1UFBA

Crystal structure of tt1696 from thermus thermophilus hb8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
127
structure length
127
Chain Sequence
MNRARDWLEQARHNLRHAQGSLGLGDYAWACFAAQQAAEAALKGLHLARGQVAWGHSILDLLADLPEDVDVPEDLVEAAKVLDKYYIPTRYPDAHPAGPAARHYTRLEAEEALDLAQKILAFVEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords TT1696 protein
publication title Crystal structure of TT1696 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 46
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ufbA00
1ZZPA 1V4AA 3GM1A 3RQGA 1WWPA 4XEKA 3GM3A 3RQEA 3O10A 3AJMA 2L6GA 5F28E 2Q00A 3L8JA 4XEVA 1K05A 3MFNA 4NQFA 1KNYA 3L8IA 3JZ0A 1PV3A 2JX0A 3B71A 3BRJA 3C8GB 1QVXA 1OW8A 3U3FA 3S9OA 1JOGA 3U0CA 3TULA 3C8GD 1OW7A 4XEFA 3GM2A 1UFBA 2HSBA 2LK4A 2YWAA 3RQFA 1WOLA 1O3UA 1OW6A 2L6FA 3JYYA 4R32A 3C18A 2L6HA 3K7DA 2PBEA 4EBJA 1K40A 2JPUA 4EBKA 1KTMA 2KK1A 1K04A 1WTYA 3C8GA
chains in the Genus database with same CATH superfamily
2EIKC 3O6XA 4LDRA 1TWCA 4KI2A 2O9XA 2QY9A 2DGJA 2ZXPA 4K0DA 2YL3A 2GA0A 1S05A 1Y4CA 2AU5A 5A6KA 4HE8D 3W8HA 4UDVA 1J8MF 3DM9B 4PK4A 2Y3GA 1MNEA 3Q7GA 3JYHA 3V7OA 5L0DA 1TQGA 2RD9A 1RMVA 3ABMC 1QPUA 3T4RA 3UGOA 4MVSA 2HV6A 2WVNA 2YL1A 3QTHA 3V5ZA 3CQZA 3RQFA 1ZHXA 4EHPA 3F47A 4XEKA 3ZG1A 1NU7D 1OXBA 1E83A 3FAPB 1YA7O 3OEOA 3ECSA 3QMKA 4JTAB 5KYYA 1MMNA 2J9WA 3NYMA 4W8KA 1WWPA 3ABKC 3EFOA 1T01A 3GM3A 3H65A 3F46A 1GQAA 1LE2A 2OJED 1FTSA 4KC9A 1AUEA 2I15A 2XXAA 3DE8A 2A1DD 2KQ9A 3AG1C 1VLSA 4MS2A 1L3PA 3EGDA 4WABA 5B1BC 1JAFA 3V5YA 4NQFA 1G4US 2OCCC 4C7OB 2HJ3A 2A68F 1VYIA 2NUPB 5JSLA 2R03A 4JEAA 2XS1A 3C8GB 3U3FA 2NPUA 2EIJC 4JRZA 1XZQA 2HJMA 3TOMA 3AG4C 1RCPA 5L0IA 1ORYA 2H8AA 4J7YA 4BPMA 4E0HA 2HSQA 4NTBA 4U5HA 4EBBA 5IY5C 2Y69C 2XM0A 1PD1A 3SZRA 5KYNA 3EGXA 3K7DA 4I1OB 3UR3C 1NG1A 5JLIA 3LEVA 4EIYA 3N24A 1ZHWA 3LJBA 1NFOA 4Q7CA 3ZQYA 4YT8A 2J8WA 4JCZA 5L3QA 4CDYA 3W8IA 2VH3A 1M6TA 4AL0A 4RD9A 4BJ6C 4DBRA 4CSAA 5T3WA 2P6VA 2CNWD 4U9EA 4K1OA 3ZVRA 1BR4A 5AGFA 4I3MA 4E7SA 4BJ5A 4J32B 1GM5A 3GEHA 1OCOC 1V74B 4NY3A 1CGNA 3MYIA 3E70C 4QDLA 1R4TA 5E3AA 3UMIA 3NKEA 4YK5A 4BJTA 3QVZA 4G7HF 2HKVA 5DQTA 1OW7A 2CYDA 2R7XA 3LNRA 3S29A 4IGGA 4DRHB 1I4YA 3RVZA 1D0ZA 1E85A 3VM6A 3KMIA 4DRIB 1O3UA 4DBQA 4PJMA 4YN0B 2ASRA 2UUIA 2WZFA 2Q4FA 1LM3B 1M2VA 2I8BA 1VMAA 4CBEA 2R7VA 3NYLA 1V4AA 3GORA 1PCXA 4JTDB 1Q0MA 4FAPB 3B0VC 2H7BA 2RSEB 3EZHA 1NU9C 3M79A 1CPRA 3U2MA 5B3SC 4AX2A 4B6IA 1YA9A 2YLGA 2Y3DA 3RW0A 4DXWA 4E17A 4LACB 4E18A 2EINC 3HTKC 3ITFA 3DZAA 2VCBA 4YJWA 3ZTZA 2R7UA 4JJGA 2R9RB 3S9OA 5AC5A 3JSZA 3RVYA 2PNOA 4LDQA 2IXOA 1A0BA 2GWWA 4O6NA 4PJNA 3S28A 4CIPA 3KH2A 5B3IA 1I4ZA 1Z5ZA 2L6HA 3NYJA 2Y3BA 4EBJA 1Q0DA 1OCZC 3EG9A 4CS8A 1K04A 2V26A 2WVOA 3Q6NA 4JCHA 2KJGA 5A69A 4IARA 4QI2A 4O6MA 3ZC4A 1FFHA 4U5DE 1H9TA 4PFPA 2LCHA 3LESA 4GYTA 4K7BA 3X2QC 4EUKB 2WZLA 2B0JA 2DYRC 5COGA 4ULWA 2NSGA 4XQ1A 1F1MA 3QVYA 3MBGA 1YZCA 4JTCB 3NG1A 2M64A 3FVYA 1NZEA 3RFYA 1TFKB 1Z23A 1QKRA 3AOUA 2Q7RA 3DJUB 3K6BA 1YJGA 4PFOA 3C8GD 2J0WA 1OKKA 4IAOA 3DMDA 2X0CA 3QW1A 2NG1A 3DWWA 4YL3A 2W4MA 4NCQA 3VRCA 4E7ZA 2Q3TA 5EGYA 2BC5A 2VC9A 2XLDA 2ZXOA 3C7JA 3FXHA 3B0UX 5JUAA 2P61A 1Z6AA 1TWAA 2J7PD 2Q9AA 1RJ9A 1YYXA 2XL8A 4HFFB 4OINF 3RIPA 3SXZA 1AVOB 1RXQA 5DQZA 2X51A 5DS6A 2XM4A 5KYUA 3SXMA 3ZQVA 4P6IC 1Z7Qc 4JJFA 1M2OA 4DRJB 2HUJA 3JT1A 1WASA 1K05A 1MMAA 2W9YA 2Z15A 3T6GB 3TD7A 3VF0A 4ANJA 4N06A 4YL0A 2DYSC 1NSGB 3ABLC 3K1IA 4O7GA 1LS4A 4Q4ZF 2ZXRA 4P9FA 2PF4E 4Z9HA 5CIVA 3KKBA 1BR1A 3EQLF 4G7ZF 5DS4A 2CGEA 2ZPAA 5E3CA 5F5HA 1UFBA 2YVKA 1OW6A 1BBHA 1OR3A 2PFDA 1W2WA 4EBKA 1BDJB 2HS5A 2HFIA 4G7OF 2IOQA 3PCVA 3US6A 3A9CA 3ZDLA 4MNDA 5A6BA 2IBFA 5KYWA 1JPNA 4JE9A 4CJGA 5COFA 4YT4A 1D1BA 1U6HA 3NMIA 3EHMA 4I44A 4XEVA 3S27A 1GGQA 3GEIA 3WG7C 4O6YA 2IXNA 3IQ6A 5KYXA 4N4WA 2LFFA 2JX0A 5E2QA 2MHRA 1E86A 2OJQA 1TWGA 2CNWA 1RKCA 3H2VA 5GPGB 3L0IA 2XLOA 3TOLA 1D1AA 4IAQA 3O55A 4X0RA 2BL2A 3QZCA 4Z9IA 3EH1A 2L6FA 3T6BA 4DVZA 3G4XA 5F5FA 3DE9A 2JPUA 4CSAC 2NSFA 1G8XA 1KTMA 4JIOA 3X1OA 1ZU5A 3ASOC 4J30B 1MMGA 4D4XA 3RQGA 2G62A 4PJJA 4CS7A 4AE4B 4BJ5C 2KNHA 2OKUA 2ZD9A 3NRHA 1SYQA 5D91A 2MYSA 2J0XA 1TR2A 2D5RB 4NTAA 2LP4A 4NTFA 3CSKA 1O5HA 4KNVA 2JD3A 1BZ4A 2XLHA 3SXKA 3TJ5A 5L3VA 4JZAA 4EWCA 3BRJA 1FR0A 1U89A 1VOMA 2PP4A 4XTKA 2LIGA 1NFNA 2D4UA 4XPWA 2OEXA 1H6GA 1UG7A 1ZW3A 3FAJA 3IHUA 1TWHA 1BR2A 3U2LA 4YWQA 2P7VA 3CZ6A 3EZIA 2YRFA 3U8PA 3S84A 3C62A 2HMQA 3PDMP 3DKAA 1WTYA 4H4KC 1V54C 3AG3C 2A6HF 1RKEB 2IYLD 2Q9BA 3RQEA 3OA1A 4F4BA 2AWYA 1LVKA 1LE4A 3Q7LA 5HV9A 2R7RA 1G5ZA 1CPQA 2L6GA 2Q00A 4PJLA 3PMRA 4U5GA 1CGOA 4BG0A 3EHNA 3LS0A 4NC3A 2QTVA 3UMKA 3JRMO 2WB7A 2AWCA 3UNGC 4H54A 4CDVA 4WGYA 4ULVA 1Z3IX 4IRUA 2MWQA 2P0NA 1OCRC 3AQBA 3H2UA 5COMA 256BA 4XWJA 1D1CA 3FOOA 1Q0FA 1HMOA 1A7VA 1FNTc 3S90A 3HJCA 1QLEC 4CS8C 1NBBA 2YLDA 1Q0KA 2WVQA 1B68A 4C7OA 4OD4A 5JS5A 2NUPA 3JRTA 2R7WA 2J9UA 3FOPA 2UUHA 2EPLX 2QLAA 3U9MA 2KYHA 3IPMO 3SEOA 5AC4A 4OD5A 1M56C 2W45A 3GM1A 2J45A 2P1AA 4ONSA 4AL1A 5E33A 3ZSUA 3LEOA 2R7QA 2YEVA 3T6JA 2A0UA 5F28E 4FESA 2YL0A 1T9KA 2J7PA 4QI0A 3MYFA 2YKZA 3AQCA 4ER9A 2XSEA 5CI9A 1VYKA 3DAGA 5CI8A 2R25A 1CGME 2FGYA 5DS5A 2A0BA 3TK0A 1EA8A 4DVYP 5JVEA 3DM5A 1OW8A 5KYYB 5JRAA 4G0HA 1PD0A 3EFOB 5KYWB 1YZAA 2L9JA 3CEXA 2XXAB 3FHDA 1XWJA 2AVKA 3GM2A 1AEPA 2YWAA 3J06A 4MVRA 3EGDB 3JYYA 3IQ5A 4OIRF 3LS1A 1ZVZA 2QE9A 5T1DB 1OXKA 4IJJA 3U9JA 3C8ZA 3N0TA 3T9OA 5BQHA 4FWVA 3HNJA 1ZZPA 2QNLA 3L34A 3W4YA 2PX3A 4LLCA 5JP7A 4MW3A 2E87A 3LNMB 2H7VC 3K1IC 4N6HA 1T6IA 2EPOA 3RH3A 3UMHA 1WN0A 1TKNA 2J9BA 5FCLA 3DI5A 4MVMA 2YZSA 1Q0GA 1A7DA 1OR2A 2XL4A 4MVUA 3W2VA 5K0IA 3EGXB 2BE5F 2ICWG 3NMKA 1ORSC 3LUTB 3Q6MA 3R2PA 1JR8A 2G3VA 3M4BA 4JURI 4G78A 2WL8A 4Q5SF 3G50A 2VCCA 3DJNB 4A2NB 2L7AA 4XLNF 4XEFA 3V5XA 2OQMA 2HSBA 1ZYRF 2HV7A 3B29A 3RF3A 4R32A 4MVQA 1JPJA 2PBEA 3HLZA 3U5SA 2KK1A 1LKXA 1IZMA 2M4EA 5B1AC 1V55C 2IXPA 2VCAA 2H7OA 2KSFA 2YL7A 3AJMA 3E9VA 1JRAA 4MW8A 4DJ9A 5L0CA 2G3KA 1G4WR 1YYJA 3M4CA 4JW1A 1I5NA 1OQCA 1ST6A 3HNIA 3KYIA 4MQ9F 1OKKD 4YT2A 3L8IA 3ZWIA 1A41A 2A6EF 3NMJA 4OIOF 4IWBA 1M2VB 4BEJA 3UGPA 4JEBA 2KC3A 3TJ6A 1SR2A 4MVZA 3VAYA 1E84A 1TFOB 1OCCC 1ZHZA 2GDCA 2QUPA 1JMWA 2EILC 4N6CA 3I4UA 4OIQF 1VLTA 1HW1A 3C18A 4JC7A 3S0XA 3MLGA 1VK5A 3K66A 1D0XA 5JT4A 2VASA 2XLVA 2NUTA 4CJOA 2Y39A 3ATPA 3LAYA 4LLEA 3AGTA 1HY5A 2Q9CA 4XPXA 3IEEA 1GS9A 1WATA 2XLEA 2WZGA 1YAUO 4BJ1A 4XLPF 4P9TA 1KU2A 2OOCA 2KGOA 1H7IA 3EG9B 3ASNC 3B71A 1J8YF 4D4NA 1LPEA 3W2WA 3GWLA 2CW0F 3GANA 3IQTA 2J9VA 5BQGA 1NLXA 4ZLDA 2ZXWC 4M63A 4MTGA 3POVA 2XLWA 3KYJA 5A6BD 1C02A 1MQVA 4C3DA 3PHF2 2GAQA 2CCYA 4L6RA 3RKOF 3SYNA 1YVIA 1QSPA 2GFHA 4MTFA 2R02A 4WJ0A 2LSEA 3B9QA 2PX0A 1YARO 5DVWA 4JVSA 4A4AA 1XZPA 1T5OA 3NKDA 1IW7F 5L0JA 2TMVP 4HFKB 2IM8A 4AK9A 1VTMP 1E2XA 3L1MA 4U5BE 4CX9A 3DAFA 4FX5A 4WGZA 1C17M 2IXMA 3MFNA 3LLIA 2YQYA 1MMDA 4BJ6A 1KNYA 2KW3C 2DI3A 2EPKX 3WHNA 3GEEA 1QQ3A 4ZLCA 3K1HA 1PV3A 3OWTA 1EQ1A 4CS9C 3A11A 1ZHTA 4MTOA 5BUOA 1U0BB 1RJ9B 1QZXA 3KL4A 3RYLA 2Y3HA 1JOGA 3U3BA 3I5QA 5EK0A 1FMWA 3WAQA 5BQIA 2C04A 5KYUB 3DXJF 1HE9A 3K33A 4CS9A 3AG2C 2B0HA 3EJNA 3HKKA 1H9GA 4GQHA 1L7CA 4W8PA 2R7TA 3EPVA 3M15A 2OG2A 1D0YA 1WGWA 1DOVA 3GODA 3ZIBA 2DB4A 2CDQA 1ORJA 1YDIA 3KPHA 3FDQA 1MNDA 2EIMC 3N2ZB 1LI7A 3SP1A 3BEHA 4O79A 3C8GA 4J7TA 1LIHA 1A7EA 3CAXA 3QW0A 4KNWA 3SXYA 1EI7A 1FAPB 1APCA 1LI5A 2F22A 4BEMJ 5A6JA 5A6AA 2AP3A 4RDAA 4U5FE 3ZTMA 3L8JA 3MX3A 2YHSA 3U8VA 1DOWA 2XRHA 5T3TA 3FMSA 1M57C 4DOZA 4YT5A 1QVXA 2J46A 2L81A 3GWNA 3LLKA 4LDKA 3HNLA 5D92A 4AE4A 4RBNA 3G4ZA 5EHHA 5L0HA 2XS8A 1S7ZA 2EPMX 4U9DA 1R5ID 1VB5A 3JCUQ 4HEAJ 1WOLA 2ETSA 1ZHYA 4C3BA 4XPYA 1T6UA 2R7SA 1Z63A 1K40A 5L0GA 5KYXB 1SMYF 3TQOA 1EKYA 3JTLO 4YL1A 1SZIA 4EKWA 4LERA 2V3CC 4CIHA 2HZ8A 2W4BA 1HMDA 2R7OA 2XL6A 3B0PA 3O10A 3WODF 4Z9JA 1Y6DA 3JSEO 1YLMA 2A69F 1T6QA 2YLIA 3DD7A 4U5CE 2EPNA 2OU6A 3HNKA 2FFHA 4I1MA 1SF8A 1HW2A 1ZW2A 3AGUA 2FAPB 2LD6A 4PACA 3JZ0A 1ZU4A 1HE1A 4E0IA 2NUTB 3M1CB 2HMZA 1O87A 4JKVA 1RKEA 4MVOA 3IQCA 5TJ5E 3C63A 2XLMA 5FZTA 3U0CA 5L0FA 3TULA 4C3EA 4KBLA 5HSWA 2LFDA 5DLJA 4IB4A 1LS1A 2R05A 3O39A 4OIPF 2LK4A 1C03A 2LQGA 3NDBB 3EH2A 1N1CA 4GEHA 2C03A 1FFTC 3I5PA 4PR9A 4U5EE 3SNHA 3R7CA 2VB6A 3VYWA 4CDAA 2OEVA 1FMVA
chains in the Genus database with same CATH topology
1ZZPA 1V4AA 3GM1A 3RQGA 1WWPA 4XEKA 3GM3A 3RQEA 3O10A 3AJMA 2L6GA 5F28E 2Q00A 3L8JA 4XEVA 1K05A 3MFNA 4NQFA 1KNYA 3L8IA 3JZ0A 1PV3A 2JX0A 3B71A 3BRJA 3C8GB 1QVXA 1OW8A 3U3FA 3S9OA 1JOGA 3U0CA 3TULA 3C8GD 1OW7A 4XEFA 3GM2A 1UFBA 2HSBA 2LK4A 2YWAA 3RQFA 1WOLA 1O3UA 1OW6A 2L6FA 3JYYA 4R32A 3C18A 2L6HA 3K7DA 2PBEA 4EBJA 1K40A 2JPUA 4EBKA 1KTMA 2KK1A 1K04A 1WTYA 3C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZP A;  1V4A A;  3GM1 A;  3RQG A;  1WWP A;  4XEK A;  3GM3 A;  3RQE A;  3O10 A;  3AJM A;  2L6G A;  5F28 E;  2Q00 A;  3L8J A;  4XEV A;  1K05 A;  3MFN A;  4NQF A;  1KNY A;  3L8I A;  3JZ0 A;  1PV3 A;  2JX0 A;  3B71 A;  3BRJ A;  3C8G B;  1QVX A;  1OW8 A;  3U3F A;  3S9O A;  1JOG A;  3U0C A;  3TUL A;  3C8G D;  1OW7 A;  4XEF A;  3GM2 A;  1UFB A;  2HSB A;  2LK4 A;  2YWA A;  3RQF A;  1WOL A;  1O3U A;  1OW6 A;  2L6F A;  3JYY A;  4R32 A;  3C18 A;  2L6H A;  3K7D A;  2PBE A;  4EBJ A;  1K40 A;  2JPU A;  4EBK A;  1KTM A;  2KK1 A;  1K04 A;  1WTY A;  3C8G A; 
#chains in the Genus database with same CATH topology
 2EIK C;  3O6X A;  4LDR A;  1TWC A;  4KI2 A;  2O9X A;  2QY9 A;  2DGJ A;  2ZXP A;  4K0D A;  2YL3 A;  2GA0 A;  1S05 A;  1Y4C A;  2AU5 A;  5A6K A;  4HE8 D;  3W8H A;  4UDV A;  1J8M F;  3DM9 B;  4PK4 A;  2Y3G A;  1MNE A;  3Q7G A;  3JYH A;  3V7O A;  5L0D A;  1TQG A;  2RD9 A;  1RMV A;  3ABM C;  1QPU A;  3T4R A;  3UGO A;  4MVS A;  2HV6 A;  2WVN A;  2YL1 A;  3QTH A;  3V5Z A;  3CQZ A;  3RQF A;  1ZHX A;  4EHP A;  3F47 A;  4XEK A;  3ZG1 A;  1NU7 D;  1OXB A;  1E83 A;  3FAP B;  1YA7 O;  3OEO A;  3ECS A;  3QMK A;  4JTA B;  5KYY A;  1MMN A;  2J9W A;  3NYM A;  4W8K A;  1WWP A;  3ABK C;  3EFO A;  1T01 A;  3GM3 A;  3H65 A;  3F46 A;  1GQA A;  1LE2 A;  2OJE D;  1FTS A;  4KC9 A;  1AUE A;  2I15 A;  2XXA A;  3DE8 A;  2A1D D;  2KQ9 A;  3AG1 C;  1VLS A;  4MS2 A;  1L3P A;  3EGD A;  4WAB A;  5B1B C;  1JAF A;  3V5Y A;  4NQF A;  1G4U S;  2OCC C;  4C7O B;  2HJ3 A;  2A68 F;  1VYI A;  2NUP B;  5JSL A;  2R03 A;  4JEA A;  2XS1 A;  3C8G B;  3U3F A;  2NPU A;  2EIJ C;  4JRZ A;  1XZQ A;  2HJM A;  3TOM A;  3AG4 C;  1RCP A;  5L0I A;  1ORY A;  2H8A A;  4J7Y A;  4BPM A;  4E0H A;  2HSQ A;  4NTB A;  4U5H A;  4EBB A;  5IY5 C;  2Y69 C;  2XM0 A;  1PD1 A;  3SZR A;  5KYN A;  3EGX A;  3K7D A;  4I1O B;  3UR3 C;  1NG1 A;  5JLI A;  3LEV A;  4EIY A;  3N24 A;  1ZHW A;  3LJB A;  1NFO A;  4Q7C A;  3ZQY A;  4YT8 A;  2J8W A;  4JCZ A;  5L3Q A;  4CDY A;  3W8I A;  2VH3 A;  1M6T A;  4AL0 A;  4RD9 A;  4BJ6 C;  4DBR A;  4CSA A;  5T3W A;  2P6V A;  2CNW D;  4U9E A;  4K1O A;  3ZVR A;  1BR4 A;  5AGF A;  4I3M A;  4E7S A;  4BJ5 A;  4J32 B;  1GM5 A;  3GEH A;  1OCO C;  1V74 B;  4NY3 A;  1CGN A;  3MYI A;  3E70 C;  4QDL A;  1R4T A;  5E3A A;  3UMI A;  3NKE A;  4YK5 A;  4BJT A;  3QVZ A;  4G7H F;  2HKV A;  5DQT A;  1OW7 A;  2CYD A;  2R7X A;  3LNR A;  3S29 A;  4IGG A;  4DRH B;  1I4Y A;  3RVZ A;  1D0Z A;  1E85 A;  3VM6 A;  3KMI A;  4DRI B;  1O3U A;  4DBQ A;  4PJM A;  4YN0 B;  2ASR A;  2UUI A;  2WZF A;  2Q4F A;  1LM3 B;  1M2V A;  2I8B A;  1VMA A;  4CBE A;  2R7V A;  3NYL A;  1V4A A;  3GOR A;  1PCX A;  4JTD B;  1Q0M A;  4FAP B;  3B0V C;  2H7B A;  2RSE B;  3EZH A;  1NU9 C;  3M79 A;  1CPR A;  3U2M A;  5B3S C;  4AX2 A;  4B6I A;  1YA9 A;  2YLG A;  2Y3D A;  3RW0 A;  4DXW A;  4E17 A;  4LAC B;  4E18 A;  2EIN C;  3HTK C;  3ITF A;  3DZA A;  2VCB A;  4YJW A;  3ZTZ A;  2R7U A;  4JJG A;  2R9R B;  3S9O A;  5AC5 A;  3JSZ A;  3RVY A;  2PNO A;  4LDQ A;  2IXO A;  1A0B A;  2GWW A;  4O6N A;  4PJN A;  3S28 A;  4CIP A;  3KH2 A;  5B3I A;  1I4Z A;  1Z5Z A;  2L6H A;  3NYJ A;  2Y3B A;  4EBJ A;  1Q0D A;  1OCZ C;  3EG9 A;  4CS8 A;  1K04 A;  2V26 A;  2WVO A;  3Q6N A;  4JCH A;  2KJG A;  5A69 A;  4IAR A;  4QI2 A;  4O6M A;  3ZC4 A;  1FFH A;  4U5D E;  1H9T A;  4PFP A;  2LCH A;  3LES A;  4GYT A;  4K7B A;  3X2Q C;  4EUK B;  2WZL A;  2B0J A;  2DYR C;  5COG A;  4ULW A;  2NSG A;  4XQ1 A;  1F1M A;  3QVY A;  3MBG A;  1YZC A;  4JTC B;  3NG1 A;  2M64 A;  3FVY A;  1NZE A;  3RFY A;  1TFK B;  1Z23 A;  1QKR A;  3AOU A;  2Q7R A;  3DJU B;  3K6B A;  1YJG A;  4PFO A;  3C8G D;  2J0W A;  1OKK A;  4IAO A;  3DMD A;  2X0C A;  3QW1 A;  2NG1 A;  3DWW A;  4YL3 A;  2W4M A;  4NCQ A;  3VRC A;  4E7Z A;  2Q3T A;  5EGY A;  2BC5 A;  2VC9 A;  2XLD A;  2ZXO A;  3C7J A;  3FXH A;  3B0U X;  5JUA A;  2P61 A;  1Z6A A;  1TWA A;  2J7P D;  2Q9A A;  1RJ9 A;  1YYX A;  2XL8 A;  4HFF B;  4OIN F;  3RIP A;  3SXZ A;  1AVO B;  1RXQ A;  5DQZ A;  2X51 A;  5DS6 A;  2XM4 A;  5KYU A;  3SXM A;  3ZQV A;  4P6I C;  1Z7Q c;  4JJF A;  1M2O A;  4DRJ B;  2HUJ A;  3JT1 A;  1WAS A;  1K05 A;  1MMA A;  2W9Y A;  2Z15 A;  3T6G B;  3TD7 A;  3VF0 A;  4ANJ A;  4N06 A;  4YL0 A;  2DYS C;  1NSG B;  3ABL C;  3K1I A;  4O7G A;  1LS4 A;  4Q4Z F;  2ZXR A;  4P9F A;  2PF4 E;  4Z9H A;  5CIV A;  3KKB A;  1BR1 A;  3EQL F;  4G7Z F;  5DS4 A;  2CGE A;  2ZPA A;  5E3C A;  5F5H A;  1UFB A;  2YVK A;  1OW6 A;  1BBH A;  1OR3 A;  2PFD A;  1W2W A;  4EBK A;  1BDJ B;  2HS5 A;  2HFI A;  4G7O F;  2IOQ A;  3PCV A;  3US6 A;  3A9C A;  3ZDL A;  4MND A;  5A6B A;  2IBF A;  5KYW A;  1JPN A;  4JE9 A;  4CJG A;  5COF A;  4YT4 A;  1D1B A;  1U6H A;  3NMI A;  3EHM A;  4I44 A;  4XEV A;  3S27 A;  1GGQ A;  3GEI A;  3WG7 C;  4O6Y A;  2IXN A;  3IQ6 A;  5KYX A;  4N4W A;  2LFF A;  2JX0 A;  5E2Q A;  2MHR A;  1E86 A;  2OJQ A;  1TWG A;  2CNW A;  1RKC A;  3H2V A;  5GPG B;  3L0I A;  2XLO A;  3TOL A;  1D1A A;  4IAQ A;  3O55 A;  4X0R A;  2BL2 A;  3QZC A;  4Z9I A;  3EH1 A;  2L6F A;  3T6B A;  4DVZ A;  3G4X A;  5F5F A;  3DE9 A;  2JPU A;  4CSA C;  2NSF A;  1G8X A;  1KTM A;  4JIO A;  3X1O A;  1ZU5 A;  3ASO C;  4J30 B;  1MMG A;  4D4X A;  3RQG A;  2G62 A;  4PJJ A;  4CS7 A;  4AE4 B;  4BJ5 C;  2KNH A;  2OKU A;  2ZD9 A;  3NRH A;  1SYQ A;  5D91 A;  2MYS A;  2J0X A;  1TR2 A;  2D5R B;  4NTA A;  2LP4 A;  4NTF A;  3CSK A;  1O5H A;  4KNV A;  2JD3 A;  1BZ4 A;  2XLH A;  3SXK A;  3TJ5 A;  5L3V A;  4JZA A;  4EWC A;  3BRJ A;  1FR0 A;  1U89 A;  1VOM A;  2PP4 A;  4XTK A;  2LIG A;  1NFN A;  2D4U A;  4XPW A;  2OEX A;  1H6G A;  1UG7 A;  1ZW3 A;  3FAJ A;  3IHU A;  1TWH A;  1BR2 A;  3U2L A;  4YWQ A;  2P7V A;  3CZ6 A;  3EZI A;  2YRF A;  3U8P A;  3S84 A;  3C62 A;  2HMQ A;  3PDM P;  3DKA A;  1WTY A;  4H4K C;  1V54 C;  3AG3 C;  2A6H F;  1RKE B;  2IYL D;  2Q9B A;  3RQE A;  3OA1 A;  4F4B A;  2AWY A;  1LVK A;  1LE4 A;  3Q7L A;  5HV9 A;  2R7R A;  1G5Z A;  1CPQ A;  2L6G A;  2Q00 A;  4PJL A;  3PMR A;  4U5G A;  1CGO A;  4BG0 A;  3EHN A;  3LS0 A;  4NC3 A;  2QTV A;  3UMK A;  3JRM O;  2WB7 A;  2AWC A;  3UNG C;  4H54 A;  4CDV A;  4WGY A;  4ULV A;  1Z3I X;  4IRU A;  2MWQ A;  2P0N A;  1OCR C;  3AQB A;  3H2U A;  5COM A;  256B A;  4XWJ A;  1D1C A;  3FOO A;  1Q0F A;  1HMO A;  1A7V A;  1FNT c;  3S90 A;  3HJC A;  1QLE C;  4CS8 C;  1NBB A;  2YLD A;  1Q0K A;  2WVQ A;  1B68 A;  4C7O A;  4OD4 A;  5JS5 A;  2NUP A;  3JRT A;  2R7W A;  2J9U A;  3FOP A;  2UUH A;  2EPL X;  2QLA A;  3U9M A;  2KYH A;  3IPM O;  3SEO A;  5AC4 A;  4OD5 A;  1M56 C;  2W45 A;  3GM1 A;  2J45 A;  2P1A A;  4ONS A;  4AL1 A;  5E33 A;  3ZSU A;  3LEO A;  2R7Q A;  2YEV A;  3T6J A;  2A0U A;  5F28 E;  4FES A;  2YL0 A;  1T9K A;  2J7P A;  4QI0 A;  3MYF A;  2YKZ A;  3AQC A;  4ER9 A;  2XSE A;  5CI9 A;  1VYK A;  3DAG A;  5CI8 A;  2R25 A;  1CGM E;  2FGY A;  5DS5 A;  2A0B A;  3TK0 A;  1EA8 A;  4DVY P;  5JVE A;  3DM5 A;  1OW8 A;  5KYY B;  5JRA A;  4G0H A;  1PD0 A;  3EFO B;  5KYW B;  1YZA A;  2L9J A;  3CEX A;  2XXA B;  3FHD A;  1XWJ A;  2AVK A;  3GM2 A;  1AEP A;  2YWA A;  3J06 A;  4MVR A;  3EGD B;  3JYY A;  3IQ5 A;  4OIR F;  3LS1 A;  1ZVZ A;  2QE9 A;  5T1D B;  1OXK A;  4IJJ A;  3U9J A;  3C8Z A;  3N0T A;  3T9O A;  5BQH A;  4FWV A;  3HNJ A;  1ZZP A;  2QNL A;  3L34 A;  3W4Y A;  2PX3 A;  4LLC A;  5JP7 A;  4MW3 A;  2E87 A;  3LNM B;  2H7V C;  3K1I C;  4N6H A;  1T6I A;  2EPO A;  3RH3 A;  3UMH A;  1WN0 A;  1TKN A;  2J9B A;  5FCL A;  3DI5 A;  4MVM A;  2YZS A;  1Q0G A;  1A7D A;  1OR2 A;  2XL4 A;  4MVU A;  3W2V A;  5K0I A;  3EGX B;  2BE5 F;  2ICW G;  3NMK A;  1ORS C;  3LUT B;  3Q6M A;  3R2P A;  1JR8 A;  2G3V A;  3M4B A;  4JUR I;  4G78 A;  2WL8 A;  4Q5S F;  3G50 A;  2VCC A;  3DJN B;  4A2N B;  2L7A A;  4XLN F;  4XEF A;  3V5X A;  2OQM A;  2HSB A;  1ZYR F;  2HV7 A;  3B29 A;  3RF3 A;  4R32 A;  4MVQ A;  1JPJ A;  2PBE A;  3HLZ A;  3U5S A;  2KK1 A;  1LKX A;  1IZM A;  2M4E A;  5B1A C;  1V55 C;  2IXP A;  2VCA A;  2H7O A;  2KSF A;  2YL7 A;  3AJM A;  3E9V A;  1JRA A;  4MW8 A;  4DJ9 A;  5L0C A;  2G3K A;  1G4W R;  1YYJ A;  3M4C A;  4JW1 A;  1I5N A;  1OQC A;  1ST6 A;  3HNI A;  3KYI A;  4MQ9 F;  1OKK D;  4YT2 A;  3L8I A;  3ZWI A;  1A41 A;  2A6E F;  3NMJ A;  4OIO F;  4IWB A;  1M2V B;  4BEJ A;  3UGP A;  4JEB A;  2KC3 A;  3TJ6 A;  1SR2 A;  4MVZ A;  3VAY A;  1E84 A;  1TFO B;  1OCC C;  1ZHZ A;  2GDC A;  2QUP A;  1JMW A;  2EIL C;  4N6C A;  3I4U A;  4OIQ F;  1VLT A;  1HW1 A;  3C18 A;  4JC7 A;  3S0X A;  3MLG A;  1VK5 A;  3K66 A;  1D0X A;  5JT4 A;  2VAS A;  2XLV A;  2NUT A;  4CJO A;  2Y39 A;  3ATP A;  3LAY A;  4LLE A;  3AGT A;  1HY5 A;  2Q9C A;  4XPX A;  3IEE A;  1GS9 A;  1WAT A;  2XLE A;  2WZG A;  1YAU O;  4BJ1 A;  4XLP F;  4P9T A;  1KU2 A;  2OOC A;  2KGO A;  1H7I A;  3EG9 B;  3ASN C;  3B71 A;  1J8Y F;  4D4N A;  1LPE A;  3W2W A;  3GWL A;  2CW0 F;  3GAN A;  3IQT A;  2J9V A;  5BQG A;  1NLX A;  4ZLD A;  2ZXW C;  4M63 A;  4MTG A;  3POV A;  2XLW A;  3KYJ A;  5A6B D;  1C02 A;  1MQV A;  4C3D A;  3PHF 2;  2GAQ A;  2CCY A;  4L6R A;  3RKO F;  3SYN A;  1YVI A;  1QSP A;  2GFH A;  4MTF A;  2R02 A;  4WJ0 A;  2LSE A;  3B9Q A;  2PX0 A;  1YAR O;  5DVW A;  4JVS A;  4A4A A;  1XZP A;  1T5O A;  3NKD A;  1IW7 F;  5L0J A;  2TMV P;  4HFK B;  2IM8 A;  4AK9 A;  1VTM P;  1E2X A;  3L1M A;  4U5B E;  4CX9 A;  3DAF A;  4FX5 A;  4WGZ A;  1C17 M;  2IXM A;  3MFN A;  3LLI A;  2YQY A;  1MMD A;  4BJ6 A;  1KNY A;  2KW3 C;  2DI3 A;  2EPK X;  3WHN A;  3GEE A;  1QQ3 A;  4ZLC A;  3K1H A;  1PV3 A;  3OWT A;  1EQ1 A;  4CS9 C;  3A11 A;  1ZHT A;  4MTO A;  5BUO A;  1U0B B;  1RJ9 B;  1QZX A;  3KL4 A;  3RYL A;  2Y3H A;  1JOG A;  3U3B A;  3I5Q A;  5EK0 A;  1FMW A;  3WAQ A;  5BQI A;  2C04 A;  5KYU B;  3DXJ F;  1HE9 A;  3K33 A;  4CS9 A;  3AG2 C;  2B0H A;  3EJN A;  3HKK A;  1H9G A;  4GQH A;  1L7C A;  4W8P A;  2R7T A;  3EPV A;  3M15 A;  2OG2 A;  1D0Y A;  1WGW A;  1DOV A;  3GOD A;  3ZIB A;  2DB4 A;  2CDQ A;  1ORJ A;  1YDI A;  3KPH A;  3FDQ A;  1MND A;  2EIM C;  3N2Z B;  1LI7 A;  3SP1 A;  3BEH A;  4O79 A;  3C8G A;  4J7T A;  1LIH A;  1A7E A;  3CAX A;  3QW0 A;  4KNW A;  3SXY A;  1EI7 A;  1FAP B;  1APC A;  1LI5 A;  2F22 A;  4BEM J;  5A6J A;  5A6A A;  2AP3 A;  4RDA A;  4U5F E;  3ZTM A;  3L8J A;  3MX3 A;  2YHS A;  3U8V A;  1DOW A;  2XRH A;  5T3T A;  3FMS A;  1M57 C;  4DOZ A;  4YT5 A;  1QVX A;  2J46 A;  2L81 A;  3GWN A;  3LLK A;  4LDK A;  3HNL A;  5D92 A;  4AE4 A;  4RBN A;  3G4Z A;  5EHH A;  5L0H A;  2XS8 A;  1S7Z A;  2EPM X;  4U9D A;  1R5I D;  1VB5 A;  3JCU Q;  4HEA J;  1WOL A;  2ETS A;  1ZHY A;  4C3B A;  4XPY A;  1T6U A;  2R7S A;  1Z63 A;  1K40 A;  5L0G A;  5KYX B;  1SMY F;  3TQO A;  1EKY A;  3JTL O;  4YL1 A;  1SZI A;  4EKW A;  4LER A;  2V3C C;  4CIH A;  2HZ8 A;  2W4B A;  1HMD A;  2R7O A;  2XL6 A;  3B0P A;  3O10 A;  3WOD F;  4Z9J A;  1Y6D A;  3JSE O;  1YLM A;  2A69 F;  1T6Q A;  2YLI A;  3DD7 A;  4U5C E;  2EPN A;  2OU6 A;  3HNK A;  2FFH A;  4I1M A;  1SF8 A;  1HW2 A;  1ZW2 A;  3AGU A;  2FAP B;  2LD6 A;  4PAC A;  3JZ0 A;  1ZU4 A;  1HE1 A;  4E0I A;  2NUT B;  3M1C B;  2HMZ A;  1O87 A;  4JKV A;  1RKE A;  4MVO A;  3IQC A;  5TJ5 E;  3C63 A;  2XLM A;  5FZT A;  3U0C A;  5L0F A;  3TUL A;  4C3E A;  4KBL A;  5HSW A;  2LFD A;  5DLJ A;  4IB4 A;  1LS1 A;  2R05 A;  3O39 A;  4OIP F;  2LK4 A;  1C03 A;  2LQG A;  3NDB B;  3EH2 A;  1N1C A;  4GEH A;  2C03 A;  1FFT C;  3I5P A;  4PR9 A;  4U5E E;  3SNH A;  3R7C A;  2VB6 A;  3VYW A;  4CDA A;  2OEV A;  1FMV A; 
#chains in the Genus database with same CATH homology
 1ZZP A;  1V4A A;  3GM1 A;  3RQG A;  1WWP A;  4XEK A;  3GM3 A;  3RQE A;  3O10 A;  3AJM A;  2L6G A;  5F28 E;  2Q00 A;  3L8J A;  4XEV A;  1K05 A;  3MFN A;  4NQF A;  1KNY A;  3L8I A;  3JZ0 A;  1PV3 A;  2JX0 A;  3B71 A;  3BRJ A;  3C8G B;  1QVX A;  1OW8 A;  3U3F A;  3S9O A;  1JOG A;  3U0C A;  3TUL A;  3C8G D;  1OW7 A;  4XEF A;  3GM2 A;  1UFB A;  2HSB A;  2LK4 A;  2YWA A;  3RQF A;  1WOL A;  1O3U A;  1OW6 A;  2L6F A;  3JYY A;  4R32 A;  3C18 A;  2L6H A;  3K7D A;  2PBE A;  4EBJ A;  1K40 A;  2JPU A;  4EBK A;  1KTM A;  2KK1 A;  1K04 A;  1WTY A;  3C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...