1M6TA

Crystal structure of b562ril, a redesigned four helix bundle
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Redesign of a Four-Helix Bundle Protein by Phage Display Coupled with Proteolysis and Structural Characterization by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2002-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1m6tA00
3ZQYA 5JSLA 3M79A 4IAQA 2BC5A 4NC3A 4D4XA 1A7VA 3DE9A 3ZTZA 2XL8A 2QLAA 4EIYA 3TOLA 4L6RA 1CGOA 1E85A 3M4CA 3QVZA 2YLGA 1CPQA 2XM4A 3IQ5A 3M4BA 1E86A 5JLIA 5JT4A 2XLVA 4U9EA 1CPRA 3ZWIA 1YZCA 3ZTMA 4N6HA 4WGZA 3M15A 3VRCA 3HNJA 1CGNA 4IARA 3FOOA 1S05A 4CDYA 2XLMA 3QW0A 4JKVA 1BBHA 5JP7A 5JS5A 4CIPA 1APCA 5AGFA 4CJOA 2CCYA 3IQ6A 2YLIA 4JE9A 3FOPA 1MQVA 1YZAA 4CDAA 3QVYA 2XLEA 3HNIA 4U9DA 4CJGA 3HNLA 1E84A 1GQAA 2YL1A 1M6TA 4WGYA 4ULVA 1RCPA 2YLDA 2J8WA 2XLOA 3C62A 2J9BA 3DE8A 4JEAA 2XLWA 4CDVA 1YYXA 5B3IA 3QW1A 2YL0A 5JVEA 3NMKA 3C63A 2XM0A 4IB4A 4D4NA 1YYJA 2XL6A 2YL7A 5JUAA 3U8PA 1EKYA 4CX9A 2XLHA 3NMIA 3TOMA 2XLDA 1NBBA 3L1MA 1QQ3A 4ER9A 5JRAA 1JAFA 4N4WA 1E83A 1QPUA 4JEBA 3ZQVA 3HNKA 2YKZA 1LM3B 256BA 3NMJA 2YL3A
chains in the Genus database with same CATH superfamily
4G7ZF 3HKKA 3ZC4A 2KK1A 2JD3A 4OIRF 3RQFA 3ZQYA 5JSLA 3M79A 2KYHA 5L0FA 1J8YF 1OR2A 4P9TA 3IQCA 4LERA 1OR3A 4O79A 1HW2A 4PR9A 2HKVA 3UR3C 3ZTZA 5CI9A 2P61A 3CZ6A 1MNEA 2IOQA 3RKOF 1WOLA 1Q0FA 4EIYA 2C03A 5GPGB 5KYXA 2J9UA 3ZSUA 3IHUA 3O55A 4WJ0A 3K1HA 4IGGA 4NTAA 2PNOA 4CS9A 4G7OF 3T4RA 2YZSA 1Z7Qc 3QVZA 1XZPA 4I44A 1JPJA 3R2PA 4OD5A 1OXBA 3AG4C 2XSEA 2XM4A 3DAGA 3IQ5A 4NQFA 3M4BA 1E86A 2EIKC 3MFNA 3MLGA 1HE9A 2Q7RA 4EHPA 2GAQA 3W2VA 5HSWA 1RMVA 3ZWIA 2B0HA 2JPUA 3FAJA 1RKEA 1VLTA 3GEEA 4EWCA 1C03A 4JCZA 1RKEB 4NCQA 2LCHA 4MTOA 1U6HA 2VH3A 1XWJA 2R03A 3LESA 4X0RA 2P1AA 4IARA 2EIMC 2ZXRA 3Q7GA 4OIQF 3GANA 2NPUA 2R7QA 4AX2A 2LQGA 1ZVZA 4MVZA 4N06A 3PCVA 4R32A 4XPYA 2YRFA 3DI5A 4O6NA 5T1DB 2Y3BA 2OJED 2HV6A 2XXAB 3NKEA 2NUTB 3EFOB 2R9RB 1OW8A 1M2OA 5JS5A 2BE5F 2HZ8A 2NUPB 3CEXA 5EK0A 2XXAA 5AC4A 2WVQA 2R7TA 1K05A 2Y39A 3X1OA 3AOUA 5T3WA 1A7DA 3ABLC 3DMDA 3POVA 2GFHA 1SF8A 2OOCA 4CSAC 1T6QA 4JE9A 3DM5A 3RF3A 2L6GA 2X0CA 3DJNB 4JZAA 1BR4A 1F1MA 4JJGA 1QZXA 2EPKX 2L6HA 4YL1A 4CDAA 4YJWA 1D0ZA 1VB5A 4I3MA 4C3BA 2FAPB 4DVZA 2XLEA 4A2NB 2OKUA 1LI7A 2J9VA 3EJNA 3GM3A 4JJFA 4XTKA 3ASOC 4U5EE 4YN0B 3DXJF 4IAOA 1EQ1A 2HMQA 3L0IA 2LFFA 3TJ6A 1VOMA 2Y69C 1ZHTA 2W45A 1RCPA 3B0VC 3KH2A 4W8KA 3U2MA 2YLDA 3ZG1A 1L7CA 2HSQA 1OCCC 3G4ZA 1WN0A 2YVKA 4JEAA 2XLWA 2EPMX 5K0IA 5AC5A 3ATPA 4JCHA 1EA8A 2X51A 4KNVA 5B3IA 1VYKA 2KJGA 3C8GA 4BJ6A 3QTHA 4ONSA 2YL0A 3K6BA 2M4EA 1OQCA 3OEOA 4I1OB 4JW1A 3VAYA 4BEMJ 2LK4A 4YT4A 1BDJB 3C8GB 4LDRA 5E3CA 5JVEA 1ZHWA 3N2ZB 3KYJA 5L0CA 2I15A 4EKWA 2V3CC 4KI2A 1JMWA 3B71A 2PX3A 3JRMO 1RXQA 4MVQA 2HFIA 3T6BA 1VMAA 2HV7A 2FFHA 3ABMC 3U3FA 1YYJA 2XL6A 3MYIA 3H65A 1YVIA 1T6IA 2OQMA 4QI0A 5D91A 1FFHA 2XLHA 1JRAA 1Q0KA 4MTGA 4XEFA 1Q0DA 1YARO 1LKXA 4NTFA 1ZHXA 1WASA 5DS5A 5IY5C 4MVUA 2G3KA 3M1CB 3NYLA 5DLJA 3T9OA 5A6BA 1YA7O 1KNYA 4ZLDA 1FFTC 2HMZA 3X2QC 3ZIBA 1JAFA 1AVOB 1QPUA 1LE4A 1OKKD 4KC9A 2NG1A 4LLCA 4XQ1A 3HJCA 2C04A 2CW0F 1AEPA 5BQIA 2L9JA 2YL3A 1LIHA 1FMVA 3RYLA 2KC3A 4CS7A 2W4MA 2A6HF 2CNWA 2ZPAA 4NC3A 2VCAA 3EGDB 1A7VA 3RVZA 3GODA 3J06A 3DE9A 2ZXWC 2QLAA 1MNDA 1NU7D 2IXMA 2B0JA 2KQ9A 3LLKA 3LS1A 3U0CA 4L6RA 4K7BA 4FAPB 4CIHA 3TK0A 1Y6DA 3N24A 2D5RB 5KYUA 2PBEA 1Z23A 2YLGA 4PJMA 4OIPF 5KYYA 4GEHA 2KW3C 3DWWA 3EGXA 3LS0A 1HW1A 3FDQA 1I5NA 1T6UA 4E18A 4U9EA 3I4UA 3EGXB 3RH3A 4MVRA 4A4AA 1RJ9B 2WZLA 2ZXOA 1YAUO 2UUHA 1AUEA 4QDLA 3ZTMA 1DOWA 4N6HA 4RD9A 3T6GB 2AWCA 2R7WA 1HMOA 3O39A 4P9FA 3G50A 3V5ZA 1C17M 4AE4A 1CGNA 3ECSA 2ZXPA 3LUTB 5COFA 4U5DE 4CSAA 1V74B 2CYDA 4XLNF 3FOOA 2H7VC 4H54A 4AE4B 2AU5A 4CDYA 4C7OB 1B68A 3EHMA 4FX5A 3LNMB 3VM6A 5JP7A 1SR2A 4PJLA 2LD6A 1YLMA 4C3EA 1ZZPA 2A68F 3K33A 4U5FE 5L0IA 1Y4CA 5F5FA 4CIPA 1NG1A 4IWBA 3SZRA 3WG7C 4JTAB 2EINC 1ZHYA 3FMSA 2PFDA 4BG0A 3QVYA 4RBNA 3U8VA 4F4BA 5A6KA 1JR8A 1O87A 1TWCA 2Q00A 2QY9A 1VK5A 3H2UA 4U9DA 4JIOA 1NFNA 2AWYA 2KNHA 1LPEA 2IXNA 2Q9AA 1FNTc 1TFOB 2YL1A 2VASA 1BR1A 2GA0A 3WHNA 3ITFA 1M56C 3H2VA 2OEXA 3L8JA 3NRHA 1MMGA 4JTCB 1ZYRF 3GWLA 2NUTA 3S90A 1NU9C 1SMYF 1ZU4A 2DGJA 3EFOA 1E2XA 1VTMP 5HV9A 4NY3A 2ASRA 2NUPA 2Z15A 3RIPA 2F22A 1FR0A 3EHNA 1YDIA 2L81A 3Q6NA 4XEKA 2RSEB 1PCXA 4FWVA 4YL0A 4AK9A 4QI2A 2DB4A 2MYSA 1OXKA 3JTLO 2L6FA 1L3PA 2ZD9A 3A9CA 5COMA 2R7RA 3B0PA 3DM9B 1I4ZA 2UUIA 4G0HA 1UG7A 3F47A 2XM0A 3K7DA 3S84A 3UGOA 2Q4FA 3NYMA 4J7YA 4XPXA 1TWHA 3IQTA 3L34A 4LDQA 2Y3DA 4PJJA 4BJ5C 2ETSA 2R7VA 5A6AA 4Z9HA 2J0WA 1T5OA 1LI5A 1QVXA 1N1CA 2G3VA 2A0BA 4YT5A 3TQOA 4ANJA 3SNHA 2XS8A 1ORJA 4U5CE 4HE8D 4CX9A 3U2LA 3NMIA 3S28A 3UMHA 4DBRA 4XLPF 2Y3HA 4ULWA 1WGWA 2J9WA 1RKCA 4OIOF 1PV3A 1W2WA 2YEVA 3C8GD 3L1MA 4UDVA 3LLIA 2DI3A 2OEVA 2RD9A 4MTFA 1H9GA 5COGA 5JRAA 2H7BA 3SXYA 3EPVA 1E83A 3HNKA 2YKZA 2YQYA 3FAPB 4I1MA 4MVMA 5L3VA 2HS5A 2GDCA 4DVYP 1OCZC 1LM3B 1QSPA 4PK4A 1GM5A 3VF0A 3GM2A 3UNGC 4OD4A 3K66A 2CDQA 5BUOA 1G5ZA 4IAQA 1WWPA 2E87A 1XZQA 4D4XA 2YHSA 1M57C 2A0UA 3ZVRA 2KGOA 2XL8A 2XS1A 3SYNA 3SP1A 4ZLCA 2WVOA 5A6BD 2A6EF 4YK5A 2XL4A 2CGEA 4IRUA 4BJTA 1E85A 1CGOA 3FXHA 3EG9A 3ZDLA 2O9XA 2Q3TA 3HLZA 5BQHA 2J7PD 2H7OA 3EG9B 4KBLA 5D92A 4BEJA 5DS6A 4DXWA 3AG3C 3GM1A 4JURI 4KNWA 2ICWG 5JLIA 2CNWD 3L8IA 2XLVA 4MW8A 2TMVP 1SYQA 4DRIB 3C7JA 5FCLA 2BL2A 1NZEA 2HSBA 2YWAA 3B29A 1J8MF 3EGDA 3VRCA 4Z9JA 5EHHA 1TFKB 4MVSA 3EH1A 1OW6A 2WB7A 3QZCA 2QUPA 3U5SA 1PD1A 5DQTA 4XPWA 3K1IC 1CGME 1NSGB 3EH2A 2VCCA 3DD7A 1KTMA 1VLSA 1WTYA 4MVOA 2XLMA 1A7EA 3JT1A 3NKDA 1BBHA 1DOVA 3S9OA 4E0HA 2IBFA 3EZIA 3U9MA 1OCOC 1U89A 5KYNA 5AGFA 4CJOA 1T01A 2CCYA 2VCBA 4AL0A 3IQ6A 5DVWA 1IZMA 1TR2A 4JTDB 3TD7A 4BPMA 1RJ9A 4MS2A 2P0NA 3FOPA 1FMWA 2HJ3A 1V55C 1YZAA 3I5QA 3RFYA 2IM8A 4EBBA 4DRHB 1FTSA 4Q5SF 4MW3A 2NSGA 5T3TA 5KYWB 1Z63A 3EZHA 1Q0GA 3LNRA 3B0UX 2HUJA 1UFBA 3HNLA 1E84A 3CAXA 3BRJA 1M6TA 4EBJA 4E7SA 2LIGA 2EPNA 4H4KC 5L0HA 3TULA 2EPLX 4XWJA 2J46A 2WZFA 4GYTA 1D0YA 3SEOA 2QE9A 4C7OA 1HMDA 1MMNA 4YT8A 4CS8C 4FESA 2LFDA 5DS4A 2XLOA 1D0XA 2P7VA 3O6XA 2R25A 3ABKC 4MQ9F 2J9BA 3DE8A 4PFPA 4BJ5A 3PDMP 3MYFA 2PF4E 1YYXA 3AGUA 1V4AA 3LJBA 3FVYA 3QW1A 3OA1A 4NTBA 5DQZA 3EQLF 1ORSC 3LAYA 1O3UA 5E33A 1I4YA 4DBQA 3JYHA 1NLXA 1YA9A 4LACB 5E3AA 3NMKA 3DKAA 1ZW2A 4J30B 3GWNA 1YJGA 2MHRA 2R02A 2LP4A 1Z5ZA 4O6MA 2FGYA 4D4NA 3AG1C 5A69A 5B1AC 3US6A 3U8PA 2MWQA 5L0JA 4EUKB 5FZTA 5L0DA 1D1AA 2GWWA 1U0BB 2Q9CA 5KYXB 2XLDA 1LE2A 1NBBA 4K0DA 3IPMO 1D1CA 2A69F 2J0XA 3I5PA 4XEVA 2IXOA 3JZ0A 1QQ3A 4ER9A 2HJMA 3AJMA 2I8BA 1M2VA 2IYLD 1S7ZA 3BEHA 4O7GA 3R7CA 2DYSC 3RQEA 3V5XA 2AVKA 3C18A 1QKRA 2KSFA 2OJQA 3AQCA 1M2VB 3G4XA 3NG1A 3PMRA 2J45A 3NMJA 1V54C 1H7IA 4LLEA 3S0XA 3F46A 1GGQA 2IXPA 3UMKA 2WZGA 5BQGA 4N6CA 2BC5A 4B6IA 5A6JA 2PP4A 5F5HA 2P6VA 3KYIA 2AP3A 2WL8A 1K40A 1LS1A 2OCCC 5F28E 3U9JA 4K1OA 1VYIA 1PD0A 3E9VA 2LSEA 4U5BE 3TOLA 5B1BC 3AG2C 2XRHA 4Q4ZF 1D1BA 1TKNA 2PX0A 3PHF2 4HFKB 3KMIA 5CI8A 5CIVA 2R7OA 3IEEA 4HFFB 3V7OA 1H6GA 1HY5A 3M4CA 3S29A 4AL1A 1LVKA 4WABA 1H9TA 2VC9A 3LEOA 2OG2A 3JCUQ 3K1IA 1CPQA 3Q6MA 4MNDA 2R05A 3T6JA 4JVSA 3WAQA 5JT4A 1CPRA 4GQHA 1YZCA 3B9QA 4M63A 1TQGA 2NSFA 2WVNA 1TWAA 3OWTA 4U5HA 4WGZA 3M15A 1MMDA 4CS9C 3DAFA 3MX3A 3GEHA 1A41A 3HNJA 4JRZA 4YWQA 2L7AA 1Q0MA 3KPHA 4RDAA 3TJ5A 1EI7A 4DRJB 1G4US 3N0TA 1K04A 1JPNA 1WATA 3Q7LA 4J7TA 4YL3A 5E2QA 4BJ1A 1S05A 2OU6A 1BZ4A 3QW0A 2R7SA 4JKVA 3RVYA 1ZHZA 4J32B 3QMKA 1ZW3A 3UMIA 1T9KA 4E7ZA 3W2WA 2QTVA 1APCA 3FHDA 5EGYA 3AGTA 1NFOA 1G4WR 1ZU5A 4YT2A 1BR2A 2YLIA 1JOGA 3A11A 3JYYA 1IW7F 4U5GA 2D4UA 2JX0A 3JSZA 1MQVA 3RW0A 1Z6AA 1TWGA 3SXKA 4CS8A 3UGPA 3W8HA 3CSKA 3JSEO 3RQGA 4G78A 3HNIA 4PFOA 1SZIA 3SXZA 2W9YA 3JRTA 3LEVA 4CJGA 1A0BA 2G62A 1GQAA 3S27A 1KU2A 1MMAA 4WGYA 4ULVA 4W8PA 3U3BA 2H8AA 1C02A 4DJ9A 2DYRC 1QLEC 1OW7A 4OINF 1HE1A 2J8WA 4PJNA 1OCRC 2EPOA 4Q7CA 3AQBA 3C62A 2R7UA 1O5HA 4CBEA 2V26A 4CDVA 4P6IC 1FAPB 3V5YA 2Q9BA 1ORYA 4IJJA 2J7PA 1R4TA 3GORA 1R5ID 5KYWA 4E0IA 3C63A 4E17A 1OKKA 1G8XA 4HEAJ 3GEIA 4IB4A 4LDKA 5TJ5E 3WODF 3E70C 2EILC 3DJUB 4Z9IA 3VYWA 3DZAA 2YL7A 3NYJA 3SXMA 5B3SC 5JUAA 4EBKA 2A1DD 1ST6A 1EKYA 2R7XA 2VB6A 4JC7A 4BJ6C 5L3QA 3C8ZA 3TOMA 3W8IA 3ASNC 3HTKC 2QNLA 4O6YA 4G7HF 2EIJC 1LS4A 3W4YA 3NDBB 3CQZA 3KL4A 2M64A 4C3DA 4DOZA 5L0GA 5KYUB 3MBGA 2Y3GA 2W4BA 4N4WA 4PACA 1GS9A 4JEBA 3KKBA 3ZQVA 5KYYB 3O10A 256BA 1Z3IX
chains in the Genus database with same CATH topology
3ZQYA 5JSLA 3M79A 4IAQA 2BC5A 4NC3A 4D4XA 1A7VA 3DE9A 3ZTZA 2XL8A 2QLAA 4EIYA 3TOLA 4L6RA 1CGOA 1E85A 3M4CA 3QVZA 2YLGA 1CPQA 2XM4A 3IQ5A 3M4BA 1E86A 5JLIA 5JT4A 2XLVA 4U9EA 1CPRA 3ZWIA 1YZCA 3ZTMA 4N6HA 4WGZA 3M15A 3VRCA 3HNJA 1CGNA 4IARA 3FOOA 1S05A 4CDYA 2XLMA 3QW0A 4JKVA 1BBHA 5JP7A 5JS5A 4CIPA 1APCA 5AGFA 4CJOA 2CCYA 3IQ6A 2YLIA 4JE9A 3FOPA 1MQVA 1YZAA 4CDAA 3QVYA 2XLEA 3HNIA 4U9DA 4CJGA 3HNLA 1E84A 1GQAA 2YL1A 1M6TA 4WGYA 4ULVA 1RCPA 2YLDA 2J8WA 2XLOA 3C62A 2J9BA 3DE8A 4JEAA 2XLWA 4CDVA 1YYXA 5B3IA 3QW1A 2YL0A 5JVEA 3NMKA 3C63A 2XM0A 4IB4A 4D4NA 1YYJA 2XL6A 2YL7A 5JUAA 3U8PA 1EKYA 4CX9A 2XLHA 3NMIA 3TOMA 2XLDA 1NBBA 3L1MA 1QQ3A 4ER9A 5JRAA 1JAFA 4N4WA 1E83A 1QPUA 4JEBA 3ZQVA 3HNKA 2YKZA 1LM3B 256BA 3NMJA 2YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQY A;  5JSL A;  3M79 A;  4IAQ A;  2BC5 A;  4NC3 A;  4D4X A;  1A7V A;  3DE9 A;  3ZTZ A;  2XL8 A;  2QLA A;  4EIY A;  3TOL A;  4L6R A;  1CGO A;  1E85 A;  3M4C A;  3QVZ A;  2YLG A;  1CPQ A;  2XM4 A;  3IQ5 A;  3M4B A;  1E86 A;  5JLI A;  5JT4 A;  2XLV A;  4U9E A;  1CPR A;  3ZWI A;  1YZC A;  3ZTM A;  4N6H A;  4WGZ A;  3M15 A;  3VRC A;  3HNJ A;  1CGN A;  4IAR A;  3FOO A;  1S05 A;  4CDY A;  2XLM A;  3QW0 A;  4JKV A;  1BBH A;  5JP7 A;  5JS5 A;  4CIP A;  1APC A;  5AGF A;  4CJO A;  2CCY A;  3IQ6 A;  2YLI A;  4JE9 A;  3FOP A;  1MQV A;  1YZA A;  4CDA A;  3QVY A;  2XLE A;  3HNI A;  4U9D A;  4CJG A;  3HNL A;  1E84 A;  1GQA A;  2YL1 A;  1M6T A;  4WGY A;  4ULV A;  1RCP A;  2YLD A;  2J8W A;  2XLO A;  3C62 A;  2J9B A;  3DE8 A;  4JEA A;  2XLW A;  4CDV A;  1YYX A;  5B3I A;  3QW1 A;  2YL0 A;  5JVE A;  3NMK A;  3C63 A;  2XM0 A;  4IB4 A;  4D4N A;  1YYJ A;  2XL6 A;  2YL7 A;  5JUA A;  3U8P A;  1EKY A;  4CX9 A;  2XLH A;  3NMI A;  3TOM A;  2XLD A;  1NBB A;  3L1M A;  1QQ3 A;  4ER9 A;  5JRA A;  1JAF A;  4N4W A;  1E83 A;  1QPU A;  4JEB A;  3ZQV A;  3HNK A;  2YKZ A;  1LM3 B;  256B A;  3NMJ A;  2YL3 A; 
#chains in the Genus database with same CATH topology
 4G7Z F;  3HKK A;  3ZC4 A;  2KK1 A;  2JD3 A;  4OIR F;  3RQF A;  3ZQY A;  5JSL A;  3M79 A;  2KYH A;  5L0F A;  1J8Y F;  1OR2 A;  4P9T A;  3IQC A;  4LER A;  1OR3 A;  4O79 A;  1HW2 A;  4PR9 A;  2HKV A;  3UR3 C;  3ZTZ A;  5CI9 A;  2P61 A;  3CZ6 A;  1MNE A;  2IOQ A;  3RKO F;  1WOL A;  1Q0F A;  4EIY A;  2C03 A;  5GPG B;  5KYX A;  2J9U A;  3ZSU A;  3IHU A;  3O55 A;  4WJ0 A;  3K1H A;  4IGG A;  4NTA A;  2PNO A;  4CS9 A;  4G7O F;  3T4R A;  2YZS A;  1Z7Q c;  3QVZ A;  1XZP A;  4I44 A;  1JPJ A;  3R2P A;  4OD5 A;  1OXB A;  3AG4 C;  2XSE A;  2XM4 A;  3DAG A;  3IQ5 A;  4NQF A;  3M4B A;  1E86 A;  2EIK C;  3MFN A;  3MLG A;  1HE9 A;  2Q7R A;  4EHP A;  2GAQ A;  3W2V A;  5HSW A;  1RMV A;  3ZWI A;  2B0H A;  2JPU A;  3FAJ A;  1RKE A;  1VLT A;  3GEE A;  4EWC A;  1C03 A;  4JCZ A;  1RKE B;  4NCQ A;  2LCH A;  4MTO A;  1U6H A;  2VH3 A;  1XWJ A;  2R03 A;  3LES A;  4X0R A;  2P1A A;  4IAR A;  2EIM C;  2ZXR A;  3Q7G A;  4OIQ F;  3GAN A;  2NPU A;  2R7Q A;  4AX2 A;  2LQG A;  1ZVZ A;  4MVZ A;  4N06 A;  3PCV A;  4R32 A;  4XPY A;  2YRF A;  3DI5 A;  4O6N A;  5T1D B;  2Y3B A;  2OJE D;  2HV6 A;  2XXA B;  3NKE A;  2NUT B;  3EFO B;  2R9R B;  1OW8 A;  1M2O A;  5JS5 A;  2BE5 F;  2HZ8 A;  2NUP B;  3CEX A;  5EK0 A;  2XXA A;  5AC4 A;  2WVQ A;  2R7T A;  1K05 A;  2Y39 A;  3X1O A;  3AOU A;  5T3W A;  1A7D A;  3ABL C;  3DMD A;  3POV A;  2GFH A;  1SF8 A;  2OOC A;  4CSA C;  1T6Q A;  4JE9 A;  3DM5 A;  3RF3 A;  2L6G A;  2X0C A;  3DJN B;  4JZA A;  1BR4 A;  1F1M A;  4JJG A;  1QZX A;  2EPK X;  2L6H A;  4YL1 A;  4CDA A;  4YJW A;  1D0Z A;  1VB5 A;  4I3M A;  4C3B A;  2FAP B;  4DVZ A;  2XLE A;  4A2N B;  2OKU A;  1LI7 A;  2J9V A;  3EJN A;  3GM3 A;  4JJF A;  4XTK A;  3ASO C;  4U5E E;  4YN0 B;  3DXJ F;  4IAO A;  1EQ1 A;  2HMQ A;  3L0I A;  2LFF A;  3TJ6 A;  1VOM A;  2Y69 C;  1ZHT A;  2W45 A;  1RCP A;  3B0V C;  3KH2 A;  4W8K A;  3U2M A;  2YLD A;  3ZG1 A;  1L7C A;  2HSQ A;  1OCC C;  3G4Z A;  1WN0 A;  2YVK A;  4JEA A;  2XLW A;  2EPM X;  5K0I A;  5AC5 A;  3ATP A;  4JCH A;  1EA8 A;  2X51 A;  4KNV A;  5B3I A;  1VYK A;  2KJG A;  3C8G A;  4BJ6 A;  3QTH A;  4ONS A;  2YL0 A;  3K6B A;  2M4E A;  1OQC A;  3OEO A;  4I1O B;  4JW1 A;  3VAY A;  4BEM J;  2LK4 A;  4YT4 A;  1BDJ B;  3C8G B;  4LDR A;  5E3C A;  5JVE A;  1ZHW A;  3N2Z B;  3KYJ A;  5L0C A;  2I15 A;  4EKW A;  2V3C C;  4KI2 A;  1JMW A;  3B71 A;  2PX3 A;  3JRM O;  1RXQ A;  4MVQ A;  2HFI A;  3T6B A;  1VMA A;  2HV7 A;  2FFH A;  3ABM C;  3U3F A;  1YYJ A;  2XL6 A;  3MYI A;  3H65 A;  1YVI A;  1T6I A;  2OQM A;  4QI0 A;  5D91 A;  1FFH A;  2XLH A;  1JRA A;  1Q0K A;  4MTG A;  4XEF A;  1Q0D A;  1YAR O;  1LKX A;  4NTF A;  1ZHX A;  1WAS A;  5DS5 A;  5IY5 C;  4MVU A;  2G3K A;  3M1C B;  3NYL A;  5DLJ A;  3T9O A;  5A6B A;  1YA7 O;  1KNY A;  4ZLD A;  1FFT C;  2HMZ A;  3X2Q C;  3ZIB A;  1JAF A;  1AVO B;  1QPU A;  1LE4 A;  1OKK D;  4KC9 A;  2NG1 A;  4LLC A;  4XQ1 A;  3HJC A;  2C04 A;  2CW0 F;  1AEP A;  5BQI A;  2L9J A;  2YL3 A;  1LIH A;  1FMV A;  3RYL A;  2KC3 A;  4CS7 A;  2W4M A;  2A6H F;  2CNW A;  2ZPA A;  4NC3 A;  2VCA A;  3EGD B;  1A7V A;  3RVZ A;  3GOD A;  3J06 A;  3DE9 A;  2ZXW C;  2QLA A;  1MND A;  1NU7 D;  2IXM A;  2B0J A;  2KQ9 A;  3LLK A;  3LS1 A;  3U0C A;  4L6R A;  4K7B A;  4FAP B;  4CIH A;  3TK0 A;  1Y6D A;  3N24 A;  2D5R B;  5KYU A;  2PBE A;  1Z23 A;  2YLG A;  4PJM A;  4OIP F;  5KYY A;  4GEH A;  2KW3 C;  3DWW A;  3EGX A;  3LS0 A;  1HW1 A;  3FDQ A;  1I5N A;  1T6U A;  4E18 A;  4U9E A;  3I4U A;  3EGX B;  3RH3 A;  4MVR A;  4A4A A;  1RJ9 B;  2WZL A;  2ZXO A;  1YAU O;  2UUH A;  1AUE A;  4QDL A;  3ZTM A;  1DOW A;  4N6H A;  4RD9 A;  3T6G B;  2AWC A;  2R7W A;  1HMO A;  3O39 A;  4P9F A;  3G50 A;  3V5Z A;  1C17 M;  4AE4 A;  1CGN A;  3ECS A;  2ZXP A;  3LUT B;  5COF A;  4U5D E;  4CSA A;  1V74 B;  2CYD A;  4XLN F;  3FOO A;  2H7V C;  4H54 A;  4AE4 B;  2AU5 A;  4CDY A;  4C7O B;  1B68 A;  3EHM A;  4FX5 A;  3LNM B;  3VM6 A;  5JP7 A;  1SR2 A;  4PJL A;  2LD6 A;  1YLM A;  4C3E A;  1ZZP A;  2A68 F;  3K33 A;  4U5F E;  5L0I A;  1Y4C A;  5F5F A;  4CIP A;  1NG1 A;  4IWB A;  3SZR A;  3WG7 C;  4JTA B;  2EIN C;  1ZHY A;  3FMS A;  2PFD A;  4BG0 A;  3QVY A;  4RBN A;  3U8V A;  4F4B A;  5A6K A;  1JR8 A;  1O87 A;  1TWC A;  2Q00 A;  2QY9 A;  1VK5 A;  3H2U A;  4U9D A;  4JIO A;  1NFN A;  2AWY A;  2KNH A;  1LPE A;  2IXN A;  2Q9A A;  1FNT c;  1TFO B;  2YL1 A;  2VAS A;  1BR1 A;  2GA0 A;  3WHN A;  3ITF A;  1M56 C;  3H2V A;  2OEX A;  3L8J A;  3NRH A;  1MMG A;  4JTC B;  1ZYR F;  3GWL A;  2NUT A;  3S90 A;  1NU9 C;  1SMY F;  1ZU4 A;  2DGJ A;  3EFO A;  1E2X A;  1VTM P;  5HV9 A;  4NY3 A;  2ASR A;  2NUP A;  2Z15 A;  3RIP A;  2F22 A;  1FR0 A;  3EHN A;  1YDI A;  2L81 A;  3Q6N A;  4XEK A;  2RSE B;  1PCX A;  4FWV A;  4YL0 A;  4AK9 A;  4QI2 A;  2DB4 A;  2MYS A;  1OXK A;  3JTL O;  2L6F A;  1L3P A;  2ZD9 A;  3A9C A;  5COM A;  2R7R A;  3B0P A;  3DM9 B;  1I4Z A;  2UUI A;  4G0H A;  1UG7 A;  3F47 A;  2XM0 A;  3K7D A;  3S84 A;  3UGO A;  2Q4F A;  3NYM A;  4J7Y A;  4XPX A;  1TWH A;  3IQT A;  3L34 A;  4LDQ A;  2Y3D A;  4PJJ A;  4BJ5 C;  2ETS A;  2R7V A;  5A6A A;  4Z9H A;  2J0W A;  1T5O A;  1LI5 A;  1QVX A;  1N1C A;  2G3V A;  2A0B A;  4YT5 A;  3TQO A;  4ANJ A;  3SNH A;  2XS8 A;  1ORJ A;  4U5C E;  4HE8 D;  4CX9 A;  3U2L A;  3NMI A;  3S28 A;  3UMH A;  4DBR A;  4XLP F;  2Y3H A;  4ULW A;  1WGW A;  2J9W A;  1RKC A;  4OIO F;  1PV3 A;  1W2W A;  2YEV A;  3C8G D;  3L1M A;  4UDV A;  3LLI A;  2DI3 A;  2OEV A;  2RD9 A;  4MTF A;  1H9G A;  5COG A;  5JRA A;  2H7B A;  3SXY A;  3EPV A;  1E83 A;  3HNK A;  2YKZ A;  2YQY A;  3FAP B;  4I1M A;  4MVM A;  5L3V A;  2HS5 A;  2GDC A;  4DVY P;  1OCZ C;  1LM3 B;  1QSP A;  4PK4 A;  1GM5 A;  3VF0 A;  3GM2 A;  3UNG C;  4OD4 A;  3K66 A;  2CDQ A;  5BUO A;  1G5Z A;  4IAQ A;  1WWP A;  2E87 A;  1XZQ A;  4D4X A;  2YHS A;  1M57 C;  2A0U A;  3ZVR A;  2KGO A;  2XL8 A;  2XS1 A;  3SYN A;  3SP1 A;  4ZLC A;  2WVO A;  5A6B D;  2A6E F;  4YK5 A;  2XL4 A;  2CGE A;  4IRU A;  4BJT A;  1E85 A;  1CGO A;  3FXH A;  3EG9 A;  3ZDL A;  2O9X A;  2Q3T A;  3HLZ A;  5BQH A;  2J7P D;  2H7O A;  3EG9 B;  4KBL A;  5D92 A;  4BEJ A;  5DS6 A;  4DXW A;  3AG3 C;  3GM1 A;  4JUR I;  4KNW A;  2ICW G;  5JLI A;  2CNW D;  3L8I A;  2XLV A;  4MW8 A;  2TMV P;  1SYQ A;  4DRI B;  3C7J A;  5FCL A;  2BL2 A;  1NZE A;  2HSB A;  2YWA A;  3B29 A;  1J8M F;  3EGD A;  3VRC A;  4Z9J A;  5EHH A;  1TFK B;  4MVS A;  3EH1 A;  1OW6 A;  2WB7 A;  3QZC A;  2QUP A;  3U5S A;  1PD1 A;  5DQT A;  4XPW A;  3K1I C;  1CGM E;  1NSG B;  3EH2 A;  2VCC A;  3DD7 A;  1KTM A;  1VLS A;  1WTY A;  4MVO A;  2XLM A;  1A7E A;  3JT1 A;  3NKD A;  1BBH A;  1DOV A;  3S9O A;  4E0H A;  2IBF A;  3EZI A;  3U9M A;  1OCO C;  1U89 A;  5KYN A;  5AGF A;  4CJO A;  1T01 A;  2CCY A;  2VCB A;  4AL0 A;  3IQ6 A;  5DVW A;  1IZM A;  1TR2 A;  4JTD B;  3TD7 A;  4BPM A;  1RJ9 A;  4MS2 A;  2P0N A;  3FOP A;  1FMW A;  2HJ3 A;  1V55 C;  1YZA A;  3I5Q A;  3RFY A;  2IM8 A;  4EBB A;  4DRH B;  1FTS A;  4Q5S F;  4MW3 A;  2NSG A;  5T3T A;  5KYW B;  1Z63 A;  3EZH A;  1Q0G A;  3LNR A;  3B0U X;  2HUJ A;  1UFB A;  3HNL A;  1E84 A;  3CAX A;  3BRJ A;  1M6T A;  4EBJ A;  4E7S A;  2LIG A;  2EPN A;  4H4K C;  5L0H A;  3TUL A;  2EPL X;  4XWJ A;  2J46 A;  2WZF A;  4GYT A;  1D0Y A;  3SEO A;  2QE9 A;  4C7O A;  1HMD A;  1MMN A;  4YT8 A;  4CS8 C;  4FES A;  2LFD A;  5DS4 A;  2XLO A;  1D0X A;  2P7V A;  3O6X A;  2R25 A;  3ABK C;  4MQ9 F;  2J9B A;  3DE8 A;  4PFP A;  4BJ5 A;  3PDM P;  3MYF A;  2PF4 E;  1YYX A;  3AGU A;  1V4A A;  3LJB A;  3FVY A;  3QW1 A;  3OA1 A;  4NTB A;  5DQZ A;  3EQL F;  1ORS C;  3LAY A;  1O3U A;  5E33 A;  1I4Y A;  4DBQ A;  3JYH A;  1NLX A;  1YA9 A;  4LAC B;  5E3A A;  3NMK A;  3DKA A;  1ZW2 A;  4J30 B;  3GWN A;  1YJG A;  2MHR A;  2R02 A;  2LP4 A;  1Z5Z A;  4O6M A;  2FGY A;  4D4N A;  3AG1 C;  5A69 A;  5B1A C;  3US6 A;  3U8P A;  2MWQ A;  5L0J A;  4EUK B;  5FZT A;  5L0D A;  1D1A A;  2GWW A;  1U0B B;  2Q9C A;  5KYX B;  2XLD A;  1LE2 A;  1NBB A;  4K0D A;  3IPM O;  1D1C A;  2A69 F;  2J0X A;  3I5P A;  4XEV A;  2IXO A;  3JZ0 A;  1QQ3 A;  4ER9 A;  2HJM A;  3AJM A;  2I8B A;  1M2V A;  2IYL D;  1S7Z A;  3BEH A;  4O7G A;  3R7C A;  2DYS C;  3RQE A;  3V5X A;  2AVK A;  3C18 A;  1QKR A;  2KSF A;  2OJQ A;  3AQC A;  1M2V B;  3G4X A;  3NG1 A;  3PMR A;  2J45 A;  3NMJ A;  1V54 C;  1H7I A;  4LLE A;  3S0X A;  3F46 A;  1GGQ A;  2IXP A;  3UMK A;  2WZG A;  5BQG A;  4N6C A;  2BC5 A;  4B6I A;  5A6J A;  2PP4 A;  5F5H A;  2P6V A;  3KYI A;  2AP3 A;  2WL8 A;  1K40 A;  1LS1 A;  2OCC C;  5F28 E;  3U9J A;  4K1O A;  1VYI A;  1PD0 A;  3E9V A;  2LSE A;  4U5B E;  3TOL A;  5B1B C;  3AG2 C;  2XRH A;  4Q4Z F;  1D1B A;  1TKN A;  2PX0 A;  3PHF 2;  4HFK B;  3KMI A;  5CI8 A;  5CIV A;  2R7O A;  3IEE A;  4HFF B;  3V7O A;  1H6G A;  1HY5 A;  3M4C A;  3S29 A;  4AL1 A;  1LVK A;  4WAB A;  1H9T A;  2VC9 A;  3LEO A;  2OG2 A;  3JCU Q;  3K1I A;  1CPQ A;  3Q6M A;  4MND A;  2R05 A;  3T6J A;  4JVS A;  3WAQ A;  5JT4 A;  1CPR A;  4GQH A;  1YZC A;  3B9Q A;  4M63 A;  1TQG A;  2NSF A;  2WVN A;  1TWA A;  3OWT A;  4U5H A;  4WGZ A;  3M15 A;  1MMD A;  4CS9 C;  3DAF A;  3MX3 A;  3GEH A;  1A41 A;  3HNJ A;  4JRZ A;  4YWQ A;  2L7A A;  1Q0M A;  3KPH A;  4RDA A;  3TJ5 A;  1EI7 A;  4DRJ B;  1G4U S;  3N0T A;  1K04 A;  1JPN A;  1WAT A;  3Q7L A;  4J7T A;  4YL3 A;  5E2Q A;  4BJ1 A;  1S05 A;  2OU6 A;  1BZ4 A;  3QW0 A;  2R7S A;  4JKV A;  3RVY A;  1ZHZ A;  4J32 B;  3QMK A;  1ZW3 A;  3UMI A;  1T9K A;  4E7Z A;  3W2W A;  2QTV A;  1APC A;  3FHD A;  5EGY A;  3AGT A;  1NFO A;  1G4W R;  1ZU5 A;  4YT2 A;  1BR2 A;  2YLI A;  1JOG A;  3A11 A;  3JYY A;  1IW7 F;  4U5G A;  2D4U A;  2JX0 A;  3JSZ A;  1MQV A;  3RW0 A;  1Z6A A;  1TWG A;  3SXK A;  4CS8 A;  3UGP A;  3W8H A;  3CSK A;  3JSE O;  3RQG A;  4G78 A;  3HNI A;  4PFO A;  1SZI A;  3SXZ A;  2W9Y A;  3JRT A;  3LEV A;  4CJG A;  1A0B A;  2G62 A;  1GQA A;  3S27 A;  1KU2 A;  1MMA A;  4WGY A;  4ULV A;  4W8P A;  3U3B A;  2H8A A;  1C02 A;  4DJ9 A;  2DYR C;  1QLE C;  1OW7 A;  4OIN F;  1HE1 A;  2J8W A;  4PJN A;  1OCR C;  2EPO A;  4Q7C A;  3AQB A;  3C62 A;  2R7U A;  1O5H A;  4CBE A;  2V26 A;  4CDV A;  4P6I C;  1FAP B;  3V5Y A;  2Q9B A;  1ORY A;  4IJJ A;  2J7P A;  1R4T A;  3GOR A;  1R5I D;  5KYW A;  4E0I A;  3C63 A;  4E17 A;  1OKK A;  1G8X A;  4HEA J;  3GEI A;  4IB4 A;  4LDK A;  5TJ5 E;  3WOD F;  3E70 C;  2EIL C;  3DJU B;  4Z9I A;  3VYW A;  3DZA A;  2YL7 A;  3NYJ A;  3SXM A;  5B3S C;  5JUA A;  4EBK A;  2A1D D;  1ST6 A;  1EKY A;  2R7X A;  2VB6 A;  4JC7 A;  4BJ6 C;  5L3Q A;  3C8Z A;  3TOM A;  3W8I A;  3ASN C;  3HTK C;  2QNL A;  4O6Y A;  4G7H F;  2EIJ C;  1LS4 A;  3W4Y A;  3NDB B;  3CQZ A;  3KL4 A;  2M64 A;  4C3D A;  4DOZ A;  5L0G A;  5KYU B;  3MBG A;  2Y3G A;  2W4B A;  4N4W A;  4PAC A;  1GS9 A;  4JEB A;  3KKB A;  3ZQV A;  5KYY B;  3O10 A;  256B A;  1Z3I X; 
#chains in the Genus database with same CATH homology
 3ZQY A;  5JSL A;  3M79 A;  4IAQ A;  2BC5 A;  4NC3 A;  4D4X A;  1A7V A;  3DE9 A;  3ZTZ A;  2XL8 A;  2QLA A;  4EIY A;  3TOL A;  4L6R A;  1CGO A;  1E85 A;  3M4C A;  3QVZ A;  2YLG A;  1CPQ A;  2XM4 A;  3IQ5 A;  3M4B A;  1E86 A;  5JLI A;  5JT4 A;  2XLV A;  4U9E A;  1CPR A;  3ZWI A;  1YZC A;  3ZTM A;  4N6H A;  4WGZ A;  3M15 A;  3VRC A;  3HNJ A;  1CGN A;  4IAR A;  3FOO A;  1S05 A;  4CDY A;  2XLM A;  3QW0 A;  4JKV A;  1BBH A;  5JP7 A;  5JS5 A;  4CIP A;  1APC A;  5AGF A;  4CJO A;  2CCY A;  3IQ6 A;  2YLI A;  4JE9 A;  3FOP A;  1MQV A;  1YZA A;  4CDA A;  3QVY A;  2XLE A;  3HNI A;  4U9D A;  4CJG A;  3HNL A;  1E84 A;  1GQA A;  2YL1 A;  1M6T A;  4WGY A;  4ULV A;  1RCP A;  2YLD A;  2J8W A;  2XLO A;  3C62 A;  2J9B A;  3DE8 A;  4JEA A;  2XLW A;  4CDV A;  1YYX A;  5B3I A;  3QW1 A;  2YL0 A;  5JVE A;  3NMK A;  3C63 A;  2XM0 A;  4IB4 A;  4D4N A;  1YYJ A;  2XL6 A;  2YL7 A;  5JUA A;  3U8P A;  1EKY A;  4CX9 A;  2XLH A;  3NMI A;  3TOM A;  2XLD A;  1NBB A;  3L1M A;  1QQ3 A;  4ER9 A;  5JRA A;  1JAF A;  4N4W A;  1E83 A;  1QPU A;  4JEB A;  3ZQV A;  3HNK A;  2YKZ A;  1LM3 B;  256B A;  3NMJ A;  2YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...