1M6TA

Crystal structure of b562ril, a redesigned four helix bundle
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Redesign of a Four-Helix Bundle Protein by Phage Display Coupled with Proteolysis and Structural Characterization by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1m6tA00
5JT4A 3DE8A 3FOPA 4JEBA 2XLEA 2YKZA 1CGNA 5AGFA 3HNLA 1YYJA 2XM4A 1E86A 5JS5A 3NMJA 3TOMA 1RCPA 1CPQA 1APCA 4U9DA 3NMIA 4IB4A 1JAFA 4CJGA 256BA 3C62A 3IQ6A 3M4BA 4CX9A 4EIYA 4CDYA 1QQ3A 4NC3A 2XLOA 3M79A 2XL6A 1YYXA 3NMKA 3VRCA 5JRAA 2XLVA 4ER9A 3QVZA 1GQAA 3C63A 2YLGA 3TOLA 4IARA 3ZTMA 5JLIA 4CDAA 4N4WA 4D4NA 2YL1A 3QW1A 4D4XA 3DE9A 3QVYA 3QW0A 4IAQA 2YL0A 2YLIA 1MQVA 1CPRA 3IQ5A 5JUAA 4WGZA 1YZAA 4JEAA 3ZTZA 1EKYA 4N6HA 1E85A 3M15A 1A7VA 1NBBA 3HNKA 5JVEA 4CJOA 1LM3B 2XL8A 2XLHA 5B3IA 4CIPA 3L1MA 2J8WA 3FOOA 3ZQYA 2J9BA 3ZWIA 2YL7A 2XLMA 2QLAA 5JP7A 4WGYA 2XM0A 4JKVA 2YL3A 3ZQVA 1E83A 4ULVA 4U9EA 2YLDA 3HNJA 1YZCA 5JSLA 4JE9A 1E84A 1S05A 1QPUA 2XLWA 1BBHA 1M6TA 2CCYA 4CDVA 3HNIA 1CGOA 3M4CA 3U8PA 2BC5A 4L6RA 2XLDA
chains in the Genus database with same CATH superfamily
2L7AA 5JT4A 4O6YA 2Y3DA 1AUEA 3T6GB 1QSPA 3AG1C 4OIOF 4QI2A 2YHSA 2ZXOA 4FWVA 4WABA 4BEJA 2UUHA 1RKCA 2XLEA 2IYLD 2L81A 1OR3A 2LIGA 4LACB 2GAQA 1L3PA 3KMIA 2J0XA 4YT5A 5T3WA 1TFOB 3FDQA 4Z9IA 1V4AA 2VASA 3H2VA 4XEFA 3RF3A 4E7ZA 3R2PA 1E86A 1QLEC 3B71A 3VYWA 4BJTA 4Z9JA 4YT8A 3SZRA 2KC3A 1WGWA 3G4XA 4OIPF 4J30B 3TOMA 1OW7A 1A0BA 1OKKD 3L8IA 2P1AA 3F47A 4BPMA 4YT4A 2IM8A 1U0BB 5A6AA 2G62A 2LCHA 1NZEA 4JVSA 4KC9A 2H8AA 3C8GD 3NDBB 256BA 4DRIB 3AQBA 3EH2A 4BJ5A 3ZC4A 1G4WR 2C04A 1M2OA 2J0WA 2DGJA 2XLOA 2OJQA 2Q9BA 2JX0A 3DMDA 4MNDA 3V7OA 3US6A 5FZTA 5L0CA 3NMKA 3W2WA 2GDCA 3JSEO 3NRHA 2P0NA 3OWTA 1FMVA 2Y3BA 3JYYA 4LDRA 1Z7Qc 3RVYA 4DXWA 2KW3C 1HMDA 4DVZA 3RKOF 5T3TA 3GEIA 1TWGA 1ZHZA 3DI5A 3TOLA 3DM5A 5A6KA 2R7XA 2KJGA 2VH3A 5B1BC 2VCBA 1IZMA 5L0GA 5JLIA 5L0DA 2W4BA 2Q9AA 4C3EA 2HZ8A 2XXAB 2PF4E 5KYNA 1Z5ZA 3QW1A 4D4XA 4XQ1A 2Q3TA 3UGPA 2WVOA 3QW0A 1BZ4A 1Q0DA 3QTHA 4IAQA 1EI7A 4RD9A 1LE4A 1CPRA 1PD1A 1JR8A 3IQ5A 1H6GA 2R7OA 4MS2A 2EPOA 1YZAA 4PJLA 1LE2A 1AEPA 2WVQA 2ICWG 5BQIA 1JPNA 4CS9C 4BJ1A 4AE4B 1TKNA 3RQEA 3MBGA 5COMA 3JT1A 3NYMA 3M15A 4KNVA 1E85A 3EGXA 2XRHA 4B6IA 1FR0A 2A0BA 1Y6DA 2BE5F 5JVEA 3TJ5A 2EPNA 2XL8A 4CS7A 4EHPA 5BQGA 5KYWA 1FAPB 2A1DD 2HV6A 2LP4A 5KYXA 1F1MA 1ST6A 3ITFA 3R7CA 2EIMC 1BR2A 1NG1A 1ZHYA 2BL2A 5EK0A 4EKWA 3UMHA 3GEEA 2J9VA 2XM0A 1DOVA 3L8JA 1A41A 3SEOA 2L9JA 3ZQVA 4ULVA 4I3MA 4YN0B 2TMVP 2WZGA 4CBEA 4JTCB 2LFFA 5DQTA 1VK5A 2R02A 1Q0MA 1UG7A 3Q6MA 4JE9A 2QUPA 3ASOC 3NKDA 4E17A 3I4UA 2R03A 1YJGA 1LPEA 3O55A 3S84A 4NQFA 2CNWA 4ZLCA 2Y69C 1RMVA 4MVSA 4OD5A 3HKKA 2CDQA 4XTKA 1OCOC 2QY9A 4Z9HA 3POVA 4Q5SF 2VC9A 2NUPA 4DVYP 2AP3A 1HE9A 3PMRA 3U8PA 2GFHA 2LSEA 2AWCA 2BC5A 2WZLA 4YL1A 3DWWA 3EZIA 4H54A 5B1AC 3BRJA 2UUIA 4W8KA 4J32B 4G0HA 4R32A 1FMWA 1J8MF 3DKAA 2HKVA 4E7SA 4C7OB 3SYNA 4JEBA 4K1OA 5DS5A 4U5FE 5F5FA 1H9GA 4PFPA 2DYSC 1V55C 2V26A 1TWAA 3KL4A 3FAPB 3MFNA 3LUTB 1W2WA 3MYFA 2FGYA 3S90A 1BR4A 1HW2A 2MHRA 3NMJA 1WWPA 4EUKB 4NTAA 1FTSA 5CIVA 3AGUA 2KGOA 1RCPA 2FAPB 3EGDA 4U9DA 3U2MA 2OEXA 4PJJA 4Q4ZF 3S29A 3MX3A 5EGYA 1OCRC 3NMIA 1JMWA 2OJED 3C62A 3EGXB 4JURI 1RKEA 1Y4CA 4HFFB 1ZU5A 2CW0F 1Z23A 4CX9A 2W4MA 3O10A 4EIYA 5KYYA 3EFOA 1Z63A 3U9JA 4CDYA 3KKBA 3NKEA 4MVRA 4RBNA 4EBBA 1ZW2A 3LEVA 3HJCA 1MMNA 3M79A 4WJ0A 5D92A 2A6EF 1K05A 2EPKX 4JTAB 5KYWB 4GYTA 5KYXB 4ER9A 2A69F 2R7SA 1OCCC 1Q0GA 1YA9A 2YVKA 2LQGA 1FFHA 4OINF 3NYJA 4KBLA 3PHF2 1LI7A 4GQHA 3EHMA 1HY5A 1PCXA 2VB6A 2R7QA 4PJMA 2ETSA 3ZTMA 1XWJA 1YLMA 2PP4A 4DRHB 1BDJB 4CDAA 2IXOA 3LLIA 5IY5C 3H65A 2Y3GA 3RFYA 3X1OA 3U3BA 3DE9A 4U5DE 4HE8D 3I5PA 1E2XA 2YLIA 1MQVA 5D91A 5DQZA 5B3SC 2PX0A 4IWBA 5JUAA 1MMAA 4QI0A 1WATA 3T4RA 2WB7A 1ZYRF 2DYRC 4P9TA 4WGZA 5AC5A 3ZTZA 3K66A 4QDLA 1FFTC 1VMAA 1D1BA 2NUPB 1EKYA 1JOGA 4J7TA 4G7HF 1SMYF 2ZXRA 4PR9A 3G4ZA 2NUTA 2JD3A 1H9TA 3ZG1A 1NBBA 3HNKA 2PNOA 1G4US 2KYHA 3F46A 2XLHA 3W8HA 3WODF 1D1CA 1HE1A 3CZ6A 4JCZA 3OEOA 4K7BA 3VAYA 2R9RB 3S27A 1OQCA 5DS6A 2J8WA 5F5HA 1B68A 4C7OA 1K40A 1YVIA 3ZWIA 2HSBA 3S9OA 2IOQA 1SR2A 1KNYA 2QLAA 2EILC 2RSEB 3RVZA 5L0HA 5KYUB 3V5ZA 2FFHA 2Y3HA 4JKVA 3EHNA 4MTOA 2YWAA 1RXQA 1R4TA 5K0IA 3EGDB 1BR1A 3FVYA 2AVKA 2J45A 4U9EA 2YLDA 5CI8A 3U5SA 3HNJA 2HMQA 4MVZA 5JSLA 1U89A 1MNDA 1RKEB 3IPMO 4PFOA 1Z3IX 1H7IA 1E84A 3TULA 3VF0A 2W9YA 3K33A 1JPJA 5KYYB 3EFOB 1T6UA 1D1AA 2V3CC 1ZHWA 2XL4A 3FHDA 1ZU4A 3RW0A 1VLTA 2OEVA 2Q4FA 4I1OB 1AVOB 3Q7LA 4XEKA 3EPVA 2PBEA 4CDVA 4U5EE 1VOMA 2IBFA 3JRMO 4NTBA 1M57C 2CNWD 1V54C 3O39A 1QQ3A 3N24A 1ORYA 1ZW3A 1UFBA 2RD9A 4DOZA 2VCAA 5HV9A 3W4YA 1YA7O 2R05A 4MW8A 2R7RA 2EIJC 4O6NA 1D0YA 1TWHA 3DE8A 5DVWA 1IW7F 3CAXA 4MVMA 1VTMP 4FAPB 1XZPA 2A68F 2HSQA 4JIOA 4OIRF 2A0UA 4CSAC 4NY3A 3A9CA 4PK4A 1CGNA 3C18A 5AGFA 3UMKA 3ZVRA 1D0ZA 3SP1A 1OCZC 1WN0A 2YQYA 4U5BE 3GEHA 2NG1A 3DD7A 3WHNA 4YWQA 3EJNA 2R7UA 1QZXA 3IHUA 3T6BA 2LK4A 5FCLA 4E18A 5HSWA 3SXYA 3K6BA 1GM5A 1S7ZA 1CPQA 3S0XA 3JYHA 2NUTB 4IB4A 4CJGA 2EIKC 3VRCA 4JTDB 3LS1A 1XZQA 2QNLA 5L0IA 2W45A 2R7WA 2OKUA 1KU2A 3EZHA 3K1IA 4CS8A 4NC3A 5L3VA 3I5QA 1I4ZA 3AGTA 3ECSA 3JTLO 2B0HA 2XL6A 4LLCA 5A6BA 4OIQF 2H7VC 2HV7A 3B29A 4O79A 3CSKA 3GM1A 3Q6NA 4BJ6C 4IRUA 3AOUA 1M56C 2J9WA 2Z15A 2J7PA 2AU5A 3C63A 3PCVA 2YLGA 4DBQA 2R7TA 4K0DA 3LNRA 1ORSC 5KYUA 2IXPA 4YT2A 2I8BA 1I5NA 4ULWA 3RIPA 2YL1A 3GANA 4MVOA 1O3UA 3TK0A 4JCHA 3C7JA 3TQOA 2GWWA 2YZSA 1R5ID 2LD6A 4M63A 2YRFA 3NYLA 2KK1A 3C8GB 4P9FA 1SF8A 4AL0A 2WVNA 5E2QA 5DLJA 3T6JA 4G7ZF 2E87A 3AQCA 1OW8A 1T6QA 4G7OF 3DM9B 4JEAA 3FMSA 1T6IA 2C03A 4JJFA 4N6HA 1EQ1A 3E9VA 2OG2A 1JRAA 1U6HA 3SNHA 1CGME 1A7VA 4XLPF 2M4EA 3GM2A 3JZ0A 4HEAJ 3KYIA 3W8IA 4DJ9A 3AJMA 1K04A 1LM3B 1ZHXA 4AK9A 5EHHA 3ZIBA 1TQGA 2XSEA 4XWJA 3SXMA 2ZXWC 5B3IA 4CIPA 3GWNA 1NFOA 2IXNA 3FAJA 4MVQA 4U5CE 1QKRA 1GGQA 3FOOA 4H4KC 4JZAA 4BEMJ 2XLMA 3DAGA 2L6FA 4WGYA 2F22A 4ONSA 3X2QC 2M64A 4IJJA 4X0RA 1NFNA 3ABKC 2OOCA 3OA1A 4XPYA 2WZFA 5COFA 4NTFA 1MMGA 1T9KA 1WOLA 1E83A 5CI9A 4C3DA 2OQMA 1MNEA 4E0HA 2HS5A 1TWCA 2JPUA 3UMIA 3PDMP 1YARO 3LESA 3MYIA 3AG4C 3DZAA 3DAFA 1M2VA 1LIHA 1NSGB 2YEVA 2DI3A 3ABMC 1V74B 4F4BA 3B0VC 3SXKA 3ATPA 3IQCA 2OCCC 3U0CA 3JSZA 2OU6A 2XLWA 3EG9A 3EQLF 3ASNC 3H2UA 1VLSA 2GA0A 2QTVA 4BJ5C 3HNIA 3JRTA 4FESA 2A6HF 1T5OA 3QMKA 1RJ9A 2D4UA 3M4CA 2X0CA 4A2NB 4GEHA 3UGOA 3KPHA 4JW1A 3NG1A 1WASA 1OXKA 2B0JA 1LI5A 2CYDA 3V5YA 2HFIA 3TD7A 3FOPA 4YK5A 1OR2A 5L3QA 4EBJA 3L34A 3A11A 2HJ3A 2YKZA 4LLEA 1HMOA 2D5RB 1OKKA 3E70C 1LKXA 2Q00A 3GWLA 4DRJB 3HNLA 1YYJA 2XM4A 4XPWA 4CS9A 2KNHA 3M1CB 3C8GA 2ZPAA 4PJNA 4XLNF 1VYIA 2G3VA 2Q9CA 3RQFA 5JS5A 3B9QA 3KYJA 3RYLA 2LFDA 4AL1A 3WG7C 2PFDA 1APCA 2HUJA 3BEHA 4BG0A 4I44A 4O6MA 4MQ9F 2G3KA 3LEOA 2IXMA 2L6HA 3N2ZB 1JAFA 4YL3A 1ZZPA 2ZXPA 3FXHA 3IQ6A 4NCQA 4HFKB 3B0PA 3M4BA 2PX3A 4EWCA 5BUOA 3B0UX 2R7VA 4KI2A 4MTFA 1TR2A 5L0FA 3DJUB 3ABLC 3AG2C 4UDVA 4W8PA 2P7VA 4ZLDA 2NPUA 4MVUA 1YYXA 2DB4A 2L6GA 3CEXA 4I1MA 3O6XA 2XLVA 3G50A 3KH2A 3N0TA 3VM6A 5JRAA 1YAUO 2WL8A 3DJNB 1HW1A 4N6CA 1O87A 1ZVZA 4CSAA 5COGA 3QVZA 5T1DB 2EPLX 4N06A 4XEVA 2J46A 4IGGA 3DXJF 1GQAA 4XPXA 3W2VA 2ASRA 5A6BD 3HLZA 1GS9A 4CIHA 4IARA 3AG3C 4LERA 4O7GA 5A6JA 1FNTc 2R25A 1YDIA 3S28A 3ZDLA 4DBRA 1C02A 3JCUQ 3LAYA 1NU7D 2CGEA 4N4WA 2VCCA 4D4NA 1KTMA 5L0JA 3LNMB 1PD0A 1M2VB 1QVXA 2J7PD 1C03A 5F28E 3QVYA 1SZIA 2YL0A 3IQTA 4A4AA 4AX2A 3U9MA 4Q7CA 4P6IC 4JJGA 3EG9B 1DOWA 3C8ZA 3GODA 2KSFA 2EPMX 4C3BA 1PV3A 3U3FA 4OD4A 5E33A 3QZCA 3L0IA 1RJ9B 1G5ZA 1MMDA 2MYSA 3CQZA 4U5HA 5E3CA 1VYKA 4LDQA 2H7BA 2Q7RA 1VB5A 4ANJA 1NLXA 4BJ6A 4E0IA 3RH3A 4RDAA 3TJ6A 4CJOA 4MW3A 1WTYA 4PACA 1Z6AA 5A69A 3SXZA 2MWQA 1EA8A 1D0XA 3LJBA 1A7DA 4YL0A 5AC4A 1L7CA 2J9UA 3L1MA 2P61A 3U2LA 2P6VA 3U8VA 3ZQYA 4IAOA 1OW6A 2J9BA 3IEEA 1Q0FA 2YL7A 1Q0KA 2Y39A 3EH1A 3GORA 3K1IC 2X51A 4CS8C 2QE9A 3V5XA 1C17M 2EINC 1NU9C 5JP7A 3UNGC 1ZHTA 3Q7GA 3WAQA 2H7OA 1N1CA 1A7EA 3LLKA 1LVKA 2YL3A 2AWYA 1J8YF 2XXAA 4MTGA 2I15A 2XS1A 2NSFA 2HJMA 1LS1A 4U5GA 1YZCA 4EBKA 1I4YA 4YJWA 5DS4A 4JC7A 2ZD9A 3HTKC 3J06A 1G8XA 2XS8A 3K7DA 2NSGA 2HMZA 3ZSUA 4J7YA 1O5HA 3MLGA 1S05A 4KNWA 5TJ5E 4LDKA 1QPUA 3T9OA 3K1HA 3UR3C 1OXBA 2KQ9A 1BBHA 1SYQA 2O9XA 1M6TA 1T01A 2CCYA 3LS0A 4JRZA 5BQHA 4G78A 1LS4A 1CGOA 3RQGA 1ORJA 3GM3A 1TFKB 5E3AA 5GPGB 4AE4A 4FX5A 4L6RA 2XLDA
chains in the Genus database with same CATH topology
5JT4A 3DE8A 3FOPA 4JEBA 2XLEA 2YKZA 1CGNA 5AGFA 3HNLA 1YYJA 2XM4A 1E86A 5JS5A 3NMJA 3TOMA 1RCPA 1CPQA 1APCA 4U9DA 3NMIA 4IB4A 1JAFA 4CJGA 256BA 3C62A 3IQ6A 3M4BA 4CX9A 4EIYA 4CDYA 1QQ3A 4NC3A 2XLOA 3M79A 2XL6A 1YYXA 3NMKA 3VRCA 5JRAA 2XLVA 4ER9A 3QVZA 1GQAA 3C63A 2YLGA 3TOLA 4IARA 3ZTMA 5JLIA 4CDAA 4N4WA 4D4NA 2YL1A 3QW1A 4D4XA 3DE9A 3QVYA 3QW0A 4IAQA 2YL0A 2YLIA 1MQVA 1CPRA 3IQ5A 5JUAA 4WGZA 1YZAA 4JEAA 3ZTZA 1EKYA 4N6HA 1E85A 3M15A 1A7VA 1NBBA 3HNKA 5JVEA 4CJOA 1LM3B 2XL8A 2XLHA 5B3IA 4CIPA 3L1MA 2J8WA 3FOOA 3ZQYA 2J9BA 3ZWIA 2YL7A 2XLMA 2QLAA 5JP7A 4WGYA 2XM0A 4JKVA 2YL3A 3ZQVA 1E83A 4ULVA 4U9EA 2YLDA 3HNJA 1YZCA 5JSLA 4JE9A 1E84A 1S05A 1QPUA 2XLWA 1BBHA 1M6TA 2CCYA 4CDVA 3HNIA 1CGOA 3M4CA 3U8PA 2BC5A 4L6RA 2XLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  3DE8 A;  3FOP A;  4JEB A;  2XLE A;  2YKZ A;  1CGN A;  5AGF A;  3HNL A;  1YYJ A;  2XM4 A;  1E86 A;  5JS5 A;  3NMJ A;  3TOM A;  1RCP A;  1CPQ A;  1APC A;  4U9D A;  3NMI A;  4IB4 A;  1JAF A;  4CJG A;  256B A;  3C62 A;  3IQ6 A;  3M4B A;  4CX9 A;  4EIY A;  4CDY A;  1QQ3 A;  4NC3 A;  2XLO A;  3M79 A;  2XL6 A;  1YYX A;  3NMK A;  3VRC A;  5JRA A;  2XLV A;  4ER9 A;  3QVZ A;  1GQA A;  3C63 A;  2YLG A;  3TOL A;  4IAR A;  3ZTM A;  5JLI A;  4CDA A;  4N4W A;  4D4N A;  2YL1 A;  3QW1 A;  4D4X A;  3DE9 A;  3QVY A;  3QW0 A;  4IAQ A;  2YL0 A;  2YLI A;  1MQV A;  1CPR A;  3IQ5 A;  5JUA A;  4WGZ A;  1YZA A;  4JEA A;  3ZTZ A;  1EKY A;  4N6H A;  1E85 A;  3M15 A;  1A7V A;  1NBB A;  3HNK A;  5JVE A;  4CJO A;  1LM3 B;  2XL8 A;  2XLH A;  5B3I A;  4CIP A;  3L1M A;  2J8W A;  3FOO A;  3ZQY A;  2J9B A;  3ZWI A;  2YL7 A;  2XLM A;  2QLA A;  5JP7 A;  4WGY A;  2XM0 A;  4JKV A;  2YL3 A;  3ZQV A;  1E83 A;  4ULV A;  4U9E A;  2YLD A;  3HNJ A;  1YZC A;  5JSL A;  4JE9 A;  1E84 A;  1S05 A;  1QPU A;  2XLW A;  1BBH A;  1M6T A;  2CCY A;  4CDV A;  3HNI A;  1CGO A;  3M4C A;  3U8P A;  2BC5 A;  4L6R A;  2XLD A; 
#chains in the Genus database with same CATH topology
 2L7A A;  5JT4 A;  4O6Y A;  2Y3D A;  1AUE A;  3T6G B;  1QSP A;  3AG1 C;  4OIO F;  4QI2 A;  2YHS A;  2ZXO A;  4FWV A;  4WAB A;  4BEJ A;  2UUH A;  1RKC A;  2XLE A;  2IYL D;  2L81 A;  1OR3 A;  2LIG A;  4LAC B;  2GAQ A;  1L3P A;  3KMI A;  2J0X A;  4YT5 A;  5T3W A;  1TFO B;  3FDQ A;  4Z9I A;  1V4A A;  2VAS A;  3H2V A;  4XEF A;  3RF3 A;  4E7Z A;  3R2P A;  1E86 A;  1QLE C;  3B71 A;  3VYW A;  4BJT A;  4Z9J A;  4YT8 A;  3SZR A;  2KC3 A;  1WGW A;  3G4X A;  4OIP F;  4J30 B;  3TOM A;  1OW7 A;  1A0B A;  1OKK D;  3L8I A;  2P1A A;  3F47 A;  4BPM A;  4YT4 A;  2IM8 A;  1U0B B;  5A6A A;  2G62 A;  2LCH A;  1NZE A;  4JVS A;  4KC9 A;  2H8A A;  3C8G D;  3NDB B;  256B A;  4DRI B;  3AQB A;  3EH2 A;  4BJ5 A;  3ZC4 A;  1G4W R;  2C04 A;  1M2O A;  2J0W A;  2DGJ A;  2XLO A;  2OJQ A;  2Q9B A;  2JX0 A;  3DMD A;  4MND A;  3V7O A;  3US6 A;  5FZT A;  5L0C A;  3NMK A;  3W2W A;  2GDC A;  3JSE O;  3NRH A;  2P0N A;  3OWT A;  1FMV A;  2Y3B A;  3JYY A;  4LDR A;  1Z7Q c;  3RVY A;  4DXW A;  2KW3 C;  1HMD A;  4DVZ A;  3RKO F;  5T3T A;  3GEI A;  1TWG A;  1ZHZ A;  3DI5 A;  3TOL A;  3DM5 A;  5A6K A;  2R7X A;  2KJG A;  2VH3 A;  5B1B C;  2VCB A;  1IZM A;  5L0G A;  5JLI A;  5L0D A;  2W4B A;  2Q9A A;  4C3E A;  2HZ8 A;  2XXA B;  2PF4 E;  5KYN A;  1Z5Z A;  3QW1 A;  4D4X A;  4XQ1 A;  2Q3T A;  3UGP A;  2WVO A;  3QW0 A;  1BZ4 A;  1Q0D A;  3QTH A;  4IAQ A;  1EI7 A;  4RD9 A;  1LE4 A;  1CPR A;  1PD1 A;  1JR8 A;  3IQ5 A;  1H6G A;  2R7O A;  4MS2 A;  2EPO A;  1YZA A;  4PJL A;  1LE2 A;  1AEP A;  2WVQ A;  2ICW G;  5BQI A;  1JPN A;  4CS9 C;  4BJ1 A;  4AE4 B;  1TKN A;  3RQE A;  3MBG A;  5COM A;  3JT1 A;  3NYM A;  3M15 A;  4KNV A;  1E85 A;  3EGX A;  2XRH A;  4B6I A;  1FR0 A;  2A0B A;  1Y6D A;  2BE5 F;  5JVE A;  3TJ5 A;  2EPN A;  2XL8 A;  4CS7 A;  4EHP A;  5BQG A;  5KYW A;  1FAP B;  2A1D D;  2HV6 A;  2LP4 A;  5KYX A;  1F1M A;  1ST6 A;  3ITF A;  3R7C A;  2EIM C;  1BR2 A;  1NG1 A;  1ZHY A;  2BL2 A;  5EK0 A;  4EKW A;  3UMH A;  3GEE A;  2J9V A;  2XM0 A;  1DOV A;  3L8J A;  1A41 A;  3SEO A;  2L9J A;  3ZQV A;  4ULV A;  4I3M A;  4YN0 B;  2TMV P;  2WZG A;  4CBE A;  4JTC B;  2LFF A;  5DQT A;  1VK5 A;  2R02 A;  1Q0M A;  1UG7 A;  3Q6M A;  4JE9 A;  2QUP A;  3ASO C;  3NKD A;  4E17 A;  3I4U A;  2R03 A;  1YJG A;  1LPE A;  3O55 A;  3S84 A;  4NQF A;  2CNW A;  4ZLC A;  2Y69 C;  1RMV A;  4MVS A;  4OD5 A;  3HKK A;  2CDQ A;  4XTK A;  1OCO C;  2QY9 A;  4Z9H A;  3POV A;  4Q5S F;  2VC9 A;  2NUP A;  4DVY P;  2AP3 A;  1HE9 A;  3PMR A;  3U8P A;  2GFH A;  2LSE A;  2AWC A;  2BC5 A;  2WZL A;  4YL1 A;  3DWW A;  3EZI A;  4H54 A;  5B1A C;  3BRJ A;  2UUI A;  4W8K A;  4J32 B;  4G0H A;  4R32 A;  1FMW A;  1J8M F;  3DKA A;  2HKV A;  4E7S A;  4C7O B;  3SYN A;  4JEB A;  4K1O A;  5DS5 A;  4U5F E;  5F5F A;  1H9G A;  4PFP A;  2DYS C;  1V55 C;  2V26 A;  1TWA A;  3KL4 A;  3FAP B;  3MFN A;  3LUT B;  1W2W A;  3MYF A;  2FGY A;  3S90 A;  1BR4 A;  1HW2 A;  2MHR A;  3NMJ A;  1WWP A;  4EUK B;  4NTA A;  1FTS A;  5CIV A;  3AGU A;  2KGO A;  1RCP A;  2FAP B;  3EGD A;  4U9D A;  3U2M A;  2OEX A;  4PJJ A;  4Q4Z F;  3S29 A;  3MX3 A;  5EGY A;  1OCR C;  3NMI A;  1JMW A;  2OJE D;  3C62 A;  3EGX B;  4JUR I;  1RKE A;  1Y4C A;  4HFF B;  1ZU5 A;  2CW0 F;  1Z23 A;  4CX9 A;  2W4M A;  3O10 A;  4EIY A;  5KYY A;  3EFO A;  1Z63 A;  3U9J A;  4CDY A;  3KKB A;  3NKE A;  4MVR A;  4RBN A;  4EBB A;  1ZW2 A;  3LEV A;  3HJC A;  1MMN A;  3M79 A;  4WJ0 A;  5D92 A;  2A6E F;  1K05 A;  2EPK X;  4JTA B;  5KYW B;  4GYT A;  5KYX B;  4ER9 A;  2A69 F;  2R7S A;  1OCC C;  1Q0G A;  1YA9 A;  2YVK A;  2LQG A;  1FFH A;  4OIN F;  3NYJ A;  4KBL A;  3PHF 2;  1LI7 A;  4GQH A;  3EHM A;  1HY5 A;  1PCX A;  2VB6 A;  2R7Q A;  4PJM A;  2ETS A;  3ZTM A;  1XWJ A;  1YLM A;  2PP4 A;  4DRH B;  1BDJ B;  4CDA A;  2IXO A;  3LLI A;  5IY5 C;  3H65 A;  2Y3G A;  3RFY A;  3X1O A;  3U3B A;  3DE9 A;  4U5D E;  4HE8 D;  3I5P A;  1E2X A;  2YLI A;  1MQV A;  5D91 A;  5DQZ A;  5B3S C;  2PX0 A;  4IWB A;  5JUA A;  1MMA A;  4QI0 A;  1WAT A;  3T4R A;  2WB7 A;  1ZYR F;  2DYR C;  4P9T A;  4WGZ A;  5AC5 A;  3ZTZ A;  3K66 A;  4QDL A;  1FFT C;  1VMA A;  1D1B A;  2NUP B;  1EKY A;  1JOG A;  4J7T A;  4G7H F;  1SMY F;  2ZXR A;  4PR9 A;  3G4Z A;  2NUT A;  2JD3 A;  1H9T A;  3ZG1 A;  1NBB A;  3HNK A;  2PNO A;  1G4U S;  2KYH A;  3F46 A;  2XLH A;  3W8H A;  3WOD F;  1D1C A;  1HE1 A;  3CZ6 A;  4JCZ A;  3OEO A;  4K7B A;  3VAY A;  2R9R B;  3S27 A;  1OQC A;  5DS6 A;  2J8W A;  5F5H A;  1B68 A;  4C7O A;  1K40 A;  1YVI A;  3ZWI A;  2HSB A;  3S9O A;  2IOQ A;  1SR2 A;  1KNY A;  2QLA A;  2EIL C;  2RSE B;  3RVZ A;  5L0H A;  5KYU B;  3V5Z A;  2FFH A;  2Y3H A;  4JKV A;  3EHN A;  4MTO A;  2YWA A;  1RXQ A;  1R4T A;  5K0I A;  3EGD B;  1BR1 A;  3FVY A;  2AVK A;  2J45 A;  4U9E A;  2YLD A;  5CI8 A;  3U5S A;  3HNJ A;  2HMQ A;  4MVZ A;  5JSL A;  1U89 A;  1MND A;  1RKE B;  3IPM O;  4PFO A;  1Z3I X;  1H7I A;  1E84 A;  3TUL A;  3VF0 A;  2W9Y A;  3K33 A;  1JPJ A;  5KYY B;  3EFO B;  1T6U A;  1D1A A;  2V3C C;  1ZHW A;  2XL4 A;  3FHD A;  1ZU4 A;  3RW0 A;  1VLT A;  2OEV A;  2Q4F A;  4I1O B;  1AVO B;  3Q7L A;  4XEK A;  3EPV A;  2PBE A;  4CDV A;  4U5E E;  1VOM A;  2IBF A;  3JRM O;  4NTB A;  1M57 C;  2CNW D;  1V54 C;  3O39 A;  1QQ3 A;  3N24 A;  1ORY A;  1ZW3 A;  1UFB A;  2RD9 A;  4DOZ A;  2VCA A;  5HV9 A;  3W4Y A;  1YA7 O;  2R05 A;  4MW8 A;  2R7R A;  2EIJ C;  4O6N A;  1D0Y A;  1TWH A;  3DE8 A;  5DVW A;  1IW7 F;  3CAX A;  4MVM A;  1VTM P;  4FAP B;  1XZP A;  2A68 F;  2HSQ A;  4JIO A;  4OIR F;  2A0U A;  4CSA C;  4NY3 A;  3A9C A;  4PK4 A;  1CGN A;  3C18 A;  5AGF A;  3UMK A;  3ZVR A;  1D0Z A;  3SP1 A;  1OCZ C;  1WN0 A;  2YQY A;  4U5B E;  3GEH A;  2NG1 A;  3DD7 A;  3WHN A;  4YWQ A;  3EJN A;  2R7U A;  1QZX A;  3IHU A;  3T6B A;  2LK4 A;  5FCL A;  4E18 A;  5HSW A;  3SXY A;  3K6B A;  1GM5 A;  1S7Z A;  1CPQ A;  3S0X A;  3JYH A;  2NUT B;  4IB4 A;  4CJG A;  2EIK C;  3VRC A;  4JTD B;  3LS1 A;  1XZQ A;  2QNL A;  5L0I A;  2W45 A;  2R7W A;  2OKU A;  1KU2 A;  3EZH A;  3K1I A;  4CS8 A;  4NC3 A;  5L3V A;  3I5Q A;  1I4Z A;  3AGT A;  3ECS A;  3JTL O;  2B0H A;  2XL6 A;  4LLC A;  5A6B A;  4OIQ F;  2H7V C;  2HV7 A;  3B29 A;  4O79 A;  3CSK A;  3GM1 A;  3Q6N A;  4BJ6 C;  4IRU A;  3AOU A;  1M56 C;  2J9W A;  2Z15 A;  2J7P A;  2AU5 A;  3C63 A;  3PCV A;  2YLG A;  4DBQ A;  2R7T A;  4K0D A;  3LNR A;  1ORS C;  5KYU A;  2IXP A;  4YT2 A;  2I8B A;  1I5N A;  4ULW A;  3RIP A;  2YL1 A;  3GAN A;  4MVO A;  1O3U A;  3TK0 A;  4JCH A;  3C7J A;  3TQO A;  2GWW A;  2YZS A;  1R5I D;  2LD6 A;  4M63 A;  2YRF A;  3NYL A;  2KK1 A;  3C8G B;  4P9F A;  1SF8 A;  4AL0 A;  2WVN A;  5E2Q A;  5DLJ A;  3T6J A;  4G7Z F;  2E87 A;  3AQC A;  1OW8 A;  1T6Q A;  4G7O F;  3DM9 B;  4JEA A;  3FMS A;  1T6I A;  2C03 A;  4JJF A;  4N6H A;  1EQ1 A;  3E9V A;  2OG2 A;  1JRA A;  1U6H A;  3SNH A;  1CGM E;  1A7V A;  4XLP F;  2M4E A;  3GM2 A;  3JZ0 A;  4HEA J;  3KYI A;  3W8I A;  4DJ9 A;  3AJM A;  1K04 A;  1LM3 B;  1ZHX A;  4AK9 A;  5EHH A;  3ZIB A;  1TQG A;  2XSE A;  4XWJ A;  3SXM A;  2ZXW C;  5B3I A;  4CIP A;  3GWN A;  1NFO A;  2IXN A;  3FAJ A;  4MVQ A;  4U5C E;  1QKR A;  1GGQ A;  3FOO A;  4H4K C;  4JZA A;  4BEM J;  2XLM A;  3DAG A;  2L6F A;  4WGY A;  2F22 A;  4ONS A;  3X2Q C;  2M64 A;  4IJJ A;  4X0R A;  1NFN A;  3ABK C;  2OOC A;  3OA1 A;  4XPY A;  2WZF A;  5COF A;  4NTF A;  1MMG A;  1T9K A;  1WOL A;  1E83 A;  5CI9 A;  4C3D A;  2OQM A;  1MNE A;  4E0H A;  2HS5 A;  1TWC A;  2JPU A;  3UMI A;  3PDM P;  1YAR O;  3LES A;  3MYI A;  3AG4 C;  3DZA A;  3DAF A;  1M2V A;  1LIH A;  1NSG B;  2YEV A;  2DI3 A;  3ABM C;  1V74 B;  4F4B A;  3B0V C;  3SXK A;  3ATP A;  3IQC A;  2OCC C;  3U0C A;  3JSZ A;  2OU6 A;  2XLW A;  3EG9 A;  3EQL F;  3ASN C;  3H2U A;  1VLS A;  2GA0 A;  2QTV A;  4BJ5 C;  3HNI A;  3JRT A;  4FES A;  2A6H F;  1T5O A;  3QMK A;  1RJ9 A;  2D4U A;  3M4C A;  2X0C A;  4A2N B;  4GEH A;  3UGO A;  3KPH A;  4JW1 A;  3NG1 A;  1WAS A;  1OXK A;  2B0J A;  1LI5 A;  2CYD A;  3V5Y A;  2HFI A;  3TD7 A;  3FOP A;  4YK5 A;  1OR2 A;  5L3Q A;  4EBJ A;  3L34 A;  3A11 A;  2HJ3 A;  2YKZ A;  4LLE A;  1HMO A;  2D5R B;  1OKK A;  3E70 C;  1LKX A;  2Q00 A;  3GWL A;  4DRJ B;  3HNL A;  1YYJ A;  2XM4 A;  4XPW A;  4CS9 A;  2KNH A;  3M1C B;  3C8G A;  2ZPA A;  4PJN A;  4XLN F;  1VYI A;  2G3V A;  2Q9C A;  3RQF A;  5JS5 A;  3B9Q A;  3KYJ A;  3RYL A;  2LFD A;  4AL1 A;  3WG7 C;  2PFD A;  1APC A;  2HUJ A;  3BEH A;  4BG0 A;  4I44 A;  4O6M A;  4MQ9 F;  2G3K A;  3LEO A;  2IXM A;  2L6H A;  3N2Z B;  1JAF A;  4YL3 A;  1ZZP A;  2ZXP A;  3FXH A;  3IQ6 A;  4NCQ A;  4HFK B;  3B0P A;  3M4B A;  2PX3 A;  4EWC A;  5BUO A;  3B0U X;  2R7V A;  4KI2 A;  4MTF A;  1TR2 A;  5L0F A;  3DJU B;  3ABL C;  3AG2 C;  4UDV A;  4W8P A;  2P7V A;  4ZLD A;  2NPU A;  4MVU A;  1YYX A;  2DB4 A;  2L6G A;  3CEX A;  4I1M A;  3O6X A;  2XLV A;  3G50 A;  3KH2 A;  3N0T A;  3VM6 A;  5JRA A;  1YAU O;  2WL8 A;  3DJN B;  1HW1 A;  4N6C A;  1O87 A;  1ZVZ A;  4CSA A;  5COG A;  3QVZ A;  5T1D B;  2EPL X;  4N06 A;  4XEV A;  2J46 A;  4IGG A;  3DXJ F;  1GQA A;  4XPX A;  3W2V A;  2ASR A;  5A6B D;  3HLZ A;  1GS9 A;  4CIH A;  4IAR A;  3AG3 C;  4LER A;  4O7G A;  5A6J A;  1FNT c;  2R25 A;  1YDI A;  3S28 A;  3ZDL A;  4DBR A;  1C02 A;  3JCU Q;  3LAY A;  1NU7 D;  2CGE A;  4N4W A;  2VCC A;  4D4N A;  1KTM A;  5L0J A;  3LNM B;  1PD0 A;  1M2V B;  1QVX A;  2J7P D;  1C03 A;  5F28 E;  3QVY A;  1SZI A;  2YL0 A;  3IQT A;  4A4A A;  4AX2 A;  3U9M A;  4Q7C A;  4P6I C;  4JJG A;  3EG9 B;  1DOW A;  3C8Z A;  3GOD A;  2KSF A;  2EPM X;  4C3B A;  1PV3 A;  3U3F A;  4OD4 A;  5E33 A;  3QZC A;  3L0I A;  1RJ9 B;  1G5Z A;  1MMD A;  2MYS A;  3CQZ A;  4U5H A;  5E3C A;  1VYK A;  4LDQ A;  2H7B A;  2Q7R A;  1VB5 A;  4ANJ A;  1NLX A;  4BJ6 A;  4E0I A;  3RH3 A;  4RDA A;  3TJ6 A;  4CJO A;  4MW3 A;  1WTY A;  4PAC A;  1Z6A A;  5A69 A;  3SXZ A;  2MWQ A;  1EA8 A;  1D0X A;  3LJB A;  1A7D A;  4YL0 A;  5AC4 A;  1L7C A;  2J9U A;  3L1M A;  2P61 A;  3U2L A;  2P6V A;  3U8V A;  3ZQY A;  4IAO A;  1OW6 A;  2J9B A;  3IEE A;  1Q0F A;  2YL7 A;  1Q0K A;  2Y39 A;  3EH1 A;  3GOR A;  3K1I C;  2X51 A;  4CS8 C;  2QE9 A;  3V5X A;  1C17 M;  2EIN C;  1NU9 C;  5JP7 A;  3UNG C;  1ZHT A;  3Q7G A;  3WAQ A;  2H7O A;  1N1C A;  1A7E A;  3LLK A;  1LVK A;  2YL3 A;  2AWY A;  1J8Y F;  2XXA A;  4MTG A;  2I15 A;  2XS1 A;  2NSF A;  2HJM A;  1LS1 A;  4U5G A;  1YZC A;  4EBK A;  1I4Y A;  4YJW A;  5DS4 A;  4JC7 A;  2ZD9 A;  3HTK C;  3J06 A;  1G8X A;  2XS8 A;  3K7D A;  2NSG A;  2HMZ A;  3ZSU A;  4J7Y A;  1O5H A;  3MLG A;  1S05 A;  4KNW A;  5TJ5 E;  4LDK A;  1QPU A;  3T9O A;  3K1H A;  3UR3 C;  1OXB A;  2KQ9 A;  1BBH A;  1SYQ A;  2O9X A;  1M6T A;  1T01 A;  2CCY A;  3LS0 A;  4JRZ A;  5BQH A;  4G78 A;  1LS4 A;  1CGO A;  3RQG A;  1ORJ A;  3GM3 A;  1TFK B;  5E3A A;  5GPG B;  4AE4 A;  4FX5 A;  4L6R A;  2XLD A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  3DE8 A;  3FOP A;  4JEB A;  2XLE A;  2YKZ A;  1CGN A;  5AGF A;  3HNL A;  1YYJ A;  2XM4 A;  1E86 A;  5JS5 A;  3NMJ A;  3TOM A;  1RCP A;  1CPQ A;  1APC A;  4U9D A;  3NMI A;  4IB4 A;  1JAF A;  4CJG A;  256B A;  3C62 A;  3IQ6 A;  3M4B A;  4CX9 A;  4EIY A;  4CDY A;  1QQ3 A;  4NC3 A;  2XLO A;  3M79 A;  2XL6 A;  1YYX A;  3NMK A;  3VRC A;  5JRA A;  2XLV A;  4ER9 A;  3QVZ A;  1GQA A;  3C63 A;  2YLG A;  3TOL A;  4IAR A;  3ZTM A;  5JLI A;  4CDA A;  4N4W A;  4D4N A;  2YL1 A;  3QW1 A;  4D4X A;  3DE9 A;  3QVY A;  3QW0 A;  4IAQ A;  2YL0 A;  2YLI A;  1MQV A;  1CPR A;  3IQ5 A;  5JUA A;  4WGZ A;  1YZA A;  4JEA A;  3ZTZ A;  1EKY A;  4N6H A;  1E85 A;  3M15 A;  1A7V A;  1NBB A;  3HNK A;  5JVE A;  4CJO A;  1LM3 B;  2XL8 A;  2XLH A;  5B3I A;  4CIP A;  3L1M A;  2J8W A;  3FOO A;  3ZQY A;  2J9B A;  3ZWI A;  2YL7 A;  2XLM A;  2QLA A;  5JP7 A;  4WGY A;  2XM0 A;  4JKV A;  2YL3 A;  3ZQV A;  1E83 A;  4ULV A;  4U9E A;  2YLD A;  3HNJ A;  1YZC A;  5JSL A;  4JE9 A;  1E84 A;  1S05 A;  1QPU A;  2XLW A;  1BBH A;  1M6T A;  2CCY A;  4CDV A;  3HNI A;  1CGO A;  3M4C A;  3U8P A;  2BC5 A;  4L6R A;  2XLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...