1M6TA

Crystal structure of b562ril, a redesigned four helix bundle
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Redesign of a Four-Helix Bundle Protein by Phage Display Coupled with Proteolysis and Structural Characterization by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1m6tA00
2YL0A 2XLEA 4U9DA 3QW1A 5JVEA 1QPUA 3QVYA 2YL1A 5JUAA 4JEAA 1APCA 2YL7A 1YYJA 3ZWIA 3NMIA 2J9BA 4JEBA 2XLOA 2YL3A 1YYXA 1BBHA 1JAFA 2YKZA 3VRCA 4WGYA 4IARA 4EIYA 1MQVA 3QVZA 2BC5A 3NMJA 4D4XA 4CJGA 3HNKA 3M4CA 1YZCA 3FOOA 3U8PA 4WGZA 1E83A 3IQ5A 1A7VA 3M15A 1E84A 2XLHA 4IAQA 4CDYA 2YLIA 3C62A 2XM4A 4IB4A 3ZTZA 4CDVA 1CPRA 1YZAA 1LM3B 4JKVA 3HNIA 2XLMA 2XLVA 3DE9A 3M79A 1E85A 1M6TA 1NBBA 2YLDA 5JLIA 1RCPA 2XL6A 2XM0A 5JS5A 4CX9A 5JP7A 4N4WA 4JE9A 3HNLA 5B3IA 2XL8A 1EKYA 3ZQYA 4NC3A 3M4BA 3HNJA 1QQ3A 3IQ6A 3QW0A 4CIPA 4D4NA 5JT4A 2XLWA 5JRAA 4CDAA 2CCYA 4U9EA 4L6RA 1CGNA 1GQAA 4ULVA 4ER9A 1S05A 5JSLA 3L1MA 3TOMA 2J8WA 4N6HA 3ZTMA 3C63A 2XLDA 4CJOA 1CGOA 3NMKA 2YLGA 5AGFA 3DE8A 2QLAA 1CPQA 3TOLA 3FOPA 256BA 3ZQVA 1E86A
chains in the Genus database with same CATH superfamily
3RIPA 4EHPA 2P61A 5A69A 2Q00A 2DYSC 2XLEA 3LJBA 4P9FA 2OQMA 2YVKA 3QW1A 4R32A 3OEOA 1ZW2A 3ZVRA 1SF8A 1Z6AA 4JCHA 4I44A 5TJ5E 3RQGA 3DM9B 4PFPA 4QI2A 3NMIA 2LCHA 1SMYF 1NFNA 2G3VA 1OKKD 2NG1A 3AG1C 4YJWA 1T6UA 2J46A 3K1IA 4MVQA 3LESA 3X1OA 3SYNA 3JTLO 4E0HA 3TULA 3W2VA 2OJED 2YL3A 2Z15A 1BBHA 1MMNA 5KYNA 4Z9HA 3O10A 5L3VA 3EGDB 1T5OA 1MMGA 2PP4A 4DBQA 3EGDA 1WN0A 3VRCA 4PJNA 4JJFA 4DOZA 1OCZC 3DAGA 4YT2A 5CIVA 1U6HA 1TWGA 4U5GA 2BC5A 4D4XA 4CJGA 2R05A 3DJUB 4BG0A 4CSAA 3US6A 3VAYA 2HJ3A 2P0NA 2R7RA 1W2WA 3AG3C 3LS0A 4LACB 3T9OA 3FVYA 1OXKA 5KYXA 2YHSA 3MX3A 4QDLA 2C03A 3IQ5A 2ICWG 5DQZA 1Z3IX 1HMDA 3L8JA 3S27A 3LLKA 4PK4A 4IAQA 2M4EA 4OD4A 4EUKB 3RQEA 2XM4A 3TJ5A 1FNTc 2LSEA 3WODF 2LFFA 1LPEA 1Q0DA 1T6IA 5L0IA 1M57C 1TWCA 2XLVA 1TFOB 3KKBA 3DE9A 2HJMA 1OQCA 3RYLA 1YA9A 2XS1A 1JPNA 4LERA 3JRTA 2VCAA 1G5ZA 2IXNA 1YARO 3EZHA 1BDJB 1M6TA 2Y3BA 3LNRA 4GYTA 5B1BC 5EHHA 5A6JA 4DRHB 1RCPA 1RJ9A 2LIGA 1SZIA 2AU5A 2IBFA 1C17M 2Y39A 3FAPB 5JP7A 4JE9A 3FMSA 1JRAA 1U89A 3HNLA 1NFOA 4IJJA 5E3CA 4Q4ZF 4MVRA 4LLCA 1ZU4A 3LNMB 5KYYA 2R7TA 3JT1A 3H2VA 1VYKA 2KNHA 4O6NA 3SXYA 3I5QA 1LIHA 3U8VA 3ZQYA 3LAYA 5CI8A 3BEHA 4U5FE 1ST6A 3IQ6A 4CIPA 4XTKA 1OXBA 1R5ID 2JPUA 2MHRA 2NSFA 1RXQA 4U9EA 4EBKA 3L8IA 4L6RA 4XPXA 1BZ4A 4JJGA 4MS2A 2L6FA 3JRMO 2PNOA 2AP3A 3EG9B 3Q7LA 4ULVA 2JX0A 3JCUQ 2NUPA 2L6HA 3L1MA 4CS9C 3GEEA 5FZTA 2KJGA 4WABA 1AUEA 2J8WA 4P9TA 3ZG1A 1OW8A 1BR4A 3ZTMA 3W4YA 4A2NB 5D91A 1Q0FA 4DXWA 4OIPF 3CEXA 5CI9A 1OKKA 4U5EE 1KNYA 1S7ZA 3T6BA 1K05A 2W4MA 3C8GA 3KMIA 1JOGA 2R7QA 3RKOF 3B0UX 5BUOA 3LEOA 2XSEA 3NKEA 3W8HA 3GM3A 4IRUA 256BA 4EBJA 3NYMA 1NSGB 4DVZA 2HV7A 3I4UA 1FFTC 1IW7F 2AWYA 5AC4A 3S90A 1MNEA 5DQTA 1H6GA 1QSPA 2B0HA 1E86A 3N24A 3OWTA 4B6IA 4DRIB 3VYWA 4MVUA 2GAQA 1GS9A 2P7VA 1ZHZA 2XS8A 3NYJA 5JVEA 1QPUA 2YEVA 3K6BA 1GM5A 5JUAA 1G4WR 1XWJA 4KC9A 5AC5A 3EGXA 4XEVA 1CGME 2ZPAA 3ZWIA 4DVYP 1M2VB 1ZHWA 3EHMA 4PJJA 3A11A 4A4AA 5L0HA 3PDMP 2E87A 2HKVA 3O39A 1NLXA 2J9BA 2J0XA 4YK5A 1KTMA 1PD0A 4C3BA 4W8KA 1Y4CA 3V5YA 4MNDA 4XEKA 4E18A 3S29A 3AOUA 4WJ0A 2EINC 5E3AA 1OW7A 2H7VC 1WATA 4JTCB 4PFOA 1ZYRF 3ABMC 3LS1A 4K1OA 5EK0A 3K7DA 2H7OA 2OCCC 3PHF2 2VB6A 2ETSA 1QKRA 3SP1A 3VF0A 2XXAA 3AGTA 3M4CA 1YZCA 3S28A 2A6EF 3K1IC 1Z7Qc 2CGEA 1LS1A 2HSBA 3U8PA 3EH2A 3NDBB 1O3UA 3GWNA 3EPVA 3IPMO 4HFKB 1E84A 2IXOA 4RD9A 2CNWA 2WZGA 1OR3A 1ZVZA 2H8AA 2IXMA 3C8GD 2P6VA 2WZLA 3GEHA 3ZIBA 1VOMA 3GANA 4KNWA 1K04A 4F4BA 3GM1A 5GPGB 1D1CA 4ZLDA 2J9VA 2L6GA 1A7DA 3FXHA 4PR9A 2VH3A 3GM2A 5BQIA 2A0BA 2CW0F 5COMA 1F1MA 3KPHA 4CSAC 2HFIA 3M79A 4BJ1A 2ASRA 2NUTB 1HE9A 5EGYA 2BL2A 2PFDA 5F5HA 2NUTA 3CAXA 1NBBA 2EPLX 2FFHA 2Q3TA 3U2MA 3S0XA 4AX2A 4QI0A 3MLGA 4CX9A 1TR2A 2AWCA 3UMIA 2RSEB 4N4WA 4C3EA 5KYXB 4GQHA 3O55A 3LEVA 4MQ9F 3ZDLA 1HY5A 2EPMX 1FMWA 4U5DE 4J32B 1H9GA 2W9YA 4ULWA 1EKYA 5COGA 3FHDA 4YL0A 2LP4A 2KK1A 2A1DD 4Q7CA 3HNJA 3RVZA 2VCCA 2EPOA 2X0CA 1Z63A 3S84A 4XLNF 1I4YA 3QW0A 1YLMA 4JW1A 4NTAA 4D4NA 2XLWA 3JSEO 5F5FA 2H7BA 1V54C 1E2XA 1CGNA 4UDVA 3U9MA 2HZ8A 3J06A 1GQAA 5T1DB 3E9VA 3U3BA 1GGQA 4ER9A 2GWWA 1RJ9B 5JSLA 3VM6A 1V55C 2CYDA 1LI7A 1RKCA 2G3KA 3B9QA 5B1AC 3TOMA 3DWWA 4XPYA 4E7SA 2EPKX 3O6XA 3EJNA 5KYWA 3QZCA 1Z23A 1ZHXA 5BQGA 2R7SA 4CJOA 4BJTA 5KYYB 2XL4A 3K1HA 3NMKA 2YLGA 2A69F 2HS5A 4FWVA 1V74B 3EZIA 1LI5A 4P6IC 5AGFA 3TK0A 3TQOA 2BE5F 1WTYA 1K40A 3MBGA 2CNWD 2A68F 3N2ZB 3TOLA 3NKDA 4XQ1A 4XWJA 2EIMC 1O5HA 4JZAA 2PF4E 3B29A 1L7CA 2J9UA 2KQ9A 2QNLA 3RQFA 3DJNB 3KL4A 3ZQVA 2YZSA 2YL0A 1YJGA 1WGWA 2OG2A 1IZMA 5BQHA 2AVKA 1FFHA 4MVOA 2NUPB 3V7OA 2XRHA 3G50A 3QVYA 1HW1A 2YL1A 3TJ6A 1ZU5A 2YRFA 4C7OB 2GA0A 3UR3C 1I5NA 2G62A 2VCBA 2YL7A 3DD7A 4XEFA 4KBLA 4DRJB 2DGJA 2R02A 4C7OA 3C8GB 2R9RB 5B3SC 3GODA 3F46A 1MMDA 2QY9A 3MYIA 4JVSA 4IGGA 1J8YF 1XZQA 1H7IA 4YT5A 4IAOA 4BJ5C 1YYXA 3FDQA 1ORYA 2J9WA 1JAFA 1Q0MA 1QVXA 4MVSA 3B71A 2M64A 2Y69C 2FAPB 2YKZA 3DKAA 4JURI 2IXPA 4NQFA 4MTFA 4W8PA 4G7ZF 3DM5A 2WVOA 4CIHA 3POVA 3C8ZA 1EI7A 2D4UA 3HJCA 1MQVA 4EIYA 5L0DA 4LDKA 3NMJA 1JPJA 1Q0KA 4YN0B 4CS8C 3IQTA 3AG2C 3NYLA 5E2QA 1XZPA 3DAFA 3HTKC 2EPNA 2OOCA 2KC3A 1AEPA 3EGXB 1OCRC 3FOOA 1LVKA 3QTHA 2R03A 4BJ6A 2OU6A 3SXMA 1A7VA 3WG7C 2W4BA 1Z5ZA 5COFA 1EA8A 4RDAA 4FAPB 1RKEB 4NCQA 2V26A 2W45A 1YAUO 4GEHA 1OR2A 1Q0GA 4XPWA 1RKEA 2WVQA 4CDYA 2YLIA 3C62A 4H4KC 4IB4A 4LDQA 2EILC 3ZTZA 4CDVA 1M56C 1MMAA 3SNHA 2I15A 3UMHA 3LUTB 3SZRA 2VC9A 2KGOA 2GFHA 1LM3B 2QUPA 3ATPA 1D0YA 3IQCA 1MNDA 2RD9A 2XLMA 4K7BA 4O6YA 4EWCA 1VK5A 1WASA 2EIKC 2O9XA 3EFOA 1I4ZA 1UFBA 3L34A 4X0RA 3JYYA 1LS4A 2UUIA 4AE4A 1E85A 1JR8A 2MWQA 5A6BD 3U0CA 2LQGA 1EQ1A 1DOVA 1L3PA 4G0HA 2XXAB 3MFNA 3Q6MA 2XM0A 2XL6A 5JS5A 2Y3HA 3DZAA 5KYUB 3OA1A 4JIOA 1DOWA 4BEMJ 5KYUA 1A41A 3ZSUA 1PD1A 5B3IA 1TWHA 3AQCA 2X51A 4EBBA 2VASA 1LE2A 2XL8A 1NG1A 2MYSA 3KYIA 4NC3A 3F47A 4E17A 5A6AA 1RMVA 4G7OF 4OIQF 3S9OA 2HV6A 1HMOA 1VYIA 1D1BA 3PCVA 4MVZA 5JRAA 3CQZA 1SYQA 2JD3A 4MW8A 2CCYA 2J0WA 1OCOC 4U5CE 3T4RA 2KYHA 1T01A 1FTSA 2IM8A 4JTAB 1WOLA 1Y6DA 4OIRF 3T6GB 3NG1A 4PJMA 5L0FA 1VTMP 2NSGA 1OCCC 1S05A 2LK4A 1QLEC 5HSWA 2HMQA 2R7OA 2OEVA 4JC7A 4LDRA 4Z9IA 4CS7A 1LKXA 4IWBA 2XLDA 1ORJA 2PBEA 3H65A 1TFKB 3RF3A 2IYLD 4FX5A 3GEIA 3RVYA 2NPUA 1J8MF 1OW6A 2Q7RA 1LE4A 3T6JA 3RH3A 3ASNC 3K33A 3K66A 3DE8A 1H9TA 1CPQA 4JRZA 3U9JA 3GWLA 4MTOA 1NU7D 2Y3DA 2Y3GA 3KH2A 4NY3A 3W8IA 3WAQA 2B0JA 2UUHA 3CSKA 2ZD9A 2DYRC 2J7PD 4FESA 1TQGA 2L7AA 1VLSA 3TD7A 2R7VA 3LLIA 1KU2A 2A0UA 3Q6NA 2EIJC 2IOQA 2Q9AA 1FR0A 4I1OB 4DBRA 1R4TA 2DB4A 3AJMA 5HV9A 1FMVA 4U9DA 4EKWA 1G8XA 2QTVA 4NTBA 1QZXA 3SEOA 1T9KA 4JEAA 5KYWB 1APCA 1PV3A 5A6KA 5DS4A 1YYJA 3E70C 3UMKA 3I5PA 4OINF 4YL3A 4RBNA 4KI2A 2R7XA 3Q7GA 4I3MA 2PX0A 4U5BE 3H2UA 2J45A 3V5ZA 4JTDB 4C3DA 4E7ZA 3DMDA 4JEBA 2XLOA 1O87A 5IY5C 2OEXA 4MW3A 1N1CA 4J7TA 4N06A 3V5XA 3G4ZA 4AL1A 1NU9C 3AGUA 3X2QC 1BR1A 1U0BB 2OJQA 2YWAA 1NZEA 4WGYA 1ZZPA 1ZW3A 3JZ0A 3DI5A 3L0IA 4IARA 2L9JA 4M63A 4U5HA 3R7CA 5A6BA 5L0JA 3QVZA 4O7GA 2I8BA 4ANJA 5T3TA 3EQLF 3RW0A 3HNKA 3HKKA 4ZLCA 1YDIA 1HE1A 2WL8A 3ECSA 1ORSC 3AG4C 1VLTA 3M1CB 4WGZA 3U3FA 3EHNA 1D0ZA 1E83A 2F22A 4E0IA 1M2OA 4PACA 5E33A 2R7WA 3M15A 3PMRA 4LLEA 3ZC4A 2XLHA 3NRHA 1PCXA 1B68A 3UGOA 3B0VC 1C03A 1ZHYA 2QE9A 4MVMA 4OD5A 3DXJF 1CPRA 1YZAA 3ABKC 3U5SA 4YT8A 3FAJA 5DS5A 2ZXRA 2Q9CA 4JKVA 3HNIA 2A6HF 3SXZA 4G7HF 2YQYA 4Q5SF 3HLZA 2PX3A 1SR2A 3JYHA 3IHUA 2V3CC 4N6CA 3EG9A 2YLDA 4Z9JA 1UG7A 1YA7O 5F28E 3RFYA 4BJ6C 5JLIA 4MTGA 4JCZA 2HSQA 1A7EA 3EH1A 4HFFB 3W2WA 5L3QA 1A0BA 2WZFA 4G78A 1D1AA 4CS9A 2D5RB 3R2PA 3SXKA 2DI3A 4J30B 5FCLA 1C02A 3M4BA 1QQ3A 3ITFA 1BR2A 2L81A 2ZXOA 3N0TA 3QMKA 4PJLA 5T3WA 5DLJA 4YT4A 3UGPA 4DJ9A 2J7PA 5JT4A 1AVOB 4I1MA 4O6MA 4YL1A 4BJ5A 4CDAA 1FAPB 3CZ6A 2HUJA 3KYJA 4BPMA 2ZXWC 2P1AA 3AQBA 1TWAA 3EFOB 2OKUA 3G4XA 4AE4B 4H54A 4CBEA 1YVIA 2WB7A 4HEAJ 4AK9A 5DS6A 3UNGC 2CDQA 1JMWA 2GDCA 4BEJA 4NTFA 3B0PA 4YWQA 2LFDA 2C04A 3JSZA 1VB5A 2HMZA 4O79A 2KSFA 2LD6A 4N6HA 3C63A 4CS8A 2TMVP 4AL0A 2R25A 1V4AA 5L0CA 3GORA 1CGOA 1M2VA 4XLPF 2ZXPA 1D0XA 2Q4FA 4J7YA 5D92A 1TKNA 4ONSA 3IEEA 1ZHTA 3A9CA 4HE8D 1T6QA 2WVNA 3ABLC 2QLAA 1VMAA 1HW2A 2KW3C 3FOPA 1WWPA 3WHNA 3U2LA 3MYFA 4K0DA 5K0IA 1G4US 4OIOF 3C18A 2FGYA 5L0GA 5DVWA 4KNVA 2Q9BA 3BRJA 2R7UA 3C7JA 3ASOC
chains in the Genus database with same CATH topology
2YL0A 2XLEA 4U9DA 3QW1A 5JVEA 1QPUA 3QVYA 2YL1A 5JUAA 4JEAA 1APCA 2YL7A 1YYJA 3ZWIA 3NMIA 2J9BA 4JEBA 2XLOA 2YL3A 1YYXA 1BBHA 1JAFA 2YKZA 3VRCA 4WGYA 4IARA 4EIYA 1MQVA 3QVZA 2BC5A 3NMJA 4D4XA 4CJGA 3HNKA 3M4CA 1YZCA 3FOOA 3U8PA 4WGZA 1E83A 3IQ5A 1A7VA 3M15A 1E84A 2XLHA 4IAQA 4CDYA 2YLIA 3C62A 2XM4A 4IB4A 3ZTZA 4CDVA 1CPRA 1YZAA 1LM3B 4JKVA 3HNIA 2XLMA 2XLVA 3DE9A 3M79A 1E85A 1M6TA 1NBBA 2YLDA 5JLIA 1RCPA 2XL6A 2XM0A 5JS5A 4CX9A 5JP7A 4N4WA 4JE9A 3HNLA 5B3IA 2XL8A 1EKYA 3ZQYA 4NC3A 3M4BA 3HNJA 1QQ3A 3IQ6A 3QW0A 4CIPA 4D4NA 5JT4A 2XLWA 5JRAA 4CDAA 2CCYA 4U9EA 4L6RA 1CGNA 1GQAA 4ULVA 4ER9A 1S05A 5JSLA 3L1MA 3TOMA 2J8WA 4N6HA 3ZTMA 3C63A 2XLDA 4CJOA 1CGOA 3NMKA 2YLGA 5AGFA 3DE8A 2QLAA 1CPQA 3TOLA 3FOPA 256BA 3ZQVA 1E86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL0 A;  2XLE A;  4U9D A;  3QW1 A;  5JVE A;  1QPU A;  3QVY A;  2YL1 A;  5JUA A;  4JEA A;  1APC A;  2YL7 A;  1YYJ A;  3ZWI A;  3NMI A;  2J9B A;  4JEB A;  2XLO A;  2YL3 A;  1YYX A;  1BBH A;  1JAF A;  2YKZ A;  3VRC A;  4WGY A;  4IAR A;  4EIY A;  1MQV A;  3QVZ A;  2BC5 A;  3NMJ A;  4D4X A;  4CJG A;  3HNK A;  3M4C A;  1YZC A;  3FOO A;  3U8P A;  4WGZ A;  1E83 A;  3IQ5 A;  1A7V A;  3M15 A;  1E84 A;  2XLH A;  4IAQ A;  4CDY A;  2YLI A;  3C62 A;  2XM4 A;  4IB4 A;  3ZTZ A;  4CDV A;  1CPR A;  1YZA A;  1LM3 B;  4JKV A;  3HNI A;  2XLM A;  2XLV A;  3DE9 A;  3M79 A;  1E85 A;  1M6T A;  1NBB A;  2YLD A;  5JLI A;  1RCP A;  2XL6 A;  2XM0 A;  5JS5 A;  4CX9 A;  5JP7 A;  4N4W A;  4JE9 A;  3HNL A;  5B3I A;  2XL8 A;  1EKY A;  3ZQY A;  4NC3 A;  3M4B A;  3HNJ A;  1QQ3 A;  3IQ6 A;  3QW0 A;  4CIP A;  4D4N A;  5JT4 A;  2XLW A;  5JRA A;  4CDA A;  2CCY A;  4U9E A;  4L6R A;  1CGN A;  1GQA A;  4ULV A;  4ER9 A;  1S05 A;  5JSL A;  3L1M A;  3TOM A;  2J8W A;  4N6H A;  3ZTM A;  3C63 A;  2XLD A;  4CJO A;  1CGO A;  3NMK A;  2YLG A;  5AGF A;  3DE8 A;  2QLA A;  1CPQ A;  3TOL A;  3FOP A;  256B A;  3ZQV A;  1E86 A; 
#chains in the Genus database with same CATH topology
 3RIP A;  4EHP A;  2P61 A;  5A69 A;  2Q00 A;  2DYS C;  2XLE A;  3LJB A;  4P9F A;  2OQM A;  2YVK A;  3QW1 A;  4R32 A;  3OEO A;  1ZW2 A;  3ZVR A;  1SF8 A;  1Z6A A;  4JCH A;  4I44 A;  5TJ5 E;  3RQG A;  3DM9 B;  4PFP A;  4QI2 A;  3NMI A;  2LCH A;  1SMY F;  1NFN A;  2G3V A;  1OKK D;  2NG1 A;  3AG1 C;  4YJW A;  1T6U A;  2J46 A;  3K1I A;  4MVQ A;  3LES A;  3X1O A;  3SYN A;  3JTL O;  4E0H A;  3TUL A;  3W2V A;  2OJE D;  2YL3 A;  2Z15 A;  1BBH A;  1MMN A;  5KYN A;  4Z9H A;  3O10 A;  5L3V A;  3EGD B;  1T5O A;  1MMG A;  2PP4 A;  4DBQ A;  3EGD A;  1WN0 A;  3VRC A;  4PJN A;  4JJF A;  4DOZ A;  1OCZ C;  3DAG A;  4YT2 A;  5CIV A;  1U6H A;  1TWG A;  4U5G A;  2BC5 A;  4D4X A;  4CJG A;  2R05 A;  3DJU B;  4BG0 A;  4CSA A;  3US6 A;  3VAY A;  2HJ3 A;  2P0N A;  2R7R A;  1W2W A;  3AG3 C;  3LS0 A;  4LAC B;  3T9O A;  3FVY A;  1OXK A;  5KYX A;  2YHS A;  3MX3 A;  4QDL A;  2C03 A;  3IQ5 A;  2ICW G;  5DQZ A;  1Z3I X;  1HMD A;  3L8J A;  3S27 A;  3LLK A;  4PK4 A;  4IAQ A;  2M4E A;  4OD4 A;  4EUK B;  3RQE A;  2XM4 A;  3TJ5 A;  1FNT c;  2LSE A;  3WOD F;  2LFF A;  1LPE A;  1Q0D A;  1T6I A;  5L0I A;  1M57 C;  1TWC A;  2XLV A;  1TFO B;  3KKB A;  3DE9 A;  2HJM A;  1OQC A;  3RYL A;  1YA9 A;  2XS1 A;  1JPN A;  4LER A;  3JRT A;  2VCA A;  1G5Z A;  2IXN A;  1YAR O;  3EZH A;  1BDJ B;  1M6T A;  2Y3B A;  3LNR A;  4GYT A;  5B1B C;  5EHH A;  5A6J A;  4DRH B;  1RCP A;  1RJ9 A;  2LIG A;  1SZI A;  2AU5 A;  2IBF A;  1C17 M;  2Y39 A;  3FAP B;  5JP7 A;  4JE9 A;  3FMS A;  1JRA A;  1U89 A;  3HNL A;  1NFO A;  4IJJ A;  5E3C A;  4Q4Z F;  4MVR A;  4LLC A;  1ZU4 A;  3LNM B;  5KYY A;  2R7T A;  3JT1 A;  3H2V A;  1VYK A;  2KNH A;  4O6N A;  3SXY A;  3I5Q A;  1LIH A;  3U8V A;  3ZQY A;  3LAY A;  5CI8 A;  3BEH A;  4U5F E;  1ST6 A;  3IQ6 A;  4CIP A;  4XTK A;  1OXB A;  1R5I D;  2JPU A;  2MHR A;  2NSF A;  1RXQ A;  4U9E A;  4EBK A;  3L8I A;  4L6R A;  4XPX A;  1BZ4 A;  4JJG A;  4MS2 A;  2L6F A;  3JRM O;  2PNO A;  2AP3 A;  3EG9 B;  3Q7L A;  4ULV A;  2JX0 A;  3JCU Q;  2NUP A;  2L6H A;  3L1M A;  4CS9 C;  3GEE A;  5FZT A;  2KJG A;  4WAB A;  1AUE A;  2J8W A;  4P9T A;  3ZG1 A;  1OW8 A;  1BR4 A;  3ZTM A;  3W4Y A;  4A2N B;  5D91 A;  1Q0F A;  4DXW A;  4OIP F;  3CEX A;  5CI9 A;  1OKK A;  4U5E E;  1KNY A;  1S7Z A;  3T6B A;  1K05 A;  2W4M A;  3C8G A;  3KMI A;  1JOG A;  2R7Q A;  3RKO F;  3B0U X;  5BUO A;  3LEO A;  2XSE A;  3NKE A;  3W8H A;  3GM3 A;  4IRU A;  256B A;  4EBJ A;  3NYM A;  1NSG B;  4DVZ A;  2HV7 A;  3I4U A;  1FFT C;  1IW7 F;  2AWY A;  5AC4 A;  3S90 A;  1MNE A;  5DQT A;  1H6G A;  1QSP A;  2B0H A;  1E86 A;  3N24 A;  3OWT A;  4B6I A;  4DRI B;  3VYW A;  4MVU A;  2GAQ A;  1GS9 A;  2P7V A;  1ZHZ A;  2XS8 A;  3NYJ A;  5JVE A;  1QPU A;  2YEV A;  3K6B A;  1GM5 A;  5JUA A;  1G4W R;  1XWJ A;  4KC9 A;  5AC5 A;  3EGX A;  4XEV A;  1CGM E;  2ZPA A;  3ZWI A;  4DVY P;  1M2V B;  1ZHW A;  3EHM A;  4PJJ A;  3A11 A;  4A4A A;  5L0H A;  3PDM P;  2E87 A;  2HKV A;  3O39 A;  1NLX A;  2J9B A;  2J0X A;  4YK5 A;  1KTM A;  1PD0 A;  4C3B A;  4W8K A;  1Y4C A;  3V5Y A;  4MND A;  4XEK A;  4E18 A;  3S29 A;  3AOU A;  4WJ0 A;  2EIN C;  5E3A A;  1OW7 A;  2H7V C;  1WAT A;  4JTC B;  4PFO A;  1ZYR F;  3ABM C;  3LS1 A;  4K1O A;  5EK0 A;  3K7D A;  2H7O A;  2OCC C;  3PHF 2;  2VB6 A;  2ETS A;  1QKR A;  3SP1 A;  3VF0 A;  2XXA A;  3AGT A;  3M4C A;  1YZC A;  3S28 A;  2A6E F;  3K1I C;  1Z7Q c;  2CGE A;  1LS1 A;  2HSB A;  3U8P A;  3EH2 A;  3NDB B;  1O3U A;  3GWN A;  3EPV A;  3IPM O;  4HFK B;  1E84 A;  2IXO A;  4RD9 A;  2CNW A;  2WZG A;  1OR3 A;  1ZVZ A;  2H8A A;  2IXM A;  3C8G D;  2P6V A;  2WZL A;  3GEH A;  3ZIB A;  1VOM A;  3GAN A;  4KNW A;  1K04 A;  4F4B A;  3GM1 A;  5GPG B;  1D1C A;  4ZLD A;  2J9V A;  2L6G A;  1A7D A;  3FXH A;  4PR9 A;  2VH3 A;  3GM2 A;  5BQI A;  2A0B A;  2CW0 F;  5COM A;  1F1M A;  3KPH A;  4CSA C;  2HFI A;  3M79 A;  4BJ1 A;  2ASR A;  2NUT B;  1HE9 A;  5EGY A;  2BL2 A;  2PFD A;  5F5H A;  2NUT A;  3CAX A;  1NBB A;  2EPL X;  2FFH A;  2Q3T A;  3U2M A;  3S0X A;  4AX2 A;  4QI0 A;  3MLG A;  4CX9 A;  1TR2 A;  2AWC A;  3UMI A;  2RSE B;  4N4W A;  4C3E A;  5KYX B;  4GQH A;  3O55 A;  3LEV A;  4MQ9 F;  3ZDL A;  1HY5 A;  2EPM X;  1FMW A;  4U5D E;  4J32 B;  1H9G A;  2W9Y A;  4ULW A;  1EKY A;  5COG A;  3FHD A;  4YL0 A;  2LP4 A;  2KK1 A;  2A1D D;  4Q7C A;  3HNJ A;  3RVZ A;  2VCC A;  2EPO A;  2X0C A;  1Z63 A;  3S84 A;  4XLN F;  1I4Y A;  3QW0 A;  1YLM A;  4JW1 A;  4NTA A;  4D4N A;  2XLW A;  3JSE O;  5F5F A;  2H7B A;  1V54 C;  1E2X A;  1CGN A;  4UDV A;  3U9M A;  2HZ8 A;  3J06 A;  1GQA A;  5T1D B;  3E9V A;  3U3B A;  1GGQ A;  4ER9 A;  2GWW A;  1RJ9 B;  5JSL A;  3VM6 A;  1V55 C;  2CYD A;  1LI7 A;  1RKC A;  2G3K A;  3B9Q A;  5B1A C;  3TOM A;  3DWW A;  4XPY A;  4E7S A;  2EPK X;  3O6X A;  3EJN A;  5KYW A;  3QZC A;  1Z23 A;  1ZHX A;  5BQG A;  2R7S A;  4CJO A;  4BJT A;  5KYY B;  2XL4 A;  3K1H A;  3NMK A;  2YLG A;  2A69 F;  2HS5 A;  4FWV A;  1V74 B;  3EZI A;  1LI5 A;  4P6I C;  5AGF A;  3TK0 A;  3TQO A;  2BE5 F;  1WTY A;  1K40 A;  3MBG A;  2CNW D;  2A68 F;  3N2Z B;  3TOL A;  3NKD A;  4XQ1 A;  4XWJ A;  2EIM C;  1O5H A;  4JZA A;  2PF4 E;  3B29 A;  1L7C A;  2J9U A;  2KQ9 A;  2QNL A;  3RQF A;  3DJN B;  3KL4 A;  3ZQV A;  2YZS A;  2YL0 A;  1YJG A;  1WGW A;  2OG2 A;  1IZM A;  5BQH A;  2AVK A;  1FFH A;  4MVO A;  2NUP B;  3V7O A;  2XRH A;  3G50 A;  3QVY A;  1HW1 A;  2YL1 A;  3TJ6 A;  1ZU5 A;  2YRF A;  4C7O B;  2GA0 A;  3UR3 C;  1I5N A;  2G62 A;  2VCB A;  2YL7 A;  3DD7 A;  4XEF A;  4KBL A;  4DRJ B;  2DGJ A;  2R02 A;  4C7O A;  3C8G B;  2R9R B;  5B3S C;  3GOD A;  3F46 A;  1MMD A;  2QY9 A;  3MYI A;  4JVS A;  4IGG A;  1J8Y F;  1XZQ A;  1H7I A;  4YT5 A;  4IAO A;  4BJ5 C;  1YYX A;  3FDQ A;  1ORY A;  2J9W A;  1JAF A;  1Q0M A;  1QVX A;  4MVS A;  3B71 A;  2M64 A;  2Y69 C;  2FAP B;  2YKZ A;  3DKA A;  4JUR I;  2IXP A;  4NQF A;  4MTF A;  4W8P A;  4G7Z F;  3DM5 A;  2WVO A;  4CIH A;  3POV A;  3C8Z A;  1EI7 A;  2D4U A;  3HJC A;  1MQV A;  4EIY A;  5L0D A;  4LDK A;  3NMJ A;  1JPJ A;  1Q0K A;  4YN0 B;  4CS8 C;  3IQT A;  3AG2 C;  3NYL A;  5E2Q A;  1XZP A;  3DAF A;  3HTK C;  2EPN A;  2OOC A;  2KC3 A;  1AEP A;  3EGX B;  1OCR C;  3FOO A;  1LVK A;  3QTH A;  2R03 A;  4BJ6 A;  2OU6 A;  3SXM A;  1A7V A;  3WG7 C;  2W4B A;  1Z5Z A;  5COF A;  1EA8 A;  4RDA A;  4FAP B;  1RKE B;  4NCQ A;  2V26 A;  2W45 A;  1YAU O;  4GEH A;  1OR2 A;  1Q0G A;  4XPW A;  1RKE A;  2WVQ A;  4CDY A;  2YLI A;  3C62 A;  4H4K C;  4IB4 A;  4LDQ A;  2EIL C;  3ZTZ A;  4CDV A;  1M56 C;  1MMA A;  3SNH A;  2I15 A;  3UMH A;  3LUT B;  3SZR A;  2VC9 A;  2KGO A;  2GFH A;  1LM3 B;  2QUP A;  3ATP A;  1D0Y A;  3IQC A;  1MND A;  2RD9 A;  2XLM A;  4K7B A;  4O6Y A;  4EWC A;  1VK5 A;  1WAS A;  2EIK C;  2O9X A;  3EFO A;  1I4Z A;  1UFB A;  3L34 A;  4X0R A;  3JYY A;  1LS4 A;  2UUI A;  4AE4 A;  1E85 A;  1JR8 A;  2MWQ A;  5A6B D;  3U0C A;  2LQG A;  1EQ1 A;  1DOV A;  1L3P A;  4G0H A;  2XXA B;  3MFN A;  3Q6M A;  2XM0 A;  2XL6 A;  5JS5 A;  2Y3H A;  3DZA A;  5KYU B;  3OA1 A;  4JIO A;  1DOW A;  4BEM J;  5KYU A;  1A41 A;  3ZSU A;  1PD1 A;  5B3I A;  1TWH A;  3AQC A;  2X51 A;  4EBB A;  2VAS A;  1LE2 A;  2XL8 A;  1NG1 A;  2MYS A;  3KYI A;  4NC3 A;  3F47 A;  4E17 A;  5A6A A;  1RMV A;  4G7O F;  4OIQ F;  3S9O A;  2HV6 A;  1HMO A;  1VYI A;  1D1B A;  3PCV A;  4MVZ A;  5JRA A;  3CQZ A;  1SYQ A;  2JD3 A;  4MW8 A;  2CCY A;  2J0W A;  1OCO C;  4U5C E;  3T4R A;  2KYH A;  1T01 A;  1FTS A;  2IM8 A;  4JTA B;  1WOL A;  1Y6D A;  4OIR F;  3T6G B;  3NG1 A;  4PJM A;  5L0F A;  1VTM P;  2NSG A;  1OCC C;  1S05 A;  2LK4 A;  1QLE C;  5HSW A;  2HMQ A;  2R7O A;  2OEV A;  4JC7 A;  4LDR A;  4Z9I A;  4CS7 A;  1LKX A;  4IWB A;  2XLD A;  1ORJ A;  2PBE A;  3H65 A;  1TFK B;  3RF3 A;  2IYL D;  4FX5 A;  3GEI A;  3RVY A;  2NPU A;  1J8M F;  1OW6 A;  2Q7R A;  1LE4 A;  3T6J A;  3RH3 A;  3ASN C;  3K33 A;  3K66 A;  3DE8 A;  1H9T A;  1CPQ A;  4JRZ A;  3U9J A;  3GWL A;  4MTO A;  1NU7 D;  2Y3D A;  2Y3G A;  3KH2 A;  4NY3 A;  3W8I A;  3WAQ A;  2B0J A;  2UUH A;  3CSK A;  2ZD9 A;  2DYR C;  2J7P D;  4FES A;  1TQG A;  2L7A A;  1VLS A;  3TD7 A;  2R7V A;  3LLI A;  1KU2 A;  2A0U A;  3Q6N A;  2EIJ C;  2IOQ A;  2Q9A A;  1FR0 A;  4I1O B;  4DBR A;  1R4T A;  2DB4 A;  3AJM A;  5HV9 A;  1FMV A;  4U9D A;  4EKW A;  1G8X A;  2QTV A;  4NTB A;  1QZX A;  3SEO A;  1T9K A;  4JEA A;  5KYW B;  1APC A;  1PV3 A;  5A6K A;  5DS4 A;  1YYJ A;  3E70 C;  3UMK A;  3I5P A;  4OIN F;  4YL3 A;  4RBN A;  4KI2 A;  2R7X A;  3Q7G A;  4I3M A;  2PX0 A;  4U5B E;  3H2U A;  2J45 A;  3V5Z A;  4JTD B;  4C3D A;  4E7Z A;  3DMD A;  4JEB A;  2XLO A;  1O87 A;  5IY5 C;  2OEX A;  4MW3 A;  1N1C A;  4J7T A;  4N06 A;  3V5X A;  3G4Z A;  4AL1 A;  1NU9 C;  3AGU A;  3X2Q C;  1BR1 A;  1U0B B;  2OJQ A;  2YWA A;  1NZE A;  4WGY A;  1ZZP A;  1ZW3 A;  3JZ0 A;  3DI5 A;  3L0I A;  4IAR A;  2L9J A;  4M63 A;  4U5H A;  3R7C A;  5A6B A;  5L0J A;  3QVZ A;  4O7G A;  2I8B A;  4ANJ A;  5T3T A;  3EQL F;  3RW0 A;  3HNK A;  3HKK A;  4ZLC A;  1YDI A;  1HE1 A;  2WL8 A;  3ECS A;  1ORS C;  3AG4 C;  1VLT A;  3M1C B;  4WGZ A;  3U3F A;  3EHN A;  1D0Z A;  1E83 A;  2F22 A;  4E0I A;  1M2O A;  4PAC A;  5E33 A;  2R7W A;  3M15 A;  3PMR A;  4LLE A;  3ZC4 A;  2XLH A;  3NRH A;  1PCX A;  1B68 A;  3UGO A;  3B0V C;  1C03 A;  1ZHY A;  2QE9 A;  4MVM A;  4OD5 A;  3DXJ F;  1CPR A;  1YZA A;  3ABK C;  3U5S A;  4YT8 A;  3FAJ A;  5DS5 A;  2ZXR A;  2Q9C A;  4JKV A;  3HNI A;  2A6H F;  3SXZ A;  4G7H F;  2YQY A;  4Q5S F;  3HLZ A;  2PX3 A;  1SR2 A;  3JYH A;  3IHU A;  2V3C C;  4N6C A;  3EG9 A;  2YLD A;  4Z9J A;  1UG7 A;  1YA7 O;  5F28 E;  3RFY A;  4BJ6 C;  5JLI A;  4MTG A;  4JCZ A;  2HSQ A;  1A7E A;  3EH1 A;  4HFF B;  3W2W A;  5L3Q A;  1A0B A;  2WZF A;  4G78 A;  1D1A A;  4CS9 A;  2D5R B;  3R2P A;  3SXK A;  2DI3 A;  4J30 B;  5FCL A;  1C02 A;  3M4B A;  1QQ3 A;  3ITF A;  1BR2 A;  2L81 A;  2ZXO A;  3N0T A;  3QMK A;  4PJL A;  5T3W A;  5DLJ A;  4YT4 A;  3UGP A;  4DJ9 A;  2J7P A;  5JT4 A;  1AVO B;  4I1M A;  4O6M A;  4YL1 A;  4BJ5 A;  4CDA A;  1FAP B;  3CZ6 A;  2HUJ A;  3KYJ A;  4BPM A;  2ZXW C;  2P1A A;  3AQB A;  1TWA A;  3EFO B;  2OKU A;  3G4X A;  4AE4 B;  4H54 A;  4CBE A;  1YVI A;  2WB7 A;  4HEA J;  4AK9 A;  5DS6 A;  3UNG C;  2CDQ A;  1JMW A;  2GDC A;  4BEJ A;  4NTF A;  3B0P A;  4YWQ A;  2LFD A;  2C04 A;  3JSZ A;  1VB5 A;  2HMZ A;  4O79 A;  2KSF A;  2LD6 A;  4N6H A;  3C63 A;  4CS8 A;  2TMV P;  4AL0 A;  2R25 A;  1V4A A;  5L0C A;  3GOR A;  1CGO A;  1M2V A;  4XLP F;  2ZXP A;  1D0X A;  2Q4F A;  4J7Y A;  5D92 A;  1TKN A;  4ONS A;  3IEE A;  1ZHT A;  3A9C A;  4HE8 D;  1T6Q A;  2WVN A;  3ABL C;  2QLA A;  1VMA A;  1HW2 A;  2KW3 C;  3FOP A;  1WWP A;  3WHN A;  3U2L A;  3MYF A;  4K0D A;  5K0I A;  1G4U S;  4OIO F;  3C18 A;  2FGY A;  5L0G A;  5DVW A;  4KNV A;  2Q9B A;  3BRJ A;  2R7U A;  3C7J A;  3ASO C; 
#chains in the Genus database with same CATH homology
 2YL0 A;  2XLE A;  4U9D A;  3QW1 A;  5JVE A;  1QPU A;  3QVY A;  2YL1 A;  5JUA A;  4JEA A;  1APC A;  2YL7 A;  1YYJ A;  3ZWI A;  3NMI A;  2J9B A;  4JEB A;  2XLO A;  2YL3 A;  1YYX A;  1BBH A;  1JAF A;  2YKZ A;  3VRC A;  4WGY A;  4IAR A;  4EIY A;  1MQV A;  3QVZ A;  2BC5 A;  3NMJ A;  4D4X A;  4CJG A;  3HNK A;  3M4C A;  1YZC A;  3FOO A;  3U8P A;  4WGZ A;  1E83 A;  3IQ5 A;  1A7V A;  3M15 A;  1E84 A;  2XLH A;  4IAQ A;  4CDY A;  2YLI A;  3C62 A;  2XM4 A;  4IB4 A;  3ZTZ A;  4CDV A;  1CPR A;  1YZA A;  1LM3 B;  4JKV A;  3HNI A;  2XLM A;  2XLV A;  3DE9 A;  3M79 A;  1E85 A;  1M6T A;  1NBB A;  2YLD A;  5JLI A;  1RCP A;  2XL6 A;  2XM0 A;  5JS5 A;  4CX9 A;  5JP7 A;  4N4W A;  4JE9 A;  3HNL A;  5B3I A;  2XL8 A;  1EKY A;  3ZQY A;  4NC3 A;  3M4B A;  3HNJ A;  1QQ3 A;  3IQ6 A;  3QW0 A;  4CIP A;  4D4N A;  5JT4 A;  2XLW A;  5JRA A;  4CDA A;  2CCY A;  4U9E A;  4L6R A;  1CGN A;  1GQA A;  4ULV A;  4ER9 A;  1S05 A;  5JSL A;  3L1M A;  3TOM A;  2J8W A;  4N6H A;  3ZTM A;  3C63 A;  2XLD A;  4CJO A;  1CGO A;  3NMK A;  2YLG A;  5AGF A;  3DE8 A;  2QLA A;  1CPQ A;  3TOL A;  3FOP A;  256B A;  3ZQV A;  1E86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...