1M6TA

Crystal structure of b562ril, a redesigned four helix bundle
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Redesign of a Four-Helix Bundle Protein by Phage Display Coupled with Proteolysis and Structural Characterization by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1m6tA00
1YZAA 2BC5A 2YL1A 2XLOA 3U8PA 3M4CA 3NMJA 1E86A 4ER9A 3TOMA 3M15A 3HNKA 1BBHA 2QLAA 1LM3B 2J8WA 2XLHA 1QPUA 1CGOA 3C62A 1MQVA 4U9EA 4CX9A 3NMKA 1E85A 1YYXA 1E83A 3FOPA 1YYJA 3HNLA 2XM4A 1CGNA 2YL7A 2YL0A 2CCYA 4EIYA 3ZTMA 2XLWA 4JEBA 4D4NA 1APCA 3DE8A 5AGFA 5JUAA 3QVZA 4D4XA 3TOLA 2YLGA 4JEAA 3ZWIA 2YL3A 256BA 4N4WA 4L6RA 5JRAA 3QW1A 5JS5A 2XL6A 3IQ5A 4CIPA 2XM0A 3DE9A 1E84A 1YZCA 4CDYA 4IAQA 3VRCA 4JE9A 1GQAA 1NBBA 5B3IA 2YLIA 4NC3A 1RCPA 3QW0A 2XLMA 1EKYA 2XLEA 2YKZA 2XLDA 5JT4A 3ZQVA 2XL8A 3IQ6A 5JVEA 1M6TA 1CPRA 4JKVA 4CJOA 1CPQA 3ZQYA 4U9DA 4CDVA 1JAFA 3HNIA 4N6HA 2YLDA 5JLIA 4WGZA 1QQ3A 3HNJA 1S05A 4ULVA 4CJGA 5JSLA 3M79A 3QVYA 4CDAA 3FOOA 3NMIA 2XLVA 1A7VA 5JP7A 4WGYA 3M4BA 3C63A 3L1MA 2J9BA 4IB4A 3ZTZA 4IARA
chains in the Genus database with same CATH superfamily
1JOGA 1HW1A 3U5SA 4EBBA 5KYNA 4MW3A 2IYLD 3BRJA 4MVSA 5A6AA 4HFFB 3DM5A 1PCXA 3TJ6A 3HKKA 3DAFA 3NRHA 1Z7Qc 2XLOA 1LE2A 2EPOA 3EJNA 3R7CA 3M4CA 1V4AA 2YHSA 1O5HA 4OIOF 5DVWA 2JPUA 2Y3DA 1PD0A 2VC9A 3U8VA 4MTOA 4DJ9A 4ER9A 2V3CC 2EPMX 1CGME 3TOMA 4J7TA 1HE9A 3FAJA 4OIQF 1OW8A 3U2MA 5L0FA 1OW6A 2OQMA 4FESA 4PFOA 2DGJA 1U0BB 2AP3A 2J8WA 5L3QA 1O87A 4AL1A 2HMZA 1A41A 2J9VA 3C62A 3S27A 4EUKB 4U9EA 4A4AA 3NMKA 4O7GA 2W45A 3X1OA 3FVYA 1YYJA 5HSWA 1Z63A 1EI7A 1NZEA 1VLTA 3F47A 1SZIA 4FX5A 2WVOA 4K0DA 4Z9HA 3WG7C 1CGNA 2PNOA 3MYFA 1WOLA 2CCYA 2IXMA 2ZXRA 3TULA 1KNYA 2YWAA 2R25A 1W2WA 4MNDA 2XLWA 4JEBA 3U0CA 1TWCA 3RVYA 4K7BA 3Q7GA 4I44A 4PJLA 3QVZA 3EH1A 1RKEA 4PJNA 3TOLA 1KU2A 3EG9B 1ZU5A 3VYWA 2W4BA 2Q3TA 5KYXA 1K40A 4PR9A 4LDQA 2R9RB 3A11A 3RVZA 3SEOA 4K1OA 1T9KA 3ZSUA 3C8GA 4N4WA 4L6RA 2Q9CA 2Y3GA 4KNVA 1BZ4A 2XS1A 3JCUQ 5T3WA 3UGPA 1Z6AA 1Z3IX 3LS1A 4MVOA 4Z9IA 1H9TA 4Z9JA 3ZIBA 5EK0A 1NG1A 1OXKA 2FFHA 2WZLA 2OJQA 3LS0A 4YJWA 5D91A 5B1AC 2L6GA 3U2LA 5E2QA 3UMIA 4CSAC 3G4ZA 1ZHTA 2XM0A 4LACB 3ABKC 3N2ZB 2GAQA 3W4YA 3K1IA 2G3KA 2H7OA 3E9VA 3RF3A 3S28A 3DI5A 2ETSA 3AG1C 2KJGA 3L8JA 3CAXA 4P6IC 4MQ9F 2R7UA 1BDJB 1OKKD 2HZ8A 3EGXA 4JTAB 3TK0A 3B0PA 4E7ZA 5KYWB 1VYKA 3S9OA 4C3BA 1Y4CA 3QW0A 4HFKB 3DM9B 2J7PD 3DMDA 3WHNA 3IEEA 1M2VB 1VB5A 1EKYA 2GFHA 2EINC 5COFA 3NG1A 3US6A 4AL0A 5DS6A 4DVZA 2R7TA 3B9QA 1QLEC 1VMAA 4LDRA 1OCCC 4H4KC 1V55C 4Q4ZF 3NYLA 3H2VA 2KGOA 4CS9C 2G3VA 2HSQA 1FTSA 2I8BA 3GM1A 2HFIA 4XLPF 2Q9AA 4MVZA 5CI9A 2F22A 2VH3A 4JKVA 4CJOA 1MMNA 4I3MA 3CQZA 2ZD9A 3Q6MA 4XWJA 1WASA 5L0HA 1T5OA 5KYYA 1OR3A 3V5XA 3S90A 2YLDA 3DKAA 4RDAA 3CSKA 4U9DA 2KSFA 3NYJA 4G7HF 2AWYA 3E70C 4CJGA 3GM3A 2KQ9A 1RXQA 4BJTA 3M79A 4MVUA 3K1HA 4CDAA 5A6JA 3B0UX 3LEVA 1WATA 1A7DA 2ZXWC 1NU7D 3JRMO 1LIHA 3OEOA 3RQEA 3V7OA 3PDMP 3V5ZA 1E2XA 2IXOA 2DYRC 4IGGA 2OU6A 4CS8A 2J9BA 1SMYF 2I15A 1XZQA 2O9XA 4IB4A 4DOZA 4YWQA 1I5NA 1VOMA 3IQTA 3QMKA 2EIMC 1M57C 1YZAA 1ZHZA 1ZW3A 2BC5A 2J7PA 4WABA 3VF0A 2GA0A 2XS8A 1TFOB 2ICWG 3NMJA 4MTFA 4E0IA 2B0JA 1T6QA 3LNMB 1B68A 2LCHA 3OA1A 4N6CA 1SF8A 4N06A 3K66A 1BR4A 1OCOC 3MBGA 1AEPA 1S7ZA 3I5QA 2J0XA 1JPNA 1VK5A 1LKXA 4RD9A 3W2WA 4J30B 1I4ZA 2NUPA 4JVSA 3RW0A 2IXNA 1FFHA 1NFNA 1OQCA 4EBJA 2R7OA 4DBQA 1WGWA 4XEKA 3EZHA 1YAUO 3DJNB 3UR3C 2UUHA 5L0GA 3MFNA 4EIYA 2ZPAA 5E3CA 3SXMA 4U5CE 3FAPB 3N0TA 2WVQA 3LLKA 3K6BA 5FZTA 4FAPB 4NCQA 1G5ZA 4HE8D 4AE4A 3BEHA 1Z23A 4XPXA 1R4TA 4DRIB 2R02A 1UFBA 3EQLF 1H7IA 3T6BA 3ZWIA 2LK4A 2YL3A 4GYTA 4OINF 3U3FA 3I4UA 1LS1A 1U6HA 4MVRA 2EPLX 1GGQA 3RKOF 2Q4FA 5JRAA 3SNHA 2HKVA 1TWGA 5JS5A 3AQBA 4MTGA 3OWTA 4C3DA 2Q9BA 4IAOA 4CIPA 3EHMA 5BQGA 3HJCA 3X2QC 3O39A 1E84A 4PFPA 2DB4A 4CDYA 2H8AA 1TKNA 4MVQA 4O6NA 4IAQA 2EIJC 2NUTA 1YDIA 1WN0A 3RIPA 5A6KA 1GQAA 2HJMA 4YT8A 1C02A 5B3IA 1D0XA 3FDQA 2HUJA 5CI8A 4E0HA 2AU5A 3K1IC 2EPNA 2R7QA 2NSGA 4IWBA 2PBEA 2WB7A 1Q0FA 1H9GA 3GWNA 1D0ZA 3QTHA 4FWVA 4C7OA 3RYLA 2UUIA 4U5EE 4ZLDA 1BR1A 3O55A 4O6MA 1V74B 1D1AA 2XXAB 1FR0A 3HTKC 2VCCA 1D1CA 5JT4A 3MLGA 3U9JA 2WZFA 3GEIA 3EGDB 2HMQA 2WZGA 2VCBA 2Q7RA 4BJ6C 4EKWA 3NKEA 3EH2A 5DLJA 1T6UA 3SXZA 5T3TA 3FHDA 4JJGA 5F5FA 3ITFA 1CPRA 2GWWA 3B29A 3JZ0A 4JTDB 4LLCA 1G4WR 4CDVA 2CDQA 5L0CA 1NU9C 2LIGA 4YL3A 4N6HA 4BEMJ 3SP1A 4PJMA 2A0UA 2H7BA 1NLXA 4NQFA 4CIHA 2LFDA 3WODF 2AVKA 2FAPB 2ASRA 1F1MA 2OJED 3N24A 4ULVA 3G50A 4NY3A 3PCVA 5T1DB 2P0NA 2C03A 2G62A 3EFOA 1M56C 5JSLA 4YT2A 1LPEA 2D5RB 4U5FE 3ZVRA 3FOOA 3H2UA 4IRUA 2XLVA 2HJ3A 2XSEA 1NSGB 2OCCC 5JP7A 3L34A 4BJ1A 1XWJA 4WGYA 4UDVA 4KBLA 4OD5A 3LEOA 1WTYA 3O6XA 3M4BA 3L1MA 3K7DA 2XRHA 4O6YA 3AGUA 1K04A 4JJFA 5TJ5E 4IARA 2A1DD 2RSEB 2JX0A 2HV6A 2EILC 4ONSA 4PACA 3F46A 1RKCA 4DXWA 2YL1A 4CS8C 1QZXA 4M63A 3GEEA 5EGYA 5IY5C 3R2PA 4GQHA 2GDCA 3B0VC 1FNTc 1FMVA 2EIKC 4NTAA 3S0XA 5KYUB 3EPVA 4XPWA 2QY9A 4OIRF 3IQCA 5BQIA 3W8IA 3GANA 5GPGB 3HNKA 4JCZA 2QLAA 3KYJA 3ECSA 3PHF2 2KK1A 4Q5SF 1PD1A 3V5YA 1VYIA 2J0WA 1Q0GA 2AWCA 4QDLA 5B3SC 3KKBA 1E85A 2Y69C 5CIVA 1YYXA 1YVIA 3AOUA 3FOPA 2HSBA 2HV7A 1OKKA 2XM4A 3EHNA 3UGOA 4XQ1A 4XEFA 2X51A 3GM2A 1G4US 2V26A 3AG4C 2YL0A 3DD7A 3MX3A 4MS2A 3QZCA 4DRHB 1JR8A 3DJUB 4U5DE 4W8PA 3C8GB 3ZTMA 1GM5A 1APCA 3SXKA 4HEAJ 1D1BA 3DE8A 3KPHA 5AGFA 2J9WA 4I1OB 4D4XA 4KI2A 4ZLCA 3RH3A 3ASNC 2D4UA 3AGTA 5AC4A 1Q0DA 1A7EA 2L9JA 4DBRA 3NYMA 2BL2A 3FMSA 4E17A 2P6VA 2W9YA 2YQYA 4BJ5A 2Y3BA 4J7YA 3LJBA 1Y6DA 4EWCA 3SZRA 4WJ0A 2QNLA 256BA 3IPMO 4YT5A 2CGEA 2Q00A 3QW1A 3PMRA 2H7VC 4P9TA 3L0IA 1J8YF 2WVNA 2LD6A 2XL6A 1ZU4A 4ANJA 5B1BC 4B6IA 3EGXB 1LI7A 1VTMP 3EG9A 3DAGA 1OR2A 1YARO 3A9CA 1XZPA 3IQ5A 4JTCB 5DS5A 4KC9A 3T6GB 1NFOA 3L8IA 2R7RA 3T6JA 2KNHA 1H6GA 1LVKA 3J06A 2Y3HA 3VRCA 2YRFA 2IBFA 3W8HA 3DXJF 1HY5A 3ABLC 3KL4A 2XL4A 4NC3A 2A0BA 1RCPA 3H65A 3JYHA 4LLEA 3MYIA 1Z5ZA 4G78A 3TD7A 1MMGA 1ST6A 2Y39A 4LERA 3POVA 2YKZA 2XLDA 5A6BD 3JTLO 1AUEA 4J32B 4U5BE 3ZQVA 3JYYA 1K05A 2R05A 2A68F 5KYWA 1RMVA 3O10A 5KYYB 5DQZA 3AQCA 1KTMA 2XL8A 3IQ6A 3KYIA 3VM6A 1JRAA 2Z15A 4KNWA 1QSPA 4R32A 1ZZPA 3C8GD 1Q0MA 1M2VA 2LFFA 1OXBA 3UMKA 1O3UA 1WWPA 2A6EF 5COGA 1CPQA 3ZQYA 1FFTC 2MWQA 1JAFA 1TQGA 2VCAA 3FXHA 1G8XA 4JIOA 2OEVA 4PK4A 3HNIA 1JMWA 1T6IA 3B71A 2FGYA 4EBKA 3GEHA 1FMWA 1ZHYA 2PFDA 3JT1A 4G0HA 4ULWA 4WGZA 2MYSA 3C7JA 4JW1A 3ZC4A 2YVKA 3ZG1A 1MMDA 1EQ1A 2WL8A 3HNJA 1S05A 4AK9A 4G7ZF 3Q7LA 4U5GA 4BPMA 3HLZA 3QVYA 2VB6A 4C3EA 3ABMC 1M2OA 3EZIA 3NMIA 1QVXA 1Q0KA 1A7VA 3LNRA 3SYNA 3W2VA 1RJ9B 2RD9A 2M64A 2DYSC 1TR2A 4IJJA 5KYUA 1C03A 4YL0A 5E33A 2ZXOA 2PP4A 1HMDA 2JD3A 4JURI 1VLSA 5AC5A 5BQHA 2L6FA 4QI2A 1HE1A 4EHPA 4XTKA 4PJJA 4CS7A 2OG2A 5DQTA 5L0IA 4JCHA 4LDKA 1TFKB 5A6BA 3U8PA 2L81A 3NDBB 1LI5A 2NG1A 1QKRA 2NUPB 4JC7A 1V54C 1E86A 1MMAA 2P7VA 1I4YA 3T4RA 2QUPA 3M15A 3JSZA 2KW3C 4DVYP 1T01A 5HV9A 4MW8A 1TWHA 1BBHA 1ZYRF 3ASOC 1YJGA 1LM3B 1U89A 5E3AA 1TWAA 2LSEA 4DRJB 4JRZA 2XLHA 1R5ID 4QI0A 1CGOA 1QPUA 3C18A 3TQOA 5BUOA 4OIPF 1MQVA 3CEXA 3UMHA 2R7XA 4YL1A 3RQFA 5FCLA 4CX9A 4AE4B 2NSFA 1E83A 3Q6NA 3HNLA 4RBNA 5A69A 1AVOB 3ATPA 3CZ6A 2PF4E 1L7CA 1EA8A 2LP4A 3GODA 2YL7A 4Q7CA 4XLNF 2A6HF 1IW7F 2IOQA 2P61A 4D4NA 1HMOA 4H54A 1ZVZA 2YEVA 2OOCA 5JUAA 3AG3C 3GORA 3JRTA 1N1CA 4A2NB 3NKDA 4AX2A 2CW0F 2YLGA 4JEAA 4O79A 1DOWA 2NPUA 4BJ6A 2YZSA 3JSEO 1C17M 5COMA 4CSAA 5L3VA 3UNGC 1UG7A 2HS5A 3AG2C 1PV3A 2NUTB 1BR2A 3KH2A 4GEHA 4BJ5C 5EHHA 2TMVP 2R7VA 4X0RA 3RFYA 1SYQA 2LQGA 4I1MA 3VAYA 1J8MF 1RKEB 1MNDA 2CNWD 4BG0A 4E7SA 4YN0B 2DI3A 3IHUA 5F28E 3DE9A 3DZAA 3AJMA 4P9FA 1YZCA 4C7OB 1A0BA 1YLMA 2L6HA 2OEXA 2PX0A 1DOVA 2VASA 2ZXPA 5D92A 3WAQA 1HW2A 2J46A 2QTVA 1OCRC 1IZMA 3G4XA 1D0YA 4JE9A 1LS4A 1NBBA 4W8KA 5F5HA 2A69F 3S29A 3U3BA 2YLIA 1YA7O 1ZHWA 2W4MA 3GWLA 4NTFA 2R7WA 1JPJA 1OW7A 1ORJA 3KMIA 2J45A 2X0CA 1FAPB 1L3PA 2XLMA 4CBEA 2EPKX 3ZDLA 4YK5A 2XLEA 2C04A 1OCZC 4E18A 2OKUA 1LE4A 5DS4A 4CS9A 2E87A 2M4EA 3LAYA 1SR2A 3U9MA 4G7OF 4XPYA 3T9OA 2R03A 3I5PA 2CYDA 4F4BA 5K0IA 3S84A 4MVMA 1ZHXA 5JVEA 3TJ5A 5L0JA 1M6TA 3EFOB 2XXAA 4U5HA 1ZW2A 1RJ9A 3C8ZA 3DWWA 2KYHA 3EGDA 2BE5F 3K33A 3LUTB 2J9UA 2R7SA 2PX3A 5JLIA 1QQ3A 2CNWA 3LLIA 1GS9A 2P1AA 5L0DA 3RQGA 4YT4A 2IM8A 2MHRA 1ORYA 2IXPA 5KYXB 2QE9A 4BEJA 2KC3A 3M1CB 4NTBA 1MNEA 2L7AA 4JZAA 4OD4A 3C63A 1YA9A 3LESA 3SXYA 3ZTZA 2B0HA 1ORSC 4XEVA
chains in the Genus database with same CATH topology
1YZAA 2BC5A 2YL1A 2XLOA 3U8PA 3M4CA 3NMJA 1E86A 4ER9A 3TOMA 3M15A 3HNKA 1BBHA 2QLAA 1LM3B 2J8WA 2XLHA 1QPUA 1CGOA 3C62A 1MQVA 4U9EA 4CX9A 3NMKA 1E85A 1YYXA 1E83A 3FOPA 1YYJA 3HNLA 2XM4A 1CGNA 2YL7A 2YL0A 2CCYA 4EIYA 3ZTMA 2XLWA 4JEBA 4D4NA 1APCA 3DE8A 5AGFA 5JUAA 3QVZA 4D4XA 3TOLA 2YLGA 4JEAA 3ZWIA 2YL3A 256BA 4N4WA 4L6RA 5JRAA 3QW1A 5JS5A 2XL6A 3IQ5A 4CIPA 2XM0A 3DE9A 1E84A 1YZCA 4CDYA 4IAQA 3VRCA 4JE9A 1GQAA 1NBBA 5B3IA 2YLIA 4NC3A 1RCPA 3QW0A 2XLMA 1EKYA 2XLEA 2YKZA 2XLDA 5JT4A 3ZQVA 2XL8A 3IQ6A 5JVEA 1M6TA 1CPRA 4JKVA 4CJOA 1CPQA 3ZQYA 4U9DA 4CDVA 1JAFA 3HNIA 4N6HA 2YLDA 5JLIA 4WGZA 1QQ3A 3HNJA 1S05A 4ULVA 4CJGA 5JSLA 3M79A 3QVYA 4CDAA 3FOOA 3NMIA 2XLVA 1A7VA 5JP7A 4WGYA 3M4BA 3C63A 3L1MA 2J9BA 4IB4A 3ZTZA 4IARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZA A;  2BC5 A;  2YL1 A;  2XLO A;  3U8P A;  3M4C A;  3NMJ A;  1E86 A;  4ER9 A;  3TOM A;  3M15 A;  3HNK A;  1BBH A;  2QLA A;  1LM3 B;  2J8W A;  2XLH A;  1QPU A;  1CGO A;  3C62 A;  1MQV A;  4U9E A;  4CX9 A;  3NMK A;  1E85 A;  1YYX A;  1E83 A;  3FOP A;  1YYJ A;  3HNL A;  2XM4 A;  1CGN A;  2YL7 A;  2YL0 A;  2CCY A;  4EIY A;  3ZTM A;  2XLW A;  4JEB A;  4D4N A;  1APC A;  3DE8 A;  5AGF A;  5JUA A;  3QVZ A;  4D4X A;  3TOL A;  2YLG A;  4JEA A;  3ZWI A;  2YL3 A;  256B A;  4N4W A;  4L6R A;  5JRA A;  3QW1 A;  5JS5 A;  2XL6 A;  3IQ5 A;  4CIP A;  2XM0 A;  3DE9 A;  1E84 A;  1YZC A;  4CDY A;  4IAQ A;  3VRC A;  4JE9 A;  1GQA A;  1NBB A;  5B3I A;  2YLI A;  4NC3 A;  1RCP A;  3QW0 A;  2XLM A;  1EKY A;  2XLE A;  2YKZ A;  2XLD A;  5JT4 A;  3ZQV A;  2XL8 A;  3IQ6 A;  5JVE A;  1M6T A;  1CPR A;  4JKV A;  4CJO A;  1CPQ A;  3ZQY A;  4U9D A;  4CDV A;  1JAF A;  3HNI A;  4N6H A;  2YLD A;  5JLI A;  4WGZ A;  1QQ3 A;  3HNJ A;  1S05 A;  4ULV A;  4CJG A;  5JSL A;  3M79 A;  3QVY A;  4CDA A;  3FOO A;  3NMI A;  2XLV A;  1A7V A;  5JP7 A;  4WGY A;  3M4B A;  3C63 A;  3L1M A;  2J9B A;  4IB4 A;  3ZTZ A;  4IAR A; 
#chains in the Genus database with same CATH topology
 1JOG A;  1HW1 A;  3U5S A;  4EBB A;  5KYN A;  4MW3 A;  2IYL D;  3BRJ A;  4MVS A;  5A6A A;  4HFF B;  3DM5 A;  1PCX A;  3TJ6 A;  3HKK A;  3DAF A;  3NRH A;  1Z7Q c;  2XLO A;  1LE2 A;  2EPO A;  3EJN A;  3R7C A;  3M4C A;  1V4A A;  2YHS A;  1O5H A;  4OIO F;  5DVW A;  2JPU A;  2Y3D A;  1PD0 A;  2VC9 A;  3U8V A;  4MTO A;  4DJ9 A;  4ER9 A;  2V3C C;  2EPM X;  1CGM E;  3TOM A;  4J7T A;  1HE9 A;  3FAJ A;  4OIQ F;  1OW8 A;  3U2M A;  5L0F A;  1OW6 A;  2OQM A;  4FES A;  4PFO A;  2DGJ A;  1U0B B;  2AP3 A;  2J8W A;  5L3Q A;  1O87 A;  4AL1 A;  2HMZ A;  1A41 A;  2J9V A;  3C62 A;  3S27 A;  4EUK B;  4U9E A;  4A4A A;  3NMK A;  4O7G A;  2W45 A;  3X1O A;  3FVY A;  1YYJ A;  5HSW A;  1Z63 A;  1EI7 A;  1NZE A;  1VLT A;  3F47 A;  1SZI A;  4FX5 A;  2WVO A;  4K0D A;  4Z9H A;  3WG7 C;  1CGN A;  2PNO A;  3MYF A;  1WOL A;  2CCY A;  2IXM A;  2ZXR A;  3TUL A;  1KNY A;  2YWA A;  2R25 A;  1W2W A;  4MND A;  2XLW A;  4JEB A;  3U0C A;  1TWC A;  3RVY A;  4K7B A;  3Q7G A;  4I44 A;  4PJL A;  3QVZ A;  3EH1 A;  1RKE A;  4PJN A;  3TOL A;  1KU2 A;  3EG9 B;  1ZU5 A;  3VYW A;  2W4B A;  2Q3T A;  5KYX A;  1K40 A;  4PR9 A;  4LDQ A;  2R9R B;  3A11 A;  3RVZ A;  3SEO A;  4K1O A;  1T9K A;  3ZSU A;  3C8G A;  4N4W A;  4L6R A;  2Q9C A;  2Y3G A;  4KNV A;  1BZ4 A;  2XS1 A;  3JCU Q;  5T3W A;  3UGP A;  1Z6A A;  1Z3I X;  3LS1 A;  4MVO A;  4Z9I A;  1H9T A;  4Z9J A;  3ZIB A;  5EK0 A;  1NG1 A;  1OXK A;  2FFH A;  2WZL A;  2OJQ A;  3LS0 A;  4YJW A;  5D91 A;  5B1A C;  2L6G A;  3U2L A;  5E2Q A;  3UMI A;  4CSA C;  3G4Z A;  1ZHT A;  2XM0 A;  4LAC B;  3ABK C;  3N2Z B;  2GAQ A;  3W4Y A;  3K1I A;  2G3K A;  2H7O A;  3E9V A;  3RF3 A;  3S28 A;  3DI5 A;  2ETS A;  3AG1 C;  2KJG A;  3L8J A;  3CAX A;  4P6I C;  4MQ9 F;  2R7U A;  1BDJ B;  1OKK D;  2HZ8 A;  3EGX A;  4JTA B;  3TK0 A;  3B0P A;  4E7Z A;  5KYW B;  1VYK A;  3S9O A;  4C3B A;  1Y4C A;  3QW0 A;  4HFK B;  3DM9 B;  2J7P D;  3DMD A;  3WHN A;  3IEE A;  1M2V B;  1VB5 A;  1EKY A;  2GFH A;  2EIN C;  5COF A;  3NG1 A;  3US6 A;  4AL0 A;  5DS6 A;  4DVZ A;  2R7T A;  3B9Q A;  1QLE C;  1VMA A;  4LDR A;  1OCC C;  4H4K C;  1V55 C;  4Q4Z F;  3NYL A;  3H2V A;  2KGO A;  4CS9 C;  2G3V A;  2HSQ A;  1FTS A;  2I8B A;  3GM1 A;  2HFI A;  4XLP F;  2Q9A A;  4MVZ A;  5CI9 A;  2F22 A;  2VH3 A;  4JKV A;  4CJO A;  1MMN A;  4I3M A;  3CQZ A;  2ZD9 A;  3Q6M A;  4XWJ A;  1WAS A;  5L0H A;  1T5O A;  5KYY A;  1OR3 A;  3V5X A;  3S90 A;  2YLD A;  3DKA A;  4RDA A;  3CSK A;  4U9D A;  2KSF A;  3NYJ A;  4G7H F;  2AWY A;  3E70 C;  4CJG A;  3GM3 A;  2KQ9 A;  1RXQ A;  4BJT A;  3M79 A;  4MVU A;  3K1H A;  4CDA A;  5A6J A;  3B0U X;  3LEV A;  1WAT A;  1A7D A;  2ZXW C;  1NU7 D;  3JRM O;  1LIH A;  3OEO A;  3RQE A;  3V7O A;  3PDM P;  3V5Z A;  1E2X A;  2IXO A;  2DYR C;  4IGG A;  2OU6 A;  4CS8 A;  2J9B A;  1SMY F;  2I15 A;  1XZQ A;  2O9X A;  4IB4 A;  4DOZ A;  4YWQ A;  1I5N A;  1VOM A;  3IQT A;  3QMK A;  2EIM C;  1M57 C;  1YZA A;  1ZHZ A;  1ZW3 A;  2BC5 A;  2J7P A;  4WAB A;  3VF0 A;  2GA0 A;  2XS8 A;  1TFO B;  2ICW G;  3NMJ A;  4MTF A;  4E0I A;  2B0J A;  1T6Q A;  3LNM B;  1B68 A;  2LCH A;  3OA1 A;  4N6C A;  1SF8 A;  4N06 A;  3K66 A;  1BR4 A;  1OCO C;  3MBG A;  1AEP A;  1S7Z A;  3I5Q A;  2J0X A;  1JPN A;  1VK5 A;  1LKX A;  4RD9 A;  3W2W A;  4J30 B;  1I4Z A;  2NUP A;  4JVS A;  3RW0 A;  2IXN A;  1FFH A;  1NFN A;  1OQC A;  4EBJ A;  2R7O A;  4DBQ A;  1WGW A;  4XEK A;  3EZH A;  1YAU O;  3DJN B;  3UR3 C;  2UUH A;  5L0G A;  3MFN A;  4EIY A;  2ZPA A;  5E3C A;  3SXM A;  4U5C E;  3FAP B;  3N0T A;  2WVQ A;  3LLK A;  3K6B A;  5FZT A;  4FAP B;  4NCQ A;  1G5Z A;  4HE8 D;  4AE4 A;  3BEH A;  1Z23 A;  4XPX A;  1R4T A;  4DRI B;  2R02 A;  1UFB A;  3EQL F;  1H7I A;  3T6B A;  3ZWI A;  2LK4 A;  2YL3 A;  4GYT A;  4OIN F;  3U3F A;  3I4U A;  1LS1 A;  1U6H A;  4MVR A;  2EPL X;  1GGQ A;  3RKO F;  2Q4F A;  5JRA A;  3SNH A;  2HKV A;  1TWG A;  5JS5 A;  3AQB A;  4MTG A;  3OWT A;  4C3D A;  2Q9B A;  4IAO A;  4CIP A;  3EHM A;  5BQG A;  3HJC A;  3X2Q C;  3O39 A;  1E84 A;  4PFP A;  2DB4 A;  4CDY A;  2H8A A;  1TKN A;  4MVQ A;  4O6N A;  4IAQ A;  2EIJ C;  2NUT A;  1YDI A;  1WN0 A;  3RIP A;  5A6K A;  1GQA A;  2HJM A;  4YT8 A;  1C02 A;  5B3I A;  1D0X A;  3FDQ A;  2HUJ A;  5CI8 A;  4E0H A;  2AU5 A;  3K1I C;  2EPN A;  2R7Q A;  2NSG A;  4IWB A;  2PBE A;  2WB7 A;  1Q0F A;  1H9G A;  3GWN A;  1D0Z A;  3QTH A;  4FWV A;  4C7O A;  3RYL A;  2UUI A;  4U5E E;  4ZLD A;  1BR1 A;  3O55 A;  4O6M A;  1V74 B;  1D1A A;  2XXA B;  1FR0 A;  3HTK C;  2VCC A;  1D1C A;  5JT4 A;  3MLG A;  3U9J A;  2WZF A;  3GEI A;  3EGD B;  2HMQ A;  2WZG A;  2VCB A;  2Q7R A;  4BJ6 C;  4EKW A;  3NKE A;  3EH2 A;  5DLJ A;  1T6U A;  3SXZ A;  5T3T A;  3FHD A;  4JJG A;  5F5F A;  3ITF A;  1CPR A;  2GWW A;  3B29 A;  3JZ0 A;  4JTD B;  4LLC A;  1G4W R;  4CDV A;  2CDQ A;  5L0C A;  1NU9 C;  2LIG A;  4YL3 A;  4N6H A;  4BEM J;  3SP1 A;  4PJM A;  2A0U A;  2H7B A;  1NLX A;  4NQF A;  4CIH A;  2LFD A;  3WOD F;  2AVK A;  2FAP B;  2ASR A;  1F1M A;  2OJE D;  3N24 A;  4ULV A;  3G50 A;  4NY3 A;  3PCV A;  5T1D B;  2P0N A;  2C03 A;  2G62 A;  3EFO A;  1M56 C;  5JSL A;  4YT2 A;  1LPE A;  2D5R B;  4U5F E;  3ZVR A;  3FOO A;  3H2U A;  4IRU A;  2XLV A;  2HJ3 A;  2XSE A;  1NSG B;  2OCC C;  5JP7 A;  3L34 A;  4BJ1 A;  1XWJ A;  4WGY A;  4UDV A;  4KBL A;  4OD5 A;  3LEO A;  1WTY A;  3O6X A;  3M4B A;  3L1M A;  3K7D A;  2XRH A;  4O6Y A;  3AGU A;  1K04 A;  4JJF A;  5TJ5 E;  4IAR A;  2A1D D;  2RSE B;  2JX0 A;  2HV6 A;  2EIL C;  4ONS A;  4PAC A;  3F46 A;  1RKC A;  4DXW A;  2YL1 A;  4CS8 C;  1QZX A;  4M63 A;  3GEE A;  5EGY A;  5IY5 C;  3R2P A;  4GQH A;  2GDC A;  3B0V C;  1FNT c;  1FMV A;  2EIK C;  4NTA A;  3S0X A;  5KYU B;  3EPV A;  4XPW A;  2QY9 A;  4OIR F;  3IQC A;  5BQI A;  3W8I A;  3GAN A;  5GPG B;  3HNK A;  4JCZ A;  2QLA A;  3KYJ A;  3ECS A;  3PHF 2;  2KK1 A;  4Q5S F;  1PD1 A;  3V5Y A;  1VYI A;  2J0W A;  1Q0G A;  2AWC A;  4QDL A;  5B3S C;  3KKB A;  1E85 A;  2Y69 C;  5CIV A;  1YYX A;  1YVI A;  3AOU A;  3FOP A;  2HSB A;  2HV7 A;  1OKK A;  2XM4 A;  3EHN A;  3UGO A;  4XQ1 A;  4XEF A;  2X51 A;  3GM2 A;  1G4U S;  2V26 A;  3AG4 C;  2YL0 A;  3DD7 A;  3MX3 A;  4MS2 A;  3QZC A;  4DRH B;  1JR8 A;  3DJU B;  4U5D E;  4W8P A;  3C8G B;  3ZTM A;  1GM5 A;  1APC A;  3SXK A;  4HEA J;  1D1B A;  3DE8 A;  3KPH A;  5AGF A;  2J9W A;  4I1O B;  4D4X A;  4KI2 A;  4ZLC A;  3RH3 A;  3ASN C;  2D4U A;  3AGT A;  5AC4 A;  1Q0D A;  1A7E A;  2L9J A;  4DBR A;  3NYM A;  2BL2 A;  3FMS A;  4E17 A;  2P6V A;  2W9Y A;  2YQY A;  4BJ5 A;  2Y3B A;  4J7Y A;  3LJB A;  1Y6D A;  4EWC A;  3SZR A;  4WJ0 A;  2QNL A;  256B A;  3IPM O;  4YT5 A;  2CGE A;  2Q00 A;  3QW1 A;  3PMR A;  2H7V C;  4P9T A;  3L0I A;  1J8Y F;  2WVN A;  2LD6 A;  2XL6 A;  1ZU4 A;  4ANJ A;  5B1B C;  4B6I A;  3EGX B;  1LI7 A;  1VTM P;  3EG9 A;  3DAG A;  1OR2 A;  1YAR O;  3A9C A;  1XZP A;  3IQ5 A;  4JTC B;  5DS5 A;  4KC9 A;  3T6G B;  1NFO A;  3L8I A;  2R7R A;  3T6J A;  2KNH A;  1H6G A;  1LVK A;  3J06 A;  2Y3H A;  3VRC A;  2YRF A;  2IBF A;  3W8H A;  3DXJ F;  1HY5 A;  3ABL C;  3KL4 A;  2XL4 A;  4NC3 A;  2A0B A;  1RCP A;  3H65 A;  3JYH A;  4LLE A;  3MYI A;  1Z5Z A;  4G78 A;  3TD7 A;  1MMG A;  1ST6 A;  2Y39 A;  4LER A;  3POV A;  2YKZ A;  2XLD A;  5A6B D;  3JTL O;  1AUE A;  4J32 B;  4U5B E;  3ZQV A;  3JYY A;  1K05 A;  2R05 A;  2A68 F;  5KYW A;  1RMV A;  3O10 A;  5KYY B;  5DQZ A;  3AQC A;  1KTM A;  2XL8 A;  3IQ6 A;  3KYI A;  3VM6 A;  1JRA A;  2Z15 A;  4KNW A;  1QSP A;  4R32 A;  1ZZP A;  3C8G D;  1Q0M A;  1M2V A;  2LFF A;  1OXB A;  3UMK A;  1O3U A;  1WWP A;  2A6E F;  5COG A;  1CPQ A;  3ZQY A;  1FFT C;  2MWQ A;  1JAF A;  1TQG A;  2VCA A;  3FXH A;  1G8X A;  4JIO A;  2OEV A;  4PK4 A;  3HNI A;  1JMW A;  1T6I A;  3B71 A;  2FGY A;  4EBK A;  3GEH A;  1FMW A;  1ZHY A;  2PFD A;  3JT1 A;  4G0H A;  4ULW A;  4WGZ A;  2MYS A;  3C7J A;  4JW1 A;  3ZC4 A;  2YVK A;  3ZG1 A;  1MMD A;  1EQ1 A;  2WL8 A;  3HNJ A;  1S05 A;  4AK9 A;  4G7Z F;  3Q7L A;  4U5G A;  4BPM A;  3HLZ A;  3QVY A;  2VB6 A;  4C3E A;  3ABM C;  1M2O A;  3EZI A;  3NMI A;  1QVX A;  1Q0K A;  1A7V A;  3LNR A;  3SYN A;  3W2V A;  1RJ9 B;  2RD9 A;  2M64 A;  2DYS C;  1TR2 A;  4IJJ A;  5KYU A;  1C03 A;  4YL0 A;  5E33 A;  2ZXO A;  2PP4 A;  1HMD A;  2JD3 A;  4JUR I;  1VLS A;  5AC5 A;  5BQH A;  2L6F A;  4QI2 A;  1HE1 A;  4EHP A;  4XTK A;  4PJJ A;  4CS7 A;  2OG2 A;  5DQT A;  5L0I A;  4JCH A;  4LDK A;  1TFK B;  5A6B A;  3U8P A;  2L81 A;  3NDB B;  1LI5 A;  2NG1 A;  1QKR A;  2NUP B;  4JC7 A;  1V54 C;  1E86 A;  1MMA A;  2P7V A;  1I4Y A;  3T4R A;  2QUP A;  3M15 A;  3JSZ A;  2KW3 C;  4DVY P;  1T01 A;  5HV9 A;  4MW8 A;  1TWH A;  1BBH A;  1ZYR F;  3ASO C;  1YJG A;  1LM3 B;  1U89 A;  5E3A A;  1TWA A;  2LSE A;  4DRJ B;  4JRZ A;  2XLH A;  1R5I D;  4QI0 A;  1CGO A;  1QPU A;  3C18 A;  3TQO A;  5BUO A;  4OIP F;  1MQV A;  3CEX A;  3UMH A;  2R7X A;  4YL1 A;  3RQF A;  5FCL A;  4CX9 A;  4AE4 B;  2NSF A;  1E83 A;  3Q6N A;  3HNL A;  4RBN A;  5A69 A;  1AVO B;  3ATP A;  3CZ6 A;  2PF4 E;  1L7C A;  1EA8 A;  2LP4 A;  3GOD A;  2YL7 A;  4Q7C A;  4XLN F;  2A6H F;  1IW7 F;  2IOQ A;  2P61 A;  4D4N A;  1HMO A;  4H54 A;  1ZVZ A;  2YEV A;  2OOC A;  5JUA A;  3AG3 C;  3GOR A;  3JRT A;  1N1C A;  4A2N B;  3NKD A;  4AX2 A;  2CW0 F;  2YLG A;  4JEA A;  4O79 A;  1DOW A;  2NPU A;  4BJ6 A;  2YZS A;  3JSE O;  1C17 M;  5COM A;  4CSA A;  5L3V A;  3UNG C;  1UG7 A;  2HS5 A;  3AG2 C;  1PV3 A;  2NUT B;  1BR2 A;  3KH2 A;  4GEH A;  4BJ5 C;  5EHH A;  2TMV P;  2R7V A;  4X0R A;  3RFY A;  1SYQ A;  2LQG A;  4I1M A;  3VAY A;  1J8M F;  1RKE B;  1MND A;  2CNW D;  4BG0 A;  4E7S A;  4YN0 B;  2DI3 A;  3IHU A;  5F28 E;  3DE9 A;  3DZA A;  3AJM A;  4P9F A;  1YZC A;  4C7O B;  1A0B A;  1YLM A;  2L6H A;  2OEX A;  2PX0 A;  1DOV A;  2VAS A;  2ZXP A;  5D92 A;  3WAQ A;  1HW2 A;  2J46 A;  2QTV A;  1OCR C;  1IZM A;  3G4X A;  1D0Y A;  4JE9 A;  1LS4 A;  1NBB A;  4W8K A;  5F5H A;  2A69 F;  3S29 A;  3U3B A;  2YLI A;  1YA7 O;  1ZHW A;  2W4M A;  3GWL A;  4NTF A;  2R7W A;  1JPJ A;  1OW7 A;  1ORJ A;  3KMI A;  2J45 A;  2X0C A;  1FAP B;  1L3P A;  2XLM A;  4CBE A;  2EPK X;  3ZDL A;  4YK5 A;  2XLE A;  2C04 A;  1OCZ C;  4E18 A;  2OKU A;  1LE4 A;  5DS4 A;  4CS9 A;  2E87 A;  2M4E A;  3LAY A;  1SR2 A;  3U9M A;  4G7O F;  4XPY A;  3T9O A;  2R03 A;  3I5P A;  2CYD A;  4F4B A;  5K0I A;  3S84 A;  4MVM A;  1ZHX A;  5JVE A;  3TJ5 A;  5L0J A;  1M6T A;  3EFO B;  2XXA A;  4U5H A;  1ZW2 A;  1RJ9 A;  3C8Z A;  3DWW A;  2KYH A;  3EGD A;  2BE5 F;  3K33 A;  3LUT B;  2J9U A;  2R7S A;  2PX3 A;  5JLI A;  1QQ3 A;  2CNW A;  3LLI A;  1GS9 A;  2P1A A;  5L0D A;  3RQG A;  4YT4 A;  2IM8 A;  2MHR A;  1ORY A;  2IXP A;  5KYX B;  2QE9 A;  4BEJ A;  2KC3 A;  3M1C B;  4NTB A;  1MNE A;  2L7A A;  4JZA A;  4OD4 A;  3C63 A;  1YA9 A;  3LES A;  3SXY A;  3ZTZ A;  2B0H A;  1ORS C;  4XEV A; 
#chains in the Genus database with same CATH homology
 1YZA A;  2BC5 A;  2YL1 A;  2XLO A;  3U8P A;  3M4C A;  3NMJ A;  1E86 A;  4ER9 A;  3TOM A;  3M15 A;  3HNK A;  1BBH A;  2QLA A;  1LM3 B;  2J8W A;  2XLH A;  1QPU A;  1CGO A;  3C62 A;  1MQV A;  4U9E A;  4CX9 A;  3NMK A;  1E85 A;  1YYX A;  1E83 A;  3FOP A;  1YYJ A;  3HNL A;  2XM4 A;  1CGN A;  2YL7 A;  2YL0 A;  2CCY A;  4EIY A;  3ZTM A;  2XLW A;  4JEB A;  4D4N A;  1APC A;  3DE8 A;  5AGF A;  5JUA A;  3QVZ A;  4D4X A;  3TOL A;  2YLG A;  4JEA A;  3ZWI A;  2YL3 A;  256B A;  4N4W A;  4L6R A;  5JRA A;  3QW1 A;  5JS5 A;  2XL6 A;  3IQ5 A;  4CIP A;  2XM0 A;  3DE9 A;  1E84 A;  1YZC A;  4CDY A;  4IAQ A;  3VRC A;  4JE9 A;  1GQA A;  1NBB A;  5B3I A;  2YLI A;  4NC3 A;  1RCP A;  3QW0 A;  2XLM A;  1EKY A;  2XLE A;  2YKZ A;  2XLD A;  5JT4 A;  3ZQV A;  2XL8 A;  3IQ6 A;  5JVE A;  1M6T A;  1CPR A;  4JKV A;  4CJO A;  1CPQ A;  3ZQY A;  4U9D A;  4CDV A;  1JAF A;  3HNI A;  4N6H A;  2YLD A;  5JLI A;  4WGZ A;  1QQ3 A;  3HNJ A;  1S05 A;  4ULV A;  4CJG A;  5JSL A;  3M79 A;  3QVY A;  4CDA A;  3FOO A;  3NMI A;  2XLV A;  1A7V A;  5JP7 A;  4WGY A;  3M4B A;  3C63 A;  3L1M A;  2J9B A;  4IB4 A;  3ZTZ A;  4IAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...