  3DD7 A;  4HSR A;  2M7B A;  3HUG B;  2P6V A;  4YN0 B;  3EUA A;  4IWB A;  3DTE A;  2WZG A;  3LSI A;  2Y0S A;  3T4R A;  1RJ9 A;  2R7T A;  4G6T B;  4Q7C A;  2LBF B;  3VYR B;  4LLE A;  4IJJ A;  3WG7 C;  4OAZ A;  3N24 A;  2HVS A;  2XXA B;  4G0H A;  3AL0 C;  4BJ5 A;  4PJN A;  2VQC A;  3RQ4 A;  2FGY A;  2Y39 A;  4C2T A;  2H7V C;  2M4E A;  1OCC C;  2ZPA A;  1X4O A;  3CP8 A;  4N4N B;  2EIK C;  4GEH A;  3W8H A;  2KL4 A;  5KYY B;  4IRU A;  5HOO A;  4YT5 A;  2IXO A;  4CIH A;  3QOD A;  2CW7 A;  4PSX A;  3W2W A;  2EIM C;  3S32 A;  3EH1 A;  5F5F A;  3K4B A;  2WL8 A;  4CS7 A;  3DMD A;  2VAS A;  1TT0 A;  4XLF A;  3H65 A;  3OR1 C;  2F5V A;  5DQT A;  3NWT A;  1NG1 A;  2Q9B A;  4JCH A;  4AVZ A;  2KQR A;  4BDY A;  1ZHZ A;  3C2H A;  3KX2 A;  4CZC A;  3PUB A;  1V5F A;  3I5Q A;  2CW8 A;  4EAT A;  1J8M F;  5T3T A;  3DPT A;  3B0V C;  5KCM A;  3ZIB A;  2NUP B;  3MD2 A;  2JD3 A;  3OA1 A;  2VQG A;  2DT7 B;  3VAY A;  1NU7 D;  3BG6 A;  3HPG A;  3B9Q A;  1VK5 A;  4CS9 C;  2M3A A;  3E1S A;  3HKZ A;  4F55 A;  1PD1 A;  2G3K A;  3HTK C;  4ZTJ A;  2WBM A;  1LVK A;  2IOQ A;  5DS4 A;  3EJN A;  3EZI A;  3T6B A;  2VXZ A;  3CES A;  4NC7 A;  4XM3 A;  2ZXI A;  1ZYR F;  1Y56 A;  4J32 B;  4N4O B;  4CSA A;  3HOS A;  2OG2 A;  4XKB A;  3FAJ A;  2XDV A;  4Q5S F;  2VJJ A;  2LC2 A;  4BJT A;  4KIT B;  1K6Y A;  2Q3T A;  3LFU A;  3DWL E;  3ZQQ A;  4C7O A;  4ZYA A;  4CCO A;  4G7H F;  2HPM A;  2JVH A;  2OUM A;  2P7V A;  1M2V B;  4CH7 A;  4BJ6 C;  3OYL A;  2WZF A;  4XMY A;  3NDB B;  2WVQ A;  3H9J A;  4E7H A;  3L2U A;  2A1D D;  4FES A;  3VDX A;  2PX0 A;  3UGP A;  4HPQ A;  1M56 C;  4YRV A;  2XF5 A;  4WJ0 A;  1OR7 C;  4QPO A;  4XOT A;  2PMZ A;  3ASO C;  3K6G A;  3K4L A;  3NRH A;  2HZD A;  4I1O B;  4BEJ A;  4YT2 A;  3ZSU A;  1BOB A;  2E1M C;  4F92 B;  3EG9 B;  4BUP A;  2ZXO A;  4OAY A;  4PUS A;  3O39 A;  4X0G A;  3DM5 A;  1NG6 A;  2VLA A;  1WJC A;  2WB1 A;  3BG7 A;  2L2O A;  2XF7 A;  3DQV C;  4MLO A;  4R79 A;  3A4C A;  3OYI A;  4BDZ A;  1N77 A;  2R7O A;  3DLA A;  3EFO A;  3ITF A;  4XLN F;  2VH3 A;  4Q4Z F;  1WJB A;  2ELJ A;  2Q1Z B;  5CI9 A;  1TWG A;  4E7J A;  3DU5 A;  4ITV A;  4ZDP A;  5KNL A;  2LH9 A;  2X1C A;  3OYM A;  2IS1 A;  1FFT C;  2J9U A;  4U5F E;  1OCZ C;  4G7Z F;  3RYL A;  1LDK B;  2NOJ B;  1N1C A;  4P1W A;  3OYK A;  1TWA A;  1FTS A;  1DP3 A;  2CGE A;  1VYI A;  3EGX A;  3FVY A;  3K66 A;  3D5R C;  2IGN A;  1YX3 A;  3F47 A;  3S27 A;  2LY2 A;  1OKK D;  1M2O A;  2BE5 F;  3EHN A;  5DVW A;  1QHH D;  2RQQ A;  4BG0 A;  3NKD A;  4XQF A;  2VIX A;  2KP6 A;  3JT1 A;  2C04 A;  3LLI A;  2WVN A;  2VL8 A;  1EA3 A;  4DBR A;  1TKN A;  3DU6 A;  3PSF A;  4U5C E;  3N0T A;  2X85 A;  3GAN A;  3OYB A;  4B44 A;  5DS5 A;  2KNH A;  2NUT A;  1D1B A;  3IUO A;  3SZG A;  4XL9 A;  1OCO C;  1TR2 A;  3EG9 A;  4RM2 A;  3S8P A;  3OYN A;  2OCC C;  2BW3 A;  3TL4 X;  3VSL A;  2HV6 A;  2LOO A;  3KEY A;  4C30 A;  2WB7 A;  4KJZ A;  4XWJ A;  4D9J A;  5BUO A;  4KIS A;  1WJF A;  4OD5 A;  3DJN B;  1NU9 C;  4K0D A;  1JPJ A;  1BR1 A;  4YJW A;  5DS6 A;  1Z7L A;  1X19 A;  1TWH A;  1ZU5 A;  1PYV A;  3FHD A;  3SNH A;  3ABK C;  4BQQ A;  1O87 A;  3L2R A;  2IXS A;  4ZLD A;  2WAD A;  1Z3X A;  1O5H A;  4BJ1 A;  4KT6 A;  2L81 A;  1Z21 A;  4B47 A;  5DLJ A;  4EBB A;  3JCU Q;  4IKF A;  4ZTF A;  3L2Q A;  5KYU B;  3SEO A;  2LG4 A;  2NG1 A;  2CV2 A;  3UNG C;  4I1M A;  2KHM A;  1X1A A;  3EQL F;  1SAU A;  1JPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...